BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF036L09

Length=684
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009625446.1|  PREDICTED: sucrose synthase                        233   1e-67   Nicotiana tomentosiformis
ref|XP_009792656.1|  PREDICTED: sucrose synthase                        233   2e-67   Nicotiana sylvestris
gb|ADA68250.1|  sucrose synthase                                        212   2e-66   Schiedea globosa
ref|NP_001275286.1|  sucrose synthase                                   229   3e-66   Solanum tuberosum [potatoes]
dbj|BAN18500.1|  sucrose synthase                                       212   3e-66   Schiedea pentandra
ref|XP_006345244.1|  PREDICTED: uncharacterized LOC102577594            229   4e-66   Solanum tuberosum [potatoes]
emb|CAA09681.1|  sucrose synthase                                       229   4e-66   Solanum lycopersicum
ref|NP_001234655.1|  sucrose synthase                                   229   4e-66   
dbj|BAN18504.1|  sucrose synthase                                       211   5e-66   Schiedea trinervis
gb|AAA97571.1|  sucrose synthase                                        228   7e-66   Solanum tuberosum [potatoes]
sp|P10691.1|SUS1_SOLTU  RecName: Full=Sucrose synthase; AltName: ...    227   2e-65   Solanum tuberosum [potatoes]
gb|ADA68252.1|  sucrose synthase                                        209   3e-65   Honckenya peploides
gb|ADA68251.1|  sucrose synthase                                        209   5e-65   Schiedea membranacea
gb|ABV02029.1|  sucrose sythase                                         225   9e-65   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_006353766.1|  PREDICTED: sucrose synthase 2 isoform X2           225   1e-64   
ref|NP_001274911.1|  sucrose synthase 2                                 225   1e-64   Solanum tuberosum [potatoes]
ref|XP_011093886.1|  PREDICTED: sucrose synthase                        225   1e-64   Sesamum indicum [beniseed]
sp|P49039.1|SUS2_SOLTU  RecName: Full=Sucrose synthase; AltName: ...    225   1e-64   Solanum tuberosum [potatoes]
ref|XP_009589756.1|  PREDICTED: sucrose synthase                        224   2e-64   Nicotiana tomentosiformis
ref|XP_010323602.1|  PREDICTED: sucrose synthase isoform X1             224   2e-64   
gb|AHL84158.1|  sucrose synthase                                        224   2e-64   Nicotiana tabacum [American tobacco]
ref|NP_001234804.1|  sucrose synthase                                   224   2e-64   
gb|ADK98097.1|  sucrose synthase                                        206   4e-64   Schiedea globosa
gb|ADW09901.1|  putative sucrose synthase                               206   8e-64   Schiedea globosa
ref|XP_009760458.1|  PREDICTED: sucrose synthase                        223   8e-64   Nicotiana sylvestris
gb|ADK98109.1|  sucrose synthase                                        205   9e-64   Schiedea globosa
gb|ADW09936.1|  putative sucrose synthase                               205   1e-63   Schiedea globosa
ref|XP_011078145.1|  PREDICTED: sucrose synthase                        222   1e-63   
gb|ADW09933.1|  putative sucrose synthase                               204   2e-63   Schiedea globosa
gb|ADK98101.1|  sucrose synthase                                        204   2e-63   Schiedea globosa
gb|ADW09904.1|  putative sucrose synthase                               204   2e-63   Schiedea globosa
gb|ADK98116.1|  sucrose synthase                                        204   2e-63   Schiedea globosa
gb|ADK98120.1|  sucrose synthase                                        204   4e-63   Schiedea adamantis
gb|ADK98103.1|  sucrose synthase                                        203   5e-63   Schiedea globosa
gb|ADW09903.1|  putative sucrose synthase                               203   6e-63   Schiedea globosa
gb|ADW09926.1|  putative sucrose synthase                               203   6e-63   Schiedea globosa
sp|P49035.1|SUS1_DAUCA  RecName: Full=Sucrose synthase isoform 1;...    220   6e-63   Daucus carota [carrots]
gb|ADK98112.1|  sucrose synthase                                        202   1e-62   Schiedea globosa
