BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF036M02

Length=708
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011089904.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    370   9e-126   
ref|XP_010521765.1|  PREDICTED: aquaporin PIP2-7-like                   367   1e-124   Tarenaya hassleriana [spider flower]
emb|CBI16313.3|  unnamed protein product                                362   7e-124   Vitis vinifera
gb|AFH36337.1|  aquaporin PIP2;2                                        364   2e-123   Quercus petraea [durmast oak]
ref|XP_009786071.1|  PREDICTED: aquaporin PIP2-7-like                   362   1e-122   Nicotiana sylvestris
ref|XP_009615789.1|  PREDICTED: aquaporin PIP2-7-like                   362   1e-122   Nicotiana tomentosiformis
ref|NP_001268056.1|  aquaporin PIP2                                     361   2e-122   Vitis vinifera
gb|ABB13430.2|  plasma membrane intrinsic protein                       361   2e-122   Olea europaea
tpg|DAA64677.1|  TPA: aquaporin PIP2 4a                                 360   6e-122   Nicotiana tabacum [American tobacco]
ref|XP_011044357.1|  PREDICTED: probable aquaporin PIP2-4               359   1e-121   Populus euphratica
ref|XP_007205689.1|  hypothetical protein PRUPE_ppa009689mg             359   2e-121   Prunus persica
ref|XP_002313510.1|  hypothetical protein POPTR_0009s01940g             358   3e-121   Populus trichocarpa [western balsam poplar]
ref|NP_001280185.1|  aquaporin PIP2-2                                   358   3e-121   Prunus mume [ume]
gb|ACU00103.1|  plasma membrane intrinsic protein PIP2.1                358   4e-121   Populus trichocarpa x Populus deltoides
gb|ABO69705.2|  aquaporin PIP2                                          357   8e-121   Prunus humilis
ref|XP_006381455.1|  hypothetical protein POPTR_0006s13000g             357   1e-120   Populus trichocarpa [western balsam poplar]
gb|KDP44053.1|  hypothetical protein JCGZ_05520                         357   1e-120   Jatropha curcas
ref|XP_008385311.1|  PREDICTED: probable aquaporin PIP2-2               356   2e-120   
ref|XP_006381453.1|  hypothetical protein POPTR_0006s12980g             357   2e-120   Populus trichocarpa [western balsam poplar]
ref|XP_006357563.1|  PREDICTED: probable aquaporin PIP2-1-like          356   2e-120   Solanum tuberosum [potatoes]
emb|CBI37861.3|  unnamed protein product                                353   2e-120   Vitis vinifera
gb|EYU36189.1|  hypothetical protein MIMGU_mgv1a011437mg                356   3e-120   Erythranthe guttata [common monkey flower]
ref|XP_006424576.1|  hypothetical protein CICLE_v10028975mg             356   3e-120   Citrus clementina [clementine]
gb|AEQ29857.1|  aquaporin PIP2                                          355   4e-120   Malus prunifolia
gb|AAB18227.1|  MipC                                                    355   5e-120   Mesembryanthemum crystallinum
ref|XP_008363507.1|  PREDICTED: aquaporin PIP2-2                        355   5e-120   Malus domestica [apple tree]
dbj|BAB40141.1|  plasma membrane intrinsic protein 2-1                  355   7e-120   Pyrus communis
ref|XP_009595123.1|  PREDICTED: aquaporin PIP2-4-like                   355   7e-120   Nicotiana tomentosiformis
gb|AIA83106.1|  putative aquaporin PIP2                                 355   7e-120   Citrus trifoliata [hardy orange]
ref|XP_009335091.1|  PREDICTED: probable aquaporin PIP2-2               355   8e-120   Pyrus x bretschneideri [bai li]
ref|XP_011048549.1|  PREDICTED: aquaporin PIP2-1-like                   355   1e-119   Populus euphratica
dbj|BAF32042.1|  putative aquaporin                                     354   1e-119   Cryptomeria japonica
gb|ABB88840.1|  aquaporin                                               354   1e-119   Stevia rebaudiana
ref|XP_011048552.1|  PREDICTED: aquaporin PIP2-2-like                   354   1e-119   Populus euphratica
ref|XP_009780213.1|  PREDICTED: aquaporin PIP2-4-like                   354   1e-119   Nicotiana sylvestris
gb|AIA83104.1|  putative aquaporin PIP2                                 354   2e-119   Citrus sinensis x Citrus trifoliata [Carrizo citrange]
ref|NP_001105639.1|  aquaporin PIP2-7                                   354   2e-119   
gb|AFH36336.1|  aquaporin PIP2;1                                        353   3e-119   Quercus petraea [durmast oak]
gb|KDP29110.1|  hypothetical protein JCGZ_16499                         353   4e-119   Jatropha curcas
ref|XP_010920405.1|  PREDICTED: aquaporin PIP2-4 isoform X1             353   4e-119   Elaeis guineensis
ref|NP_001267957.1|  aquaporin PIP2;2                                   352   5e-119   Vitis vinifera
gb|ABH09327.1|  putative aquaporin                                      352   5e-119   Vitis vinifera
gb|ABC69040.1|  aquaporin PIP2-1                                        353   5e-119   Rhododendron catawbiense [Catawba rosebay]
dbj|BAF32141.1|  putative aquaporin                                     352   6e-119   Taxodium distichum [bald cypress]
ref|XP_002530280.1|  Aquaporin PIP2.1, putative                         353   6e-119   Ricinus communis
gb|ACU87558.1|  PIP protein                                             352   6e-119   Gossypium hirsutum [American cotton]
gb|KHF98939.1|  putative aquaporin PIP2-8 -like protein                 352   6e-119   Gossypium arboreum [tree cotton]
ref|XP_009628968.1|  PREDICTED: probable aquaporin PIP2-1               352   6e-119   Nicotiana tomentosiformis
tpg|DAA33864.1|  TPA: aquaporin PIP2;4                                  352   7e-119   Gossypium hirsutum [American cotton]
emb|CAH60724.1|  putative plasma membrane intrinsic protein             352   7e-119   Populus tremula x Populus tremuloides
gb|AAB67868.1|  plasma membrane major intrinsic protein 1               352   7e-119   Beta vulgaris [beet]
gb|AGD98714.1|  aquaporin protein 11                                    352   8e-119   Camellia sinensis [black tea]
gb|ACB71281.1|  plasma membrane intrinsic protein                       352   8e-119   Tamarix hispida
gb|ACB42440.1|  aquaporin PIP2;3                                        352   9e-119   Gossypium hirsutum [American cotton]
gb|AGD98708.1|  aquaporin protein 5                                     352   1e-118   Camellia sinensis [black tea]
gb|AAW80918.1|  putative plasma membrane intrinsic protein              352   1e-118   Astragalus membranaceus
ref|XP_010456647.1|  PREDICTED: probable aquaporin PIP2-4               352   1e-118   Camelina sativa [gold-of-pleasure]
ref|NP_001237286.1|  PIP2,2                                             352   1e-118   
ref|XP_007016740.1|  Plasma membrane intrinsic protein 2,4              352   1e-118   
emb|CAB46351.1|  major intrinsic protein 2                              352   1e-118   Solanum tuberosum [potatoes]
gb|AGC24024.1|  plasma membrane intrinsic protein 1                     352   1e-118   Lilium hybrid cultivar
gb|ACX37450.1|  plasma membrane intrinsic protein                       352   1e-118   Hevea brasiliensis [jebe]
gb|ACU21481.1|  unknown                                                 352   1e-118   Glycine max [soybeans]
ref|XP_010266854.1|  PREDICTED: probable aquaporin PIP2-8               352   1e-118   Nelumbo nucifera [Indian lotus]
gb|KHN32779.1|  Aquaporin PIP2-2                                        350   2e-118   Glycine soja [wild soybean]
ref|NP_001275065.1|  major intrinsic protein 2                          352   2e-118   Solanum tuberosum [potatoes]
ref|NP_001234625.1|  aquaporin                                          351   2e-118   Solanum lycopersicum
gb|ACU87556.1|  PIP protein                                             351   2e-118   Gossypium hirsutum [American cotton]
gb|AAF71820.1|AF141900_1  putative aquaporin PIP2-2                     351   2e-118   Vitis cinerea var. helleri x Vitis rupestris
ref|XP_010526891.1|  PREDICTED: probable aquaporin PIP2-8               351   2e-118   Tarenaya hassleriana [spider flower]
ref|XP_010548112.1|  PREDICTED: probable aquaporin PIP2-8               351   2e-118   Tarenaya hassleriana [spider flower]
gb|KHG29841.1|  putative aquaporin PIP2-2                               351   2e-118   Gossypium arboreum [tree cotton]
ref|XP_006422584.1|  hypothetical protein CICLE_v10029003mg             351   3e-118   Citrus clementina [clementine]
gb|AEY75244.1|  plasma membrane intrinsic protein                       351   3e-118   Malus hupehensis
ref|XP_007143702.1|  hypothetical protein PHAVU_007G094600g             351   3e-118   Phaseolus vulgaris [French bean]
ref|XP_010483715.1|  PREDICTED: probable aquaporin PIP2-4               351   3e-118   Camelina sativa [gold-of-pleasure]
ref|NP_001059545.1|  Os07g0448800                                       351   3e-118   
ref|XP_010043748.1|  PREDICTED: probable aquaporin PIP2-4               350   4e-118   Eucalyptus grandis [rose gum]
ref|XP_011092966.1|  PREDICTED: aquaporin PIP2-7                        350   4e-118   Sesamum indicum [beniseed]
gb|ACB42441.1|  aquaporin PIP2;4                                        350   4e-118   Gossypium hirsutum [American cotton]
gb|EAZ39662.1|  hypothetical protein OsJ_24090                          351   4e-118   Oryza sativa Japonica Group [Japonica rice]
gb|KHG00060.1|  putative aquaporin PIP2-2                               350   5e-118   Gossypium arboreum [tree cotton]
gb|KJB56128.1|  hypothetical protein B456_009G107200                    350   5e-118   Gossypium raimondii
emb|CBI31462.3|  unnamed protein product                                347   5e-118   Vitis vinifera
gb|ACU87555.1|  PIP protein                                             350   5e-118   Gossypium hirsutum [American cotton]
gb|EYU42155.1|  hypothetical protein MIMGU_mgv1a011301mg                350   5e-118   Erythranthe guttata [common monkey flower]
emb|CAA04654.1|  major intrinsic protein PIPC                           347   6e-118   Craterostigma plantagineum
ref|XP_010443868.1|  PREDICTED: probable aquaporin PIP2-4               350   6e-118   Camelina sativa [gold-of-pleasure]
gb|KJB20285.1|  hypothetical protein B456_003G141600                    351   7e-118   Gossypium raimondii
ref|XP_010253676.1|  PREDICTED: aquaporin PIP2-4-like                   350   8e-118   Nelumbo nucifera [Indian lotus]
ref|XP_002461930.1|  hypothetical protein SORBIDRAFT_02g010760          350   1e-117   Sorghum bicolor [broomcorn]
ref|XP_007041804.1|  Plasma membrane intrinsic protein 2,8 isoform 1    349   1e-117   Theobroma cacao [chocolate]
ref|NP_001289999.1|  aquaporin PIP2-1                                   350   1e-117   Beta vulgaris subsp. vulgaris [field beet]
gb|AAC32107.1|  probable aquaporin                                      349   1e-117   Picea mariana [black spruce]
gb|KJB26182.1|  hypothetical protein B456_004G229000                    349   1e-117   Gossypium raimondii
ref|XP_007027328.1|  Plasma membrane intrinsic protein 2                349   1e-117   Theobroma cacao [chocolate]
ref|XP_003548071.1|  PREDICTED: aquaporin PIP2-2-like                   349   1e-117   Glycine max [soybeans]
ref|XP_002306187.1|  membrane intrinsic family protein                  349   1e-117   
ref|XP_010098191.1|  Aquaporin PIP2-7                                   349   1e-117   Morus notabilis
ref|XP_011046666.1|  PREDICTED: probable aquaporin PIP2-8               349   1e-117   Populus euphratica
ref|XP_009614931.1|  PREDICTED: aquaporin PIP2-1-like                   349   2e-117   Nicotiana tomentosiformis
gb|ABK60195.2|  PIP2 protein                                            349   2e-117   Gossypium hirsutum [American cotton]
gb|AHK05706.1|  plasma membrane intrinsic protein PIP2;3                349   2e-117   Hevea brasiliensis [jebe]
gb|KJB12139.1|  hypothetical protein B456_002G002500                    348   2e-117   Gossypium raimondii
gb|AIK66515.1|  putative aquaporin                                      349   2e-117   Vitis vinifera
gb|ABK22173.1|  unknown                                                 348   2e-117   Picea sitchensis
ref|XP_003536353.1|  PREDICTED: aquaporin PIP2-1-like isoform 1         349   2e-117   
gb|ACR56613.1|  plasma intrinsic protein 2;3                            348   2e-117   Juglans regia
ref|XP_003625627.1|  Aquaporin PIP2-1                                   348   2e-117   Medicago truncatula
ref|XP_006400824.1|  hypothetical protein EUTSA_v10014299mg             348   3e-117   Eutrema salsugineum [saltwater cress]
ref|XP_008463943.1|  PREDICTED: aquaporin PIP2-7                        348   3e-117   Cucumis melo [Oriental melon]
gb|ABK24156.1|  unknown                                                 348   3e-117   Picea sitchensis
emb|CAH60721.1|  putative plasma membrane intrinsic protein             348   4e-117   Populus tremula x Populus tremuloides
ref|XP_010264685.1|  PREDICTED: aquaporin PIP2-1-like                   348   4e-117   Nelumbo nucifera [Indian lotus]
gb|ABH09326.1|  putative aquaporin                                      348   4e-117   Vitis vinifera
gb|ACU20229.1|  unknown                                                 348   5e-117   Glycine max [soybeans]
gb|KHG30776.1|  Aquaporin PIP2-2 -like protein                          348   5e-117   Gossypium arboreum [tree cotton]
ref|XP_009355655.1|  PREDICTED: probable aquaporin PIP2-8               347   5e-117   Pyrus x bretschneideri [bai li]
ref|XP_010920407.1|  PREDICTED: probable aquaporin PIP2-2               348   6e-117   Elaeis guineensis
dbj|BAG68661.1|  plasma membrane intrinsic protein                      348   6e-117   Tulipa gesneriana
gb|AFK33316.1|  unknown                                                 347   6e-117   Medicago truncatula
gb|AHG32323.1|  PIP2-2                                                  347   6e-117   Pisum sativum [garden pea]
ref|XP_002519539.1|  Aquaporin PIP2.2, putative                         347   7e-117   Ricinus communis
gb|KHG10662.1|  Aquaporin PIP2-1 -like protein                          347   7e-117   Gossypium arboreum [tree cotton]
gb|EYU40445.1|  hypothetical protein MIMGU_mgv1a011413mg                347   7e-117   Erythranthe guttata [common monkey flower]
gb|ACG32567.1|  aquaporin PIP2.1                                        347   7e-117   Zea mays [maize]
gb|KJB11821.1|  hypothetical protein B456_002G2484001                   347   7e-117   Gossypium raimondii
gb|KHN00691.1|  Aquaporin PIP2-2                                        347   8e-117   Glycine soja [wild soybean]
ref|NP_001240039.1|  uncharacterized protein LOC100782155               347   8e-117   Glycine max [soybeans]
ref|XP_004956113.1|  PREDICTED: aquaporin PIP2-1-like                   347   8e-117   Setaria italica
ref|XP_009792249.1|  PREDICTED: aquaporin PIP2-1-like                   347   8e-117   Nicotiana sylvestris
gb|AAA68701.1|  similar to mipB gene product in Mesembryanthemum ...    346   9e-117   Mesembryanthemum crystallinum
ref|XP_002521292.1|  Aquaporin PIP2.7, putative                         347   9e-117   
ref|NP_001105024.1|  aquaporin PIP2-1                                   347   9e-117   Zea mays [maize]
gb|AFB83067.1|  plasma intrinsic protein PIP2.1                         347   9e-117   Helianthemum almeriense
ref|XP_003563177.1|  PREDICTED: probable aquaporin PIP2-1               347   9e-117   Brachypodium distachyon [annual false brome]
gb|KHG08488.1|  putative aquaporin PIP2-2                               347   1e-116   Gossypium arboreum [tree cotton]
ref|XP_003556232.1|  PREDICTED: aquaporin PIP2-1-like                   347   1e-116   Glycine max [soybeans]
ref|XP_009398603.1|  PREDICTED: probable aquaporin PIP2-2               347   1e-116   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001267922.1|  aquaporin-like                                     347   1e-116   Vitis vinifera
gb|AAF71816.1|AF141642_1  putative aquaporin PIP2-1                     347   1e-116   Vitis cinerea var. helleri x Vitis rupestris
gb|KJB21561.1|  hypothetical protein B456_004G001400                    347   1e-116   Gossypium raimondii
gb|AAV69744.1|  aquaporin                                               347   1e-116   Vitis vinifera
ref|XP_003518297.1|  PREDICTED: aquaporin PIP2-2-like                   347   1e-116   Glycine max [soybeans]
ref|XP_010266027.1|  PREDICTED: aquaporin PIP2-7-like                   346   1e-116   Nelumbo nucifera [Indian lotus]
ref|XP_006846771.1|  hypothetical protein AMTR_s00148p00023270          346   2e-116   Amborella trichopoda
gb|ACZ06859.1|  plasma membrane intrinsic protein                       347   2e-116   Glycine soja [wild soybean]
gb|ACB87734.1|  aquaporin                                               346   2e-116   Manihot esculenta [manioc]
emb|CAN75442.1|  hypothetical protein VITISV_019657                     346   2e-116   Vitis vinifera
emb|CDY31523.1|  BnaA10g13480D                                          345   2e-116   Brassica napus [oilseed rape]
gb|ACG39551.1|  aquaporin PIP2.1                                        347   2e-116   Zea mays [maize]
ref|NP_001274381.1|  aquaporin PIP2-7-like                              346   2e-116   Cucumis sativus [cucumbers]
gb|AIG92831.1|  aquaporin PIP2                                          346   2e-116   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ABU94631.1|  putative aquaporin PIP2;3                               346   2e-116   Phaseolus vulgaris [French bean]
gb|AAB18228.1|  MipE                                                    346   2e-116   Mesembryanthemum crystallinum
gb|AFQ23186.1|  aquaporin PIP2;1                                        346   2e-116   Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_006280883.1|  hypothetical protein CARUB_v10026881mg             346   3e-116   
ref|XP_004291577.1|  PREDICTED: aquaporin PIP2-2                        346   3e-116   Fragaria vesca subsp. vesca
ref|XP_009131906.1|  PREDICTED: probable aquaporin PIP2-4               346   3e-116   Brassica rapa
ref|XP_011015478.1|  PREDICTED: aquaporin PIP2-2-like                   346   3e-116   Populus euphratica
gb|AEQ20672.1|  PIP2;1                                                  346   3e-116   Karelinia caspia
gb|ADJ57599.1|  plasma membrane intrinsic protein PIP2;1                345   3e-116   Fragaria chiloensis
gb|KJB32662.1|  hypothetical protein B456_005G254400                    345   3e-116   Gossypium raimondii
ref|XP_003522619.2|  PREDICTED: aquaporin PIP2-7                        347   4e-116   
ref|XP_002866389.1|  hypothetical protein ARALYDRAFT_919301             345   4e-116   Arabidopsis lyrata subsp. lyrata
ref|XP_003538174.1|  PREDICTED: aquaporin PIP2-7                        345   4e-116   Glycine max [soybeans]
gb|AAC17529.1|  aquaporin 2                                             345   4e-116   Samanea saman [cow-tamarind]
ref|XP_006428786.1|  hypothetical protein CICLE_v10012379mg             345   4e-116   Citrus clementina [clementine]
ref|XP_011041003.1|  PREDICTED: probable aquaporin PIP2-5               345   4e-116   Populus euphratica
ref|NP_179277.1|  putative aquaporin PIP2-8                             345   5e-116   Arabidopsis thaliana [mouse-ear cress]
gb|KHN05685.1|  Aquaporin PIP2-7                                        345   5e-116   Glycine soja [wild soybean]
gb|ACU24483.1|  unknown                                                 345   5e-116   Glycine max [soybeans]
gb|AAO86707.1|  aquaporin                                               345   5e-116   Zea mays [maize]
ref|XP_008785285.1|  PREDICTED: aquaporin PIP2-4                        345   5e-116   Phoenix dactylifera
gb|ACR56614.1|  plasma intrinsic protein 2;4                            345   5e-116   Juglans regia
ref|NP_001240223.1|  prolactin-inducible protein                        345   6e-116   Glycine max [soybeans]
ref|XP_006412152.1|  hypothetical protein EUTSA_v10025940mg             345   6e-116   Eutrema salsugineum [saltwater cress]
ref|XP_009120600.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    345   6e-116   Brassica rapa
gb|AAC16545.1|  aquaporin                                               345   7e-116   Oryza sativa [red rice]
dbj|BAG06231.1|  plasma membrane intrinsic protein                      345   7e-116   Hordeum vulgare [barley]
ref|XP_007151872.1|  hypothetical protein PHAVU_004G082700g             345   7e-116   Phaseolus vulgaris [French bean]
gb|KFK36606.1|  hypothetical protein AALP_AA4G145300                    345   7e-116   Arabis alpina [alpine rockcress]
ref|XP_006294744.1|  hypothetical protein CARUB_v10023789mg             345   7e-116   Capsella rubella
ref|XP_008791536.1|  PREDICTED: aquaporin PIP2-4-like                   345   8e-116   Phoenix dactylifera
ref|NP_001105638.1|  aquaporin PIP2-2                                   345   1e-115   Zea mays [maize]
gb|ACR56615.1|  plasma intrinsic protein 2;5                            344   1e-115   Juglans regia
gb|EYU34445.1|  hypothetical protein MIMGU_mgv1a011350mg                344   1e-115   Erythranthe guttata [common monkey flower]
emb|CDX88767.1|  BnaA03g08820D                                          343   1e-115   
gb|ACF79873.1|  unknown                                                 345   1e-115   Zea mays [maize]
ref|XP_007150204.1|  hypothetical protein PHAVU_005G135300g             344   1e-115   Phaseolus vulgaris [French bean]
gb|ABM54183.1|  aquaporin                                               344   1e-115   Jatropha curcas
dbj|BAD90699.1|  plasma membrane intrinsic protein 2;3                  344   1e-115   Mimosa pudica [sensitive-plant]
gb|ABK23750.1|  unknown                                                 344   1e-115   Picea sitchensis
ref|XP_003540176.1|  PREDICTED: aquaporin PIP2-7                        344   1e-115   
ref|XP_009794928.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    344   1e-115   Nicotiana sylvestris
ref|XP_006481455.1|  PREDICTED: aquaporin PIP2-2-like                   344   1e-115   Citrus sinensis [apfelsine]
ref|XP_007151871.1|  hypothetical protein PHAVU_004G082600g             344   1e-115   Phaseolus vulgaris [French bean]
ref|XP_010489282.1|  PREDICTED: probable aquaporin PIP2-8               344   1e-115   
ref|XP_009367074.1|  PREDICTED: aquaporin PIP2-2                        344   1e-115   Pyrus x bretschneideri [bai li]
gb|KHN38765.1|  Aquaporin PIP2-7                                        344   1e-115   Glycine soja [wild soybean]
gb|ADK25057.1|  plasma membrane intrinsic protein                       344   2e-115   Glycine max [soybeans]
gb|EAY86778.1|  hypothetical protein OsI_08158                          344   2e-115   Oryza sativa Indica Group [Indian rice]
ref|XP_011094668.1|  PREDICTED: aquaporin PIP2-4-like                   343   2e-115   Sesamum indicum [beniseed]
ref|XP_006410896.1|  hypothetical protein EUTSA_v10017874mg             344   2e-115   Eutrema salsugineum [saltwater cress]
dbj|BAD90697.1|  plasma membrane intrinsic protein 2;1                  344   2e-115   Mimosa pudica [sensitive-plant]
ref|XP_010505293.1|  PREDICTED: aquaporin PIP2-2                        343   2e-115   Camelina sativa [gold-of-pleasure]
gb|AAM63463.1|  aquaporin (plasma membrane intrinsic protein 2B)        343   2e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010467415.1|  PREDICTED: probable aquaporin PIP2-8               343   2e-115   Camelina sativa [gold-of-pleasure]
gb|AAO39008.1|  plasma intrinsic protein 2,2                            343   2e-115   Juglans regia
ref|XP_006481459.1|  PREDICTED: aquaporin PIP2-2-like                   343   2e-115   Citrus sinensis [apfelsine]
gb|ACV66986.1|  plasma membrane aquaporin 2                             343   2e-115   Hevea brasiliensis [jebe]
gb|ACU00102.1|  plasma membrane intrinsic protein PIP2.6                343   2e-115   Populus trichocarpa x Populus deltoides
gb|AAG30607.1|AF314656_1  aquaporin                                     343   2e-115   Brassica oleracea
ref|XP_002881493.1|  hypothetical protein ARALYDRAFT_482707             343   2e-115   Arabidopsis lyrata subsp. lyrata
ref|XP_003604054.1|  Aquaporin PIP22                                    343   2e-115   
gb|AAL49750.1|AF452012_1  aquaporin-like protein                        343   3e-115   Petunia x hybrida [garden petunia]
gb|AAF65845.1|AF255795_1  aquaporin 1                                   343   3e-115   Allium cepa
ref|NP_195236.1|  plasma membrane intrinsic protein 3                   343   3e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869108.1|  hypothetical protein ARALYDRAFT_491143             343   3e-115   
ref|XP_009126591.1|  PREDICTED: probable aquaporin PIP2-4               343   3e-115   Brassica rapa
ref|XP_011045923.1|  PREDICTED: probable aquaporin PIP2-8               343   3e-115   Populus euphratica
ref|XP_008377729.1|  PREDICTED: probable aquaporin PIP2-8               343   3e-115   Malus domestica [apple tree]
gb|KFK30134.1|  hypothetical protein AALP_AA7G221400                    343   4e-115   Arabis alpina [alpine rockcress]
ref|XP_011031744.1|  PREDICTED: probable aquaporin PIP2-5               343   4e-115   Populus euphratica
ref|NP_181254.1|  aquaporin PIP2-2                                      343   4e-115   Arabidopsis thaliana [mouse-ear cress]
gb|KCW55551.1|  hypothetical protein EUGRSUZ_I01429                     343   4e-115   Eucalyptus grandis [rose gum]
emb|CAH60723.1|  putative plasma membrane intrinsic protein             343   4e-115   Populus tremula x Populus tremuloides
ref|NP_001289846.1|  probable aquaporin PIP2-1                          343   4e-115   
ref|XP_010107541.1|  Aquaporin PIP2-2                                   343   4e-115   Morus notabilis
ref|XP_008791535.1|  PREDICTED: aquaporin PIP2-4-like                   343   4e-115   Phoenix dactylifera
gb|AFK47400.1|  unknown                                                 343   4e-115   Lotus japonicus
pdb|2B5F|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    343   4e-115   Spinacia oleracea
ref|NP_001047491.1|  Os02g0629200                                       343   5e-115   
gb|ACU19125.1|  unknown                                                 343   5e-115   Glycine max [soybeans]
gb|ABK93567.1|  unknown                                                 343   5e-115   Populus trichocarpa [western balsam poplar]
ref|XP_006846905.1|  hypothetical protein AMTR_s00152p00041700          342   5e-115   Amborella trichopoda
gb|AFB82643.1|  aquaporin                                               342   6e-115   Camellia sinensis [black tea]
pdb|1Z98|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    342   6e-115   Spinacia oleracea
ref|XP_010516975.1|  PREDICTED: aquaporin PIP2-2-like                   342   6e-115   Camelina sativa [gold-of-pleasure]
gb|AAL49751.1|AF452013_1  aquaporin-like protein                        341   6e-115   Petunia x hybrida [garden petunia]
ref|XP_002316367.1|  putative aquaporin family protein                  342   7e-115   Populus trichocarpa [western balsam poplar]
gb|AAD31846.1|AF133530_1  water channel protein MipH                    342   7e-115   Mesembryanthemum crystallinum
gb|AGD98705.1|  aquaporin                                               342   7e-115   Camellia sinensis [black tea]
emb|CDY09192.1|  BnaA02g06180D                                          341   7e-115   Brassica napus [oilseed rape]
emb|CDX72515.1|  BnaC07g45370D                                          341   8e-115   
dbj|BAD90701.1|  plasma membrane intrinsic protein 2;5                  342   8e-115   Mimosa pudica [sensitive-plant]
gb|ABL76066.1|  aquaporin 2                                             342   8e-115   Bruguiera gymnorhiza [Burma mangrove]
emb|CDX69112.1|  BnaC01g03410D                                          342   8e-115   
ref|XP_004304427.1|  PREDICTED: aquaporin PIP2-1-like                   342   9e-115   Fragaria vesca subsp. vesca
ref|XP_010553324.1|  PREDICTED: aquaporin PIP2-2                        338   9e-115   Tarenaya hassleriana [spider flower]
ref|XP_007132257.1|  hypothetical protein PHAVU_011G079300g             342   1e-114   Phaseolus vulgaris [French bean]
emb|CDY17511.1|  BnaC03g65520D                                          342   1e-114   Brassica napus [oilseed rape]
ref|XP_009138343.1|  PREDICTED: aquaporin PIP2-7-like                   342   1e-114   Brassica rapa
ref|XP_008809438.1|  PREDICTED: probable aquaporin PIP2-6               342   1e-114   Phoenix dactylifera
ref|XP_002877918.1|  hypothetical protein ARALYDRAFT_485715             342   1e-114   
ref|XP_002884019.1|  PIP2_8/PIP3B                                       342   1e-114   Arabidopsis lyrata subsp. lyrata
ref|XP_006284279.1|  hypothetical protein CARUB_v10005443mg             342   1e-114   Capsella rubella
ref|XP_009413714.1|  PREDICTED: aquaporin PIP2-4-like isoform X1        342   1e-114   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB62459.1|  hypothetical protein B456_009G418100                    342   1e-114   Gossypium raimondii
gb|ADL16407.1|  aquaporin                                               342   1e-114   Dianthus caryophyllus [carnation]
gb|ACN40330.1|  unknown                                                 342   1e-114   Picea sitchensis
gb|AEY75254.1|  aquaporin                                               341   1e-114   Atriplex canescens [shadscale]
emb|CDX76314.1|  BnaA08g10860D                                          341   1e-114   
dbj|BAD90700.1|  plasma membrane intrinsic protein 2;4                  341   1e-114   Mimosa pudica [sensitive-plant]
ref|XP_010684101.1|  PREDICTED: aquaporin PIP2-1-like                   341   2e-114   Beta vulgaris subsp. vulgaris [field beet]
gb|AAB67869.1|  plasma membrane major intrinsic protein 2               341   2e-114   Beta vulgaris [beet]
ref|XP_006436425.1|  hypothetical protein CICLE_v10032302mg             341   2e-114   Citrus clementina [clementine]
dbj|BAA92260.1|  Plasma membrane aquaporin 2b                           341   2e-114   Raphanus sativus
ref|XP_010529747.1|  PREDICTED: aquaporin PIP2-2-like                   341   2e-114   Tarenaya hassleriana [spider flower]
gb|AAO39007.1|  plasma intrinsic protein 2,1                            341   2e-114   Juglans regia
ref|XP_010504105.1|  PREDICTED: aquaporin PIP2-1-like                   341   2e-114   Camelina sativa [gold-of-pleasure]
gb|KHG06004.1|  Aquaporin PIP2-2 -like protein                          341   2e-114   Gossypium arboreum [tree cotton]
ref|XP_010554547.1|  PREDICTED: probable aquaporin PIP2-5               341   2e-114   Tarenaya hassleriana [spider flower]
ref|XP_010920097.1|  PREDICTED: probable aquaporin PIP2-6               341   2e-114   Elaeis guineensis
ref|XP_006410897.1|  hypothetical protein EUTSA_v10017041mg             341   2e-114   Eutrema salsugineum [saltwater cress]
ref|XP_006657663.1|  PREDICTED: aquaporin PIP2-5-like                   338   2e-114   
ref|XP_010426989.1|  PREDICTED: aquaporin PIP2-1                        341   2e-114   Camelina sativa [gold-of-pleasure]
ref|XP_010690355.1|  PREDICTED: aquaporin PIP-type                      341   2e-114   Beta vulgaris subsp. vulgaris [field beet]
gb|AEH76326.1|  plasma membrane intrinsic protein 2A                    341   2e-114   Camelina sativa [gold-of-pleasure]
emb|CDX71032.1|  BnaC03g11160D                                          340   2e-114   
ref|XP_009342865.1|  PREDICTED: probable aquaporin PIP2-5 isoform X2    341   2e-114   
gb|AHA84284.1|  prolactin-inducible protein                             341   2e-114   
emb|CDP07111.1|  unnamed protein product                                341   2e-114   
ref|XP_008382110.1|  PREDICTED: probable aquaporin PIP2-8               341   2e-114   
ref|XP_009342858.1|  PREDICTED: probable aquaporin PIP2-5 isoform X1    341   3e-114   
ref|NP_200874.1|  putative aquaporin PIP2-4                             341   3e-114   
gb|ABK24624.1|  unknown                                                 340   3e-114   
ref|XP_010509371.1|  PREDICTED: aquaporin PIP2-2-like                   341   3e-114   
ref|XP_004953172.1|  PREDICTED: aquaporin PIP2-4-like                   341   3e-114   
ref|XP_010037961.1|  PREDICTED: probable aquaporin PIP2-2               341   3e-114   
pdb|3CLL|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    341   3e-114   
dbj|BAA22098.1|  unnamed protein product                                337   3e-114   
gb|ABK22504.1|  unknown                                                 340   3e-114   
ref|XP_009105909.1|  PREDICTED: aquaporin PIP2-7                        340   3e-114   
ref|XP_010505294.1|  PREDICTED: aquaporin PIP2-2-like                   340   3e-114   
sp|P42767.1|PIP1_ATRCA  RecName: Full=Aquaporin PIP-type                340   3e-114   
gb|ABU94630.1|  putative aquaporin PIP2;2                               340   4e-114   
gb|AFO63679.1|  plasma intrinsic protein 2                              340   4e-114   
ref|XP_003597235.1|  Aquaporin PIP2-7                                   340   4e-114   
ref|XP_009389186.1|  PREDICTED: probable aquaporin PIP2-6               340   4e-114   
ref|XP_009387242.1|  PREDICTED: aquaporin PIP2-5                        340   5e-114   
pdb|3CN6|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    341   5e-114   
emb|CDX91341.1|  BnaC04g08090D                                          340   5e-114   
ref|XP_009133124.1|  PREDICTED: aquaporin PIP2-2-like                   340   5e-114   
emb|CDX91340.1|  BnaC04g08100D                                          340   5e-114   
ref|XP_010516059.1|  PREDICTED: probable aquaporin PIP2-8               340   5e-114   
gb|AAL32127.1|  aquaporin                                               340   5e-114   
gb|AAB36949.1|  plasma membrane intrinsic protein PIP3                  340   5e-114   
dbj|BAA92261.1|  Plasma membrane aquaporin 2c                           340   5e-114   
ref|XP_006296058.1|  hypothetical protein CARUB_v10025207mg             340   6e-114   
emb|CDY46759.1|  BnaA03g17030D                                          340   6e-114   
ref|XP_009143524.1|  PREDICTED: aquaporin PIP2-2                        340   6e-114   
gb|AHB33479.1|  plasma intrinsic protein 2-3                            340   6e-114   
ref|NP_190910.1|  aquaporin PIP2-1                                      340   6e-114   
gb|AHZ08398.1|  phosphatidylinosital biphosphate protein                340   7e-114   
gb|KDO44716.1|  hypothetical protein CISIN_1g0196812mg                  342   7e-114   
ref|XP_009624885.1|  PREDICTED: aquaporin PIP2-1-like                   340   7e-114   
ref|XP_010516976.1|  PREDICTED: aquaporin PIP2-2-like                   340   7e-114   
ref|XP_008236033.1|  PREDICTED: aquaporin PIP2-7                        340   7e-114   
ref|XP_004304428.1|  PREDICTED: aquaporin PIP2-1-like                   340   7e-114   
ref|XP_009133125.1|  PREDICTED: aquaporin PIP2-2-like                   340   8e-114   
ref|XP_007009830.1|  Plasma membrane intrinsic protein 2A               339   8e-114   
ref|XP_008387595.1|  PREDICTED: probable aquaporin PIP2-5               340   8e-114   
ref|XP_008446888.1|  PREDICTED: aquaporin PIP2-1-like                   340   8e-114   
dbj|BAA23744.1|  HvPIP2;1                                               339   9e-114   
ref|XP_006403691.1|  hypothetical protein EUTSA_v10010598mg             340   9e-114   
gb|AEO13898.1|  aquaporin 7                                             339   9e-114   
pdb|3CN5|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    340   1e-113   
dbj|BAE02729.1|  PIP aquaporin                                          339   1e-113   
tpg|DAA64673.1|  TPA: aquaporin PIP2 1                                  339   1e-113   
ref|XP_010432340.1|  PREDICTED: aquaporin PIP2-7                        339   1e-113   
ref|XP_008449253.1|  PREDICTED: aquaporin PIP2-2-like isoform X3        339   1e-113   
ref|XP_009376943.1|  PREDICTED: probable aquaporin PIP2-8               339   1e-113   
ref|XP_004493972.1|  PREDICTED: probable aquaporin PIP2-5-like          339   1e-113   
gb|ABX83874.1|  plasma membrane intrinsic protein                       339   1e-113   
ref|XP_004156296.1|  PREDICTED: aquaporin PIP2-2-like                   339   1e-113   
ref|XP_010042277.1|  PREDICTED: aquaporin PIP2-1-like                   338   1e-113   
ref|XP_010043747.1|  PREDICTED: probable aquaporin PIP2-5               339   1e-113   
gb|AGG39693.1|  aquaporin protein AQU15                                 339   1e-113   
dbj|BAF63508.1|  plasma membrane intrinsic protein                      338   1e-113   
ref|XP_009760326.1|  PREDICTED: aquaporin PIP2-1-like                   339   2e-113   
ref|XP_006298288.1|  hypothetical protein CARUB_v10014353mg             338   2e-113   
gb|KFK36762.1|  hypothetical protein AALP_AA4G166800                    338   2e-113   
ref|XP_002312952.1|  hypothetical protein POPTR_0009s13890g             338   2e-113   
ref|XP_009345759.1|  PREDICTED: probable aquaporin PIP2-5               338   2e-113   
ref|XP_009782764.1|  PREDICTED: aquaporin PIP2-7                        338   2e-113   
ref|XP_002452483.1|  hypothetical protein SORBIDRAFT_04g026650          339   2e-113   
gb|KDP44363.1|  hypothetical protein JCGZ_20043                         338   2e-113   
emb|CDP04351.1|  unnamed protein product                                335   2e-113   
gb|AGD98707.1|  aquaporin protein 4                                     338   2e-113   
emb|CDY56697.1|  BnaCnng31040D                                          338   2e-113   
ref|XP_002532756.1|  Aquaporin PIP2.1, putative                         338   2e-113   
gb|AFB83068.1|  plasma intrinsic protein PIP2.2                         338   2e-113   
ref|XP_010032196.1|  PREDICTED: aquaporin PIP2-1                        338   2e-113   
gb|KCW55550.1|  hypothetical protein EUGRSUZ_I01429                     338   3e-113   
ref|XP_009116034.1|  PREDICTED: aquaporin PIP2-1                        338   3e-113   
ref|XP_009615212.1|  PREDICTED: aquaporin PIP2-7                        338   3e-113   
ref|NP_001105025.1|  aquaporin PIP2-3                                   338   3e-113   
ref|XP_010031998.1|  PREDICTED: aquaporin PIP2-7-like                   338   3e-113   
ref|NP_001105026.1|  aquaporin PIP2-4                                   338   3e-113   
gb|ABK22146.1|  unknown                                                 338   3e-113   
gb|AAL49752.1|AF452014_1  aquaporin-like protein                        338   3e-113   
ref|XP_006291609.1|  hypothetical protein CARUB_v10017763mg             338   4e-113   
ref|NP_001105616.1|  aquaporin PIP2-5                                   338   4e-113   
ref|XP_004143245.1|  PREDICTED: aquaporin PIP2-2-like                   338   4e-113   
gb|KHN33668.1|  Aquaporin PIP2-7                                        337   5e-113   
gb|ACG33001.1|  aquaporin PIP2.2                                        338   5e-113   
ref|XP_011077012.1|  PREDICTED: probable aquaporin PIP2-5               337   5e-113   
ref|XP_008243934.1|  PREDICTED: probable aquaporin PIP2-5               337   5e-113   
ref|XP_004304426.1|  PREDICTED: aquaporin PIP2-1-like                   337   5e-113   
emb|CAA53478.1|  plasma membrane intrinsic protein 2b                   337   5e-113   
ref|XP_009400343.1|  PREDICTED: probable aquaporin PIP2-6               337   5e-113   
ref|XP_003575410.1|  PREDICTED: aquaporin PIP2-4                        337   5e-113   
gb|AAM61438.1|  aquaporin (plasma membrane intrinsic protein 2C)        337   6e-113   
emb|CAB45651.1|  putative plasma membrane intrinsic protein             337   6e-113   
gb|KHG20375.1|  putative aquaporin PIP2-5 -like protein                 337   6e-113   
ref|XP_004290727.1|  PREDICTED: aquaporin PIP2-7                        337   6e-113   
ref|XP_004157526.1|  PREDICTED: aquaporin PIP2-7-like                   337   7e-113   
ref|XP_003606383.1|  Aquaporin PIP2-7                                   337   7e-113   
ref|XP_009412922.1|  PREDICTED: probable aquaporin PIP2-6               337   7e-113   
ref|XP_004142421.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    337   7e-113   
tpg|DAA64674.1|  TPA: aquaporin PIP2 2                                  337   8e-113   
gb|KJB73803.1|  hypothetical protein B456_011G253400                    335   8e-113   
gb|AAL33586.1|AF440272_1  aquaporin                                     337   8e-113   
gb|AAB65787.1|  plasma membrane intrinsic protein                       337   8e-113   
gb|KJB73580.1|  hypothetical protein B456_011G239500                    337   8e-113   
ref|XP_007207344.1|  hypothetical protein PRUPE_ppa009630mg             337   1e-112   
ref|XP_002311092.1|  plasma membrane intrinsic protein 1-1              337   1e-112   
ref|XP_007137341.1|  hypothetical protein PHAVU_009G118900g             336   1e-112   
ref|NP_181255.1|  aquaporin PIP2-3                                      337   1e-112   
gb|KDO41796.1|  hypothetical protein CISIN_1g023108mg                   337   1e-112   
ref|XP_007218772.1|  hypothetical protein PRUPE_ppa009540mg             337   1e-112   
emb|CAH60720.1|  putative plasma membrane intrinsic protein             336   1e-112   
gb|KFK34592.1|  hypothetical protein AALP_AA5G165800                    337   1e-112   
ref|XP_009619670.1|  PREDICTED: aquaporin PIP2-1-like                   336   1e-112   
dbj|BAA32778.1|  Plasma membrane aquaporin (PAQ2)                       336   2e-112   
dbj|BAF33069.1|  aquaporin                                              337   2e-112   
ref|XP_004487111.1|  PREDICTED: aquaporin PIP2-7-like                   336   2e-112   
gb|ABK60196.1|  PIP2 protein                                            336   2e-112   
ref|NP_001235204.1|  Pip1 protein                                       336   2e-112   
ref|XP_010933360.1|  PREDICTED: probable aquaporin PIP2-6               336   2e-112   
gb|KDO68093.1|  hypothetical protein CISIN_1g023370mg                   333   3e-112   
ref|XP_007200557.1|  hypothetical protein PRUPE_ppa009691mg             335   3e-112   
gb|AAW55294.1|  aquaporin 2                                             332   3e-112   
gb|AAY22203.1|  putative aquaporin                                      335   3e-112   
emb|CDY13298.1|  BnaC06g14590D                                          335   3e-112   
gb|ACM50914.1|  aquaporin                                               335   3e-112   
gb|AHA84128.1|  plasma membrane integral protein ZmPIP2-7               335   3e-112   
ref|XP_006339071.1|  PREDICTED: aquaporin PIP2-1-like                   335   3e-112   
ref|XP_010325988.1|  PREDICTED: aquaporin PIP2-1-like                   335   4e-112   
sp|Q8GRI8.1|PIP25_ORYSJ  RecName: Full=Aquaporin PIP2-5; AltName:...    335   4e-112   
ref|NP_001274397.1|  aquaporin PIP2-1-like                              335   4e-112   
ref|XP_006428788.1|  hypothetical protein CICLE_v10012375mg             335   4e-112   
ref|XP_006481457.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        335   5e-112   
emb|CAB61749.1|  putative water channel protein                         333   5e-112   
gb|ADJ67992.1|  aquaporin                                               335   5e-112   
dbj|BAD90698.1|  plasma membrane intrinsic protein 2;2                  335   6e-112   
ref|NP_001289823.1|  aquaporin PIP2-1-like                              335   6e-112   
gb|KCW51592.1|  hypothetical protein EUGRSUZ_J01087                     338   6e-112   
emb|CDX10333.1|  aquaporin                                              335   6e-112   
gb|EAZ03714.1|  hypothetical protein OsI_25847                          335   6e-112   
ref|XP_008233329.1|  PREDICTED: probable aquaporin PIP2-5               335   7e-112   
ref|XP_009381972.1|  PREDICTED: probable aquaporin PIP2-2               335   7e-112   
dbj|BAE06148.1|  PIP aquaporin isoform                                  335   7e-112   
ref|XP_009108681.1|  PREDICTED: aquaporin PIP2-7-like                   334   8e-112   
gb|AAS65964.1|  aquaporin PIP 2                                         334   8e-112   
gb|EYU37965.1|  hypothetical protein MIMGU_mgv1a011471mg                334   8e-112   
ref|XP_003591907.1|  Aquaporin PIP                                      332   1e-111   
emb|CDY53629.1|  BnaC09g53920D                                          333   1e-111   
ref|XP_011088776.1|  PREDICTED: uncharacterized protein LOC105169921    349   1e-111   
gb|EMS51072.1|  Aquaporin PIP2-5                                        334   1e-111   
ref|XP_004307390.1|  PREDICTED: aquaporin PIP2-1                        334   1e-111   
gb|ABK21046.1|  unknown                                                 334   1e-111   
ref|XP_010107654.1|  Aquaporin PIP2-7                                   333   1e-111   
gb|AFQ23181.1|  aquaporin PIP2;2                                        333   2e-111   
ref|XP_009593453.1|  PREDICTED: aquaporin PIP2-2-like                   333   2e-111   
ref|XP_004505993.1|  PREDICTED: aquaporin PIP2-7-like                   333   2e-111   
ref|XP_002322877.1|  major intrinsic protein 1                          333   2e-111   
gb|KJB15837.1|  hypothetical protein B456_002G198900                    330   2e-111   
ref|NP_001274308.1|  aquaporin PIP2-1-like                              333   2e-111   
gb|KFK34721.1|  hypothetical protein AALP_AA5G183600                    333   2e-111   
tpg|DAA64687.1|  TPA: aquaporin PIP2 10                                 333   3e-111   
gb|AAX92685.1|  probable aquaporin                                      330   3e-111   
gb|AHW81492.1|  ECFP-tagged plasma membrane intrinsic protein 2a        342   3e-111   
ref|XP_009345382.1|  PREDICTED: probable aquaporin PIP2-5               333   3e-111   
ref|XP_010934344.1|  PREDICTED: aquaporin PIP2-4-like                   333   3e-111   
ref|XP_004500724.1|  PREDICTED: uncharacterized protein LOC101494283    346   3e-111   
emb|CDP06739.1|  unnamed protein product                                333   4e-111   
ref|XP_008807132.1|  PREDICTED: probable aquaporin PIP2-6               333   4e-111   
emb|CDY07519.1|  BnaC06g15450D                                          333   4e-111   
gb|EYU39575.1|  hypothetical protein MIMGU_mgv1a011441mg                333   4e-111   
ref|NP_001288933.1|  probable aquaporin PIP2-6                          333   4e-111   
tpg|DAA60472.1|  TPA: plasma membrane intrinsic protein2                334   4e-111   
ref|XP_006403531.1|  hypothetical protein EUTSA_v10010603mg             333   5e-111   
ref|XP_010046653.1|  PREDICTED: aquaporin PIP2-1-like                   332   5e-111   
emb|CDX67611.1|  BnaA07g16510D                                          332   5e-111   
ref|XP_004976254.1|  PREDICTED: aquaporin PIP2-5-like                   333   5e-111   
emb|CDY14415.1|  BnaC03g21800D                                          332   6e-111   
ref|XP_009772697.1|  PREDICTED: aquaporin PIP2-2-like                   332   6e-111   
ref|XP_010555818.1|  PREDICTED: probable aquaporin PIP2-5               332   7e-111   
gb|AFK47442.1|  unknown                                                 332   7e-111   
ref|XP_001753248.1|  predicted protein                                  332   7e-111   
ref|XP_008365039.1|  PREDICTED: probable aquaporin PIP2-5               332   8e-111   
gb|EAZ03711.1|  hypothetical protein OsI_25843                          332   1e-110   
ref|XP_004496281.1|  PREDICTED: aquaporin PIP2-1-like                   332   1e-110   
ref|XP_008449255.1|  PREDICTED: aquaporin PIP2-2-like                   332   1e-110   
ref|XP_007162747.1|  hypothetical protein PHAVU_001G177000g             332   1e-110   
ref|XP_002879778.1|  PIP2_6/PIP2E                                       332   1e-110   
gb|AAV80229.1|  aquaporin 2                                             331   1e-110   
ref|XP_008366675.1|  PREDICTED: probable aquaporin PIP2-5               331   1e-110   
ref|NP_181434.1|  plasma membrane intrinsic protein 2E                  331   2e-110   
ref|XP_006294722.1|  hypothetical protein CARUB_v10023768mg             331   2e-110   
ref|XP_010516024.1|  PREDICTED: probable aquaporin PIP2-5               331   2e-110   
ref|XP_010028741.1|  PREDICTED: uncharacterized protein LOC104418957    344   2e-110   
ref|XP_001762521.1|  predicted protein                                  330   2e-110   
ref|XP_001779900.1|  predicted protein                                  330   2e-110   
ref|XP_006846005.1|  hypothetical protein AMTR_s00155p00061840          331   2e-110   
ref|XP_010427203.1|  PREDICTED: probable aquaporin PIP2-5               331   2e-110   
gb|AEY75242.1|  plasma membrane intrinsic protein                       331   2e-110   
ref|XP_006367008.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        330   2e-110   
dbj|BAB40143.1|  plasma membrane intrinsic protein 2-2                  331   2e-110   
ref|XP_006367007.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        331   3e-110   
gb|ACU00104.1|  plasma membrane intrinsic protein PIP2.2                330   3e-110   
gb|AEF32110.1|  aquaporin PIP2                                          330   3e-110   
emb|CDX73446.1|  BnaC08g25570D                                          330   3e-110   
ref|XP_002446796.1|  hypothetical protein SORBIDRAFT_06g022840          330   4e-110   
gb|AFH36338.1|  aquaporin PIP2;3                                        330   4e-110   
gb|ABN11917.1|  aquaporin                                               330   4e-110   
emb|CAB07783.1|  PaMip-2                                                331   4e-110   
ref|XP_009414435.1|  PREDICTED: probable aquaporin PIP2-6               330   4e-110   
ref|NP_001274376.1|  aquaporin PIP2-7-like                              330   4e-110   
gb|AAG44947.1|AF290620_1  putative PIP2                                 330   4e-110   
ref|XP_010509080.1|  PREDICTED: probable aquaporin PIP2-6               330   4e-110   
ref|NP_191042.1|  putative aquaporin PIP2-5                             330   4e-110   
gb|ABI96814.1|  plasma membrane intrinsic protein                       330   4e-110   
ref|XP_008447947.1|  PREDICTED: aquaporin PIP2-7                        330   5e-110   
ref|XP_006367014.1|  PREDICTED: aquaporin PIP2-1-like                   330   5e-110   
ref|XP_006411124.1|  hypothetical protein EUTSA_v10017026mg             330   5e-110   
ref|XP_006581099.1|  PREDICTED: uncharacterized protein LOC100808290    343   5e-110   
ref|XP_006291622.1|  hypothetical protein CARUB_v10017773mg             330   5e-110   