emb|CAJ32596.1|  sucrose synthase                                       219   2e-62   Coffea arabica [arabica coffee]
emb|CAI56307.1|  sucrose synthase                                       219   2e-62   Coffea canephora [robusta coffee]
gb|ADW09905.1|  putative sucrose synthase                               202   3e-62   Schiedea globosa
gb|AEN79500.1|  sucrose synthase 1                                      218   7e-62   Phelipanche ramosa
gb|ABI17891.1|  sucrose synthase                                        217   9e-62   Coffea canephora [robusta coffee]
gb|ADW09914.1|  putative sucrose synthase                               200   9e-62   Schiedea globosa
gb|ADW09891.1|  putative sucrose synthase                               200   9e-62   Schiedea membranacea
gb|ADW09895.1|  putative sucrose synthase                               200   1e-61   Schiedea globosa
sp|O49845.1|SUS2_DAUCA  RecName: Full=Sucrose synthase isoform 2;...    215   4e-61   Daucus carota [carrots]
gb|AHL29281.1|  sucrose synthase 1                                      213   3e-60   Camellia sinensis [black tea]
gb|ADW09921.1|  putative sucrose synthase                               197   3e-60   Schiedea globosa
emb|CAA67195.1|  sucrose synthase                                       198   4e-60   Pisum sativum [garden pea]
gb|ADW09887.1|  putative sucrose synthase                               196   4e-60   Schiedea stellarioides
gb|AFS17277.1|  sucrose synthase 1                                      212   7e-60   Amaranthus cruentus/Amaranthus hypocondriacus mixed library
gb|ADW09917.1|  putative sucrose synthase                               196   7e-60   Schiedea globosa
gb|ADR00484.1|  sucrose synthase                                        206   1e-59   Arachis hypogaea var. vulgaris [Spanish peanut]
gb|ADW09918.1|  putative sucrose synthase                               195   1e-59   Schiedea globosa
ref|XP_004508035.1|  PREDICTED: sucrose synthase-like isoform X3        211   2e-59   Cicer arietinum [garbanzo]
gb|AEE60913.1|  nodule-enhanced sucrose synthase                        211   2e-59   Cicer arietinum [garbanzo]
gb|KDP33978.1|  hypothetical protein JCGZ_07549                         210   2e-59   Jatropha curcas
gb|AGH29112.1|  sucrose synthase                                        210   2e-59   Jatropha curcas
ref|XP_004287669.1|  PREDICTED: sucrose synthase                        210   2e-59   Fragaria vesca subsp. vesca
dbj|BAD94975.1|  sucrose-UDP glucosyltransferase                        200   2e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011010969.1|  PREDICTED: sucrose synthase-like isoform X2        210   2e-59   Populus euphratica
ref|XP_011010968.1|  PREDICTED: sucrose synthase-like isoform X1        210   2e-59   Populus euphratica
gb|ADW09907.1|  putative sucrose synthase                               194   2e-59   Schiedea globosa
gb|ADW80565.1|  sucrose synthase 1                                      210   3e-59   Populus tomentosa [Chinese white poplar]
gb|ADW80556.1|  sucrose synthase 1                                      210   3e-59   Populus tomentosa [Chinese white poplar]
gb|ADW80541.1|  sucrose synthase 1                                      210   3e-59   Populus tomentosa [Chinese white poplar]
gb|ADW80534.1|  sucrose synthase 1                                      210   3e-59   Populus tomentosa [Chinese white poplar]
gb|ADW80570.1|  sucrose synthase 1                                      210   3e-59   Populus tomentosa [Chinese white poplar]
gb|ADW80559.1|  sucrose synthase 1                                      210   3e-59   Populus tomentosa [Chinese white poplar]
gb|ADW80548.1|  sucrose synthase 1                                      210   3e-59   Populus tomentosa [Chinese white poplar]
gb|ADW80540.1|  sucrose synthase 1                                      210   3e-59   Populus tomentosa [Chinese white poplar]
gb|ADW80546.1|  sucrose synthase 1                                      210   3e-59   Populus tomentosa [Chinese white poplar]
gb|ADW80539.1|  sucrose synthase 1                                      210   3e-59   Populus tomentosa [Chinese white poplar]
gb|ADW80562.1|  sucrose synthase 1                                      210   3e-59   Populus tomentosa [Chinese white poplar]
gb|ADW80558.1|  sucrose synthase 1                                      210   3e-59   Populus tomentosa [Chinese white poplar]
gb|ADV71181.1|  sucrose synthase 1                                      210   3e-59   Populus tomentosa [Chinese white poplar]
gb|ADW80560.1|  sucrose synthase 1                                      210   3e-59   Populus tomentosa [Chinese white poplar]
gb|ADW80555.1|  sucrose synthase 1                                      210   3e-59   Populus tomentosa [Chinese white poplar]
gb|ADW80543.1|  sucrose synthase 1                                      210   3e-59   Populus tomentosa [Chinese white poplar]
gb|ADW80536.1|  sucrose synthase 1                                      210   3e-59   Populus tomentosa [Chinese white poplar]
gb|ADW80550.1|  sucrose synthase 1                                      210   3e-59   Populus tomentosa [Chinese white poplar]
gb|ADW80563.1|  sucrose synthase 1                                      210   4e-59   Populus tomentosa [Chinese white poplar]
gb|ADW80551.1|  sucrose synthase 1                                      210   4e-59   Populus tomentosa [Chinese white poplar]
gb|ADW80535.1|  sucrose synthase 1                                      210   4e-59   Populus tomentosa [Chinese white poplar]
gb|ADW80552.1|  sucrose synthase 1                                      210   4e-59   Populus tomentosa [Chinese white poplar]
gb|ADW80549.1|  sucrose synthase 1                                      210   4e-59   Populus tomentosa [Chinese white poplar]
gb|ADW80566.1|  sucrose synthase 1                                      209   4e-59   Populus tomentosa [Chinese white poplar]
gb|ADW80571.1|  sucrose synthase 1                                      209   4e-59   Populus tomentosa [Chinese white poplar]
gb|KJB65372.1|  hypothetical protein B456_010G092300                    209   5e-59   Gossypium raimondii
gb|ABD61653.1|  sucrose synthase                                        209   6e-59   Cichorium intybus [radicchio]
ref|XP_007012546.1|  Sucrose synthase 4 isoform 1                       209   7e-59   Theobroma cacao [chocolate]
ref|XP_007012547.1|  Sucrose synthase 4 isoform 2                       209   8e-59   
gb|AIJ28960.1|  sucrose synthase                                        209   9e-59   Manihot esculenta subsp. flabellifolia
ref|XP_003551045.1|  PREDICTED: sucrose synthase-like isoform X1        208   1e-58   
gb|KHN17754.1|  Sucrose synthase                                        208   1e-58   Glycine soja [wild soybean]
gb|AFO84090.1|  sucrose synthase                                        208   1e-58   Actinidia chinensis
gb|KJB82966.1|  hypothetical protein B456_013G222400                    208   2e-58   Gossypium raimondii
gb|AEV40460.1|  sucrose synthase 1                                      208   2e-58   Gossypium arboreum [tree cotton]
gb|KHG00606.1|  Sucrose synthase                                        208   2e-58   Gossypium arboreum [tree cotton]
dbj|BAM68521.1|  sucrose synthase                                       207   2e-58   Mangifera indica
dbj|BAM37539.1|  sucrose synthase                                       207   2e-58   Mangifera indica
gb|AHA41509.1|  sucrose synthase                                        207   2e-58   Populus deltoides
ref|XP_007154543.1|  hypothetical protein PHAVU_003G127500g             207   2e-58   Phaseolus vulgaris [French bean]
gb|ADW80545.1|  sucrose synthase 1                                      207   2e-58   Populus tomentosa [Chinese white poplar]
dbj|BAA88905.1|  sucrose synthase                                       207   2e-58   Citrus unshiu [satsuma mandarin]
gb|AAN76498.1|AF315375_1  sucrose synthase                              207   3e-58   Phaseolus vulgaris [French bean]
gb|KDO73788.1|  hypothetical protein CISIN_1g003661mg                   207   3e-58   Citrus sinensis [apfelsine]
ref|XP_006474580.1|  PREDICTED: sucrose synthase-like isoform X1        207   3e-58   Citrus sinensis [apfelsine]