>ref|XP_011089904.1| PREDICTED: LOW QUALITY PROTEIN: aquaporin PIP2-7-like [Sesamum 
indicum]
Length=278

 Score =   370 bits (949),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 178/194 (92%), Positives = 188/194 (97%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+AQCLGAICGVGLVKAFQKS+Y
Sbjct  85   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRALVYMVAQCLGAICGVGLVKAFQKSYY  144

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGANE+AAGYNKG GLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  145  NRYGGGANELAAGYNKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  204

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+NDDKAWD+HWIFWVGPF+GA  AA YHQYILR
Sbjct  205  VFMVHLATIPITGTGINPARSFGAAVIYNDDKAWDDHWIFWVGPFIGAAIAAFYHQYILR  264

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  265  AAAIKALGSFRSNA  278



>ref|XP_010521765.1| PREDICTED: aquaporin PIP2-7-like [Tarenaya hassleriana]
Length=286

 Score =   367 bits (942),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/194 (91%), Positives = 189/194 (97%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM+AQCLGAICG GLVKAFQKS+Y
Sbjct  93   FILVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYMVAQCLGAICGCGLVKAFQKSYY  152

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGAN +A+GYNKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFA
Sbjct  153  NRYGGGANVLASGYNKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFA  212

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWD+HW+FWVGPF+GALAAAVYHQY+LR
Sbjct  213  VFMVHLATIPITGTGINPARSFGAAVIYNQDKAWDDHWLFWVGPFIGALAAAVYHQYVLR  272

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  273  AAAIKALGSFRSNA  286



>emb|CBI16313.3| unnamed protein product [Vitis vinifera]
Length=196

 Score =   362 bits (928),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 174/194 (90%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YMIAQCLGA+CGVGLVKAFQ S Y
Sbjct  3    FILVYCTAGISGGHINPAVTFGLFLARKVSLVRALMYMIAQCLGAVCGVGLVKAFQSSLY  62

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGANE+A GYNKG GLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  63   NRYGGGANELAGGYNKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  122

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DKAWD+HW+FWVGPF+GA  AA YHQYILR
Sbjct  123  VFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWMFWVGPFIGAAIAAFYHQYILR  182

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  183  AAAIKALGSFRSNA  196



>gb|AFH36337.1| aquaporin PIP2;2 [Quercus petraea]
Length=285

 Score =   364 bits (934),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/194 (92%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICGVGLVKAFQKS Y
Sbjct  92   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGLVKAFQKSLY  151

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE+AAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  152  TRYGGGANELAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  211

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN  KAWD+HWIFWVGPFVGA  AA YHQ+ILR
Sbjct  212  VFMVHLATIPITGTGINPARSFGAAVIFNQSKAWDDHWIFWVGPFVGAAIAAFYHQFILR  271

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  272  AAAIKALGSFRSNA  285



>ref|XP_009786071.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana sylvestris]
 tpg|DAA64678.1| TPA_exp: aquaporin PIP2 4b [Nicotiana tabacum]
Length=287

 Score =   362 bits (930),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/194 (90%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM++QCLGAICGVGLVKAFQK++Y
Sbjct  94   FVLVYCTAGISGGHINPAVTFGLFLARKVSLMRAVLYMVSQCLGAICGVGLVKAFQKAYY  153

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGG N MA G+NKG GLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  154  NRYGGGVNVMAGGHNKGVGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  213

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWDEHWIFWVGPFVGA AAAVYHQYILR
Sbjct  214  VFMVHLATIPITGTGINPARSFGAAVIYNQDKAWDEHWIFWVGPFVGAFAAAVYHQYILR  273

Query  167  GSAIKALGSFRSNA  126
              A+KALGSFRSNA
Sbjct  274  AGALKALGSFRSNA  287



>ref|XP_009615789.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana tomentosiformis]
Length=287

 Score =   362 bits (929),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/194 (90%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM++QCLGAICGVGLVKAFQK++Y
Sbjct  94   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVSQCLGAICGVGLVKAFQKAYY  153

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGG N MA G+NKG GLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  154  NRYGGGVNVMAGGHNKGVGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  213

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWDEHWIFWVGPFVGA AAAVYHQYILR
Sbjct  214  VFMVHLATIPITGTGINPARSFGAAVIYNQDKAWDEHWIFWVGPFVGAFAAAVYHQYILR  273

Query  167  GSAIKALGSFRSNA  126
              A+KALGSFRSNA
Sbjct  274  AGALKALGSFRSNA  287



>ref|NP_001268056.1| aquaporin PIP2 [Vitis vinifera]
 gb|ABC84558.1| aquaporin PIP2 [Vitis vinifera]
Length=280

 Score =   361 bits (927),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/194 (90%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YMIAQCLGA+CGVGLVKAFQ S Y
Sbjct  87   FILVYCTAGISGGHINPAVTFGLFLARKVSLVRALMYMIAQCLGAVCGVGLVKAFQSSLY  146

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGANE+A GYNKG GLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  147  NRYGGGANELAGGYNKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  206

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DKAWD+HW+FWVGPF+GA  AA YHQYILR
Sbjct  207  VFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWMFWVGPFIGAAIAAFYHQYILR  266

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  267  AAAIKALGSFRSNA  280



>gb|ABB13430.2| plasma membrane intrinsic protein [Olea europaea]
Length=287

 Score =   361 bits (927),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/194 (90%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVT GLFL RKV+L RAVLYM+AQCLGAICGVGLVKAFQKS+Y
Sbjct  94   FILVYCTAGISGGHINPAVTLGLFLGRKVSLIRAVLYMVAQCLGAICGVGLVKAFQKSYY  153

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            ++YGGGANE+A GYNKG GLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  154  HKYGGGANELAPGYNKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  213

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DK WD+HWIFWVGPFVGAL AA+YHQYILR
Sbjct  214  VFMVHLATIPITGTGINPARSFGAAVIYNEDKPWDDHWIFWVGPFVGALIAAIYHQYILR  273

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  274  AGAIKALGSFRSNA  287



>tpg|DAA64677.1| TPA_exp: aquaporin PIP2 4a [Nicotiana tabacum]
Length=287

 Score =   360 bits (924),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 174/194 (90%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM++QCLGAICGVGLVKAFQK+++
Sbjct  94   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVSQCLGAICGVGLVKAFQKAYF  153

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGG N MA G+NKG GLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  154  NRYGGGVNVMAGGHNKGVGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  213