dbj|BAA89049.1|  sucrose synthase                                       207   3e-58   Citrus unshiu [satsuma mandarin]
ref|XP_006452883.1|  hypothetical protein CICLE_v10007483mg             207   3e-58   Citrus clementina [clementine]
gb|AEV40463.1|  sucrose synthase 4                                      207   4e-58   Gossypium arboreum [tree cotton]
gb|AEV40464.1|  sucrose synthase 5                                      206   5e-58   Gossypium arboreum [tree cotton]
gb|AEQ94149.1|  sucrose synthase1                                       194   6e-58   Elaeis guineensis
gb|AFK45264.1|  unknown                                                 192   8e-58   Medicago truncatula
gb|AEF56625.1|  sucrose synthase                                        206   9e-58   Arachis hypogaea var. vulgaris [Spanish peanut]
gb|ADR81996.1|  sucrose synthase 1                                      206   1e-57   Populus trichocarpa [western balsam poplar]
ref|XP_002324136.2|  sucrose synthase family protein                    206   1e-57   
gb|ADW09927.1|  putative sucrose synthase                               190   1e-57   Schiedea globosa
dbj|BAM68527.1|  sucrose synthase                                       206   1e-57   Mangifera indica
dbj|BAM68520.1|  sucrose synthase                                       206   1e-57   Mangifera indica
ref|XP_003609947.1|  Sucrose synthase                                   202   1e-57   
gb|ADW09923.1|  putative sucrose synthase                               190   1e-57   Schiedea globosa
emb|CAB39757.2|  sucrose synthase                                       194   2e-57   Lotus japonicus
gb|AEN71067.1|  sucrose synthase Sus1                                   205   2e-57   Gossypium tomentosum
gb|ACV72640.1|  sucrose synthase 1                                      205   2e-57   Gossypium hirsutum [American cotton]
gb|AAC28107.1|  nodule-enhanced sucrose synthase                        205   2e-57   Pisum sativum [garden pea]
emb|CAA09910.1|  sucrose synthase                                       205   2e-57   Pisum sativum [garden pea]
dbj|BAM68526.1|  sucrose synthase                                       205   2e-57   Mangifera indica
gb|AEN71079.1|  sucrose synthase Sus1                                   205   2e-57   Gossypium aridum
gb|AEN71059.1|  sucrose synthase Sus1                                   205   2e-57   Gossypium thurberi
gb|ADY68845.1|  sucrose synthase                                        205   2e-57   Gossypium barbadense [Egyptian cotton]
gb|AEN71078.1|  sucrose synthase Sus1                                   205   2e-57   Gossypium klotzschianum
gb|AEK81520.1|  sucrose synthase isoform B                              205   2e-57   Gossypium hirsutum [American cotton]
gb|AEN71075.1|  sucrose synthase Sus1                                   205   2e-57   Gossypium armourianum
gb|AEN71061.1|  sucrose synthase Sus1                                   205   2e-57   Gossypium schwendimanii
gb|AEN71068.1|  sucrose synthase Sus1                                   205   2e-57   Gossypium tomentosum
sp|P31926.1|SUSY_VICFA  RecName: Full=Sucrose synthase; AltName: ...    205   2e-57   Vicia faba [broad bean]
gb|AEK81522.1|  sucrose synthase isoform D                              205   2e-57   Gossypium hirsutum [American cotton]
gb|AEN71080.1|  sucrose synthase Sus1                                   205   2e-57   Gossypium gossypioides
gb|AEN71066.1|  sucrose synthase Sus1                                   205   2e-57   Gossypium darwinii
gb|AAD28641.1|  sucrose synthase                                        205   2e-57   Gossypium hirsutum [American cotton]
gb|ADY68844.1|  sucrose synthase                                        205   2e-57   Gossypium barbadense [Egyptian cotton]
gb|AEN71063.1|  sucrose synthase Sus1                                   205   2e-57   Gossypium mustelinum
gb|ADY68848.1|  sucrose synthase                                        204   2e-57   Gossypium hirsutum [American cotton]
gb|AEV40462.1|  sucrose synthase 3                                      204   2e-57   Gossypium arboreum [tree cotton]
gb|ADY68846.1|  sucrose synthase                                        204   2e-57   Gossypium herbaceum subsp. africanum
gb|AAR03498.1|  sucrose synthase                                        204   3e-57   Populus tremuloides
gb|AIJ28962.1|  sucrose synthase                                        204   3e-57   Manihot esculenta [manioc]
gb|AAR19769.1|  sucrose synthase                                        204   3e-57   Beta vulgaris [beet]
ref|XP_010687574.1|  PREDICTED: sucrose synthase                        204   3e-57   
ref|XP_010047438.1|  PREDICTED: sucrose synthase                        204   3e-57   Eucalyptus grandis [rose gum]
ref|XP_002877269.1|  hypothetical protein ARALYDRAFT_484788             204   4e-57   
emb|CAN82840.1|  hypothetical protein VITISV_024563                     204   4e-57   Vitis vinifera
gb|AGM14949.1|  sucrose synthase 4                                      204   5e-57   Hevea brasiliensis [jebe]
ref|XP_002275155.1|  PREDICTED: sucrose synthase                        204   5e-57   Vitis vinifera
gb|AAK59464.1|  putative sucrose synthase                               200   5e-57   Arabidopsis thaliana [mouse-ear cress]
gb|ABP88869.1|  sucrose synthase                                        204   5e-57   Medicago falcata [sickle alfalfa]
ref|XP_010271909.1|  PREDICTED: sucrose synthase                        204   5e-57   Nelumbo nucifera [Indian lotus]
ref|XP_010247458.1|  PREDICTED: sucrose synthase                        204   5e-57   Nelumbo nucifera [Indian lotus]
gb|AIJ28961.1|  sucrose synthase                                        204   6e-57   Manihot esculenta [manioc]
gb|ABD96570.1|  sucrose synthase                                        203   7e-57   Manihot esculenta [manioc]
gb|AGM14948.1|  sucrose synthase 3                                      203   8e-57   Hevea brasiliensis [jebe]
ref|NP_001237525.1|  sucrose synthase                                   203   8e-57   Glycine max [soybeans]
gb|AGO61958.1|  sucrose synthase                                        197   9e-57   Prunus serrulata
gb|ADR81997.1|  sucrose synthase 2                                      203   9e-57   Populus trichocarpa [western balsam poplar]
ref|XP_006381564.1|  sucrose synthase family protein                    203   9e-57   Populus trichocarpa [western balsam poplar]
ref|NP_001289655.1|  sucrose synthase                                   203   1e-56   Eucalyptus grandis [rose gum]
sp|O65026.1|SUSY_MEDSA  RecName: Full=Sucrose synthase; AltName: ...    202   1e-56   Medicago sativa [alfalfa]
ref|XP_010535796.1|  PREDICTED: sucrose synthase 4                      202   1e-56   Tarenaya hassleriana [spider flower]
gb|EYU25805.1|  hypothetical protein MIMGU_mgv1a001207mg                202   1e-56   Erythranthe guttata [common monkey flower]
gb|AEN71060.1|  sucrose synthase Sus1                                   202   2e-56   Gossypium laxum
ref|XP_006290612.1|  hypothetical protein CARUB_v10016702mg             202   2e-56   Capsella rubella
gb|ADW80586.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
emb|CAB40795.1|  sucrose synthase                                       202   2e-56   Medicago truncatula
gb|ADW80611.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80589.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80587.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80580.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80593.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80592.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80609.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80600.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80575.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADV71182.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80606.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80584.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80591.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80581.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80608.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80585.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80607.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80604.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80588.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80578.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80610.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80595.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80574.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80582.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80576.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