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWDEHWIFWVGPFVGA AAAVYHQYILR
Sbjct  214  VFMVHLATIPITGTGINPARSFGAAVIYNQDKAWDEHWIFWVGPFVGAFAAAVYHQYILR  273

Query  167  GSAIKALGSFRSNA  126
              A+KALGSFRSNA
Sbjct  274  AGALKALGSFRSNA  287



>ref|XP_011044357.1| PREDICTED: probable aquaporin PIP2-4 [Populus euphratica]
Length=284

 Score =   359 bits (922),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/194 (90%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICG GLVKAFQKSFY
Sbjct  91   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGCGLVKAFQKSFY  150

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N YGGGANE+  GYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  151  NHYGGGANELQEGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  210

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN  KAWD+HW+FWVGPF+GA  AA YHQ+ILR
Sbjct  211  VFMVHLATIPITGTGINPARSFGAAVIFNQSKAWDDHWLFWVGPFIGAAIAAFYHQFILR  270

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  271  AAAIKALGSFRSNA  284



>ref|XP_007205689.1| hypothetical protein PRUPE_ppa009689mg [Prunus persica]
 gb|EMJ06888.1| hypothetical protein PRUPE_ppa009689mg [Prunus persica]
Length=281

 Score =   359 bits (921),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+LPRAVLY++AQ LGAICGVGLVKAFQK++Y
Sbjct  88   FVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVLYIVAQSLGAICGVGLVKAFQKTYY  147

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
              YGGGANE+AAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  148  EEYGGGANELAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  207

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VF+VHLATIPITGTGINPARSFGAAVI+N DKAWD+ WIFW+GPF+GA  AA+YHQYILR
Sbjct  208  VFIVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAALYHQYILR  267

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  268  AGAIKALGSFRSNA  281



>ref|XP_002313510.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
 gb|EEE87465.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
Length=284

 Score =   358 bits (920),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICG GLVKAFQKS+Y
Sbjct  91   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGCGLVKAFQKSYY  150

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N YGGGANE+  GYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  151  NHYGGGANELQEGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  210

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN  KAWD+HW+FWVGPF+GA  AA YHQ+ILR
Sbjct  211  VFMVHLATIPITGTGINPARSFGAAVIFNQSKAWDDHWLFWVGPFIGAAIAAFYHQFILR  270

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  271  AAAIKALGSFRSNA  284



>ref|NP_001280185.1| aquaporin PIP2-2 [Prunus mume]
 dbj|BAE48656.1| aquaporin [Prunus mume]
Length=281

 Score =   358 bits (919),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+LPRAVLY+IAQ LGAICGVGLVKAFQK++Y
Sbjct  88   FVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVLYIIAQSLGAICGVGLVKAFQKTYY  147

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
              YGGGANE+AAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  148  EEYGGGANELAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  207

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VF+VHLATIPITGTGINPARSFGAAVI+N DKAWD+ WIFW+GPF+GA  AA+YHQYILR
Sbjct  208  VFIVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAALYHQYILR  267

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  268  AGAIKALGSFRSNA  281



>gb|ACU00103.1| plasma membrane intrinsic protein PIP2.1 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score =   358 bits (919),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 187/194 (96%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICG GLVKAFQKS+Y
Sbjct  90   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYMVAQCLGAICGCGLVKAFQKSYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             +YGGGANE+A G++KGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  TKYGGGANELATGFSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DKAWD+HWIFWVGPF+GA  AA+YHQY+LR
Sbjct  210  VFMVHLATIPITGTGINPARSFGAAVIYNEDKAWDDHWIFWVGPFIGAAIAALYHQYVLR  269

Query  167  GSAIKALGSFRSNA  126
             +A+KALGSFRS++
Sbjct  270  AAAVKALGSFRSSS  283



>gb|ABO69705.2| aquaporin PIP2 [Prunus humilis]
Length=281

 Score =   357 bits (917),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+LPRAVLY++AQ LGAICGVGLVKAFQK++Y
Sbjct  88   FVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVLYIVAQSLGAICGVGLVKAFQKTYY  147

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
              YGGGANE+AAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  148  EEYGGGANELAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  207

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VF+VHLATIPITGTGINPARSFGAAVI+N DKAWD+ WIFW+GPF+GA  AA+YHQYILR
Sbjct  208  VFIVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAALYHQYILR  267

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  268  AGAIKALGSFRSNA  281



>ref|XP_006381455.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
 gb|ABK94847.1| unknown [Populus trichocarpa]
 gb|ERP59252.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
Length=285

 Score =   357 bits (916),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 186/194 (96%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICG GLVKAFQKS+Y
Sbjct  90   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYMVAQCLGAICGCGLVKAFQKSYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             +YGGGANE+A G++KGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  TKYGGGANELATGFSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWD+HWIFWVGPF+GA  AA+YHQY+LR
Sbjct  210  VFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDHWIFWVGPFIGAAIAALYHQYVLR  269

Query  167  GSAIKALGSFRSNA  126
             +A+KALGSFRS++
Sbjct  270  AAAVKALGSFRSSS  283



>gb|KDP44053.1| hypothetical protein JCGZ_05520 [Jatropha curcas]
Length=286

 Score =   357 bits (915),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 175/194 (90%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFL RKV+L RA+ YMIAQCLGAICG GLVKAFQK++Y
Sbjct  93   FILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALGYMIAQCLGAICGCGLVKAFQKAYY  152

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGANE+A GYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  153  NRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  212

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWD+ WIFWVGPFVGA  AA YHQYILR
Sbjct  213  VFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFVGAAIAAFYHQYILR  272

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  273  AAAIKALGSFRSNA  286



>ref|XP_008385311.1| PREDICTED: probable aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   356 bits (914),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLY+IAQCLGAICGVGLVKAFQKS+Y
Sbjct  88   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYIIAQCLGAICGVGLVKAFQKSYY  147

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             +YGGGANE++AGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  148  MKYGGGANELSAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  207

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VF+VHLATIPITGTGINPARSFGAAVI+N DKAWD+ WIFW+GPF+GA  AA YHQYILR
Sbjct  208  VFIVHLATIPITGTGINPARSFGAAVIYNXDKAWDDQWIFWLGPFIGAAIAAFYHQYILR  267

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  268  AGAIKALGSFRSNA  281



>ref|XP_006381453.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
 gb|ABK96511.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP59250.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
Length=285

 Score =   357 bits (915),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 186/194 (96%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICG GLVKAFQKS+Y
Sbjct  90   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYMVAQCLGAICGCGLVKAFQKSYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             +YGGG NE+A G++KGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  TKYGGGVNELATGFSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DKAWD+HWIFWVGPF+GA  AA+YHQY+LR
Sbjct  210  VFMVHLATIPITGTGINPARSFGAAVIYNEDKAWDDHWIFWVGPFIGAAIAALYHQYVLR  269

Query  167  GSAIKALGSFRSNA  126
             +A+KALGSFRS++
Sbjct  270  AAAVKALGSFRSSS  283



>ref|XP_006357563.1| PREDICTED: probable aquaporin PIP2-1-like [Solanum tuberosum]
Length=286

 Score =   356 bits (914),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICGVG VKAFQ ++Y
Sbjct  93   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSAYY  152

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGG N MAAG+NKG GLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  153  NRYGGGVNVMAAGHNKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  212

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWDEHWIFWVGPF+GA  AA YHQ++LR
Sbjct  213  VFMVHLATIPITGTGINPARSFGAAVIYNGDKAWDEHWIFWVGPFIGAFIAAFYHQFVLR  272

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  273  AGAIKALGSFRSNA  286



>emb|CBI37861.3| unnamed protein product [Vitis vinifera]
Length=198

 Score =   353 bits (905),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+ YM+AQCLGAICGVGLVKAF KSFY
Sbjct  3    FILVYCTAGISGGHINPAVTFGLFLARKVSLIRALAYMVAQCLGAICGVGLVKAFMKSFY  62

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +AAGYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  63   NSLGGGANSVAAGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  122

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N++K WD+ WIFWVGPFVGALAAA YHQYILR
Sbjct  123  VFMVHLATIPITGTGINPARSFGAAVIYNNEKVWDDQWIFWVGPFVGALAAAAYHQYILR  182

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  183  AAAIKALGSFRSN  195



>gb|EYU36189.1| hypothetical protein MIMGU_mgv1a011437mg [Erythranthe guttata]
Length=282

 Score =   356 bits (913),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICGVG VKAFQKS Y
Sbjct  89   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQKSHY  148

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N++GGGAN +A GYNKGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  149  NKFGGGANTLALGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  208

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN++KAWD+HWIFWVGPF+GA  AA+YHQ++LR
Sbjct  209  VFMVHLATIPITGTGINPARSFGAAVIFNNEKAWDDHWIFWVGPFIGAAIAAIYHQFVLR  268

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  269  AGAIKALGSFRSNA  282



>ref|XP_006424576.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 ref|XP_006488095.1| PREDICTED: aquaporin PIP2-1-like [Citrus sinensis]
 gb|ESR37816.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|KDO73274.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=289

 Score =   356 bits (913),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFL RKV+L RA+LYM+AQCLGAICG G VKAFQKS+Y
Sbjct  96   FILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYY  155

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGANE+A GYNKGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  156  NRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  215

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N +KAWD+ WIFWVGPF+GA  AA YHQYILR
Sbjct  216  VFMVHLATIPITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAFVAAFYHQYILR  275

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  276  AAAIKALGSFRSNA  289



>gb|AEQ29857.1| aquaporin PIP2 [Malus prunifolia]
Length=281

 Score =   355 bits (912),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLY++AQCLGAICGVGLVKAFQKS+Y
Sbjct  88   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYIVAQCLGAICGVGLVKAFQKSYY  147

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             +YGGGANE+A GYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  148  VKYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  207

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VF+VHLATIPITGTGINPARSFGAAVI+N DKAWD+ WIFW+GPF+GA  AA YHQYILR
Sbjct  208  VFIVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILR  267

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  268  AGAIKALGSFRSNA  281



>gb|AAB18227.1| MipC [Mesembryanthemum crystallinum]
Length=287

 Score =   355 bits (912),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L +AVLYM+AQCLGAICGVG VKAFQK++Y
Sbjct  94   FILVYCTAGISGGHINPAVTFGLFLARKVSLIKAVLYMVAQCLGAICGVGFVKAFQKAYY  153

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANEMA+GY KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFA
Sbjct  154  VRYGGGANEMASGYTKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFA  213

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N  KAWD+HWIFWVGPF+GA  AA YHQYILR
Sbjct  214  VFMVHLATIPITGTGINPARSFGAAVIYNQQKAWDDHWIFWVGPFIGAAIAAFYHQYILR  273

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRS+A
Sbjct  274  AAAIKALGSFRSSA  287



>ref|XP_008363507.1| PREDICTED: aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   355 bits (911),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLY++AQCLGAICGVGLVKAFQKS+Y
Sbjct  88   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYIVAQCLGAICGVGLVKAFQKSYY  147

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             +YGGGANE+A GYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  148  VKYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  207

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VF+VHLATIPITGTGINPARSFGAAVI+N DKAWD+ WIFW+GPF+GA  AA YHQYILR
Sbjct  208  VFIVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILR  267

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  268  AGAIKALGSFRSNA  281



>dbj|BAB40141.1| plasma membrane intrinsic protein 2-1 [Pyrus communis]
Length=281

 Score =   355 bits (910),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLY+IAQCLGAICGVGLVKAFQKS+Y
Sbjct  88   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYIIAQCLGAICGVGLVKAFQKSYY  147

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             +YGGGANE++AGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  148  VKYGGGANELSAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  207

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VF+VHLATIPITGTGINPARS GAAVI+N DKAWD+ WIFW+GPF+GA  AA YHQYILR
Sbjct  208  VFIVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILR  267

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  268  AGAIKALGSFRSNA  281



>ref|XP_009595123.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana tomentosiformis]
 tpg|DAA64685.1| TPA_exp: aquaporin PIP2 9a [Nicotiana tabacum]
Length=287

 Score =   355 bits (911),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICGVGLVK FQ ++Y
Sbjct  94   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGLVKGFQSAYY  153

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGAN MA G+ KG GL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  154  VRYGGGANVMAPGHTKGVGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  213

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWDEHWIFWVGPF+GA AAAVYHQ+ILR
Sbjct  214  VFMVHLATIPITGTGINPARSFGAAVIYNQDKAWDEHWIFWVGPFIGAFAAAVYHQFILR  273

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  274  AGAIKALGSFRSNA  287



>gb|AIA83106.1| putative aquaporin PIP2 [Citrus trifoliata]
Length=292

 Score =   355 bits (911),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFL RKV+L RA+LYM+AQCLGAICG G VKAFQKS+Y
Sbjct  99   FILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYY  158

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGANE+A GYNKGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  159  NRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  218

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N +KAWD+ WI WVGPF+GA  AA YHQYILR
Sbjct  219  VFMVHLATIPITGTGINPARSFGAAVIYNKEKAWDDQWILWVGPFIGAFVAAFYHQYILR  278

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  279  AAAIKALGSFRSNA  292



>ref|XP_009335091.1| PREDICTED: probable aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=281

 Score =   355 bits (910),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLY+IAQCLGAICGVGLVKAFQKS+Y
Sbjct  88   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYIIAQCLGAICGVGLVKAFQKSYY  147

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             +YGGGANE++AGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  148  VKYGGGANELSAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  207

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VF+VHLATIPITGTGINPARS GAAVI+N DKAWD+ WIFW+GPF+GA  AA YHQYILR
Sbjct  208  VFIVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILR  267

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  268  AGAIKALGSFRSNA  281



>ref|XP_011048549.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048550.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048551.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
Length=285

 Score =   355 bits (910),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM+AQCLGAICG GLVKAFQKS+Y
Sbjct  90   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMVAQCLGAICGCGLVKAFQKSYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
              YGGGANE+A G++KGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  TNYGGGANELATGFSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWD+HWIFWVGPF+GA  AA+YHQY+LR
Sbjct  210  VFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDHWIFWVGPFIGAAIAALYHQYVLR  269

Query  167  GSAIKALGSFRSNA  126
             +A+KALGSFRS++
Sbjct  270  AAAVKALGSFRSSS  283



>dbj|BAF32042.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32043.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32044.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32045.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32046.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32047.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32048.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32049.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32050.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32051.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32052.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32053.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32054.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32055.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32056.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32057.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32058.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32059.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32060.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32061.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32062.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32063.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32064.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32065.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32066.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32067.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32068.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32069.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32070.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32071.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32072.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32073.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32074.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32075.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32076.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32077.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32078.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32079.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32080.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32081.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32082.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32083.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32084.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32085.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32086.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32087.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32088.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32089.1| putative aquaporin [Cryptomeria japonica]
Length=275

 Score =   354 bits (909),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+LPRAVLYM+AQCLGAICGVGLVKAFQKSFY
Sbjct  80   FVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVLYMVAQCLGAICGVGLVKAFQKSFY  139

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            + YGGGAN +A GY+KGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  140  DMYGGGANSVAPGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  199

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+  DK WD+ WIFWVGPF+GA AAA YHQYILR
Sbjct  200  VFMVHLATIPITGTGINPARSFGAAVIYGHDKIWDDQWIFWVGPFLGAFAAAFYHQYILR  259

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  260  AAAIKALGSFRSN  272



>gb|ABB88840.1| aquaporin [Stevia rebaudiana]
Length=281

 Score =   354 bits (909),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM+AQCLGAICGVGLVKAFQ S+Y
Sbjct  88   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRALLYMVAQCLGAICGVGLVKAFQSSYY  147

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGANE+A GYNKGTGLG EIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  148  NRYGGGANELADGYNKGTGLGTEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  207

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWD+ WIFWVGPF+GA  AA YHQ++LR
Sbjct  208  VFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAFYHQFVLR  267

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  268  AGAIKALGSFRSNA  281



>ref|XP_011048552.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   354 bits (909),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM+AQCLGAICG GLVKAFQKS+Y
Sbjct  90   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMVAQCLGAICGCGLVKAFQKSYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
              YGGGANE+A G++KGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  TNYGGGANELATGFSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWD+HWIFWVGPF+GA  AA+YHQY+LR
Sbjct  210  VFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDHWIFWVGPFIGAAIAALYHQYVLR  269

Query  167  GSAIKALGSFRSNA  126
             +A+KALGSFRS++
Sbjct  270  AAAVKALGSFRSSS  283



>ref|XP_009780213.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana sylvestris]
 tpg|DAA64686.1| TPA_exp: aquaporin PIP2 9b [Nicotiana tabacum]
Length=287

 Score =   354 bits (909),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICGVG VKAFQ ++Y
Sbjct  94   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSAYY  153

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGAN MA G+ KG GL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  154  VRYGGGANVMAPGHTKGVGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  213

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWDEHWIFWVGPF+GA AAAVYHQ+ILR
Sbjct  214  VFMVHLATIPITGTGINPARSFGAAVIYNHDKAWDEHWIFWVGPFIGAFAAAVYHQFILR  273

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  274  AGAIKALGSFRSNA  287



>gb|AIA83104.1| putative aquaporin PIP2 [Citrus sinensis x Citrus trifoliata]
Length=290

 Score =   354 bits (909),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFL RKV+L RA+LYM+AQCLGAICG G VKAFQKS+Y
Sbjct  97   FILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYY  156

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGANE+A GYNKGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  157  NRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  216

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPI GTGINPARSFGAAVI+N +KAWD+ WIFWVGPF+GA  AA YHQYILR
Sbjct  217  VFMVHLATIPIIGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAFVAAFYHQYILR  276

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  277  AAAIKALGSFRSNA  290



>ref|NP_001105639.1| aquaporin PIP2-7 [Zea mays]
 sp|Q9ATM4.1|PIP27_MAIZE RecName: Full=Aquaporin PIP2-7; AltName: Full=Plasma membrane 
intrinsic protein 2-7; AltName: Full=ZmPIP2-7; AltName: Full=ZmPIP2;7 
[Zea mays]
 gb|AAK26763.1| plasma membrane integral protein ZmPIP2-7 [Zea mays]
 gb|ACU23788.1| unknown [Glycine max]
 gb|KHN21518.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score =   354 bits (908),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFL RKV+L RA+LYMIAQC GAICG GL K FQKSFY
Sbjct  94   FILVYCTAGISGGHINPAVTFGLFLGRKVSLVRALLYMIAQCAGAICGAGLAKGFQKSFY  153

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGG N ++ GYNKGT LGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  154  NRYGGGVNTVSDGYNKGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  213

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARSFG AVIFN+DKAWD+ WI+WVGPFVGA  AA+YHQYILR
Sbjct  214  VFMVHLATIPVTGTGINPARSFGPAVIFNNDKAWDDQWIYWVGPFVGAAVAAIYHQYILR  273

Query  167  GSAIKALGSFRSNA  126
            GSAIKALGSFRSNA
Sbjct  274  GSAIKALGSFRSNA  287



>gb|AFH36336.1| aquaporin PIP2;1 [Quercus petraea]
Length=278

 Score =   353 bits (905),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV YMIAQCLGAICGVGLVKAF KSFY
Sbjct  83   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVSYMIAQCLGAICGVGLVKAFMKSFY  142

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +  GGGAN +A+GYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  143  DANGGGANLVASGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  202

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N++K WDEHWIFWVGPFVGALAAA YHQYILR
Sbjct  203  VFMVHLATIPITGTGINPARSFGAAVIYNNEKVWDEHWIFWVGPFVGALAAAAYHQYILR  262

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  263  AAAIKALGSFRSN  275



>gb|KDP29110.1| hypothetical protein JCGZ_16499 [Jatropha curcas]
Length=284

 Score =   353 bits (906),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM AQCLGAICG GLVKAFQK++Y
Sbjct  89   FILVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMAAQCLGAICGCGLVKAFQKAYY  148

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE+A GY+KGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  149  TRYGGGANELADGYSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  208

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWD+ WIFWVGPF+GA  AA+YHQYILR
Sbjct  209  VFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAIYHQYILR  268

Query  167  GSAIKALGSFRSNA  126
              A+KALGSFRS +
Sbjct  269  AGAVKALGSFRSTS  282



>ref|XP_010920405.1| PREDICTED: aquaporin PIP2-4 isoform X1 [Elaeis guineensis]
Length=285

 Score =   353 bits (906),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYMIAQCLGAICGVGLVKAFQK++Y
Sbjct  92   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRALLYMIAQCLGAICGVGLVKAFQKAYY  151

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGG NE+++GY+KGTGL AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  152  NRYGGGVNELSSGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  211

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS G AVI+N+DKAWD+ WIFWVGPF+GA  AA YHQYILR
Sbjct  212  VFMVHLATIPITGTGINPARSLGPAVIYNNDKAWDDQWIFWVGPFIGAAIAAAYHQYILR  271

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  272  AGAIKALGSFRSNA  285



>ref|NP_001267957.1| aquaporin PIP2;2 [Vitis vinifera]
 gb|AEZ35023.1| plasma membrane 2;2 aquaporin [Vitis vinifera]
Length=279

 Score =   352 bits (904),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+ YM+AQCLGAICGVGLVKAF KSFY
Sbjct  84   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRALAYMVAQCLGAICGVGLVKAFMKSFY  143

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +AAGYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  144  NSLGGGANSVAAGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  203

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N++K WD+ WIFWVGPFVGALAAA YHQYILR
Sbjct  204  VFMVHLATIPITGTGINPARSFGAAVIYNNEKVWDDQWIFWVGPFVGALAAAAYHQYILR  263

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  264  AAAIKALGSFRSN  276



>gb|ABH09327.1| putative aquaporin [Vitis vinifera]
 gb|ABN14351.1| aquaporin PIP2;2 [Vitis vinifera]
 emb|CAN77349.1| hypothetical protein VITISV_007541 [Vitis vinifera]
Length=279

 Score =   352 bits (904),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+ YM+AQCLGAICGVGLVKAF KSFY
Sbjct  84   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRALAYMVAQCLGAICGVGLVKAFMKSFY  143

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +AAGYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  144  NSLGGGANSVAAGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  203

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N++K WD+ WIFWVGPFVGALAAA YHQYILR
Sbjct  204  VFMVHLATIPITGTGINPARSFGAAVIYNNEKVWDDQWIFWVGPFVGALAAAAYHQYILR  263

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  264  AAAIKALGSFRSN  276



>gb|ABC69040.1| aquaporin PIP2-1 [Rhododendron catawbiense]
Length=281

 Score =   353 bits (905),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICGVGLVKAFQKS++
Sbjct  88   FVLVYCTAGISGGHINPAVTFGLFLARKVSLFRAVLYMVAQCLGAICGVGLVKAFQKSYF  147

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGANE+A+GYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  148  DRYGGGANEVASGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  207

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+ KAWD+ WIFWVGPF GA  AA YHQ+ILR
Sbjct  208  VFMVHLATIPITGTGINPARSFGAAVIYNNSKAWDDQWIFWVGPFAGAAIAAFYHQFILR  267

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  268  AAAIKALGSFRSN  280



>dbj|BAF32141.1| putative aquaporin [Taxodium distichum]
Length=274

 Score =   352 bits (904),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+LPRAVLYM+AQCLGAICGVGLVKAFQKSFY
Sbjct  79   FVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVLYMVAQCLGAICGVGLVKAFQKSFY  138

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            + +GGGAN +A GY+KGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  139  DMHGGGANSVAQGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  198

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+  DK WD+ WIFWVGPF+GA AAA YHQYILR
Sbjct  199  VFMVHLATIPITGTGINPARSFGAAVIYGHDKIWDDQWIFWVGPFLGAFAAAFYHQYILR  258

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  259  AAAIKALGSFRSN  271



>ref|XP_002530280.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF32087.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=287

 Score =   353 bits (905),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFL RKV+L RA+ YM+AQCLGAICG GLVKAFQK++Y
Sbjct  94   FILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALGYMVAQCLGAICGCGLVKAFQKAYY  153

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGANE+A GYNKGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  154  NRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  213

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N +KAWD+ WIFWVGPF+GA  AA YHQYILR
Sbjct  214  VFMVHLATIPITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAIAAFYHQYILR  273

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  274  AAAIKALGSFRSNA  287



>gb|ACU87558.1| PIP protein [Gossypium hirsutum]
 gb|KHG24536.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=282

 Score =   352 bits (904),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFL RKV+L RAV+YM+AQCLGAICG GLVK FQKS+Y
Sbjct  89   FILVYCTAGISGGHINPAVTFGLFLGRKVSLVRAVMYMVAQCLGAICGCGLVKGFQKSYY  148

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N YGGGANE+  G+NKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  149  NTYGGGANELQDGFNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  208

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWD+ W+FWVGPF+GA  AA+YHQYILR
Sbjct  209  VFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWMFWVGPFIGAAIAAIYHQYILR  268

Query  167  GSAIKALGSFRSNA  126
              A+KALGSFRSNA
Sbjct  269  AGAMKALGSFRSNA  282



>gb|KHF98939.1| putative aquaporin PIP2-8 -like protein [Gossypium arboreum]
Length=278

 Score =   352 bits (904),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM+AQCLGAICGVGLVKAF KS Y
Sbjct  83   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKSEY  142

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A GYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  143  NSLGGGANTVATGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  202

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DKAWD+HWIFWVGP VGALAAA YHQYILR
Sbjct  203  VFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPMVGALAAAAYHQYILR  262

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  263  AAAIKALGSFRSN  275



>ref|XP_009628968.1| PREDICTED: probable aquaporin PIP2-1 [Nicotiana tomentosiformis]
 tpg|DAA64679.1| TPA_exp: aquaporin PIP2 5 [Nicotiana tabacum]
Length=283

 Score =   352 bits (904),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+AQCLGAICGVG VKAFQ ++Y
Sbjct  90   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRALVYMVAQCLGAICGVGFVKAFQSAYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGAN MAAG+ KG GL AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  150  DRYGGGANVMAAGHTKGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWDEHWIFWVGPF+GA AAA YHQYILR
Sbjct  210  VFMVHLATIPITGTGINPARSFGAAVIYNQDKAWDEHWIFWVGPFIGAFAAAAYHQYILR  269

Query  167  GSAIKALGSFRSNA  126
              A+KALGSFRSNA
Sbjct  270  AGAVKALGSFRSNA  283



>tpg|DAA33864.1| TPA_inf: aquaporin PIP2;4 [Gossypium hirsutum]
Length=270

 Score =   352 bits (903),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+  RAV YM++QCLGAICGVGLVKAF K  Y
Sbjct  75   FILVYCTAGISGGHINPAVTFGLFLARKVSFIRAVAYMVSQCLGAICGVGLVKAFMKHPY  134

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A+GYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  135  NSLGGGANTVASGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  194

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DKAWDEHWIFWVGPFVGALAAA+YHQYILR
Sbjct  195  VFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDEHWIFWVGPFVGALAAAIYHQYILR  254

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  255  ATAIKALGSFRSN  267



>emb|CAH60724.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score =   352 bits (904),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 186/194 (96%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM+AQCLGAICG GLVKAFQKS+Y
Sbjct  90   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMVAQCLGAICGCGLVKAFQKSYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             +YGGGAN +A+G++KGT LGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  TKYGGGANGLASGFSKGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DKAWD+HWIFWVGPF+GA  AA+YHQY+LR
Sbjct  210  VFMVHLATIPITGTGINPARSFGAAVIYNEDKAWDDHWIFWVGPFIGAAIAALYHQYVLR  269

Query  167  GSAIKALGSFRSNA  126
             +A+KALGSFRS++
Sbjct  270  AAAVKALGSFRSSS  283



>gb|AAB67868.1| plasma membrane major intrinsic protein 1 [Beta vulgaris]
Length=288

 Score =   352 bits (904),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+ YM+AQCLGAICGVG VKAFQ ++Y
Sbjct  95   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRALAYMVAQCLGAICGVGFVKAFQSAYY  154

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGAN+MA GYNKGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  155  DRYGGGANQMAHGYNKGTGLGAEIIGTFVLVYTVFAATDPKRSARDSHVPVLAPLPIGFA  214

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN++K+W+EHWIFWVGPFVGA  AA YHQYILR
Sbjct  215  VFMVHLATIPITGTGINPARSFGAAVIFNEEKSWNEHWIFWVGPFVGAAIAAFYHQYILR  274

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRS+A
Sbjct  275  AGAIKALGSFRSSA  288



>gb|AGD98714.1| aquaporin protein 11 [Camellia sinensis]
Length=287

 Score =   352 bits (904),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM+AQC GAICGVGLVKAFQ+++Y
Sbjct  94   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRALLYMVAQCSGAICGVGLVKAFQRAYY  153

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGANE+A GYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  154  DRYGGGANEVAPGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  213

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARSFGAAVI+N  KAWD+HWIFWVGPFVGA  AA YHQ+ILR
Sbjct  214  VFMVHLATIPVTGTGINPARSFGAAVIYNQKKAWDDHWIFWVGPFVGAAIAAFYHQFILR  273

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  274  AAAIKALGSFRSNA  287



>gb|ACB71281.1| plasma membrane intrinsic protein [Tamarix hispida]
Length=281

 Score =   352 bits (903),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYMIAQCLGA+CGVGLVKAF K FY
Sbjct  86   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMIAQCLGAVCGVGLVKAFMKPFY  145

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGG N +A GY KGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  146  NSQGGGTNLVAPGYTKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  205

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DK WDEHWIFWVGPFVGALAAA YHQYILR
Sbjct  206  VFMVHLATIPITGTGINPARSFGAAVIYNNDKVWDEHWIFWVGPFVGALAAAAYHQYILR  265

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  266  AAAIKALGSFRSN  278



>gb|ACB42440.1| aquaporin PIP2;3 [Gossypium hirsutum]
 gb|AIL95755.1| aquaporin [Gossypium hirsutum]
 gb|KJB15834.1| hypothetical protein B456_002G198900 [Gossypium raimondii]
Length=278

 Score =   352 bits (903),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+  RAV YM++QCLGAICGVGLVKAF K  Y
Sbjct  83   FILVYCTAGISGGHINPAVTFGLFLARKVSFIRAVAYMVSQCLGAICGVGLVKAFMKHPY  142

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A+GYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  143  NSLGGGANTVASGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  202

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DKAWDEHWIFWVGPFVGALAAA+YHQYILR
Sbjct  203  VFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDEHWIFWVGPFVGALAAAIYHQYILR  262

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  263  AAAIKALGSFRSN  275



>gb|AGD98708.1| aquaporin protein 5 [Camellia sinensis]
Length=285

 Score =   352 bits (903),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV+Y++AQCLGAICGV LVKAFQ+++Y
Sbjct  92   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVMYIVAQCLGAICGVALVKAFQRAYY  151

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGANE+A GYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  152  DRYGGGANEVAPGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  211

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARSFGAAVI+N  KAWD+HWIFWVGPFVGA+ AA YHQ+ILR
Sbjct  212  VFMVHLATIPVTGTGINPARSFGAAVIYNQKKAWDDHWIFWVGPFVGAVIAAFYHQFILR  271

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  272  AAAIKALGSFRSNA  285



>gb|AAW80918.1| putative plasma membrane intrinsic protein [Astragalus membranaceus]
Length=283

 Score =   352 bits (903),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV+YM+AQCLGAICGVG VKAFQKS+Y
Sbjct  88   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVMYMVAQCLGAICGVGFVKAFQKSYY  147

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             ++GGGANE+A GYNKGTGL AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  148  VKFGGGANELADGYNKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  207

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWD+ WIFWVGPFVGA  AA YHQ++LR
Sbjct  208  VFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFVGAAIAAFYHQFVLR  267

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  268  AAAIKALGSFRSNA  281



>ref|XP_010456647.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=285

 Score =   352 bits (903),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVT GLFLARKV+L R VLY++AQCLGAICG GLVKAFQ S+Y
Sbjct  92   FVLVYCTAGISGGHINPAVTMGLFLARKVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYY  151

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE+A GYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  152  TRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  211

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N +KAWD+ WIFWVGP +GA AAA+YHQ+ILR
Sbjct  212  VFMVHLATIPITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPMIGAAAAALYHQFILR  271

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  272  AAAIKALGSFRSNA  285



>ref|NP_001237286.1| PIP2,2 [Glycine max]
 gb|AAX86046.1| PIP2,2 [Glycine max]
Length=287

 Score =   352 bits (903),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFL RKV+L RA+LYMIAQC GAICG GL K FQKSFY
Sbjct  94   FILVYCTAGISGGHINPAVTFGLFLGRKVSLVRALLYMIAQCAGAICGAGLAKGFQKSFY  153

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGG N ++ GYNKGT LGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  154  NRYGGGVNTVSDGYNKGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  213

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFM HLATIP+TGTGINPARSFG AVIFN+DKAWD+ WI+WVGPFVGA  AA+YHQYILR
Sbjct  214  VFMAHLATIPVTGTGINPARSFGPAVIFNNDKAWDDQWIYWVGPFVGAAVAAIYHQYILR  273

Query  167  GSAIKALGSFRSNA  126
            GSAIKALGSFRSNA
Sbjct  274  GSAIKALGSFRSNA  287



>ref|XP_007016740.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
 gb|EOY34359.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
Length=289

 Score =   352 bits (903),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFL RKV+L RA++YM+AQCLGAICG GLVKAFQK++Y
Sbjct  96   FILVYCTAGISGGHINPAVTFGLFLGRKVSLIRAIMYMVAQCLGAICGCGLVKAFQKTYY  155

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N YGGGANE+  GYNKGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  156  NTYGGGANELQPGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  215

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N +KAWD+ WIFWVGPF+GA  AA YHQYILR
Sbjct  216  VFMVHLATIPITGTGINPARSFGAAVIYNREKAWDDQWIFWVGPFIGAAIAAFYHQYILR  275

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  276  AAAIKALGSFRSNA  289



>emb|CAB46351.1| major intrinsic protein 2 [Solanum tuberosum]
Length=286

 Score =   352 bits (903),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICGVG VKAFQ ++Y
Sbjct  93   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSAYY  152

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGG N MA G+ KG GL AEIIGTFVLVY VFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  153  NRYGGGVNVMAPGHTKGVGLAAEIIGTFVLVYVVFSATDPKRSARDSHVPVLAPLPIGFA  212

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN DKAWDEHWIFWVGPF+GA  AAVYHQYILR
Sbjct  213  VFMVHLATIPITGTGINPARSFGAAVIFNGDKAWDEHWIFWVGPFIGAFIAAVYHQYILR  272

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  273  AGAIKALGSFRSNA  286



>gb|AGC24024.1| plasma membrane intrinsic protein 1 [Lilium hybrid cultivar]
Length=288

 Score =   352 bits (903),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYMIAQCLGAICGVGLVK FQK+FY
Sbjct  95   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMIAQCLGAICGVGLVKGFQKAFY  154

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE++AGY+KGTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFA
Sbjct  155  VRYGGGANELSAGYSKGTGLAAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFA  214

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N  KAWD+ WIFWVGPF+GA  AA YHQYILR
Sbjct  215  VFMVHLATIPITGTGINPARSFGAAVIYNKSKAWDDQWIFWVGPFIGAAIAAGYHQYILR  274

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  275  AGAIKALGSFRSNA  288



>gb|ACX37450.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=288

 Score =   352 bits (903),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVT GLFLARKV+L RA+LYM AQCLGAICG GLVKAFQK++Y
Sbjct  93   FILVYCTAGISGGHINPAVTLGLFLARKVSLVRAILYMAAQCLGAICGCGLVKAFQKAYY  152

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGANE+A GY+KGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  153  NRYGGGANELADGYSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  212

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARSFGAAVI+N DKAWD+ WIFWVGPF+GA  AA YHQYILR
Sbjct  213  VFMVHLATIPVTGTGINPARSFGAAVIYNQDKAWDDQWIFWVGPFIGAAIAAFYHQYILR  272

Query  167  GSAIKALGSFRSNA  126
             +A+KALGSFRS +
Sbjct  273  AAAVKALGSFRSTS  286



>gb|ACU21481.1| unknown [Glycine max]
Length=287

 Score =   352 bits (903),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFL RKV+L RA+LYMIAQC GAICG GL K FQKSFY
Sbjct  94   FILVYCTAGISGGHINPAVTFGLFLGRKVSLVRALLYMIAQCAGAICGAGLAKGFQKSFY  153

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGG N ++ GYNK T LGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  154  NRYGGGVNTVSDGYNKSTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  213

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARSFG AVIFN+DKAWD+ WI+WVGPFVGA  AA+YHQYILR
Sbjct  214  VFMVHLATIPVTGTGINPARSFGPAVIFNNDKAWDDQWIYWVGPFVGAAVAAIYHQYILR  273

Query  167  GSAIKALGSFRSNA  126
            GSAIKALGSFRSNA
Sbjct  274  GSAIKALGSFRSNA  287



>ref|XP_010266854.1| PREDICTED: probable aquaporin PIP2-8 [Nelumbo nucifera]
Length=280

 Score =   352 bits (902),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM+AQCLGAICGVGLVKAF K  Y
Sbjct  85   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHSY  144

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGAN ++AGY+KGT LGAEIIGTF+LVYTVFSATDPKR  RDSHVPVLAPLPIGFA
Sbjct  145  NRYGGGANSVSAGYSKGTALGAEIIGTFLLVYTVFSATDPKRKTRDSHVPVLAPLPIGFA  204

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWD+HWIFWVGPF+GALAAA YHQYILR
Sbjct  205  VFMVHLATIPITGTGINPARSFGAAVIYNGDKAWDDHWIFWVGPFIGALAAAAYHQYILR  264

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  265  AAAIKALGSFRSN  277



>gb|KHN32779.1| Aquaporin PIP2-2 [Glycine soja]
Length=239

 Score =   350 bits (897),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+AQCLGAICGVGLVKAFQK++Y
Sbjct  44   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFQKAYY  103

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGANE++ GY+ G GLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  104  NRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  163

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAV++N  KAWD+HWIFWVGPF+GA  AA YHQ+ILR
Sbjct  164  VFMVHLATIPVTGTGINPARSLGAAVMYNQQKAWDDHWIFWVGPFIGAAIAAFYHQFILR  223

Query  167  GSAIKALGSFRSN  129
             SA KALGSFRSN
Sbjct  224  ASAAKALGSFRSN  236



>ref|NP_001275065.1| major intrinsic protein 2 [Solanum tuberosum]
 gb|ABB29939.1| major intrinsic protein 2-like [Solanum tuberosum]
 emb|CBI99236.1| major intrinsic protein 2 [Solanum tuberosum]
Length=287

 Score =   352 bits (902),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICGVG VKAFQ ++Y
Sbjct  94   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSAYY  153

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGG N MA G+ KG GL AEIIGTFVLVY VFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  154  NRYGGGVNVMAPGHTKGVGLAAEIIGTFVLVYVVFSATDPKRSARDSHVPVLAPLPIGFA  213

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN DKAWDEHWIFWVGPF+GA  AAVYHQYILR
Sbjct  214  VFMVHLATIPITGTGINPARSFGAAVIFNGDKAWDEHWIFWVGPFIGAFIAAVYHQYILR  273

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  274  AGAIKALGSFRSNA  287



>ref|NP_001234625.1| aquaporin [Solanum lycopersicum]
 gb|ADU34070.1| aquaporin [Solanum lycopersicum]
 dbj|BAO18627.1| plasmamembrane intrinsic protein 2;4 [Solanum lycopersicum]
Length=280

 Score =   351 bits (901),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICGVG VKAFQ ++Y
Sbjct  87   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSAYY  146

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGG N MA G++KG GLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  147  NRYGGGVNVMAGGHSKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  206

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARSFGAAVIFN DKAWDEHWIFWVGPF+GA  AA YHQ++LR
Sbjct  207  VFMVHLATIPVTGTGINPARSFGAAVIFNGDKAWDEHWIFWVGPFIGAFIAAFYHQFVLR  266

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRS A
Sbjct  267  AGAIKALGSFRSTA  280



>gb|ACU87556.1| PIP protein [Gossypium hirsutum]
Length=278

 Score =   351 bits (901),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM+AQCLGAICGVGLVKAF KS Y
Sbjct  83   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKSEY  142

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGG N +A GYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  143  NSLGGGVNTVATGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  202

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DKAWD+HWIFWVGP VGALAAA YHQYILR
Sbjct  203  VFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPMVGALAAAAYHQYILR  262

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  263  AAAIKALGSFRSN  275



>gb|AAF71820.1|AF141900_1 putative aquaporin PIP2-2 [Vitis cinerea var. helleri x Vitis 
rupestris]
Length=279

 Score =   351 bits (901),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGI+GGHINPAVTFGLFLARKV+L RA+ YM+AQCLGAICGVGLVKAF KSFY
Sbjct  84   FILVYCTAGIAGGHINPAVTFGLFLARKVSLIRALAYMVAQCLGAICGVGLVKAFMKSFY  143

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +AAGYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  144  NSLGGGANSVAAGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  203

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N++K WD+ WIFWVGPFVGALAAA YHQYILR
Sbjct  204  VFMVHLATIPITGTGINPARSFGAAVIYNNEKVWDDQWIFWVGPFVGALAAAAYHQYILR  263

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  264  AAAIKALGSFRSN  276



>ref|XP_010526891.1| PREDICTED: probable aquaporin PIP2-8 [Tarenaya hassleriana]
Length=281

 Score =   351 bits (901),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM+AQCLGAICGVGLVKAF KS Y
Sbjct  86   FILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVAYMVAQCLGAICGVGLVKAFMKSPY  145

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NR GGGAN +A GYN GT LGAEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLPIGFA
Sbjct  146  NRLGGGANTVADGYNTGTALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFA  205

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N++KAWD+HWIFWVGPFVGALAAA YHQYILR
Sbjct  206  VFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILR  265

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  266  AAAIKALGSFRSN  278



>ref|XP_010548112.1| PREDICTED: probable aquaporin PIP2-8 [Tarenaya hassleriana]
Length=281

 Score =   351 bits (900),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM+AQCLGAICGVGLVKAF K+ Y
Sbjct  86   FILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVAYMVAQCLGAICGVGLVKAFMKNPY  145

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NR GGGAN +A GYN GT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  146  NRLGGGANTVADGYNTGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  205

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DKAWD+HWIFWVGPFVGALAAA YHQYILR
Sbjct  206  VFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILR  265

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  266  AAAIKALGSFRSN  278



>gb|KHG29841.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=291

 Score =   351 bits (901),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLF+ RKV+L RA+LYM+AQCLGAICG GLVKAFQK++Y
Sbjct  98   FILVYCTAGISGGHINPAVTFGLFVGRKVSLIRALLYMVAQCLGAICGCGLVKAFQKTYY  157

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N YGGGANE+  G+NKGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  158  NSYGGGANELQDGFNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  217

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N +KAWD+ WIFWVGPF+GA  AA YHQYILR
Sbjct  218  VFMVHLATIPITGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPFIGAFVAAFYHQYILR  277

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  278  AAAIKALGSFRSNA  291



>ref|XP_006422584.1| hypothetical protein CICLE_v10029003mg [Citrus clementina]
 ref|XP_006486723.1| PREDICTED: aquaporin PIP2-7-like [Citrus sinensis]
 gb|ESR35824.1| hypothetical protein CICLE_v10029003mg [Citrus clementina]
 gb|KDO68090.1| hypothetical protein CISIN_1g023370mg [Citrus sinensis]
Length=283

 Score =   351 bits (900),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM+AQCLGAICGVGLVKAF K  Y
Sbjct  88   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEY  147

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A+GYNKG+ LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  148  NSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  207

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DKAWD+HWIFWVGPFVGALAAA YHQYILR
Sbjct  208  VFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILR  267

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  268  AAAIKALGSFRSN  280



>gb|AEY75244.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=281

 Score =   351 bits (900),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVY TAGISGGHINPAVTFGLFLARKV+L RAVLY+IAQCLGAICGVGLVKAFQKS+Y
Sbjct  88   FVLVYYTAGISGGHINPAVTFGLFLARKVSLIRAVLYIIAQCLGAICGVGLVKAFQKSYY  147

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             ++GGGANE++AGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  148  VKFGGGANELSAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  207

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VF+VHLATIPITGTGINPARSFGAAVI+N DKAWD+ WIFW+GPF+GA  AA YHQYILR
Sbjct  208  VFIVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILR  267

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  268  AGAIKALGSFRSNA  281



>ref|XP_007143702.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
 gb|AGV54658.1| aquaporin PIP2 [Phaseolus vulgaris]
 gb|ESW15696.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
Length=287

 Score =   351 bits (900),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+AQCLGAICGVGLVKAFQKS+Y
Sbjct  92   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFQKSYY  151

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGAN +A GY+ GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  152  NRYGGGANSLADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  211

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAVI+N DK WD+HWIFWVGPF+GA  AA YHQ+ILR
Sbjct  212  VFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPFIGAAIAAFYHQFILR  271

Query  167  GSAIKALGSFRSN  129
              A+KALGSFRSN
Sbjct  272  AGAVKALGSFRSN  284



>ref|XP_010483715.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   351 bits (900),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVT GLFLARKV+L R VLY++AQCLGAICG GLVKAFQ S+Y
Sbjct  93   FVLVYCTAGISGGHINPAVTMGLFLARKVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYY  152

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE+A GYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  153  TRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  212

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N +KAWD+ WIFWVGP +GA AAA+YHQ+ILR
Sbjct  213  VFMVHLATIPITGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAAALYHQFILR  272

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRS+A
Sbjct  273  AAAIKALGSFRSSA  286



>ref|NP_001059545.1| Os07g0448800 [Oryza sativa Japonica Group]
 sp|Q8H5N9.1|PIP21_ORYSJ RecName: Full=Probable aquaporin PIP2-1; AltName: Full=OsPIP2;1; 
AltName: Full=Plasma membrane intrinsic protein 2-1; AltName: 
Full=Plasma membrane intrinsic protein 2a; Short=PIP2a 
[Oryza sativa Japonica Group]
 dbj|BAC15868.1| plasma membrane intrinsic protein [Oryza sativa Japonica Group]
 dbj|BAF21459.1| Os07g0448800 [Oryza sativa Japonica Group]
 gb|EAZ03715.1| hypothetical protein OsI_25848 [Oryza sativa Indica Group]
 dbj|BAG96349.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93010.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99732.1| unnamed protein product [Oryza sativa Japonica Group]
Length=290

 Score =   351 bits (900),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LY++AQCLGAICGVGLVKAFQ +++
Sbjct  97   FILVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYIVAQCLGAICGVGLVKAFQSAYF  156

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGAN +AAGY+KGTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  157  NRYGGGANTLAAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  216

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVIFN++KAW  HWIFWVGPFVGA  AA YHQYILR
Sbjct  217  VFMVHLATIPITGTGINPARSIGAAVIFNNEKAWHNHWIFWVGPFVGAAIAAFYHQYILR  276

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  277  AGAIKALGSFRSNA  290



>ref|XP_010043748.1| PREDICTED: probable aquaporin PIP2-4 [Eucalyptus grandis]
 gb|KCW85737.1| hypothetical protein EUGRSUZ_B02499 [Eucalyptus grandis]
Length=284

 Score =   350 bits (899),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV+YM+AQCLGAICG GLVKAFQ+++Y
Sbjct  91   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQRAYY  150

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE+A GY+KG GLGAEI+GTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  151  TRYGGGANELADGYSKGVGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  210

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWD+ W+FWVGPF+GA  AA YHQYILR
Sbjct  211  VFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWMFWVGPFIGAAIAAFYHQYILR  270

Query  167  GSAIKALGSFRSNA  126
              A+KALGSFRSNA
Sbjct  271  AGAVKALGSFRSNA  284



>ref|XP_011092966.1| PREDICTED: aquaporin PIP2-7 [Sesamum indicum]
Length=283

 Score =   350 bits (899),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+ YMIAQCLGAICGVGLVKAF KS+Y
Sbjct  88   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRALGYMIAQCLGAICGVGLVKAFMKSYY  147

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A GYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  148  NGLGGGANSVAPGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  207

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DK WD+HWIFWVGPFVGALAAA YHQYILR
Sbjct  208  VFMVHLATIPITGTGINPARSFGAAVIYNNDKVWDDHWIFWVGPFVGALAAAAYHQYILR  267

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  268  AAAIKALGSFRSN  280



>gb|ACB42441.1| aquaporin PIP2;4 [Gossypium hirsutum]
 gb|KHG19165.1| Aquaporin PIP2-7 -like protein [Gossypium arboreum]
Length=278

 Score =   350 bits (898),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM++QCLGAICGVGLVKAF K  Y
Sbjct  83   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVSQCLGAICGVGLVKAFMKHPY  142

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A+GYN GT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  143  NSLGGGANTVASGYNNGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  202

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DKAWD+HWIFWVGPFVGALAAA+YHQYILR
Sbjct  203  VFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAIYHQYILR  262

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  263  AAAIKALGSFRSN  275



>gb|EAZ39662.1| hypothetical protein OsJ_24090 [Oryza sativa Japonica Group]
Length=290

 Score =   351 bits (900),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LY++AQCLGAICGVGLVKAFQ +++
Sbjct  97   FILVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYIVAQCLGAICGVGLVKAFQSAYF  156

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGAN +AAGY+KGTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  157  NRYGGGANTLAAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  216

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVIFN++KAW  HWIFWVGPFVGA  AA YHQYILR
Sbjct  217  VFMVHLATIPITGTGINPARSIGAAVIFNNEKAWHNHWIFWVGPFVGAAIAAFYHQYILR  276

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  277  AGAIKALGSFRSNA  290



>gb|KHG00060.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=289

 Score =   350 bits (899),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLF+ RKV+L RA++YM+AQCLGAICG GLVKAFQK++Y
Sbjct  96   FILVYCTAGISGGHINPAVTFGLFVGRKVSLIRALMYMVAQCLGAICGCGLVKAFQKTYY  155

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N YGGGANE+  G+NKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFA
Sbjct  156  NNYGGGANELQPGFNKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFA  215

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARSFGAAVI+N +KAWD+ WIFWVGPF+GA AAA YHQYILR
Sbjct  216  VFMVHLATIPVTGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAAAAFYHQYILR  275

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  276  AAAIKALGSFRSNA  289



>gb|KJB56128.1| hypothetical protein B456_009G107200 [Gossypium raimondii]
Length=289

 Score =   350 bits (899),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLF+ RKV+L RA++YM+AQCLGAICG GLVKAFQK++Y
Sbjct  96   FILVYCTAGISGGHINPAVTFGLFVGRKVSLIRALMYMVAQCLGAICGCGLVKAFQKTYY  155

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N YGGGANE+  G+NKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFA
Sbjct  156  NNYGGGANELQPGFNKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFA  215

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARSFGAAVI+N +KAWD+ WIFWVGPF+GA AAA YHQYILR
Sbjct  216  VFMVHLATIPVTGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAAAAFYHQYILR  275

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  276  AAAIKALGSFRSNA  289



>emb|CBI31462.3| unnamed protein product [Vitis vinifera]
Length=198

 Score =   347 bits (890),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM+AQCLGAICGVGLVKAFQ ++Y
Sbjct  3    FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAILYMVAQCLGAICGVGLVKAFQSAYY  62

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGANE++ GY+KGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  63   DRYGGGANELSTGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  122

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVI+N++KAWD+ WIFWVGPF+GA  AA YHQ+ILR
Sbjct  123  VFMVHLATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILR  182

Query  167  GSAIKALGSFRSN  129
              A+KALGSFRS 
Sbjct  183  AGAVKALGSFRST  195



>gb|ACU87555.1| PIP protein [Gossypium hirsutum]
Length=278

 Score =   350 bits (898),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM+AQCLGAICGVGLVKAF KS Y
Sbjct  83   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKSEY  142

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A GYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  143  NSLGGGANTVATGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  202

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DKAWD+ WIFWVGP VGALAAA YHQYILR
Sbjct  203  VFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDQWIFWVGPMVGALAAAAYHQYILR  262

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  263  AAAIKALGSFRSN  275



>gb|EYU42155.1| hypothetical protein MIMGU_mgv1a011301mg [Erythranthe guttata]
Length=286

 Score =   350 bits (898),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFL RKV+L RAVLYM+AQCLGAICGVGLVKAFQKS+Y
Sbjct  93   FILVYCTAGISGGHINPAVTFGLFLGRKVSLIRAVLYMVAQCLGAICGVGLVKAFQKSYY  152

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGAN +A GYN G GLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  153  VRYGGGANTLAHGYNTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  212

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN+DKAWD+ WIFWVGPFVGA  AA YHQ+ILR
Sbjct  213  VFMVHLATIPITGTGINPARSFGAAVIFNNDKAWDDQWIFWVGPFVGAAIAAFYHQFILR  272

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRS+A
Sbjct  273  AAAIKALGSFRSHA  286



>emb|CAA04654.1| major intrinsic protein PIPC [Craterostigma plantagineum]
Length=198

 Score =   347 bits (890),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV YMIAQCLGAICGVGLVKAF  + Y
Sbjct  3    FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVSYMIAQCLGAICGVGLVKAFMHNPY  62

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NR GGGAN +A GYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  63   NRLGGGANTVAPGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  122

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN+ KAWD+HWIFWVGPF+GALAAA+YHQYILR
Sbjct  123  VFMVHLATIPITGTGINPARSFGAAVIFNNGKAWDDHWIFWVGPFLGALAAAIYHQYILR  182

Query  167  GSAIKALGSFRSN  129
              A KALGSFRSN
Sbjct  183  AQAAKALGSFRSN  195



>ref|XP_010443868.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   350 bits (898),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVT GLFLARKV+L R VLY++AQCLGAICG GLVKAFQ S+Y
Sbjct  93   FVLVYCTAGISGGHINPAVTMGLFLARKVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYY  152

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE+A GYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  153  TRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  212

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N +KAWD+ WIFWVGP +GA AAA+YHQ+ILR
Sbjct  213  VFMVHLATIPITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPMIGAAAAALYHQFILR  272

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRS+A
Sbjct  273  AAAIKALGSFRSSA  286



>gb|KJB20285.1| hypothetical protein B456_003G141600 [Gossypium raimondii]
Length=320

 Score =   351 bits (901),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLF+ RKV+L RA+LYM+AQCLGAICG GLVKAFQK++Y
Sbjct  127  FILVYCTAGISGGHINPAVTFGLFVGRKVSLIRALLYMVAQCLGAICGCGLVKAFQKTYY  186

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N YGGGANE+  G+NKGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  187  NSYGGGANELQDGFNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  246

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N +KAWD+ WIFWVGPF+GA  AA YHQYILR
Sbjct  247  VFMVHLATIPITGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPFIGAFVAAFYHQYILR  306

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  307  AAAIKALGSFRSNA  320



>ref|XP_010253676.1| PREDICTED: aquaporin PIP2-4-like [Nelumbo nucifera]
Length=287

 Score =   350 bits (897),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV+Y+IAQCLGAICGVGLVK FQKS+Y
Sbjct  92   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVMYIIAQCLGAICGVGLVKGFQKSYY  151

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE+A GY+KG GL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  152  VRYGGGANELADGYSKGVGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  211

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVIFN DKAW +HWIFWVGPF+GA  AA YHQYILR
Sbjct  212  VFMVHLATIPITGTGINPARSLGAAVIFNKDKAWHDHWIFWVGPFIGAAIAAFYHQYILR  271

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  272  AAAIKALGSFRSN  284



>ref|XP_002461930.1| hypothetical protein SORBIDRAFT_02g010760 [Sorghum bicolor]
 gb|EER98451.1| hypothetical protein SORBIDRAFT_02g010760 [Sorghum bicolor]
Length=290

 Score =   350 bits (897),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+LY++AQCLGAICGVGLVKAFQ +++
Sbjct  97   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGLVKAFQSAYF  156

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGAN +A+GY++GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  157  DRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  216

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAVI+N DK WD+HWIFWVGPFVGA  AA YHQYILR
Sbjct  217  VFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPFVGAAIAAFYHQYILR  276

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  277  AGAIKALGSFRSNA  290



>ref|XP_007041804.1| Plasma membrane intrinsic protein 2,8 isoform 1 [Theobroma cacao]
 gb|EOX97635.1| Plasma membrane intrinsic protein 2,8 isoform 1 [Theobroma cacao]
Length=278

 Score =   349 bits (896),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM+AQCLGAICGVGLVKAF K  Y
Sbjct  83   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHDY  142

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A+GYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  143  NSQGGGANTVASGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  202

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVI+N++KAWD+HWIFWVGPFVGALAAA YHQYILR
Sbjct  203  VFMVHLATIPITGTGINPARSIGAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILR  262

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  263  AAAIKALGSFRSN  275



>ref|NP_001289999.1| aquaporin PIP2-1 [Beta vulgaris subsp. vulgaris]
 gb|ACT22630.1| plasma membrane intrinsic protein PIP2;2 [Beta vulgaris subsp. 
vulgaris]
Length=288

 Score =   350 bits (897),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVT GLFLARKV+L RA+ YM+AQCLGAICGVG VKAFQ ++Y
Sbjct  95   FILVYCTAGISGGHINPAVTIGLFLARKVSLIRALAYMVAQCLGAICGVGFVKAFQSAYY  154

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGAN+M+ GYNKGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  155  DRYGGGANQMSHGYNKGTGLGAEIIGTFVLVYTVFAATDPKRSARDSHVPVLAPLPIGFA  214

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN++K+W+EHWIFWVGPFVGA  AA YHQYILR
Sbjct  215  VFMVHLATIPITGTGINPARSFGAAVIFNEEKSWNEHWIFWVGPFVGAAIAAFYHQYILR  274

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRS+A
Sbjct  275  AGAIKALGSFRSSA  288



>gb|AAC32107.1| probable aquaporin [Picea mariana]
Length=282

 Score =   349 bits (896),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+LPRAVLYM+AQCLGAICG GLVKAFQKS+Y
Sbjct  87   FVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVLYMVAQCLGAICGCGLVKAFQKSYY  146

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            ++YGGGAN +A GY KG GL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  147  DQYGGGANSVAHGYTKGVGLSAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  206

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+   K WDEHWIFWVGPF+GA  AA YHQYILR
Sbjct  207  VFMVHLATIPITGTGINPARSFGAAVIYGHQKIWDEHWIFWVGPFLGAAGAAAYHQYILR  266

Query  167  GSAIKALGSFRSN  129
              AIKALGSFRSN
Sbjct  267  AGAIKALGSFRSN  279



>gb|KJB26182.1| hypothetical protein B456_004G229000 [Gossypium raimondii]
Length=282

 Score =   349 bits (896),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFL RKV+L RAV+YM+AQCLGAICG GLVK FQKS+Y
Sbjct  89   FILVYCTAGISGGHINPAVTFGLFLGRKVSLVRAVMYMVAQCLGAICGCGLVKWFQKSYY  148

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N YGGGANE+  G+NKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  149  NTYGGGANELQDGFNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  208