ref|XP_003609949.1|  Sucrose synthase                                   202   2e-56   Medicago truncatula
gb|ADW80598.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80590.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80605.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80597.1|  sucrose synthase 2                                      202   2e-56   Populus tomentosa [Chinese white poplar]
gb|AIJ28959.1|  sucrose synthase                                        202   2e-56   Manihot esculenta subsp. flabellifolia
gb|ABW76422.1|  sucrose synthase                                        202   2e-56   Populus tremuloides
gb|ADW80596.1|  sucrose synthase 2                                      202   3e-56   Populus tomentosa [Chinese white poplar]
ref|XP_007138617.1|  hypothetical protein PHAVU_009G223800g             202   3e-56   Phaseolus vulgaris [French bean]
ref|XP_010420928.1|  PREDICTED: sucrose synthase 1-like                 201   3e-56   Camelina sativa [gold-of-pleasure]
gb|ADW80602.1|  sucrose synthase 2                                      201   3e-56   Populus tomentosa [Chinese white poplar]
ref|XP_010454391.1|  PREDICTED: sucrose synthase 1-like isoform X2      201   3e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010454392.1|  PREDICTED: sucrose synthase 1-like isoform X3      201   3e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010493195.1|  PREDICTED: sucrose synthase 1                      201   3e-56   Camelina sativa [gold-of-pleasure]
emb|CDX70945.1|  BnaC03g10290D                                          201   4e-56   
ref|XP_010454390.1|  PREDICTED: sucrose synthase 1-like isoform X1      201   4e-56   Camelina sativa [gold-of-pleasure]
ref|XP_008337809.1|  PREDICTED: sucrose synthase                        201   4e-56   Malus domestica [apple tree]
ref|XP_003609946.1|  Sucrose synthase                                   202   4e-56   
ref|XP_009120766.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...    201   4e-56   Brassica rapa
emb|CDX92432.1|  BnaA10g14710D                                          201   4e-56   
gb|KHN49081.1|  Sucrose synthase                                        201   4e-56   Glycine soja [wild soybean]
ref|XP_011039917.1|  PREDICTED: sucrose synthase                        201   4e-56   Populus euphratica
ref|XP_003546526.1|  PREDICTED: sucrose synthase-like isoform X1        201   4e-56   
gb|AII19313.1|  sucrose synthase 1                                      201   5e-56   Ricinus communis
ref|XP_010520519.1|  PREDICTED: sucrose synthase 4-like                 201   5e-56   Tarenaya hassleriana [spider flower]
ref|XP_002516210.1|  sucrose synthase, putative                         201   6e-56   
emb|CDY16569.1|  BnaC09g37040D                                          201   6e-56   Brassica napus [oilseed rape]
sp|P49034.1|SUSY_ALNGL  RecName: Full=Sucrose synthase; AltName: ...    201   6e-56   Alnus glutinosa
ref|XP_003533802.1|  PREDICTED: sucrose synthase-like isoform X1        201   6e-56   Glycine max [soybeans]
ref|NP_566865.2|  sucrose synthase 4                                    201   7e-56   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA45272.1|  TPA: putative sucrose synthase family protein          191   7e-56   
ref|NP_197583.1|  sucrose synthase 1                                    201   7e-56   Arabidopsis thaliana [mouse-ear cress]
gb|ADW80603.1|  sucrose synthase 2                                      200   7e-56   Populus tomentosa [Chinese white poplar]
gb|KHN47619.1|  Sucrose synthase                                        200   7e-56   Glycine soja [wild soybean]