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWD+ W+FWVGPF+GA  AA YHQYILR
Sbjct  209  VFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWMFWVGPFIGAAIAANYHQYILR  268

Query  167  GSAIKALGSFRSNA  126
              A+KALGSFRSNA
Sbjct  269  AGAMKALGSFRSNA  282



>ref|XP_007027328.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
 gb|EOY07830.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
Length=283

 Score =   349 bits (896),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM AQCLGAICG GLVKAFQKS+Y
Sbjct  88   FILVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMAAQCLGAICGCGLVKAFQKSYY  147

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGAN +A GY+ GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  148  NRYGGGANSLADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  207

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAV++N DK WD+ WIFWVGPF+GA  AA+YHQYILR
Sbjct  208  VFMVHLATIPITGTGINPARSFGAAVMYNQDKPWDDQWIFWVGPFIGAAIAAIYHQYILR  267

Query  167  GSAIKALGSFRSNA  126
             +A KALGSFRS++
Sbjct  268  AAAAKALGSFRSSS  281



>ref|XP_003548071.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   349 bits (896),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+AQCLGAICGVGLVKAFQK++Y
Sbjct  90   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFQKAYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGANE++ GY+ G GLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  NRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAV++N  KAWD+HWIFWVGPF+GA  AA YHQ+ILR
Sbjct  210  VFMVHLATIPVTGTGINPARSLGAAVMYNQQKAWDDHWIFWVGPFIGAAIAAFYHQFILR  269

Query  167  GSAIKALGSFRSN  129
             SA KALGSFRSN
Sbjct  270  ASAAKALGSFRSN  282



>ref|XP_002306187.1| membrane intrinsic family protein [Populus trichocarpa]
 gb|ABK95359.1| unknown [Populus trichocarpa]
 gb|EEE86698.1| membrane intrinsic family protein [Populus trichocarpa]
Length=279

 Score =   349 bits (895),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM+AQCLGAICGVGLVKAF K  Y
Sbjct  84   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKKNY  143

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A GYN GT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  144  NSLGGGANTVAMGYNTGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  203

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN++KAWD+HWIFWVGPFVGALAAA YHQYILR
Sbjct  204  VFMVHLATIPITGTGINPARSFGAAVIFNNEKAWDDHWIFWVGPFVGALAAAAYHQYILR  263

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  264  AAAIKALGSFRSN  276



>ref|XP_010098191.1| Aquaporin PIP2-7 [Morus notabilis]
 gb|EXB74647.1| Aquaporin PIP2-7 [Morus notabilis]
Length=281

 Score =   349 bits (895),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAVLY++AQCLGAICG GLVKAFQ S+Y
Sbjct  88   FILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYIVAQCLGAICGTGLVKAFQSSYY  147

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NR+GGGAN +A  YNKG GLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  148  NRHGGGANTLADHYNKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  207

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DKAWD+ WIFWVGPF+GA  AA YHQYILR
Sbjct  208  VFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDQWIFWVGPFIGAAIAAFYHQYILR  267

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRS A
Sbjct  268  AGAIKALGSFRSTA  281



>ref|XP_011046666.1| PREDICTED: probable aquaporin PIP2-8 [Populus euphratica]
Length=279

 Score =   349 bits (895),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM+AQCLGAICGVGLVKAF K  Y
Sbjct  84   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKKNY  143

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A GYN GT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  144  NSLGGGANTVAMGYNTGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  203

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN++KAWD+HWIFWVGPFVGALAAA YHQYILR
Sbjct  204  VFMVHLATIPITGTGINPARSFGAAVIFNNEKAWDDHWIFWVGPFVGALAAAAYHQYILR  263

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  264  AAAIKALGSFRSN  276



>ref|XP_009614931.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
 tpg|DAA64676.1| TPA_exp: aquaporin PIP2 3b [Nicotiana tabacum]
Length=285

 Score =   349 bits (895),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARK++L RAV+YMIAQCLGAICG GLVKAFQKS+Y
Sbjct  92   FVLVYCTAGISGGHINPAVTFGLFLARKISLARAVMYMIAQCLGAICGCGLVKAFQKSYY  151

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE+A GY+ GTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  152  VRYGGGANELATGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  211

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+  DKAWD+ WIFWVGP +GA  AA+YHQYILR
Sbjct  212  VFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPLIGAAIAALYHQYILR  271

Query  167  GSAIKALGSFRSNA  126
              A+KALGSFRSNA
Sbjct  272  AGAVKALGSFRSNA  285



>gb|ABK60195.2| PIP2 protein [Gossypium hirsutum]
Length=285

 Score =   349 bits (895),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM AQCLGAICG GLVKAFQKS+Y
Sbjct  90   FILVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMAAQCLGAICGCGLVKAFQKSYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N+YGGGAN +A GY+ GTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  NKYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAV+FN DK WD+HWIFWVGPF+GA  AA+YHQYILR
Sbjct  210  VFMVHLATIPITGTGINPARSFGAAVMFNQDKPWDDHWIFWVGPFIGAAIAAIYHQYILR  269

Query  167  GSAIKALGSFRSNA  126
              A KALGSFRS++
Sbjct  270  AGAAKALGSFRSSS  283



>gb|AHK05706.1| plasma membrane intrinsic protein PIP2;3 [Hevea brasiliensis]
Length=285

 Score =   349 bits (895),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV+YM+AQCLGAI GVGLVKAFQ SFY
Sbjct  90   FILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAIAGVGLVKAFQSSFY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGAN +AAGY+KG GLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  KRYGGGANSLAAGYSKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVI+N DK WD+HWIFWVGPF+GA  AA YHQ+ILR
Sbjct  210  VFMVHLATIPITGTGINPARSLGAAVIYNQDKPWDDHWIFWVGPFIGAAIAAFYHQFILR  269

Query  167  GSAIKALGSFRSN  129
              A+KALGSFRSN
Sbjct  270  AGAVKALGSFRSN  282



>gb|KJB12139.1| hypothetical protein B456_002G002500 [Gossypium raimondii]
Length=278

 Score =   348 bits (894),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM+AQCLGAICGVGLVKAF KS Y
Sbjct  83   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKSEY  142

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGG N +A GYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  143  NSLGGGVNTVATGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  202

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DKAWD+ WIFWVGP VGALAAA YHQYILR
Sbjct  203  VFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDQWIFWVGPMVGALAAAAYHQYILR  262

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  263  AAAIKALGSFRSN  275



>gb|AIK66515.1| putative aquaporin [Vitis vinifera]
Length=284

 Score =   349 bits (895),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM+AQCLGAICGVGLVKAFQ ++Y
Sbjct  89   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAILYMVAQCLGAICGVGLVKAFQSAYY  148

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGANE+A GY+KGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLPIGFA
Sbjct  149  NRYGGGANELATGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFA  208

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVI+N++KAWD+ WIFWVGPF+GA  AA YHQ+ILR
Sbjct  209  VFMVHLATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILR  268

Query  167  GSAIKALGSFRSN  129
              AIKALGSFRS 
Sbjct  269  AGAIKALGSFRST  281



>gb|ABK22173.1| unknown [Picea sitchensis]
Length=282

 Score =   348 bits (894),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+LPRAVLYM+AQCLGAICG GLVKAFQKS+Y
Sbjct  87   FVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVLYMVAQCLGAICGCGLVKAFQKSYY  146

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            ++YGGGAN +A GY KG GL AEIIGTFVLVYTVFSATDPKRNARDSH+PVLAPLPIGFA
Sbjct  147  DQYGGGANSVAHGYTKGVGLSAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFA  206

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+   K WDEHWIFWVGPF+GA  AA YHQYILR
Sbjct  207  VFMVHLATIPITGTGINPARSFGAAVIYGHQKIWDEHWIFWVGPFLGAAGAAAYHQYILR  266

Query  167  GSAIKALGSFRSN  129
              AIKALGSFRSN
Sbjct  267  AGAIKALGSFRSN  279



>ref|XP_003536353.1| PREDICTED: aquaporin PIP2-1-like isoform 1 [Glycine max]
 gb|KHN17135.1| Aquaporin PIP2-2 [Glycine soja]
Length=287

 Score =   349 bits (895),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+AQCLGAICGVGLVKAFQKS++
Sbjct  92   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFQKSYF  151

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N+YGGGAN +AAGY+ GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  152  NKYGGGANSLAAGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  211

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAVI+N DK WD+HWIFWVGPF+GA  AA YHQ+ILR
Sbjct  212  VFMVHLATIPVTGTGINPARSLGAAVIYNQDKPWDDHWIFWVGPFIGAAIAAFYHQFILR  271

Query  167  GSAIKALGSFRSN  129
              A KALGSFRSN
Sbjct  272  AGAAKALGSFRSN  284



>gb|ACR56613.1| plasma intrinsic protein 2;3 [Juglans regia]
Length=284

 Score =   348 bits (894),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICGVGLVK FQK+ Y
Sbjct  91   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGLVKGFQKTHY  150

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N+ GGGANE+A GYNKG GLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  151  NQNGGGANELAPGYNKGVGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  210

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWD+ WIFWVGPF+GA  AA YHQ+ILR
Sbjct  211  VFMVHLATIPITGTGINPARSFGAAVIYNQDKAWDDQWIFWVGPFIGAAIAAFYHQFILR  270

Query  167  GSAIKALGSFRSNA  126
               +KALGSFRSNA
Sbjct  271  AEPLKALGSFRSNA  284



>ref|XP_003625627.1| Aquaporin PIP2-1 [Medicago truncatula]
 gb|ABD32807.1| Major intrinsic protein [Medicago truncatula]
 gb|AES81845.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score =   348 bits (894),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICGVGLVKAFQK +Y
Sbjct  92   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGLVKAFQKGYY  151

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRY GGAN ++AGY+KGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  152  NRYKGGANMLSAGYSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  211

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N++KAWD+ WIFWVGPF+GA  AA+YHQ++LR
Sbjct  212  VFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAIYHQFVLR  271

Query  167  GSAIKALGSFRSNA  126
              A KALGSFRS++
Sbjct  272  AQAAKALGSFRSSS  285



>ref|XP_006400824.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
 gb|ESQ42277.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
Length=285

 Score =   348 bits (894),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAG+SGGHINPAVTFGLFLARKV+L R VLY++AQCLGAICG G VKAFQ S+Y
Sbjct  92   FVLVYCTAGVSGGHINPAVTFGLFLARKVSLVRTVLYIVAQCLGAICGCGFVKAFQSSYY  151

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE+A GYNKGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLPIGFA
Sbjct  152  TRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFA  211

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N +KAWD+ WIFWVGP +GA AAA+YHQ++LR
Sbjct  212  VFMVHLATIPITGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAAALYHQFVLR  271

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRS+A
Sbjct  272  AAAIKALGSFRSSA  285



>ref|XP_008463943.1| PREDICTED: aquaporin PIP2-7 [Cucumis melo]
Length=283

 Score =   348 bits (893),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQC GAICG GLVKAFQ ++Y
Sbjct  90   FILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYMLAQCAGAICGCGLVKAFQSAYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RY GGAN ++ GYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  VRYNGGANMLSDGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN +KAWD+ WIFWVGPF+GA  AA+YHQY+LR
Sbjct  210  VFMVHLATIPITGTGINPARSFGAAVIFNKEKAWDDQWIFWVGPFIGAAIAAIYHQYVLR  269

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  270  AGAIKALGSFRSNA  283



>gb|ABK24156.1| unknown [Picea sitchensis]
Length=282

 Score =   348 bits (893),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+LPRAVLYM+AQCLGAICG GLVKAFQKS+Y
Sbjct  87   FVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVLYMVAQCLGAICGCGLVKAFQKSYY  146

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            ++YGGGAN +A GY KG GL +EIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  147  DQYGGGANSVAHGYTKGVGLSSEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  206

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+   K WDEHWIFWVGPF+GA  AA YHQYILR
Sbjct  207  VFMVHLATIPITGTGINPARSFGAAVIYGHQKIWDEHWIFWVGPFLGAAGAAAYHQYILR  266

Query  167  GSAIKALGSFRSN  129
              AIKALGSFRSN
Sbjct  267  AGAIKALGSFRSN  279



>emb|CAH60721.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=279

 Score =   348 bits (892),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM+AQCLGAICGVGLVKAF K  Y
Sbjct  84   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKKKY  143

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A GYN GT LGAEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLPIGFA
Sbjct  144  NSLGGGANTVAMGYNTGTALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFA  203

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN++KAWD+HWIFWVGPFVGALAAA YHQYILR
Sbjct  204  VFMVHLATIPITGTGINPARSFGAAVIFNNEKAWDDHWIFWVGPFVGALAAAAYHQYILR  263

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  264  AAAIKALGSFRSN  276



>ref|XP_010264685.1| PREDICTED: aquaporin PIP2-1-like [Nelumbo nucifera]
Length=287

 Score =   348 bits (893),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV+YM+AQCLGAICGVGLVK FQK++Y
Sbjct  92   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVMYMVAQCLGAICGVGLVKGFQKAYY  151

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             R GGGAN +A GY+KG GLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  152  MRSGGGANSLALGYSKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  211

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVI+N DKAWD+HWIFWVGPF GA  AA+YHQYILR
Sbjct  212  VFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDHWIFWVGPFTGAALAALYHQYILR  271

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  272  AAAIKALGSFRSN  284



>gb|ABH09326.1| putative aquaporin [Vitis vinifera]
Length=284

 Score =   348 bits (892),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM+AQCLGAICGVGLVKAFQ ++Y
Sbjct  89   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAILYMVAQCLGAICGVGLVKAFQSAYY  148

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGANE++ GY+KGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  149  DRYGGGANELSTGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  208

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVI+N++KAWD+ WIFWVGPF+GA  AA YHQ+ILR
Sbjct  209  VFMVHLATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILR  268

Query  167  GSAIKALGSFRSNA  126
              A+KALGSFRS A
Sbjct  269  AGAVKALGSFRSTA  282



>gb|ACU20229.1| unknown [Glycine max]
Length=285

 Score =   348 bits (892),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+AQCLGAICGVGLVKAFQK++Y
Sbjct  90   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFQKAYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGANE++ GY+ G GLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  NRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAV++N  KAWD+HWIFWVGPF+GA  AA YHQ+ILR
Sbjct  210  VFMVHLATIPVTGTGINPARSLGAAVVYNQQKAWDDHWIFWVGPFIGAAIAAFYHQFILR  269

Query  167  GSAIKALGSFRSN  129
              A KALGSFRSN
Sbjct  270  AGAAKALGSFRSN  282



>gb|KHG30776.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   348 bits (892),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM AQCLGAICG GLVKAFQKS+Y
Sbjct  90   FILVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMAAQCLGAICGCGLVKAFQKSYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N+YGGGAN +A GY+ GTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  NKYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAV+FN DK WD+HWIFWVGPF+GA  AA+YH+YILR
Sbjct  210  VFMVHLATIPITGTGINPARSFGAAVMFNQDKPWDDHWIFWVGPFIGAAIAAIYHEYILR  269

Query  167  GSAIKALGSFRSNA  126
              A KALGSFRS++
Sbjct  270  AGAAKALGSFRSSS  283



>ref|XP_009355655.1| PREDICTED: probable aquaporin PIP2-8 [Pyrus x bretschneideri]
Length=281

 Score =   347 bits (891),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM+AQCLGAI GVGLVKAFQK  Y
Sbjct  86   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAIVGVGLVKAFQKHKY  145

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A+GYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  146  NSVGGGANSVASGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  205

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VF+VHLATIPITGTGINPARSFGAAVI+N+DK WDEHWIFWVGPFVGALAAA YHQYILR
Sbjct  206  VFIVHLATIPITGTGINPARSFGAAVIYNNDKIWDEHWIFWVGPFVGALAAAAYHQYILR  265

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  266  AAAIKALGSFRSN  278



>ref|XP_010920407.1| PREDICTED: probable aquaporin PIP2-2 [Elaeis guineensis]
Length=287

 Score =   348 bits (892),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 182/192 (95%), Gaps = 0/192 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYMIAQCLGAICGVGLVK FQ+++Y
Sbjct  95   FILVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYMIAQCLGAICGVGLVKGFQRAYY  154

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGANE+++GY+KGTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  155  DRYGGGANELSSGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  214

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVI+N++KAWD+ WIFWVGPF+GA  AA YHQY+LR
Sbjct  215  VFMVHLATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAAYHQYVLR  274

Query  167  GSAIKALGSFRS  132
             SA KALGSFRS
Sbjct  275  ASAGKALGSFRS  286



>dbj|BAG68661.1| plasma membrane intrinsic protein [Tulipa gesneriana]
Length=288

 Score =   348 bits (892),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGL + RKV+L RAV YM+AQCLGAICGVG VKAFQK+FY
Sbjct  95   FILVYCTAGISGGHINPAVTFGLLVGRKVSLIRAVFYMVAQCLGAICGVGFVKAFQKAFY  154

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE++AGY+KGTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFA
Sbjct  155  VRYGGGANELSAGYSKGTGLAAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFA  214

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWD+ WIFWVGPF+GA  AA YHQY+LR
Sbjct  215  VFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAAYHQYVLR  274

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  275  AGAIKALGSFRSNA  288



>gb|AFK33316.1| unknown [Medicago truncatula]
Length=287

 Score =   347 bits (891),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 167/192 (87%), Positives = 182/192 (95%), Gaps = 0/192 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICGVGLVKAFQK +Y
Sbjct  92   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGLVKAFQKGYY  151

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRY GGAN ++AGY+KGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  152  NRYKGGANMLSAGYSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  211

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N++KAWD+ WIFWVGPF+GA  AA+YHQ++LR
Sbjct  212  VFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAIYHQFVLR  271

Query  167  GSAIKALGSFRS  132
              A KALGSFRS
Sbjct  272  AQAAKALGSFRS  283



>gb|AHG32323.1| PIP2-2 [Pisum sativum]
Length=287

 Score =   347 bits (891),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLF+ RKV+L RA+LY+IAQCLGAICG GL K FQ S+Y
Sbjct  94   FILVYCTAGISGGHINPAVTFGLFVGRKVSLIRALLYIIAQCLGAICGAGLAKGFQSSYY  153

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGAN ++ GY+KGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  154  NRYGGGANTVSDGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  213

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARSFG AVIFN+DKAWD+ WI+WVGPF+GA  AA+YHQYILR
Sbjct  214  VFMVHLATIPVTGTGINPARSFGPAVIFNNDKAWDDQWIYWVGPFIGAAVAAIYHQYILR  273

Query  167  GSAIKALGSFRSNA  126
            GSAIKALGSFRSNA
Sbjct  274  GSAIKALGSFRSNA  287



>ref|XP_002519539.1| Aquaporin PIP2.2, putative [Ricinus communis]
 gb|EEF42953.1| Aquaporin PIP2.2, putative [Ricinus communis]
Length=288

 Score =   347 bits (891),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 165/194 (85%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM AQCLGAICG GLVKAFQ+++Y
Sbjct  93   FILVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYMAAQCLGAICGCGLVKAFQRAYY  152

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGANE+A GY+ GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFA
Sbjct  153  NRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFA  212

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARSFGAAVI+N +KAWD+ WIFWVGPF+GA  AA+YHQY+LR
Sbjct  213  VFMVHLATIPVTGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAIAAIYHQYVLR  272

Query  167  GSAIKALGSFRSNA  126
             SA KALGSFRS++
Sbjct  273  ASAAKALGSFRSSS  286



>gb|KHG10662.1| Aquaporin PIP2-1 -like protein [Gossypium arboreum]
 gb|KJB36605.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
 gb|KJB36607.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
Length=285

 Score =   347 bits (891),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 165/194 (85%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+ YM AQCLGAICG GLVKAFQKS+Y
Sbjct  90   FILVYCTAGISGGHINPAVTFGLFLARKVSLVRAIFYMAAQCLGAICGCGLVKAFQKSYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N+YGGGAN +A GY+ GTGL AEIIGTFVLVYTVFSATDPKRNARDSH+PVLAPLPIGFA
Sbjct  150  NKYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DK WD+HWIFWVGPF+GA  AA+YHQ+ILR
Sbjct  210  VFMVHLATIPITGTGINPARSFGAAVIYNQDKPWDDHWIFWVGPFIGAAIAAIYHQFILR  269

Query  167  GSAIKALGSFRSNA  126
             +A+KALGSFRS++
Sbjct  270  AAAVKALGSFRSSS  283



>gb|EYU40445.1| hypothetical protein MIMGU_mgv1a011413mg [Erythranthe guttata]
Length=282

 Score =   347 bits (891),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM+AQCLGAICGVGLVKAF KS Y
Sbjct  87   FILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVAYMVAQCLGAICGVGLVKAFMKSPY  146

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A GYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  147  NHLGGGANSVAPGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  206

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN+ K WD+ WIFWVGPFVGALAAA YHQYILR
Sbjct  207  VFMVHLATIPITGTGINPARSFGAAVIFNNGKVWDDQWIFWVGPFVGALAAAAYHQYILR  266

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  267  AAAIKALGSFRSN  279



>gb|ACG32567.1| aquaporin PIP2.1 [Zea mays]
Length=290

 Score =   347 bits (891),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+LY++AQCLGAICGVGLVKAFQ +++
Sbjct  97   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGLVKAFQSAYF  156

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGAN +A+GY++GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  157  DRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  216

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAVI+N DK WD+HWIFWVGP VGA  AA YHQYILR
Sbjct  217  VFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPLVGAAIAAFYHQYILR  276

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  277  AGAIKALGSFRSNA  290



>gb|KJB11821.1| hypothetical protein B456_002G2484001 [Gossypium raimondii]
Length=285

 Score =   347 bits (891),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM AQCLGAICG GLVKAFQKS+Y
Sbjct  90   FILVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMAAQCLGAICGCGLVKAFQKSYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N+YGGGAN +A GY+ GTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  NKYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAV+FN DK WD+HWIFWVGP +GA  AA+YHQYILR
Sbjct  210  VFMVHLATIPITGTGINPARSFGAAVMFNQDKPWDDHWIFWVGPLIGAAIAAIYHQYILR  269

Query  167  GSAIKALGSFRSNA  126
              A KALGSFRS++
Sbjct  270  AGAAKALGSFRSSS  283



>gb|KHN00691.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   347 bits (891),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+AQCLGAICGVGLVKAFQK++Y
Sbjct  90   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFQKAYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGANE++ GY+ G GLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  NRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAV++N  KAWD+HWIFWVGPF+GA  AA YHQ+ILR
Sbjct  210  VFMVHLATIPVTGTGINPARSLGAAVMYNQQKAWDDHWIFWVGPFIGAAIAAFYHQFILR  269

Query  167  GSAIKALGSFRSN  129
              A KALGSFRSN
Sbjct  270  AGAAKALGSFRSN  282



>ref|NP_001240039.1| uncharacterized protein LOC100782155 [Glycine max]
 gb|ACU23140.1| unknown [Glycine max]
 gb|KHN32778.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   347 bits (891),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+AQCLGAICGVGLVKAFQK++Y
Sbjct  90   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFQKAYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGANE++ GY+ G GLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  NRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAV++N  KAWD+HWIFWVGPF+GA  AA YHQ+ILR
Sbjct  210  VFMVHLATIPVTGTGINPARSLGAAVMYNQQKAWDDHWIFWVGPFIGAAIAAFYHQFILR  269

Query  167  GSAIKALGSFRSN  129
              A KALGSFRSN
Sbjct  270  AGAAKALGSFRSN  282



>ref|XP_004956113.1| PREDICTED: aquaporin PIP2-1-like [Setaria italica]
Length=289

 Score =   347 bits (891),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+LY++AQCLGAICGVGLVKAFQ +++
Sbjct  96   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGLVKAFQSAYF  155

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGAN +A+GY++GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  156  DRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  215

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAVI+N DK WD+HWIFWVGPF GA  AA YHQYILR
Sbjct  216  VFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPFAGAAIAAFYHQYILR  275

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  276  AGAIKALGSFRSNA  289



>ref|XP_009792249.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
 tpg|DAA64675.1| TPA_exp: aquaporin PIP2 3a [Nicotiana tabacum]
Length=285

 Score =   347 bits (890),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARK++L RAV+YMIAQCLGAICG GLVKAFQKS+Y
Sbjct  92   FVLVYCTAGISGGHINPAVTFGLFLARKISLARAVMYMIAQCLGAICGCGLVKAFQKSYY  151

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
              YGGGANE+A GY+ GTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  152  VNYGGGANELATGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  211

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+  +KAWD+ WIFWVGPF+GA  AA+YHQYILR
Sbjct  212  VFMVHLATIPITGTGINPARSFGAAVIYGKEKAWDDQWIFWVGPFIGAAIAALYHQYILR  271

Query  167  GSAIKALGSFRSNA  126
              A+KALGSFRSNA
Sbjct  272  AGAVKALGSFRSNA  285



>gb|AAA68701.1| similar to mipB gene product in Mesembryanthemum crystallinum, 
encoded by Genbank Accession Number L36097; MIP homolog; Method: 
conceptual translation supplied by author, partial [Mesembryanthemum 
crystallinum]
Length=252

 Score =   346 bits (887),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV YMIAQCLGAICGVGLVKAF K +Y
Sbjct  57   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVSYMIAQCLGAICGVGLVKAFMKGYY  116

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A GY+KGT LGAEIIGTFV+VYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  117  NSVGGGANSVAHGYSKGTALGAEIIGTFVVVYTVFSATDPKRSARDSHVPVLAPLPIGFA  176

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN  K WD+HWIFWVGP VGALAAA YHQYILR
Sbjct  177  VFMVHLATIPITGTGINPARSFGAAVIFNSKKNWDDHWIFWVGPMVGALAAAAYHQYILR  236

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  237  AAAIKALGSFRSN  249



>ref|XP_002521292.1| Aquaporin PIP2.7, putative [Ricinus communis]
 emb|CAE53883.1| aquaporin [Ricinus communis]
 gb|EEF41148.1| Aquaporin PIP2.7, putative [Ricinus communis]
Length=280

 Score =   347 bits (890),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM+AQCLGAICGVGLVKAF K+ Y
Sbjct  85   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKNPY  144

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NR GGGAN +A+GY+ GT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  145  NRLGGGANSVASGYSNGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  204

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DK WD+HWIFWVGPFVGALAAA YHQY+LR
Sbjct  205  VFMVHLATIPITGTGINPARSFGAAVIYNNDKVWDDHWIFWVGPFVGALAAAAYHQYVLR  264

Query  167  GSAIKALGSFRSN  129
             + IKALGSFRSN
Sbjct  265  AAGIKALGSFRSN  277



>ref|NP_001105024.1| aquaporin PIP2-1 [Zea mays]
 sp|Q84RL7.2|PIP21_MAIZE RecName: Full=Aquaporin PIP2-1; AltName: Full=Plasma membrane 
intrinsic protein 2-1; AltName: Full=ZmPIP2-1; AltName: Full=ZmPIP2;1 
[Zea mays]
 gb|AAK26758.1| plasma membrane integral protein ZmPIP2-1 [Zea mays]
 gb|ACF78965.1| unknown [Zea mays]
 gb|ACF84592.1| unknown [Zea mays]
 gb|ACF86144.1| unknown [Zea mays]
 gb|ACG31774.1| aquaporin PIP2.1 [Zea mays]
 tpg|DAA60473.1| TPA: plasma membrane intrinsic protein2 [Zea mays]
Length=290

 Score =   347 bits (891),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+LY++AQCLGAICGVGLVKAFQ +++
Sbjct  97   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGLVKAFQSAYF  156

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGAN +A+GY++GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  157  DRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  216

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAVI+N DK WD+HWIFWVGP VGA  AA YHQYILR
Sbjct  217  VFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPLVGAAIAAFYHQYILR  276

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  277  AGAIKALGSFRSNA  290



>gb|AFB83067.1| plasma intrinsic protein PIP2.1 [Helianthemum almeriense]
Length=279

 Score =   347 bits (889),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV YMIAQCLGAICGVGLVKAF K  Y
Sbjct  84   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMIAQCLGAICGVGLVKAFMKHDY  143

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N +GGGAN + +GY+KGT LGAEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLPIGFA
Sbjct  144  NTFGGGANSVNSGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFA  203

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN+ K+WD+HWIFWVGPF+GALAAA YHQYILR
Sbjct  204  VFMVHLATIPITGTGINPARSFGAAVIFNNQKSWDDHWIFWVGPFIGALAAAAYHQYILR  263

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  264  AAAIKALGSFRSN  276



>ref|XP_003563177.1| PREDICTED: probable aquaporin PIP2-1 [Brachypodium distachyon]
Length=290

 Score =   347 bits (891),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYMIAQCLGA+CGVGLVKAFQ +++
Sbjct  97   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYMIAQCLGAMCGVGLVKAFQSAYF  156

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGAN +AAGY+KGTGL AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  157  VRYGGGANTLAAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  216

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVIFN DKAWD+ WIFWVGP VGA  AA YHQYILR
Sbjct  217  VFMVHLATIPITGTGINPARSLGAAVIFNKDKAWDDQWIFWVGPMVGAAIAAFYHQYILR  276

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  277  AGAIKALGSFRSNA  290



>gb|KHG08488.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=285

 Score =   347 bits (890),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFL RKV+L RA++YM+AQCLGAICG GLVKAFQK++Y
Sbjct  93   FILVYCTAGISGGHINPAVTFGLFLGRKVSLIRAIMYMVAQCLGAICGCGLVKAFQKTYY  152