sp|Q01390.1|SUSY_VIGRR  RecName: Full=Sucrose synthase; AltName: ...    200   7e-56   Vigna radiata var. radiata [golden gram]
pdb|3S28|A  Chain A, The Crystal Structure Of Sucrose Synthase-1 ...    200   8e-56   Arabidopsis thaliana [mouse-ear cress]
gb|ADW80599.1|  sucrose synthase 2                                      200   8e-56   Populus tomentosa [Chinese white poplar]
gb|AGQ57012.1|  sucrose synthase 1                                      200   8e-56   Hevea brasiliensis [jebe]
gb|ADW80579.1|  sucrose synthase 2                                      200   8e-56   Populus tomentosa [Chinese white poplar]
dbj|BAH56282.1|  sucrose synthase                                       200   8e-56   Vigna angularis [azuki bean]
ref|XP_009131818.1|  PREDICTED: sucrose synthase 1                      200   9e-56   Brassica rapa
gb|ADW80601.1|  sucrose synthase 2                                      200   9e-56   Populus tomentosa [Chinese white poplar]
gb|ADW80577.1|  sucrose synthase 2                                      200   9e-56   Populus tomentosa [Chinese white poplar]
ref|XP_006287059.1|  hypothetical protein CARUB_v10000208mg             200   1e-55   
gb|AFI57908.1|  sucrose synthase 1                                      199   1e-55   Prunus persica
ref|XP_008382924.1|  PREDICTED: sucrose synthase-like                   199   2e-55   
emb|CDX88838.1|  BnaA03g08110D                                          199   2e-55   
ref|XP_008349074.1|  PREDICTED: sucrose synthase-like                   199   2e-55   
ref|XP_008242292.1|  PREDICTED: sucrose synthase                        199   2e-55   Prunus mume [ume]
ref|XP_007204649.1|  hypothetical protein PRUPE_ppa001535mg             199   2e-55   Prunus persica
gb|ACP17902.1|  sucrose synthase                                        199   2e-55   Phaseolus vulgaris [French bean]
gb|ACF85812.1|  unknown                                                 184   2e-55   Zea mays [maize]
ref|XP_008338289.1|  PREDICTED: sucrose synthase-like                   199   2e-55   
ref|XP_009348897.1|  PREDICTED: sucrose synthase-like                   199   2e-55   Pyrus x bretschneideri [bai li]
ref|XP_009348896.1|  PREDICTED: sucrose synthase-like                   199   3e-55   Pyrus x bretschneideri [bai li]
gb|ADW80583.1|  sucrose synthase 2                                      199   3e-55   Populus tomentosa [Chinese white poplar]
gb|KJB65376.1|  hypothetical protein B456_010G092300                    198   4e-55   Gossypium raimondii
ref|XP_006400648.1|  hypothetical protein EUTSA_v10012719mg             198   5e-55   Eutrema salsugineum [saltwater cress]
gb|KEH37657.1|  sucrose synthase                                        198   6e-55   Medicago truncatula
ref|XP_008797380.1|  PREDICTED: sucrose synthase 1-like isoform X2      198   6e-55   Phoenix dactylifera
gb|AIL23782.1|  sucrose synthase                                        198   6e-55   Prunus serrulata
gb|AGV22112.1|  sucrose synthase 2                                      197   6e-55   Betula luminifera [liang ye hua]
tpg|DAA45273.1|  TPA: putative sucrose synthase family protein          191   7e-55   
ref|XP_008391777.1|  PREDICTED: sucrose synthase-like isoform X1        197   7e-55   
ref|XP_009343356.1|  PREDICTED: sucrose synthase-like                   197   7e-55   Pyrus x bretschneideri [bai li]
ref|XP_008391788.1|  PREDICTED: sucrose synthase-like isoform X2        197   8e-55   
pdb|3S27|A  Chain A, The Crystal Structure Of Sucrose Synthase-1 ...    197   9e-55   Arabidopsis thaliana [mouse-ear cress]
emb|CDO97805.1|  unnamed protein product                                197   9e-55   Coffea canephora [robusta coffee]
ref|XP_008797379.1|  PREDICTED: sucrose synthase 1-like isoform X1      197   1e-54   
ref|XP_002874016.1|  hypothetical protein ARALYDRAFT_910122             197   1e-54   Arabidopsis lyrata subsp. lyrata
sp|Q41608.1|SUS1_TULGE  RecName: Full=Sucrose synthase 1; AltName...    197   1e-54   Tulipa gesneriana
ref|XP_010107074.1|  Sucrose synthase                                   197   1e-54   Morus notabilis