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N YGGGANE+ +G+NKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  153  NNYGGGANELQSGFNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  212

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARSFGAAVI+N +KAWD+ WIFWVGPF+GA  AA YHQYILR
Sbjct  213  VFMVHLATIPVTGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAIAAFYHQYILR  272

Query  167  GSAIKALGSFRSN  129
             +AIKA GS RSN
Sbjct  273  AAAIKAFGSSRSN  285



>ref|XP_003556232.1| PREDICTED: aquaporin PIP2-1-like [Glycine max]
 gb|KHN00839.1| Putative aquaporin PIP2-5 [Glycine soja]
Length=284

 Score =   347 bits (890),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+AQCLGAICGVGLVKAFQKS++
Sbjct  89   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFQKSYF  148

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N+YGGGAN +A GY+ GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  149  NKYGGGANSLADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  208

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAVI+N DK WD+HWIFWVGPF+GA  AA YHQ+ILR
Sbjct  209  VFMVHLATIPVTGTGINPARSLGAAVIYNQDKPWDDHWIFWVGPFIGAAIAAFYHQFILR  268

Query  167  GSAIKALGSFRSN  129
              A KALGSFRSN
Sbjct  269  AGAAKALGSFRSN  281



>ref|XP_009398603.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=288

 Score =   347 bits (890),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYMI QCLGAICGVGLVK FQK+F+
Sbjct  95   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRALLYMIGQCLGAICGVGLVKGFQKAFF  154

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE++ GY+KGTGL AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  155  VRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  214

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWD+ WIFWVGP +GA  AA YHQYILR
Sbjct  215  VFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYILR  274

Query  167  GSAIKALGSFRSNA  126
              A+KALGSFRSNA
Sbjct  275  AGAVKALGSFRSNA  288



>ref|NP_001267922.1| aquaporin-like [Vitis vinifera]
 gb|ABN14353.1| aquaporin PIP2;4 [Vitis vinifera]
Length=284

 Score =   347 bits (890),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/194 (85%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM+AQCLGAICGVGLVKAFQ ++Y
Sbjct  89   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAILYMVAQCLGAICGVGLVKAFQSAYY  148

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGANE++ GY+KGTGLGAEIIGTFVLVYTVFSATDPK++ARDSHVPVLAPLPIGFA
Sbjct  149  DRYGGGANELSTGYSKGTGLGAEIIGTFVLVYTVFSATDPKKSARDSHVPVLAPLPIGFA  208

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVI+N++KAWD+ WIFWVGPF+GA  AA YHQ+ILR
Sbjct  209  VFMVHLATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILR  268

Query  167  GSAIKALGSFRSNA  126
              A+KALGSFRS A
Sbjct  269  AGAVKALGSFRSTA  282



>gb|AAF71816.1|AF141642_1 putative aquaporin PIP2-1 [Vitis cinerea var. helleri x Vitis 
rupestris]
Length=284

 Score =   347 bits (889),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM+AQCLGAICGVGLVKAFQ ++Y
Sbjct  89   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAILYMVAQCLGAICGVGLVKAFQSAYY  148

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGANE++ GY+KGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  149  DRYGGGANELSTGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  208

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVI+N++KAWD+ WIFWVGPF+GA  AA YHQ+ILR
Sbjct  209  VFMVHLATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILR  268

Query  167  GSAIKALGSFRSN  129
              AIKALGSFRS 
Sbjct  269  AGAIKALGSFRST  281



>gb|KJB21561.1| hypothetical protein B456_004G001400 [Gossypium raimondii]
Length=285

 Score =   347 bits (889),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFL RKV+L RA++YM+AQCLGAICG GLVKAFQK++Y
Sbjct  93   FILVYCTAGISGGHINPAVTFGLFLGRKVSLIRAIMYMVAQCLGAICGCGLVKAFQKTYY  152

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N YGGGANE+ +G+NKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  153  NNYGGGANELQSGFNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  212

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARSFGAAVI+N +KAWD+ WIFWVGPF+GA  AA YHQYILR
Sbjct  213  VFMVHLATIPVTGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAIAAFYHQYILR  272

Query  167  GSAIKALGSFRSN  129
             +AIKA GS RSN
Sbjct  273  AAAIKAFGSSRSN  285



>gb|AAV69744.1| aquaporin [Vitis vinifera]
Length=284

 Score =   347 bits (889),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM+AQCLGAICGVGLVKAFQ ++Y
Sbjct  89   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAILYMVAQCLGAICGVGLVKAFQSAYY  148

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGANE++ GY+KGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  149  DRYGGGANELSTGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  208

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVI+N++KAWD+ WIFWVGPF+GA  AA YHQ+ILR
Sbjct  209  VFMVHLATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILR  268

Query  167  GSAIKALGSFRSN  129
              A+KALGSFRS 
Sbjct  269  AGAVKALGSFRST  281



>ref|XP_003518297.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   347 bits (889),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+AQCLGA+CGVGLVKAFQK++Y
Sbjct  90   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAMCGVGLVKAFQKAYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGANE++ GY+ G GLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  NRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARSFGAAV++N  KAWD+ WIFWVGPF+GA  AA YHQ+ILR
Sbjct  210  VFMVHLATIPVTGTGINPARSFGAAVMYNQKKAWDDQWIFWVGPFIGAAIAAFYHQFILR  269

Query  167  GSAIKALGSFRSN  129
             SA KA+GSFRSN
Sbjct  270  ASAAKAVGSFRSN  282



>ref|XP_010266027.1| PREDICTED: aquaporin PIP2-7-like [Nelumbo nucifera]
Length=280

 Score =   346 bits (888),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM+AQCLGAICGVGLVKAF K  Y
Sbjct  85   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHAY  144

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN + AGY+KGT LGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  145  NANGGGANSVNAGYSKGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  204

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN +K WD+HWIFWVGPFVGALAAA YHQYILR
Sbjct  205  VFMVHLATIPITGTGINPARSFGAAVIFNREKIWDDHWIFWVGPFVGALAAAAYHQYILR  264

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  265  AAAIKALGSFRSN  277



>ref|XP_006846771.1| hypothetical protein AMTR_s00148p00023270 [Amborella trichopoda]
 gb|ERN08352.1| hypothetical protein AMTR_s00148p00023270 [Amborella trichopoda]
Length=283

 Score =   346 bits (888),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV+YM+AQCLGAICGVGLVK FQ ++Y
Sbjct  88   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVMYMVAQCLGAICGVGLVKGFQSAYY  147

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGAN ++ GY+KG GLGAEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLPIGFA
Sbjct  148  NRYGGGANTLSNGYDKGVGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFA  207

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVI+N+ KAWD+ WIFWVGPF+GA  AA YHQYILR
Sbjct  208  VFMVHLATIPITGTGINPARSLGAAVIYNNKKAWDDQWIFWVGPFIGAAIAAAYHQYILR  267

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  268  AAAIKALGSFRSN  280



>gb|ACZ06859.1| plasma membrane intrinsic protein [Glycine soja]
Length=284

 Score =   347 bits (889),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+AQCLGAICGVGLVKAFQKS++
Sbjct  89   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFQKSYF  148

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N+YGGGAN +A GY+ GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  149  NKYGGGANSLADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  208

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAVI+N DK WD+HWIFWVGPF+GA  AA YHQ+ILR
Sbjct  209  VFMVHLATIPVTGTGINPARSLGAAVIYNQDKPWDDHWIFWVGPFIGAAIAAFYHQFILR  268

Query  167  GSAIKALGSFRSN  129
              A KALGSFRSN
Sbjct  269  AGAAKALGSFRSN  281



>gb|ACB87734.1| aquaporin [Manihot esculenta]
Length=280

 Score =   346 bits (888),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM+AQCLGAICGVGLVKAF K  Y
Sbjct  85   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHSY  144

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A GY+KGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  145  NGLGGGANSVAPGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  204

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DK WD+HWIFWVGPF+GALAAA YHQYILR
Sbjct  205  VFMVHLATIPITGTGINPARSFGAAVIYNNDKVWDDHWIFWVGPFIGALAAAAYHQYILR  264

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  265  AAAIKALGSFRSN  277



>emb|CAN75442.1| hypothetical protein VITISV_019657 [Vitis vinifera]
Length=284

 Score =   346 bits (888),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM+AQCLGAICGVGLVKAFQ ++Y
Sbjct  89   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAILYMVAQCLGAICGVGLVKAFQSAYY  148

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGANE++ GY+KGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  149  DRYGGGANELSTGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  208

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVI+N++KAWD+ WIFWVGPF+GA  AA YHQ+ILR
Sbjct  209  VFMVHLATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILR  268

Query  167  GSAIKALGSFRSN  129
              A+KALGSFRS 
Sbjct  269  AGAVKALGSFRST  281



>emb|CDY31523.1| BnaA10g13480D [Brassica napus]
Length=260

 Score =   345 bits (886),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 163/194 (84%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAG+SGGHINPAVTFGLFLARKV+L R VLY++AQCLGAICG GLVKAFQ S+Y
Sbjct  67   FVLVYCTAGVSGGHINPAVTFGLFLARKVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYY  126

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE+A GYNKGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLPIGFA
Sbjct  127  TRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFA  186

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N +KAWD+ WIFWVGP +GA AAA+YHQ++LR
Sbjct  187  VFMVHLATIPITGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAAALYHQFVLR  246

Query  167  GSAIKALGSFRSNA  126
             + IK+LGSFRS+A
Sbjct  247  AAGIKSLGSFRSSA  260



>gb|ACG39551.1| aquaporin PIP2.1 [Zea mays]
Length=290

 Score =   347 bits (889),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+LY++AQCLGAICGVGLVKAFQ +++
Sbjct  97   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGLVKAFQSAYF  156

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGAN +A+GY++GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  157  DRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  216

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAVI+N DK WD+HWIFWVGP VGA  AA YHQYILR
Sbjct  217  VFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPLVGAAIAAFYHQYILR  276

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  277  AGAIKALGSFRSNA  290



>ref|NP_001274381.1| aquaporin PIP2-7-like [Cucumis sativus]
 ref|XP_004145740.1| PREDICTED: aquaporin PIP2-7-like [Cucumis sativus]
 ref|XP_004169567.1| PREDICTED: aquaporin PIP2-7-like [Cucumis sativus]
 gb|AHB33480.1| plasma intrinsic protein 2-4 [Cucumis sativus]
 gb|KGN46837.1| hypothetical protein Csa_6G140850 [Cucumis sativus]
Length=283

 Score =   346 bits (888),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LY+IAQC GAICG GLVKAFQ ++Y
Sbjct  90   FILVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIIAQCAGAICGCGLVKAFQSAYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RY GGAN ++ GYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  VRYNGGANMLSDGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN +KAWD+ WIFWVGPF+GA  AA+YHQY+LR
Sbjct  210  VFMVHLATIPITGTGINPARSFGAAVIFNKEKAWDDQWIFWVGPFIGAAIAAIYHQYVLR  269

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  270  AGAIKALGSFRSNA  283



>gb|AIG92831.1| aquaporin PIP2 [Chrysanthemum x morifolium]
Length=285

 Score =   346 bits (888),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+AQCLGAICGVGLVKAF KS Y
Sbjct  90   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFNKSLY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGAN +A GYNKGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  150  NRYGGGANSLADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARSFGAAVI+N +K WD+ WIFWVGPF+GA  AA YHQ+ILR
Sbjct  210  VFMVHLATIPVTGTGINPARSFGAAVIYNKEKIWDDQWIFWVGPFIGAAIAAFYHQFILR  269

Query  167  GSAIKALGSFRSN  129
              AIKALGSFRS+
Sbjct  270  AGAIKALGSFRSS  282



>gb|ABU94631.1| putative aquaporin PIP2;3 [Phaseolus vulgaris]
Length=287

 Score =   346 bits (888),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVY TAGISGGHINPAVTFGLFLARKV+L RA++YM+AQCLGAICGVGLVKAFQKS+Y
Sbjct  92   FILVYWTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFQKSYY  151

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGAN +A GY+ GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  152  NRYGGGANSLADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  211

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAVI+N DK WD+HWIFWVGPF+GA  AA YHQ+ILR
Sbjct  212  VFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPFIGAAIAAFYHQFILR  271

Query  167  GSAIKALGSFRSN  129
              A+KALGSFRSN
Sbjct  272  AGAVKALGSFRSN  284



>gb|AAB18228.1| MipE [Mesembryanthemum crystallinum]
Length=284

 Score =   346 bits (887),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV YMIAQCLGAICGVGLVKAF K +Y
Sbjct  89   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVSYMIAQCLGAICGVGLVKAFMKGYY  148

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A GY+KGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  149  NSVGGGANSVAHGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  208

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN  K WD+HWIFWVGP VGALAAA YHQYILR
Sbjct  209  VFMVHLATIPITGTGINPARSFGAAVIFNSKKNWDDHWIFWVGPMVGALAAAAYHQYILR  268

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  269  AAAIKALGSFRSN  281



>gb|AFQ23186.1| aquaporin PIP2;1 [Eustoma exaltatum subsp. russellianum]
Length=286

 Score =   346 bits (887),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+LPRA  YM+AQCLGAICGVGLVKAFQ+S+Y
Sbjct  93   FILVYCTAGISGGHINPAVTFGLFLARKVSLPRAFFYMVAQCLGAICGVGLVKAFQRSYY  152

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RY GGAN +A GY KG GL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  153  HRYEGGANMVAPGYTKGVGLSAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  212

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+  DKAWD+ WIFWVGPFVGA  AA+YHQYILR
Sbjct  213  VFMVHLATIPITGTGINPARSFGAAVIYGADKAWDDQWIFWVGPFVGAAIAALYHQYILR  272

Query  167  GSAIKALGSFRSN  129
              AIKALGSFRSN
Sbjct  273  AGAIKALGSFRSN  285



>ref|XP_006280883.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
 gb|EOA13781.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
Length=297

 Score =   346 bits (888),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVT GLFLARKV+L R VLY++AQCLGAICG GLVKAFQ S+Y
Sbjct  104  FVLVYCTAGISGGHINPAVTVGLFLARKVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYY  163

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE+A GYNKGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  164  TRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  223

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N +KAWD+ WIFWVGP +GA AAA+YHQ+ILR
Sbjct  224  VFMVHLATIPITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPMIGAAAAALYHQFILR  283

Query  167  GSAIKALGSFRSNA  126
             +AIKAL SFRS+A
Sbjct  284  AAAIKALNSFRSSA  297



>ref|XP_004291577.1| PREDICTED: aquaporin PIP2-2 [Fragaria vesca subsp. vesca]
Length=281

 Score =   346 bits (887),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLY++AQ LGAICGVGLVKAFQK+ Y
Sbjct  88   FVLVYCTAGISGGHINPAVTFGLFLARKVSLLRAVLYIVAQSLGAICGVGLVKAFQKTLY  147

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            + YGGGAN +A GY+KGTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  148  DEYGGGANTLAPGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  207

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWD+HW+FW+GPF+GA  AA YHQ++LR
Sbjct  208  VFMVHLATIPITGTGINPARSFGAAVIYNQDKAWDDHWMFWLGPFIGAAIAAFYHQFVLR  267

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  268  AGAIKALGSFRSNA  281



>ref|XP_009131906.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=285

 Score =   346 bits (887),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 163/194 (84%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVT GLFLARKV+L R VLY++AQCLGAICG GLVKAFQ S+Y
Sbjct  92   FVLVYCTAGISGGHINPAVTVGLFLARKVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYY  151

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGAN++A GYNKGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLPIGFA
Sbjct  152  NRYGGGANQLADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFA  211

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N +KAWD+ WIFWVGP +GA AAA+YHQ++LR
Sbjct  212  VFMVHLATIPITGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAAALYHQFVLR  271

Query  167  GSAIKALGSFRSNA  126
             + IK+LGSFRS+A
Sbjct  272  AAGIKSLGSFRSSA  285



>ref|XP_011015478.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   346 bits (887),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM+AQCLGAICG GLVKAFQKS+Y
Sbjct  90   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMVAQCLGAICGCGLVKAFQKSYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
              YGGGAN +A GY+KG GLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  TSYGGGANGLAIGYSKGNGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N +KAWD+HWIFWVGPF+GA  AA+YHQ+ILR
Sbjct  210  VFMVHLATIPITGTGINPARSFGAAVIYNKEKAWDDHWIFWVGPFIGAAIAALYHQFILR  269

Query  167  GSAIKALGSFRSN  129
             +A+K+LGSFRS+
Sbjct  270  AAAVKSLGSFRSS  282



>gb|AEQ20672.1| PIP2;1 [Karelinia caspia]
Length=284

 Score =   346 bits (887),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 163/194 (84%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLAR V+LPRA +YM+AQCLGAICG GLVKAFQK++Y
Sbjct  91   FVLVYCTAGISGGHINPAVTFGLFLARXVSLPRAFMYMVAQCLGAICGCGLVKAFQKTYY  150

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             +YGGGANE+A GY+ GTGLGAEI+GTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  151  TKYGGGANELADGYSNGTGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  210

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+  DKAWD+ W+FWVGP +GA  AA YHQY+LR
Sbjct  211  VFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWLFWVGPMIGAAIAAFYHQYVLR  270

Query  167  GSAIKALGSFRSNA  126
              A+KALGSFRSNA
Sbjct  271  AGAVKALGSFRSNA  284



>gb|ADJ57599.1| plasma membrane intrinsic protein PIP2;1 [Fragaria chiloensis]
Length=284

 Score =   345 bits (886),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLY++AQ LGAICGVGLVKAFQK+ Y
Sbjct  91   FVLVYCTAGISGGHINPAVTFGLFLARKVSLLRAVLYIVAQSLGAICGVGLVKAFQKTLY  150

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            + YGGGAN +A GY+KGTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  151  DEYGGGANSLAPGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  210

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWD+HW+FW+GPF+GA  AA YHQ++LR
Sbjct  211  VFMVHLATIPITGTGINPARSFGAAVIYNQDKAWDDHWMFWLGPFIGAAIAAFYHQFVLR  270

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  271  AGAIKALGSFRSNA  284



>gb|KJB32662.1| hypothetical protein B456_005G254400 [Gossypium raimondii]
Length=278

 Score =   345 bits (886),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM+AQCLGAICGVGLVKAF    Y
Sbjct  83   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVTYMVAQCLGAICGVGLVKAFMNHEY  142

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
               GGGAN +A GYNKGT LGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  143  TTLGGGANTVATGYNKGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  202

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+ KAWD+HWIFWVGPFVGA+AAA YHQYILR
Sbjct  203  VFMVHLATIPITGTGINPARSFGAAVIYNNGKAWDDHWIFWVGPFVGAVAAAAYHQYILR  262

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  263  AAAIKALGSFRSN  275



>ref|XP_003522619.2| PREDICTED: aquaporin PIP2-7 [Glycine max]
Length=322

 Score =   347 bits (890),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+ YM+AQCLGAICGVGLVKAF K  Y
Sbjct  127  FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRALFYMVAQCLGAICGVGLVKAFMKHSY  186

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN ++AGYNKG+ LGAEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLPIGFA
Sbjct  187  NSLGGGANSVSAGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFA  246

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+ K WD+HWIFWVGPFVGALAAA YHQYILR
Sbjct  247  VFMVHLATIPITGTGINPARSFGAAVIYNNGKVWDDHWIFWVGPFVGALAAAAYHQYILR  306

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  307  AAAIKALGSFRSN  319



>ref|XP_002866389.1| hypothetical protein ARALYDRAFT_919301 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42648.1| hypothetical protein ARALYDRAFT_919301 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   345 bits (886),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVT GLFLARKV+L R VLY++AQCLGAICG GLVKAFQ S+Y
Sbjct  92   FVLVYCTAGISGGHINPAVTVGLFLARKVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYY  151

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE+A GYNKGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  152  TRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  211

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N++KAWD+ WIFWVGP +GA AAA YHQ+ILR
Sbjct  212  VFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPMIGAAAAAFYHQFILR  271

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRS A
Sbjct  272  AAAIKALGSFRSFA  285



>ref|XP_003538174.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
Length=286

 Score =   345 bits (886),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFL RKV+L RA+LYM+AQC GAICG GL K FQKS+Y
Sbjct  93   FILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCAGAICGTGLAKGFQKSYY  152

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGAN +A GYN GT LGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  153  NRYGGGANSVADGYNNGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  212

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DK WD+ WIFWVGP VGA  AA YHQYILR
Sbjct  213  VFMVHLATIPITGTGINPARSFGAAVIYNKDKIWDDQWIFWVGPIVGAAVAAFYHQYILR  272

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  273  AAAIKALGSFRSNA  286



>gb|AAC17529.1| aquaporin 2 [Samanea saman]
Length=287

 Score =   345 bits (886),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM+AQCLGAICGVGLVKAFQK++Y
Sbjct  92   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAILYMVAQCLGAICGVGLVKAFQKAYY  151

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGAN ++ GY+ GTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  152  SRYGGGANTLSDGYSTGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  211

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAVIFN  KAWD+HWIFWVGPF+GA  AA YHQ+ILR
Sbjct  212  VFMVHLATIPVTGTGINPARSLGAAVIFNQQKAWDDHWIFWVGPFIGAAIAAFYHQFILR  271

Query  167  GSAIKALGSFRSN  129
              A KALGSFRSN
Sbjct  272  AGAAKALGSFRSN  284



>ref|XP_006428786.1| hypothetical protein CICLE_v10012379mg [Citrus clementina]
 gb|ESR42026.1| hypothetical protein CICLE_v10012379mg [Citrus clementina]
Length=287

 Score =   345 bits (886),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 165/194 (85%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV+YM+AQCLGAICG GLVKAFQKS+Y
Sbjct  92   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKSYY  151

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE+A GY+ GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  152  TRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  211

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAVI+  DKAWD+ WIFWVGPF+GA  AA YHQ+ILR
Sbjct  212  VFMVHLATIPVTGTGINPARSLGAAVIYKKDKAWDDQWIFWVGPFIGAAIAAFYHQFILR  271

Query  167  GSAIKALGSFRSNA  126
             SA KALGSF+S++
Sbjct  272  ASASKALGSFKSSS  285



>ref|XP_011041003.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   345 bits (886),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV+YM+AQCLGAICGVGLVKAFQKS+Y
Sbjct  90   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVMYMVAQCLGAICGVGLVKAFQKSYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGAN +A G++ GTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  150  KRYGGGANTLADGFSTGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVI+N DKAWD+HWIFWVGPF GA  AA YHQ+ILR
Sbjct  210  VFMVHLATIPITGTGINPARSLGAAVIYNQDKAWDDHWIFWVGPFAGAAIAAFYHQFILR  269

Query  167  GSAIKALGSFRS  132
              A+KALGSFRS
Sbjct  270  AGAVKALGSFRS  281



>ref|NP_179277.1| putative aquaporin PIP2-8 [Arabidopsis thaliana]
 sp|Q9ZVX8.1|PIP28_ARATH RecName: Full=Probable aquaporin PIP2-8; AltName: Full=Plasma 
membrane intrinsic protein 2-8; Short=AtPIP2;8; AltName: Full=Plasma 
membrane intrinsic protein 3b; Short=PIP3b [Arabidopsis 
thaliana]
 gb|AAC64216.1| putative plasma membrane intrinsic protein [Arabidopsis thaliana]
 gb|AAM15086.1| putative plasma membrane intrinsic protein [Arabidopsis thaliana]
 gb|AAO63278.1| At2g16850 [Arabidopsis thaliana]
 dbj|BAF00056.1| putative aquaporin [Arabidopsis thaliana]
 gb|AEC06543.1| putative aquaporin PIP2-8 [Arabidopsis thaliana]
Length=278

 Score =   345 bits (885),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+LPRAV YM+AQCLGAICGVGLVKAF  + Y
Sbjct  83   FVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVAYMVAQCLGAICGVGLVKAFMMTPY  142

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             R GGGAN +A GY+ GT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  143  KRLGGGANTVADGYSTGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  202

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N++KAWD+HWIFWVGPFVGALAAA YHQYILR
Sbjct  203  VFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILR  262

Query  167  GSAIKALGSFRSN  129
             +AIKAL SFRSN
Sbjct  263  AAAIKALASFRSN  275



>gb|KHN05685.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   345 bits (885),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFL RKV+L RA+LYM+AQC GAICG GL K FQK++Y
Sbjct  93   FILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCAGAICGTGLAKGFQKAYY  152

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGAN +A GYN GT LGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  153  NRYGGGANSVADGYNNGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  212

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DK WD+ WIFWVGP VGA  AA YHQYILR
Sbjct  213  VFMVHLATIPITGTGINPARSFGAAVIYNEDKIWDDQWIFWVGPIVGAAVAAFYHQYILR  272

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  273  AAAIKALGSFRSNA  286



>gb|ACU24483.1| unknown [Glycine max]
Length=284

 Score =   345 bits (885),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+AQCL AICGVGLVKAFQKS++
Sbjct  89   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLSAICGVGLVKAFQKSYF  148

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N+YGGGAN +A GY+ GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  149  NKYGGGANSLADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  208

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAVI+N DK WD+HWIFWVGPF+GA  AA YHQ+ILR
Sbjct  209  VFMVHLATIPVTGTGINPARSLGAAVIYNQDKPWDDHWIFWVGPFIGAAIAAFYHQFILR  268

Query  167  GSAIKALGSFRSN  129
              A KALGSFRSN
Sbjct  269  AGAAKALGSFRSN  281



>gb|AAO86707.1| aquaporin [Zea mays]
Length=290

 Score =   345 bits (886),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 165/194 (85%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+LY++AQCLGAICGVGLVKAFQ +++
Sbjct  97   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGLVKAFQSAYF  156

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGAN +A+GY++GTG GAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  157  DRYGGGANSLASGYSRGTGFGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  216

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAVI+N DK WD+HWIFWVGP VGA  AA YHQYILR
Sbjct  217  VFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPLVGAAIAAFYHQYILR  276

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  277  AGAIKALGSFRSNA  290



>ref|XP_008785285.1| PREDICTED: aquaporin PIP2-4 [Phoenix dactylifera]
Length=287

 Score =   345 bits (885),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 181/192 (94%), Gaps = 0/192 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYMIAQCLGAICG GLVK FQK++Y
Sbjct  95   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRALLYMIAQCLGAICGAGLVKGFQKAYY  154

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE+++GY++GTGL AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  155  VRYGGGANELSSGYSRGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  214

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DKAWD+ WIFWVGPF+GA  AA YHQY+LR
Sbjct  215  VFMVHLATIPITGTGINPARSFGAAVIYNEDKAWDDQWIFWVGPFIGAAIAAAYHQYVLR  274

Query  167  GSAIKALGSFRS  132
             SA KALGS+RS
Sbjct  275  ASAGKALGSYRS  286



>gb|ACR56614.1| plasma intrinsic protein 2;4 [Juglans regia]
Length=280

 Score =   345 bits (885),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV+YM+AQCLGAICGVGLVKAF K  Y
Sbjct  85   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVVYMVAQCLGAICGVGLVKAFMKHDY  144

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGG N +A GY+KGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  145  NTLGGGTNSVAQGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  204

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VF+VHLATIPITGTGINPARSFGAAVI+++DK WDEHWIFWVGPFVGALAAA YHQYILR
Sbjct  205  VFIVHLATIPITGTGINPARSFGAAVIYDNDKVWDEHWIFWVGPFVGALAAAAYHQYILR  264

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  265  AAAIKALGSFRSN  277



>ref|NP_001240223.1| prolactin-inducible protein [Glycine max]
 gb|ACU20043.1| unknown [Glycine max]
Length=286

 Score =   345 bits (885),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFL RKV+L RA+LYM+AQC GAICG GL K FQK++Y
Sbjct  93   FILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCAGAICGTGLAKGFQKAYY  152

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGAN +A GYN GT LGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  153  NRYGGGANSVADGYNNGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  212

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DK WD+ WIFWVGP VGA  AA YHQYILR
Sbjct  213  VFMVHLATIPITGTGINPARSFGAAVIYNEDKIWDDQWIFWVGPIVGAAVAAFYHQYILR  272

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  273  AAAIKALGSFRSNA  286



>ref|XP_006412152.1| hypothetical protein EUTSA_v10025940mg [Eutrema salsugineum]
 gb|ESQ53605.1| hypothetical protein EUTSA_v10025940mg [Eutrema salsugineum]
Length=281

 Score =   345 bits (884),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV YMIAQCLGAICGVG VKAF K+ Y
Sbjct  86   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVGYMIAQCLGAICGVGFVKAFMKTPY  145

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A GY+KGT LGAEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLPIGFA
Sbjct  146  NTLGGGANTVADGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFA  205

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+ KAWD+HWIFWVGPF+GALAAA YHQYILR
Sbjct  206  VFMVHLATIPITGTGINPARSFGAAVIYNNKKAWDDHWIFWVGPFLGALAAAAYHQYILR  265

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  266  AAAIKALGSFRSNA  279



>ref|XP_009120600.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-4 [Brassica 
rapa]
Length=285

 Score =   345 bits (885),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 162/194 (84%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAG+SGGHINPAVTFGLFLARKV+L R VLY++AQCLGAICG GLVKAFQ S+Y
Sbjct  92   FVLVYCTAGVSGGHINPAVTFGLFLARKVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYY  151

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE+A GYNKGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLPIGFA
Sbjct  152  TRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFA  211

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVI+N +KAWD+ WIFWVGP +GA AAA+YHQ++LR
Sbjct  212  VFMVHLATIPITGTGINPARSLGAAVIYNQEKAWDDQWIFWVGPMIGAAAAALYHQFVLR  271

Query  167  GSAIKALGSFRSNA  126
             + IK+LGSFRS+A
Sbjct  272  AAGIKSLGSFRSSA  285



>gb|AAC16545.1| aquaporin [Oryza sativa]
Length=290

 Score =   345 bits (885),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LY++AQCLGAICGVGLV AF  +++
Sbjct  97   FILVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYIVAQCLGAICGVGLVNAFPNAYF  156

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGAN +AAGY+KGTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  157  NRYGGGANTLAAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  216

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVIFN++KAW  HWIFWVGPFVGA  AA YHQYILR
Sbjct  217  VFMVHLATIPITGTGINPARSIGAAVIFNNEKAWHNHWIFWVGPFVGAAIAAFYHQYILR  276

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  277  AGAIKALGSFRSNA  290



>dbj|BAG06231.1| plasma membrane intrinsic protein [Hordeum vulgare]
 dbj|BAK01580.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01902.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   345 bits (885),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM+AQCLGA+CGVGLVKAFQ +++
Sbjct  97   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYMVAQCLGAMCGVGLVKAFQSAYF  156

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGAN +AAGY+KGTGL AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  157  VRYGGGANTLAAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  216

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVI+N DKAWD+ WIFWVGP +GA  AA YHQYILR
Sbjct  217  VFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPMIGAAIAAFYHQYILR  276

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  277  AGAIKALGSFRSNA  290



>ref|XP_007151872.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
 gb|ESW23866.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
Length=285

 Score =   345 bits (884),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+AQCLGAICGVGLVKAFQK++Y
Sbjct  90   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFQKAYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N+YGGGANE++ GY+ G GLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  NKYGGGANELSDGYSTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAVI+N +KAWD+ WIFWVGPF+GA  AA YHQ+ILR
Sbjct  210  VFMVHLATIPVTGTGINPARSLGAAVIYNKEKAWDDQWIFWVGPFIGAAIAAFYHQFILR  269

Query  167  GSAIKALGSFRSN  129
              A KALGSFRSN
Sbjct  270  AGAAKALGSFRSN  282



>gb|KFK36606.1| hypothetical protein AALP_AA4G145300 [Arabis alpina]
Length=284

 Score =   345 bits (884),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICGVG VKAFQ S+Y
Sbjct  89   FILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYMVAQCLGAICGVGFVKAFQSSYY  148

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGAN +A GYN GTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  149  VRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  208

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN+ K WD+HWIFWVGPF+GA  AA YHQ++LR
Sbjct  209  VFMVHLATIPITGTGINPARSFGAAVIFNESKPWDDHWIFWVGPFIGAAIAAFYHQFVLR  268

Query  167  GSAIKALGSFRSNA  126
             S  K+LGSFRS A
Sbjct  269  ASGSKSLGSFRSAA  282



>ref|XP_006294744.1| hypothetical protein CARUB_v10023789mg [Capsella rubella]
 gb|EOA27642.1| hypothetical protein CARUB_v10023789mg [Capsella rubella]
Length=285

 Score =   345 bits (884),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICGVG VKAFQ S+Y
Sbjct  90   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGAN +A GYN GTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  VRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN+ K WD+HWIFWVGPF+GA  AA+YHQ++LR
Sbjct  210  VFMVHLATIPITGTGINPARSFGAAVIFNESKPWDDHWIFWVGPFIGAAIAAIYHQFVLR  269

Query  167  GSAIKALGSFRSNA  126
             S  K+LGSFRS A
Sbjct  270  ASGSKSLGSFRSAA  283



>ref|XP_008791536.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=288

 Score =   345 bits (884),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYMIAQCLGAICG GLVK FQK++Y
Sbjct  93   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRALLYMIAQCLGAICGAGLVKGFQKAYY  152

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE+++GY+KGTGL AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  153  VRYGGGANELSSGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  212

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI++ +KAWD+ WIFWVGPF+GA  A  YHQ++LR
Sbjct  213  VFMVHLATIPITGTGINPARSFGAAVIYDKEKAWDDQWIFWVGPFIGAAIATAYHQFVLR  272

Query  167  GSAIKALGSFRSNA  126
              A+KALGSFRSNA
Sbjct  273  AGAVKALGSFRSNA  286



>ref|NP_001105638.1| aquaporin PIP2-2 [Zea mays]
 sp|Q9ATM8.1|PIP22_MAIZE RecName: Full=Aquaporin PIP2-2; AltName: Full=Plasma membrane 
intrinsic protein 2-2; AltName: Full=ZmPIP2-2; AltName: Full=ZmPIP2;2 
[Zea mays]
 gb|AAK26759.1| plasma membrane integral protein ZmPIP2-2 [Zea mays]
 gb|ACG39966.1| aquaporin PIP2.1 [Zea mays]
 gb|ACN31255.1| unknown [Zea mays]
 tpg|DAA39706.1| TPA: plasma membrane intrinsic protein2 [Zea mays]
Length=292

 Score =   345 bits (884),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/194 (84%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM+AQCLGA+CGVGLVKAFQ +++
Sbjct  99   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYMVAQCLGAVCGVGLVKAFQSAYF  158

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGAN +A+GY++G GLGAEI+GTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  159  DRYGGGANSLASGYSRGAGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  218

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAV++N DK WD+HWIFWVGP +GA  AA YHQYILR
Sbjct  219  VFMVHLATIPVTGTGINPARSLGAAVVYNKDKPWDDHWIFWVGPLLGAAIAAFYHQYILR  278

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  279  AGAIKALGSFRSNA  292



>gb|ACR56615.1| plasma intrinsic protein 2;5 [Juglans regia]
Length=281

 Score =   344 bits (883),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM+AQCLGAICGVGLVKAF K  Y
Sbjct  86   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHDY  145

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A GY+KGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  146  NAQGGGANSVAHGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  205

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VF+VHLATIPITGTGINPARSFGAAVI+++DK WDEHWIFWVGPFVGALAAA YHQYILR
Sbjct  206  VFIVHLATIPITGTGINPARSFGAAVIYDNDKIWDEHWIFWVGPFVGALAAAAYHQYILR  265

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  266  AAAIKALGSFRSN  278



>gb|EYU34445.1| hypothetical protein MIMGU_mgv1a011350mg [Erythranthe guttata]
Length=284

 Score =   344 bits (883),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLY+IAQCLGAICG GLVKAFQKS+Y
Sbjct  89   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYIIAQCLGAICGCGLVKAFQKSYY  148

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
              +GGGANE+A GY+KGTGL AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  149  VEHGGGANELALGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  208

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+  DKAWD+ WIFWVGPF+GA  AA+YHQYILR
Sbjct  209  VFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQYILR  268

Query  167  GSAIKALGSFRSNA  126
              A+KALGSFRS++
Sbjct  269  AGAVKALGSFRSSS  282



>emb|CDX88767.1| BnaA03g08820D [Brassica napus]
Length=260

 Score =   343 bits (881),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/194 (84%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVT GLF+ARKV+L R VLY++AQCLGAICG GLVKAFQ S+Y
Sbjct  67   FVLVYCTAGISGGHINPAVTVGLFIARKVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYY  126

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGAN++A GYNKGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLPIGFA
Sbjct  127  NRYGGGANQLADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFA  186

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N +KAWD+ WIFWVGP +GA AAA+YHQ++LR
Sbjct  187  VFMVHLATIPITGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAAALYHQFVLR  246

Query  167  GSAIKALGSFRSNA  126
             + IK+LGSFRS+A
Sbjct  247  AAGIKSLGSFRSSA  260



>gb|ACF79873.1| unknown [Zea mays]
Length=294

 Score =   345 bits (884),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/194 (84%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM+AQCLGA+CGVGLVKAFQ +++
Sbjct  101  FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYMVAQCLGAVCGVGLVKAFQSAYF  160

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGAN +A+GY++G GLGAEI+GTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  161  DRYGGGANSLASGYSRGAGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  220

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAV++N DK WD+HWIFWVGP +GA  AA YHQYILR
Sbjct  221  VFMVHLATIPVTGTGINPARSLGAAVVYNKDKPWDDHWIFWVGPLLGAAIAAFYHQYILR  280

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  281  AGAIKALGSFRSNA  294



>ref|XP_007150204.1| hypothetical protein PHAVU_005G135300g [Phaseolus vulgaris]
 gb|ESW22198.1| hypothetical protein PHAVU_005G135300g [Phaseolus vulgaris]
Length=287

 Score =   344 bits (883),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVT GLFL RKV+L RA+LY++AQC GAI G GL KAFQKSFY
Sbjct  94   FILVYCTAGISGGHINPAVTLGLFLGRKVSLVRALLYIVAQCAGAISGAGLAKAFQKSFY  153

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGAN ++ GYNKGT LGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  154  NRYGGGANTVSDGYNKGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  213

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFG AVIFN+DKAWD+ WI+WVGPF+GA  AA YHQYILR
Sbjct  214  VFMVHLATIPITGTGINPARSFGPAVIFNNDKAWDDQWIYWVGPFIGAAVAAFYHQYILR  273

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  274  AAAIKALGSFRSNA  287



>gb|ABM54183.1| aquaporin [Jatropha curcas]
 gb|KDP29674.1| hypothetical protein JCGZ_18836 [Jatropha curcas]
Length=280

 Score =   344 bits (883),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+ YM+AQCLGAICGVGLVKAF K+ Y
Sbjct  85   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRALAYMVAQCLGAICGVGLVKAFMKNPY  144

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +  GY+KGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVP+LAPLPIGFA
Sbjct  145  NHLGGGANSVNTGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFA  204

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DK WD+HWIFWVGPFVGA+AAA YHQYILR
Sbjct  205  VFMVHLATIPITGTGINPARSFGAAVIYNNDKVWDDHWIFWVGPFVGAIAAAAYHQYILR  264

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  265  AAAIKALGSFRSN  277



>dbj|BAD90699.1| plasma membrane intrinsic protein 2;3 [Mimosa pudica]
Length=288

 Score =   344 bits (883),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LY++AQCLGAICGVGLVKAFQK++Y
Sbjct  93   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAILYIVAQCLGAICGVGLVKAFQKAYY  152

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             +YGGGAN +  GY+ GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  153  TKYGGGANTLGDGYSVGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  212

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARSFGAAVIFN  KAWD+HWIFWVGPF+GA  AA YHQ+ILR
Sbjct  213  VFMVHLATIPVTGTGINPARSFGAAVIFNQQKAWDKHWIFWVGPFIGAAIAAFYHQFILR  272

Query  167  GSAIKALGSFRSN  129
              A KALGSFRSN
Sbjct  273  AGAAKALGSFRSN  285



>gb|ABK23750.1| unknown [Picea sitchensis]
Length=282

 Score =   344 bits (883),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+LPRA+LYMIAQCLGAICG GLV+AFQKSFY
Sbjct  87   FVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAILYMIAQCLGAICGAGLVEAFQKSFY  146

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGAN +  GY KG GL AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  147  DRYGGGANFVHPGYTKGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  206

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+   ++WD+HWIFWVGPFVGA  AA YHQYILR
Sbjct  207  VFMVHLATIPITGTGINPARSFGAAVIYGHKQSWDDHWIFWVGPFVGAALAAAYHQYILR  266

Query  167  GSAIKALGSFRSN  129
             +A+KALGS+RSN
Sbjct  267  AAAVKALGSYRSN  279



>ref|XP_003540176.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
 gb|KHN11201.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score =   344 bits (883),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFL RKV+L RA+LYMIAQC GAICG GL K FQKS+Y
Sbjct  94   FILVYCTAGISGGHINPAVTFGLFLGRKVSLVRALLYMIAQCAGAICGAGLAKGFQKSYY  153

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGG N ++ GYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  154  NRYGGGVNTVSDGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  213

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARSFG AVIFN+DKAWD+ WI+WVGPFVGA  AA YHQYILR
Sbjct  214  VFMVHLATIPVTGTGINPARSFGPAVIFNNDKAWDDQWIYWVGPFVGAAVAAFYHQYILR  273

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  274  AAAIKALGSFRSN  286



>ref|XP_009794928.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-1 [Nicotiana 
sylvestris]
Length=282

 Score =   344 bits (883),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 180/194 (93%), Gaps = 1/194 (1%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+AQCLGAICGVG VKAFQ S Y
Sbjct  90   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRALVYMVAQCLGAICGVGFVKAFQ-SXY  148

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGANEMA G+ KG GL AEIIGTFVLVY VFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  149  DRYGGGANEMAPGHTKGVGLAAEIIGTFVLVYVVFSATDPKRSARDSHVPVLAPLPIGFA  208

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAW+EHWIFWVGPF+GA AAA YHQYILR
Sbjct  209  VFMVHLATIPITGTGINPARSFGAAVIYNQDKAWNEHWIFWVGPFIGAFAAAAYHQYILR  268

Query  167  GSAIKALGSFRSNA  126
              A+KALGSFRSNA
Sbjct  269  AGAVKALGSFRSNA  282



>ref|XP_006481455.1| PREDICTED: aquaporin PIP2-2-like [Citrus sinensis]
Length=287

 Score =   344 bits (883),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV+YM+AQCLGAICG GLVKAFQKS+Y
Sbjct  92   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKSYY  151

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE+A GY+ GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  152  TRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  211

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAVI++ +KAWD+ WIFWVGPF+GA  AA YHQ+ILR
Sbjct  212  VFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILR  271

Query  167  GSAIKALGSFRSNA  126
             SA KALGSF+S++
Sbjct  272  ASASKALGSFKSSS  285



>ref|XP_007151871.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
 gb|ESW23865.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
Length=285

 Score =   344 bits (883),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+AQCLGAICGVGLVKAFQK++Y
Sbjct  90   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFQKAYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE++ GY+ G GLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  TRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAVI+N +KAWD+ WIFWVGPF+GA  AA YHQ+ILR
Sbjct  210  VFMVHLATIPVTGTGINPARSLGAAVIYNKEKAWDDQWIFWVGPFIGAAIAAFYHQFILR  269

Query  167  GSAIKALGSFRSN  129
              A KALGSFRSN
Sbjct  270  AGAAKALGSFRSN  282



>ref|XP_010489282.1| PREDICTED: probable aquaporin PIP2-8 [Camelina sativa]
Length=278

 Score =   344 bits (882),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFG FLARKV+L RAV YM+AQCLGAICGVGLVKAF  + Y
Sbjct  83   FVLVYCTAGISGGHINPAVTFGFFLARKVSLLRAVAYMVAQCLGAICGVGLVKAFMMTPY  142

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             R+GGGAN +A GY+ GT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  143  KRHGGGANTVAHGYSTGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  202

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+NDDKAWD+HWIFWVGPFVGALAAA YHQYILR
Sbjct  203  VFMVHLATIPITGTGINPARSFGAAVIYNDDKAWDDHWIFWVGPFVGALAAAAYHQYILR  262

Query  167  GSAIKALGSFRSN  129
             +AIKAL SFRSN
Sbjct  263  AAAIKALASFRSN  275



>ref|XP_009367074.1| PREDICTED: aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=288

 Score =   344 bits (882),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 183/201 (91%), Gaps = 7/201 (3%)
 Frame = -2

Query  707  FILVYCTA-------GISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVK  549
            F+LVYCTA        I+GGHINPAVTFGLFLARKV+L RAVLY++AQCLGAICGVGLVK
Sbjct  88   FVLVYCTAPPSCFSMTIAGGHINPAVTFGLFLARKVSLIRAVLYIVAQCLGAICGVGLVK  147

Query  548  AFQKSFYNRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLA  369
            AFQKS+Y +YGGGANE+A GYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLA
Sbjct  148  AFQKSYYVKYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLA  207

Query  368  PLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAV  189
            PLPIGFAVF+VHLATIPITGTGINPARSFGAAVI+N DKAWD+ WIFW+GPF+GA  AA 
Sbjct  208  PLPIGFAVFIVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAAF  267

Query  188  YHQYILRGSAIKALGSFRSNA  126
            YHQYILR  AIKALGSFRSNA
Sbjct  268  YHQYILRAGAIKALGSFRSNA  288



>gb|KHN38765.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   344 bits (882),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFL RKV+L RA+LYM+AQC GAICG GL K FQK++Y
Sbjct  93   FILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCAGAICGTGLAKGFQKAYY  152

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGAN +A GYN GT LGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  153  NRYGGGANSVADGYNNGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  212

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DK WD+ WIFWVGP VGA  AA YHQYILR
Sbjct  213  VFMVHLATIPITGTGINPARSFGAAVIYNKDKIWDDQWIFWVGPIVGAAVAAFYHQYILR  272

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSFRSNA
Sbjct  273  AAAIKALGSFRSNA  286



>gb|ADK25057.1| plasma membrane intrinsic protein [Glycine max]
Length=286

 Score =   344 bits (882),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFL RKV+L RA+LYM+AQC GAICG GL K FQK++Y
Sbjct  93   FILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCAGAICGTGLAKGFQKAYY  152

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGAN +A GYN GT LGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  153  NRYGGGANSVADGYNNGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  212

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DK WD+ WIFWVGP VGA  AA YHQYILR
Sbjct  213  VFMVHLATIPITGTGINPARSFGAAVIYNEDKIWDDQWIFWVGPIVGAAVAAFYHQYILR  272

Query  167  GSAIKALGSFRSNA  126
             +AIKALGSF+SNA
Sbjct  273  AAAIKALGSFKSNA  286



>gb|EAY86778.1| hypothetical protein OsI_08158 [Oryza sativa Indica Group]
Length=288

 Score =   344 bits (882),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 179/194 (92%), Gaps = 1/194 (1%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAVLY+IAQCLGAICGVGLVK FQ S+Y
Sbjct  96   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYIIAQCLGAICGVGLVKGFQSSYY  155

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE++ GY+KGTGLGAEIIGTFVLVYTVFSATDPKRNARDSH+PVLAPLPIGFA
Sbjct  156  ARYGGGANELSDGYSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFA  215

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVI+N DKAWD+ WIFWVGP +GA  AA YHQY+LR
Sbjct  216  VFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLR  275

Query  167  GSAIKALGSFRSNA  126
             SA K LGS+RSNA
Sbjct  276  ASAAK-LGSYRSNA  288



>ref|XP_011094668.1| PREDICTED: aquaporin PIP2-4-like [Sesamum indicum]
Length=281

 Score =   343 bits (881),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLY+IAQCLGAI GVGLVKAFQK++Y
Sbjct  87   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYIIAQCLGAISGVGLVKAFQKAYY  146

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE+A GY+ GTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  147  VRYGGGANELADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  206

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+  DKAWD+ WIFWVGPF+GA  AA+YHQYILR
Sbjct  207  VFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQYILR  266

Query  167  GSAIKALGSFRSNA  126
              A KALGSFRS++
Sbjct  267  AGAAKALGSFRSSS  280



>ref|XP_006410896.1| hypothetical protein EUTSA_v10017874mg [Eutrema salsugineum]
 gb|ESQ52349.1| hypothetical protein EUTSA_v10017874mg [Eutrema salsugineum]
Length=284

 Score =   344 bits (882),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICGVG VKAFQ S+Y
Sbjct  89   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYY  148

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGAN +A GYN GTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  149  VRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  208

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN+ K WD+HWIFWVGPF+GA  AA YHQ++LR
Sbjct  209  VFMVHLATIPITGTGINPARSFGAAVIFNESKPWDDHWIFWVGPFIGAAIAAFYHQFVLR  268

Query  167  GSAIKALGSFRSNA  126
             S  K+LGSFRS A
Sbjct  269  ASGSKSLGSFRSAA  282



>dbj|BAD90697.1| plasma membrane intrinsic protein 2;1 [Mimosa pudica]
Length=287

 Score =   344 bits (882),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFL RKV+L RAVLYM+AQC GAICG GL KAFQK++Y
Sbjct  94   FILVYCTAGISGGHINPAVTFGLFLGRKVSLIRAVLYMVAQCAGAICGTGLAKAFQKAYY  153

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGG N +  GY+KGT LGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  154  DRYGGGVNFVQPGYSKGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  213

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARSFGAAVI+N  KAWD+HWIFWVGP +GALAAA+YHQYILR
Sbjct  214  VFMVHLATIPVTGTGINPARSFGAAVIYNGSKAWDDHWIFWVGPAIGALAAAIYHQYILR  273

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  274  AAAIKALGSFRSN  286



>ref|XP_010505293.1| PREDICTED: aquaporin PIP2-2 [Camelina sativa]
 ref|XP_010509372.1| PREDICTED: aquaporin PIP2-2 [Camelina sativa]
Length=285

 Score =   343 bits (881),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICGVG VKAFQ S+Y
Sbjct  90   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGAN +A GYN GTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  VRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN+ K WD+HWIFWVGPF+GA  AA YHQ++LR
Sbjct  210  VFMVHLATIPITGTGINPARSFGAAVIFNESKPWDDHWIFWVGPFIGAAIAAFYHQFVLR  269

Query  167  GSAIKALGSFRSNA  126
             S  K+LGSFRS A
Sbjct  270  ASGSKSLGSFRSAA  283



>gb|AAM63463.1| aquaporin (plasma membrane intrinsic protein 2B) [Arabidopsis 
thaliana]
Length=285

 Score =   343 bits (881),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICGVG VKAFQ S+Y
Sbjct  90   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGAN +A GYN GTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  DRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N  K WD+HWIFWVGPF+GA  AA YHQ++LR
Sbjct  210  VFMVHLATIPITGTGINPARSFGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFYHQFVLR  269

Query  167  GSAIKALGSFRSNA  126
             S  K+LGSFRS A
Sbjct  270  ASGSKSLGSFRSAA  283



>ref|XP_010467415.1| PREDICTED: probable aquaporin PIP2-8 [Camelina sativa]
Length=278

 Score =   343 bits (881),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM+AQCLGAICGVGLVKAF  + Y
Sbjct  83   FVLVYCTAGISGGHINPAVTFGLFLARKVSLLRAVAYMVAQCLGAICGVGLVKAFMMTPY  142

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             R+GGGAN +A GY+ GT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  143  KRHGGGANAVAHGYSTGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  202

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+NDDKAW++HWIFWVGPFVGALAAA YHQYILR
Sbjct  203  VFMVHLATIPITGTGINPARSFGAAVIYNDDKAWNDHWIFWVGPFVGALAAAAYHQYILR  262

Query  167  GSAIKALGSFRSN  129
             +AIKAL SFRSN
Sbjct  263  AAAIKALASFRSN  275



>gb|AAO39008.1| plasma intrinsic protein 2,2 [Juglans regia]
Length=287

 Score =   343 bits (881),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/194 (85%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM AQCLGA+CG GLVKAFQK++Y
Sbjct  92   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVFYMAAQCLGAVCGCGLVKAFQKAYY  151

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            ++YGGGANE+A GY+KGTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  152  SKYGGGANELADGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  211

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+  DKAWD+ WIFWVGPF+GA  AA YHQYILR
Sbjct  212  VFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFIGAAIAAFYHQYILR  271

Query  167  GSAIKALGSFRSNA  126
             +A KALGSFRS++
Sbjct  272  AAAAKALGSFRSSS  285



>ref|XP_006481459.1| PREDICTED: aquaporin PIP2-2-like [Citrus sinensis]
Length=287

 Score =   343 bits (881),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV+YM+AQCLGAICG GLVKAFQKS+Y
Sbjct  92   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKSYY  151

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE+A GY+ G GLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  152  TRYGGGANELADGYSTGAGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  211

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARS GAAVI+  DKAWD+ WIFWVGPF+GA  AA YHQ+ILR
Sbjct  212  VFMVHLATIPVTGTGINPARSLGAAVIYKKDKAWDDQWIFWVGPFIGAAIAAFYHQFILR  271

Query  167  GSAIKALGSFRSNA  126
             SA KALGSF+S++
Sbjct  272  ASASKALGSFKSSS  285



>gb|ACV66986.1| plasma membrane aquaporin 2 [Hevea brasiliensis]
Length=278

 Score =   343 bits (880),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAV+FGLFLARKV+L RAV YM+AQCLGAICGVGLVKAF K  Y
Sbjct  83   FILVYCTAGISGGHINPAVSFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHPY  142

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A GYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  143  NGLGGGANTVAPGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  202

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DKAWD+H IFWVGPFVGALAAA YHQYILR
Sbjct  203  VFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHRIFWVGPFVGALAAAAYHQYILR  262

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  263  AAAIKALGSFRSN  275



>gb|ACU00102.1| plasma membrane intrinsic protein PIP2.6 [Populus trichocarpa 
x Populus deltoides]
Length=279

 Score =   343 bits (881),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM+AQCLGAICGVGLVKAF K  Y
Sbjct  84   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMMAQCLGAICGVGLVKAFMKKNY  143

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A GYN GT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  144  NSLGGGANTVAMGYNTGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  203

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLAT+PITGTGINPARSF AAVIFN++KAWD+HWIFWVGPFVGALAAA YHQYILR
Sbjct  204  VFMVHLATVPITGTGINPARSFXAAVIFNNEKAWDDHWIFWVGPFVGALAAAAYHQYILR  263

Query  167  GSAIKALGSFRSN  129
             +AI ALGSFRSN
Sbjct  264  AAAIXALGSFRSN  276



>gb|AAG30607.1|AF314656_1 aquaporin [Brassica oleracea]
Length=281

 Score =   343 bits (881),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAG+SGGHINPAVTFGLFLARKV+L RAV YMIAQCLGAICGVG VKAF K+ Y
Sbjct  86   FVLVYCTAGVSGGHINPAVTFGLFLARKVSLVRAVGYMIAQCLGAICGVGFVKAFMKTPY  145

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A GY+KGT LGAEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLPIGFA
Sbjct  146  NTLGGGANTVAPGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFA  205

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N++KAWD+HWIFWVGPFVGALAAA YHQYILR
Sbjct  206  VFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILR  265

Query  167  GSAIKALGSFRSNA  126
             +A+KAL SFRSNA
Sbjct  266  AAAVKALASFRSNA  279



>ref|XP_002881493.1| hypothetical protein ARALYDRAFT_482707 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57752.1| hypothetical protein ARALYDRAFT_482707 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   343 bits (881),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICGVG VKAFQ S+Y
Sbjct  90   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGAN +A GYN GTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  VRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN+ K WD+HWIFWVGPF+GA  AA YHQ++LR
Sbjct  210  VFMVHLATIPITGTGINPARSFGAAVIFNESKPWDDHWIFWVGPFIGAAIAAFYHQFVLR  269

Query  167  GSAIKALGSFRSNA  126
             S  K+LGSFRS A
Sbjct  270  ASGSKSLGSFRSAA  283



>ref|XP_003604054.1| Aquaporin PIP22 [Medicago truncatula]
 gb|AES74305.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=279

 Score =   343 bits (880),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICGVGLVKAF K  Y
Sbjct  84   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGLVKAFMKHPY  143

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A+GY+KG+ LGAE+IGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  144  NHLGGGANFVASGYSKGSALGAEMIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  203

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN+ K WD+HWIFWVGPFVGALAAA YHQYILR
Sbjct  204  VFMVHLATIPITGTGINPARSFGAAVIFNNAKVWDDHWIFWVGPFVGALAAAAYHQYILR  263

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  264  AAAIKALGSFRSN  276



>gb|AAL49750.1|AF452012_1 aquaporin-like protein [Petunia x hybrida]
Length=283

 Score =   343 bits (880),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+ Y+I+Q LGAICGVGLVKAF KS+Y
Sbjct  88   FVLVYCTAGISGGHINPAVTFGLFLARKVSLTRAIAYIISQSLGAICGVGLVKAFMKSYY  147

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN + +GY+ GT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  148  NSLGGGANSVNSGYSNGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  207

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+DK WD+HWIFWVGPFVGALAAA YHQYILR
Sbjct  208  VFMVHLATIPITGTGINPARSFGAAVIYNNDKVWDDHWIFWVGPFVGALAAAAYHQYILR  267

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  268  AAAIKALGSFRSN  280



>gb|AAF65845.1|AF255795_1 aquaporin 1 [Allium cepa]
Length=291

 Score =   343 bits (881),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 165/194 (85%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYMIAQCLGAICGVG VKAFQ ++Y
Sbjct  98   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRALLYMIAQCLGAICGVGFVKAFQSAYY  157

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGAN + AGY+KGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  158  SRYGGGANTLNAGYSKGTGLAAEIIGTFVLVYTVFAATDPKRSARDSHVPVLAPLPIGFA  217

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWD+ WIFWVGPF+GA  AA YHQY+LR
Sbjct  218  VFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAAYHQYVLR  277

Query  167  GSAIKALGSFRSNA  126
              A+KALGSF SNA
Sbjct  278  AGAVKALGSFGSNA  291



>ref|NP_195236.1| plasma membrane intrinsic protein 3 [Arabidopsis thaliana]
 ref|NP_001190920.1| plasma membrane intrinsic protein 3 [Arabidopsis thaliana]
 sp|P93004.2|PIP27_ARATH RecName: Full=Aquaporin PIP2-7; AltName: Full=Plasma membrane 
intrinsic protein 2-7; Short=AtPIP2;7; AltName: Full=Plasma 
membrane intrinsic protein 3; AltName: Full=Salt stress-induced 
major intrinsic protein; Contains: RecName: Full=Aquaporin 
PIP2-7, N-terminally processed [Arabidopsis thaliana]
 gb|AAL06563.1|AF412110_1 AT4g35100/M4E13_150 [Arabidopsis thaliana]
 emb|CAA17774.1| plasma membrane intrinsic protein (SIMIP) [Arabidopsis thaliana]
 emb|CAB80227.1| plasma membrane intrinsic protein (SIMIP) [Arabidopsis thaliana]
 gb|AAL32881.1| plasma membrane intrinsic protein (SIMIP) [Arabidopsis thaliana]
 gb|AAM10142.1| plasma membrane intrinsic protein (SIMIP) [Arabidopsis thaliana]
 gb|AAM66021.1| plasma membrane intrinsic protein SIMIP [Arabidopsis thaliana]
 dbj|BAH30556.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86464.1| plasma membrane intrinsic protein 3 [Arabidopsis thaliana]
 gb|AEE86465.1| plasma membrane intrinsic protein 3 [Arabidopsis thaliana]
Length=280

 Score =   343 bits (880),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+ YMIAQCLGAICGVG VKAF K+ Y
Sbjct  85   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALGYMIAQCLGAICGVGFVKAFMKTPY  144

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A GY+KGT LGAEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLPIGFA
Sbjct  145  NTLGGGANTVADGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFA  204

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N++KAWD+ WIFWVGPF+GALAAA YHQYILR
Sbjct  205  VFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILR  264

Query  167  GSAIKALGSFRSNA  126
             SAIKALGSFRSNA
Sbjct  265  ASAIKALGSFRSNA  278



>ref|XP_002869108.1| hypothetical protein ARALYDRAFT_491143 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45367.1| hypothetical protein ARALYDRAFT_491143 [Arabidopsis lyrata subsp. 
lyrata]
Length=280

 Score =   343 bits (880),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+ YMIAQCLGAICGVG VKAF K+ Y
Sbjct  85   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALGYMIAQCLGAICGVGFVKAFMKTPY  144

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A GY+KGT LGAEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLPIGFA
Sbjct  145  NTLGGGANTVADGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFA  204

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N++KAWD+ WIFWVGPF+GALAAA YHQYILR
Sbjct  205  VFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILR  264

Query  167  GSAIKALGSFRSNA  126
             SAIKALGSFRSNA
Sbjct  265  ASAIKALGSFRSNA  278



>ref|XP_009126591.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=283

 Score =   343 bits (880),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L R VLY++AQCLGAICG GLVKAFQ S+Y
Sbjct  90   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGAN++A GYNKGTGLGAEIIGTFVLVY VF+ATDPKR+ARDSH+PVLAPLPIGFA
Sbjct  150  NRYGGGANQLAEGYNKGTGLGAEIIGTFVLVYPVFAATDPKRSARDSHIPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
             FMVHLATIPITGTGINPARSFGAAVI+N +KAWD+ WIFWVGP +GA AAA+YHQ++LR
Sbjct  210  AFMVHLATIPITGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAAALYHQFVLR  269

Query  167  GSAIKALGSFRSNA  126
             + IK+LGSFRS+A
Sbjct  270  AAGIKSLGSFRSSA  283



>ref|XP_011045923.1| PREDICTED: probable aquaporin PIP2-8 [Populus euphratica]
Length=279

 Score =   343 bits (879),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM+AQCLGA+CGVGLVKAF K +Y
Sbjct  84   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVGYMVAQCLGAVCGVGLVKAFMKPYY  143

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A GY+ GT LGAEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLPIGFA
Sbjct  144  NSLGGGANTVAPGYSTGTALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFA  203

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI ND KAWD+HWIFWVGPFVGALAAA YHQYILR
Sbjct  204  VFMVHLATIPITGTGINPARSFGAAVIINDKKAWDDHWIFWVGPFVGALAAAAYHQYILR  263

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRS+
Sbjct  264  AAAIKALGSFRSH  276



>ref|XP_008377729.1| PREDICTED: probable aquaporin PIP2-8 [Malus domestica]
Length=281

 Score =   343 bits (879),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV YM+AQCLGAI GVGLVKAFQK  Y
Sbjct  86   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAIVGVGLVKAFQKHKY  145

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A+GY+KGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  146  NSVGGGANSVASGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  205

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VF+VHLATIPITGTGINPARSFGAAVI+N+DK WD+HWIFWVGPFVGALAAA YHQYILR
Sbjct  206  VFIVHLATIPITGTGINPARSFGAAVIYNNDKIWDDHWIFWVGPFVGALAAAAYHQYILR  265

Query  167  GSAIKALGSFRSN  129
             +A+KALGSFRSN
Sbjct  266  AAALKALGSFRSN  278



>gb|KFK30134.1| hypothetical protein AALP_AA7G221400 [Arabis alpina]
Length=282

 Score =   343 bits (879),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV YMI+QCLGAICGVG VKAF K+ Y
Sbjct  87   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVGYMISQCLGAICGVGFVKAFMKTPY  146

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A GYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLPIGFA
Sbjct  147  NTLGGGANMVADGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFA  206

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N++KAWD+ WIFWVGPF+GALAAA YHQYILR
Sbjct  207  VFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILR  266

Query  167  GSAIKALGSFRSNA  126
             +A+KALGSFRSNA
Sbjct  267  AAAVKALGSFRSNA  280



>ref|XP_011031744.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   343 bits (880),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV+YM+AQCLGAICGVGLVKAFQKS+Y
Sbjct  90   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVMYMVAQCLGAICGVGLVKAFQKSYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             +Y GGAN +A GY+ GTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  150  TKYQGGANILADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVI+N++KAWD+ WIFWVGPF+GA  AA YHQ+ILR
Sbjct  210  VFMVHLATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILR  269

Query  167  GSAIKALGSFRSN  129
              AIKALGSFRSN
Sbjct  270  AGAIKALGSFRSN  282



>ref|NP_181254.1| aquaporin PIP2-2 [Arabidopsis thaliana]
 sp|P43287.2|PIP22_ARATH RecName: Full=Aquaporin PIP2-2; AltName: Full=Plasma membrane 
intrinsic protein 2-2; Short=AtPIP2;2; AltName: Full=Plasma 
membrane intrinsic protein 2b; Short=PIP2b; AltName: Full=TMP2b; 
Contains: RecName: Full=Aquaporin PIP2-2, N-terminally 
processed [Arabidopsis thaliana]
 gb|AAD18142.1| aquaporin (plasma membrane intrinsic protein 2B) [Arabidopsis 
thaliana]
 gb|AEC09362.1| aquaporin PIP2-2 [Arabidopsis thaliana]
Length=285

 Score =   343 bits (879),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICGVG VKAFQ S+Y
Sbjct  90   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGAN +A GYN GTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  DRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N  K WD+HWIFWVGPF+GA  AA YHQ++LR
Sbjct  210  VFMVHLATIPITGTGINPARSFGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFYHQFVLR  269

Query  167  GSAIKALGSFRSNA  126
             S  K+LGSFRS A
Sbjct  270  ASGSKSLGSFRSAA  283



>gb|KCW55551.1| hypothetical protein EUGRSUZ_I01429 [Eucalyptus grandis]
Length=281

 Score =   343 bits (879),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+ YMIAQCLGAICGVGLVKAF K FY
Sbjct  86   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRALSYMIAQCLGAICGVGLVKAFMKPFY  145

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A GY+ GT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  146  NSLGGGANSVATGYSTGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  205

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+ K WD+ WIFWVGPFVGALAAA YHQYILR
Sbjct  206  VFMVHLATIPITGTGINPARSFGAAVIYNNGKVWDDQWIFWVGPFVGALAAAAYHQYILR  265

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  266  AAAIKALGSFRSN  278



>emb|CAH60723.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score =   343 bits (879),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV+YM+AQCLGAICGVGLVKAFQKS+Y
Sbjct  90   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVMYMVAQCLGAICGVGLVKAFQKSYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             +YGGGAN +A G++ GTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  150  KKYGGGANTLADGFSIGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVI+N DKAWD HWIFWVGPF GA  AA YHQ+ILR
Sbjct  210  VFMVHLATIPITGTGINPARSLGAAVIYNQDKAWDHHWIFWVGPFAGAAIAAFYHQFILR  269

Query  167  GSAIKALGSFRS  132
              A+KALGSFRS
Sbjct  270  AGAVKALGSFRS  281



>ref|NP_001289846.1| probable aquaporin PIP2-1 [Solanum lycopersicum]
 dbj|BAO18629.1| plasmamembrane intrinsic protein 2;6 [Solanum lycopersicum]
Length=287

 Score =   343 bits (879),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM+AQCLGAICGVG VKAFQ ++Y
Sbjct  94   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAILYMVAQCLGAICGVGFVKAFQSAYY  153

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGG N MA G+ KG GL AEIIGTFVLVY VFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  154  NRYGGGVNVMAGGHTKGVGLAAEIIGTFVLVYVVFSATDPKRSARDSHVPVLAPLPIGFA  213

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN DKAWD+HWIFWVGPF GA  AAVY QYI R
Sbjct  214  VFMVHLATIPITGTGINPARSFGAAVIFNGDKAWDDHWIFWVGPFFGAFIAAVYPQYIFR  273

Query  167  GSAIKALGSFRSNA  126
              AIKALGSFRSNA
Sbjct  274  AGAIKALGSFRSNA  287



>ref|XP_010107541.1| Aquaporin PIP2-2 [Morus notabilis]
 gb|EXC16223.1| Aquaporin PIP2-2 [Morus notabilis]
Length=286

 Score =   343 bits (879),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L R +LY+ AQCLGAICG GLVKAFQ S+Y
Sbjct  91   FILVYCTAGISGGHINPAVTFGLFLARKVSLVRTILYIAAQCLGAICGCGLVKAFQNSYY  150

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGAN +A GY+ GTGL AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  151  DRYGGGANSLADGYSNGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  210

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DK WD+HWIFWVGPF+GA  AA+YHQYILR
Sbjct  211  VFMVHLATIPITGTGINPARSFGAAVIYNKDKPWDDHWIFWVGPFIGAAIAALYHQYILR  270

Query  167  GSAIKALGSFRSNA  126
             +A+KALGSFRS++
Sbjct  271  AAAVKALGSFRSSS  284



>ref|XP_008791535.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=287

 Score =   343 bits (879),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYMIAQCLGAICG GLV+ FQK++Y
Sbjct  95   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRALLYMIAQCLGAICGAGLVRGFQKAYY  154

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE+++GY+KGTGL AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  155  VRYGGGANELSSGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  214

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N +KAWD+ WIFWVGPF+GA  A  YHQY+LR
Sbjct  215  VFMVHLATIPITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAIAEAYHQYVLR  274

Query  167  GSAIKALGSFRS  132
             SA KALGSFRS
Sbjct  275  ASAAKALGSFRS  286



>gb|AFK47400.1| unknown [Lotus japonicus]
Length=287

 Score =   343 bits (879),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM+AQCLGAICGVGLVKAFQKS Y
Sbjct  92   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAILYMVAQCLGAICGVGLVKAFQKSHY  151

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N+YGGGAN +  GY+ GTGLGAEIIGTFVLVYTVFSATDPKR+A DSHVPVLAPLPIGFA
Sbjct  152  NKYGGGANSLNDGYSTGTGLGAEIIGTFVLVYTVFSATDPKRSAGDSHVPVLAPLPIGFA  211

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARSFGAAVIFN  K WD+HWIFWVGPF+GA  AA YHQ+ILR
Sbjct  212  VFMVHLATIPVTGTGINPARSFGAAVIFNQSKPWDDHWIFWVGPFIGAAIAAFYHQFILR  271

Query  167  GSAIKALGSFRSN  129
              A+KALGSFRSN
Sbjct  272  AGAVKALGSFRSN  284



>pdb|2B5F|A Chain A, Crystal Structure Of The Spinach Aquaporin Sopip2;1 
In An Open Conformation To 3.9 Resolution
 pdb|2B5F|B Chain B, Crystal Structure Of The Spinach Aquaporin Sopip2;1 
In An Open Conformation To 3.9 Resolution
 pdb|2B5F|C Chain C, Crystal Structure Of The Spinach Aquaporin Sopip2;1 
In An Open Conformation To 3.9 Resolution
 pdb|2B5F|D Chain D, Crystal Structure Of The Spinach Aquaporin Sopip2;1 
In An Open Conformation To 3.9 Resolution
Length=303

 Score =   343 bits (881),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA++YMIAQCLGAICGVGLVKAF K  Y
Sbjct  86   FVLVYCTAGISGGHINPAVTFGLFLARKVSLLRALVYMIAQCLGAICGVGLVKAFMKGPY  145

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N++GGGAN +A GYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVP+LAPLPIGFA
Sbjct  146  NQFGGGANSVALGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFA  205

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN +K WD+ WIFWVGPF+GA  AA YHQY+LR
Sbjct  206  VFMVHLATIPITGTGINPARSFGAAVIFNSNKVWDDQWIFWVGPFIGAAVAAAYHQYVLR  265

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  266  AAAIKALGSFRSN  278



>ref|NP_001047491.1| Os02g0629200 [Oryza sativa Japonica Group]
 sp|Q6K215.1|PIP22_ORYSJ RecName: Full=Probable aquaporin PIP2-2; AltName: Full=OsPIP2;2; 
AltName: Full=Plasma membrane intrinsic protein 2-2 [Oryza 
sativa Japonica Group]
 dbj|BAD23735.1| putative plasma membrane integral protein [Oryza sativa Japonica 
Group]
 dbj|BAF09405.1| Os02g0629200 [Oryza sativa Japonica Group]
 dbj|BAG88109.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score =   343 bits (879),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 178/194 (92%), Gaps = 1/194 (1%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAVLY+IAQCLGAICGVGLVK FQ S+Y
Sbjct  96   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYIIAQCLGAICGVGLVKGFQSSYY  155

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGANE++ GY+KGTGLGAEIIGTFVLVYTVFSATDPKRNARDSH+PVLAPLPIGFA
Sbjct  156  ARYGGGANELSDGYSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFA  215

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS G AVI+N DKAWD+ WIFWVGP +GA  AA YHQY+LR
Sbjct  216  VFMVHLATIPITGTGINPARSLGTAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLR  275

Query  167  GSAIKALGSFRSNA  126
             SA K LGS+RSNA
Sbjct  276  ASAAK-LGSYRSNA  288



>gb|ACU19125.1| unknown [Glycine max]
Length=287

 Score =   343 bits (879),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFL RKV+L RA+LYMIAQC GAICG GL K FQKS+Y
Sbjct  94   FILVYCTAGISGGHINPAVTFGLFLGRKVSLVRALLYMIAQCAGAICGAGLAKGFQKSYY  153

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGG N ++ GYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  154  NRYGGGVNTVSDGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  213

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIP+TGTGINPARSFG AVIFN+DKAWD+ WI+WVGPFVGA  AA YHQYI R
Sbjct  214  VFMVHLATIPVTGTGINPARSFGPAVIFNNDKAWDDQWIYWVGPFVGAAVAAFYHQYIFR  273

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  274  AAAIKALGSFRSN  286



>gb|ABK93567.1| unknown [Populus trichocarpa]
Length=285

 Score =   343 bits (879),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV+YM+AQCLGAICGVGLVKAFQKS+Y
Sbjct  90   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVMYMVAQCLGAICGVGLVKAFQKSYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             +YGGGAN +A G++ GTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  150  KKYGGGANTLADGFSTGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVI+N DKAWD HWIFWVGPF GA  AA YHQ+ILR
Sbjct  210  VFMVHLATIPITGTGINPARSLGAAVIYNQDKAWDGHWIFWVGPFAGAAIAAFYHQFILR  269

Query  167  GSAIKALGSFRS  132
              A+KALGSFRS
Sbjct  270  AGAVKALGSFRS  281



>ref|XP_006846905.1| hypothetical protein AMTR_s00152p00041700 [Amborella trichopoda]
 gb|ERN08486.1| hypothetical protein AMTR_s00152p00041700 [Amborella trichopoda]
Length=280

 Score =   342 bits (878),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAV+YM+AQCLGAICGVGLVKAF K  Y
Sbjct  85   FILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGVGLVKAFMKPLY  144

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGANE+  GY KG GLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  145  NNLGGGANEVVHGYTKGVGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  204

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N DKAWD+HW+FWVGPFVGA AAA YHQYILR
Sbjct  205  VFMVHLATIPITGTGINPARSFGAAVIYNSDKAWDDHWVFWVGPFVGAAAAAAYHQYILR  264

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  265  AAAIKALGSFRSN  277



>gb|AFB82643.1| aquaporin [Camellia sinensis]
Length=279

 Score =   342 bits (878),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+  MIAQCLGAICGVGLVKAF KS Y
Sbjct  84   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRALACMIAQCLGAICGVGLVKAFMKSSY  143

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A GYNKGT LGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  144  NSLGGGANSVAHGYNKGTALGAEIIGTFVLVYTVFAATDPKRSARDSHVPVLAPLPIGFA  203

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+   WDEHWIFWVGPFVGALAAA YHQYILR
Sbjct  204  VFMVHLATIPITGTGINPARSFGAAVIYNNKHIWDEHWIFWVGPFVGALAAAAYHQYILR  263

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  264  AAAIKALGSFRSN  276



>pdb|1Z98|A Chain A, Crystal Structure Of The Spinach Aquaporin Sopip2;1 
In A Closed Conformation
 pdb|1Z98|M Chain M, Crystal Structure Of The Spinach Aquaporin Sopip2;1 
In A Closed Conformation
 pdb|4IA4|A Chain A, Structure Of The Spinach Aquaporin Sopip2;1 At Ph 6
 pdb|4IA4|B Chain B, Structure Of The Spinach Aquaporin Sopip2;1 At Ph 6
 pdb|4IA4|C Chain C, Structure Of The Spinach Aquaporin Sopip2;1 At Ph 6
 pdb|4IA4|D Chain D, Structure Of The Spinach Aquaporin Sopip2;1 At Ph 6
 pdb|4JC6|A Chain A, Mercury Activation Of The Plant Aquaporin Sopip2;1 - 
Structural And Functional Characterization
 pdb|4JC6|B Chain B, Mercury Activation Of The Plant Aquaporin Sopip2;1 - 
Structural And Functional Characterization
 pdb|4JC6|C Chain C, Mercury Activation Of The Plant Aquaporin Sopip2;1 - 
Structural And Functional Characterization
 pdb|4JC6|D Chain D, Mercury Activation Of The Plant Aquaporin Sopip2;1 - 
Structural And Functional Characterization
 pdb|4JC6|H Chain H, Mercury Activation Of The Plant Aquaporin Sopip2;1 - 
Structural And Functional Characterization
 pdb|4JC6|J Chain J, Mercury Activation Of The Plant Aquaporin Sopip2;1 - 
Structural And Functional Characterization
 pdb|4JC6|L Chain L, Mercury Activation Of The Plant Aquaporin Sopip2;1 - 
Structural And Functional Characterization
 pdb|4JC6|N Chain N, Mercury Activation Of The Plant Aquaporin Sopip2;1 - 
Structural And Functional Characterization
 gb|AAA99274.2| aquaporin [Spinacia oleracea]
Length=281

 Score =   342 bits (878),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA++YMIAQCLGAICGVGLVKAF K  Y
Sbjct  86   FVLVYCTAGISGGHINPAVTFGLFLARKVSLLRALVYMIAQCLGAICGVGLVKAFMKGPY  145

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N++GGGAN +A GYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVP+LAPLPIGFA
Sbjct  146  NQFGGGANSVALGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFA  205

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN +K WD+ WIFWVGPF+GA  AA YHQY+LR
Sbjct  206  VFMVHLATIPITGTGINPARSFGAAVIFNSNKVWDDQWIFWVGPFIGAAVAAAYHQYVLR  265

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  266  AAAIKALGSFRSN  278



>ref|XP_010516975.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   342 bits (878),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RAVLYM+AQCLGAICGVG VKAFQ ++Y
Sbjct  90   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSAYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             RYGGGAN +A GYN GTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  150  VRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVIFN+ K WD+HWIFWVGPF+GA  AA YHQ++LR
Sbjct  210  VFMVHLATIPITGTGINPARSFGAAVIFNESKPWDDHWIFWVGPFIGAAIAAFYHQFVLR  269

Query  167  GSAIKALGSFRSNA  126
             S  K+LGSFRS A
Sbjct  270  ASGSKSLGSFRSAA  283



>gb|AAL49751.1|AF452013_1 aquaporin-like protein [Petunia x hybrida]
Length=256

 Score =   341 bits (875),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 181/194 (93%), Gaps = 1/194 (1%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAF-QKSF  531
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV Y+I+QCLGAICGVGLVKAF  K +
Sbjct  60   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYIISQCLGAICGVGLVKAFMNKHY  119

Query  530  YNRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGF  351
            YN  GGGANE+A+GYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGF
Sbjct  120  YNSLGGGANEVASGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGF  179

Query  350  AVFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYIL  171
            AVFMVHLATIPITGTGINPARSFGAAVI+N DKAWD+ WIFWVGPF+GAL AA+YHQ++L
Sbjct  180  AVFMVHLATIPITGTGINPARSFGAAVIYNQDKAWDDQWIFWVGPFIGALIAALYHQFVL  239

Query  170  RGSAIKALGSFRSN  129
            R  A+KALGSFRSN
Sbjct  240  RAGAVKALGSFRSN  253



>ref|XP_002316367.1| putative aquaporin family protein [Populus trichocarpa]
 gb|ABK92446.1| unknown [Populus trichocarpa]
 gb|EEF02538.1| putative aquaporin family protein [Populus trichocarpa]
Length=285

 Score =   342 bits (878),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV+YM+AQCLGAICGVGLVKAFQKS+Y
Sbjct  90   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVMYMVAQCLGAICGVGLVKAFQKSYY  149

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
             +YGGGAN +A G++ GTGLGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  150  KKYGGGANTLADGFSTGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  209

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVI+N DKAWD HWIFWVGPF GA  AA YHQ+ILR
Sbjct  210  VFMVHLATIPITGTGINPARSLGAAVIYNQDKAWDGHWIFWVGPFAGAAIAAFYHQFILR  269

Query  167  GSAIKALGSFRS  132
              A+KALGSFRS
Sbjct  270  AGAVKALGSFRS  281



>gb|AAD31846.1|AF133530_1 water channel protein MipH [Mesembryanthemum crystallinum]
Length=291

 Score =   342 bits (878),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARK++L RA++YM+AQCLGAICGVG VKAFQ ++Y
Sbjct  95   FILVYCTAGISGGHINPAVTFGLFLARKLSLIRAIMYMVAQCLGAICGVGFVKAFQSAYY  154

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N+YGGGANE++ GY+KGTGL AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  155  NKYGGGANELSVGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  214

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVI+N++KAWD+ WIFWVGPF+GA  AA+YHQYILR
Sbjct  215  VFMVHLATIPITGTGINPARSLGAAVIYNNNKAWDDQWIFWVGPFIGAAIAAIYHQYILR  274

Query  167  GSAIKALGSFRSN  129
               IKALGSFRS+
Sbjct  275  AGFIKALGSFRSS  287



>gb|AGD98705.1| aquaporin [Camellia sinensis]
Length=283

 Score =   342 bits (878),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV YMIAQCLGAICGVGLVKAF K  Y
Sbjct  88   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVSYMIAQCLGAICGVGLVKAFMKHNY  147

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A GYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  148  NSLGGGANLIAPGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  207

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+ K W +HWIFWVGPFVGA+AAA YHQYILR
Sbjct  208  VFMVHLATIPITGTGINPARSFGAAVIYNNKKVWGQHWIFWVGPFVGAMAAAAYHQYILR  267

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  268  AAAIKALGSFRSN  280



>emb|CDY09192.1| BnaA02g06180D [Brassica napus]
Length=259

 Score =   341 bits (875),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 182/195 (93%), Gaps = 1/195 (1%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+  R VLY++AQCLGAICG GLVKAFQ S+Y
Sbjct  65   FVLVYCTAGISGGHINPAVTFGLFLARKVSFVRTVLYIVAQCLGAICGCGLVKAFQSSYY  124

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            NRYGGGAN++A GYNKGTGLGAEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLPIGFA
Sbjct  125  NRYGGGANQLAEGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFA  184

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAW-DEHWIFWVGPFVGALAAAVYHQYIL  171
            VFMVHLATIPITGTGINPARSFGAAVI+N +KAW D+ WIFWVGP +GA AAA+YHQ++L
Sbjct  185  VFMVHLATIPITGTGINPARSFGAAVIYNQEKAWDDQQWIFWVGPMIGAAAAALYHQFVL  244

Query  170  RGSAIKALGSFRSNA  126
            R + IK+LGSFRS+A
Sbjct  245  RAAGIKSLGSFRSSA  259



>emb|CDX72515.1| BnaC07g45370D [Brassica napus]
Length=254

 Score =   341 bits (874),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV YMIAQCLGAICGVG VKAF K+ Y
Sbjct  59   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVGYMIAQCLGAICGVGFVKAFMKTPY  118

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A GY+ GT LGAEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLPIGFA
Sbjct  119  NTLGGGANMVADGYSNGTALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFA  178

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N++KAWD+HWIFWVGPFVGALAAA YHQYILR
Sbjct  179  VFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILR  238

Query  167  GSAIKALGSFRSNA  126
             +A+KAL SFRSNA
Sbjct  239  AAAVKALASFRSNA  252



>dbj|BAD90701.1| plasma membrane intrinsic protein 2;5 [Mimosa pudica]
Length=281

 Score =   342 bits (877),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+ YM+AQCLGAICG GLVKAF K  Y
Sbjct  86   FVLVYCTAGISGGHINPAVTFGLFLARKVSLIRALAYMVAQCLGAICGTGLVKAFMKHSY  145

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGANE+ +GY+KGT LGAEIIGTFVLVYTVFSA DPKR+ARDSHVPVLAPLPIGFA
Sbjct  146  NSLGGGANEVNSGYSKGTALGAEIIGTFVLVYTVFSAIDPKRSARDSHVPVLAPLPIGFA  205

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N+ KAWD+HWIFWVGPFVGALAAA YHQYILR
Sbjct  206  VFMVHLATIPITGTGINPARSFGAAVIYNNGKAWDDHWIFWVGPFVGALAAAAYHQYILR  265

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  266  AAAIKALGSFRSN  278



>gb|ABL76066.1| aquaporin 2 [Bruguiera gymnorhiza]
Length=280

 Score =   342 bits (877),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVTFGLFLARKV+L RA+ YM+AQCLGAICGVGLVKAF K  Y
Sbjct  85   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRALAYMVAQCLGAICGVGLVKAFMKHSY  144

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN + AGYNKGT LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFA
Sbjct  145  NSLGGGANFVNAGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFA  204

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI N+DK WD+ WIFWVGPFVGALAAA YHQYILR
Sbjct  205  VFMVHLATIPITGTGINPARSFGAAVIHNNDKIWDDQWIFWVGPFVGALAAAAYHQYILR  264

Query  167  GSAIKALGSFRSN  129
             +AIKALGSFRSN
Sbjct  265  AAAIKALGSFRSN  277



>emb|CDX69112.1| BnaC01g03410D [Brassica napus]
Length=281

 Score =   342 bits (877),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+L RAV YMIAQCLGAICGVG VKAF K+ Y
Sbjct  86   FVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVGYMIAQCLGAICGVGFVKAFMKTPY  145

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            N  GGGAN +A GY+ GT LGAEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLPIGFA
Sbjct  146  NTLGGGANTVADGYSTGTALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFA  205

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N++KAWD+HWIFWVGPFVGALAAA YHQYILR
Sbjct  206  VFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILR  265

Query  167  GSAIKALGSFRSNA  126
             +A+KAL SFRSNA
Sbjct  266  AAAVKALASFRSNA  279



>ref|XP_004304427.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=287

 Score =   342 bits (877),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            F+LVYCTAGISGGHINPAVTFGLFLARKV+LPRAVLY++AQ LGAICG GLVK+FQ + Y
Sbjct  92   FVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVLYIVAQSLGAICGCGLVKSFQSALY  151

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
              YGGGAN +A GY+KGTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  152  TNYGGGANGLADGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  211

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARSFGAAVI+N++KAWD+HWIFWVGPF+GA  AA+YHQYILR
Sbjct  212  VFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFIGAAIAALYHQYILR  271

Query  167  GSAIKALGSFRSNA  126
              A+KALGSFRS++
Sbjct  272  AGAVKALGSFRSSS  285



>ref|XP_010553324.1| PREDICTED: aquaporin PIP2-2 [Tarenaya hassleriana]
Length=198

 Score =   338 bits (868),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 163/194 (84%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -2

Query  707  FILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGLVKAFQKSFY  528
            FILVYCTAGISGGHINPAVT GL +ARKVTL RAVLYM+AQCLGAICGVGLVK+FQ   Y
Sbjct  3    FILVYCTAGISGGHINPAVTLGLLIARKVTLVRAVLYMVAQCLGAICGVGLVKSFQSGRY  62

Query  527  NRYGGGANEMAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  348
            +RYGGGAN +A GY++GTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA
Sbjct  63   DRYGGGANSLADGYSEGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFA  122

Query  347  VFMVHLATIPITGTGINPARSFGAAVIFNDDKAWDEHWIFWVGPFVGALAAAVYHQYILR  168
            VFMVHLATIPITGTGINPARS GAAVIFN DK WD+HWIFWVGPF+GA  AA YHQY+LR
Sbjct  123  VFMVHLATIPITGTGINPARSLGAAVIFNKDKPWDDHWIFWVGPFIGAAIAAFYHQYVLR  182

Query  167  GSAIKALGSFRSNA  126
             S  K+LGSFRS++
Sbjct  183  ASGSKSLGSFRSSS  196



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1219970116365