ref|XP_008783129.1|  PREDICTED: sucrose synthase 1-like isoform X1      197   2e-54   Phoenix dactylifera
ref|XP_008783137.1|  PREDICTED: sucrose synthase 1-like isoform X2      197   2e-54   Phoenix dactylifera
emb|CAA57881.1|  sucrose synthase                                       196   2e-54   Oxybasis rubra [pigweed]
ref|XP_004508033.1|  PREDICTED: sucrose synthase-like isoform X1        196   2e-54   
ref|XP_009343357.1|  PREDICTED: sucrose synthase                        196   3e-54   Pyrus x bretschneideri [bai li]
sp|Q41607.1|SUS2_TULGE  RecName: Full=Sucrose synthase 2; AltName...    195   4e-54   Tulipa gesneriana
gb|ABR25521.1|  sucrose synthase metabolism                             184   5e-54   Oryza sativa Indica Group [Indian rice]
gb|ABK23178.1|  unknown                                                 181   5e-54   
gb|AAM22755.1|  sucrose synthase                                        182   6e-54   
ref|XP_010917399.1|  PREDICTED: sucrose synthase 1-like                 195   6e-54   
dbj|BAM05649.1|  sucrose synthase 3                                     195   6e-54   
gb|ACF80843.1|  unknown                                                 182   7e-54   
ref|XP_004488146.1|  PREDICTED: sucrose synthase-like isoform X6        195   7e-54   
ref|XP_010937277.1|  PREDICTED: sucrose synthase 2-like                 195   8e-54   
ref|XP_008450968.1|  PREDICTED: sucrose synthase                        194   9e-54   
gb|AEN83999.1|  sucrose synthase                                        194   9e-54   
gb|KGN66333.1|  hypothetical protein Csa_1G597800                       194   1e-53   
ref|XP_004144053.1|  PREDICTED: sucrose synthase-like                   194   1e-53   
emb|CAA09680.1|  sucrose synthase                                       189   1e-53   
gb|KJB82967.1|  hypothetical protein B456_013G222400                    194   1e-53   
gb|ADM77484.1|  sucrose synthase-like protein                           181   1e-53   
gb|ADM77474.1|  sucrose synthase-like protein                           181   1e-53   
gb|ACF78506.1|  unknown                                                 191   1e-53   
gb|AFM52233.1|  putative sucrose synthase 2                             194   1e-53   
dbj|BAA89232.1|  wsus                                                   194   2e-53   
gb|AFA36485.1|  putative sucrose synthase 2                             184   2e-53   
emb|CAC32462.1|  sucrose synthase isoform 3                             194   2e-53   
ref|XP_010932355.1|  PREDICTED: sucrose synthase 2-like isoform X2      193   2e-53   
ref|XP_010932353.1|  PREDICTED: sucrose synthase 1-like isoform X1      193   2e-53   
gb|AGM14947.1|  sucrose synthase 2                                      193   3e-53   
gb|AAA34305.1|  sucrose synthase type 2                                 182   3e-53   
ref|XP_008795811.1|  PREDICTED: sucrose synthase 4-like                 183   3e-53   
gb|KJB54539.1|  hypothetical protein B456_009G038000                    193   3e-53   
gb|KJB54541.1|  hypothetical protein B456_009G038000                    193   4e-53   
tpg|DAA45279.1|  TPA: putative sucrose synthase family protein          188   4e-53   
emb|CAA50317.1|  sucrose synthase                                       192   4e-53   
dbj|BAM75184.1|  sucrose synthase                                       185   4e-53   
ref|XP_009610442.1|  PREDICTED: sucrose synthase 4-like                 185   4e-53   
ref|XP_010049327.1|  PREDICTED: sucrose synthase-like                   192   5e-53   
ref|NP_001289661.1|  sucrose synthase-like                              192   5e-53   
gb|AGQ57013.1|  sucrose synthase 2                                      192   6e-53   
ref|XP_008783098.1|  PREDICTED: sucrose synthase 1                      192   8e-53   
ref|XP_009410254.1|  PREDICTED: sucrose synthase 1-like                 192   8e-53   
gb|ADY02961.1|  sucrose synthase                                        192   9e-53   
ref|XP_009404100.1|  PREDICTED: sucrose synthase 2                      192   9e-53   
ref|XP_006838088.1|  hypothetical protein AMTR_s00106p00019920          191   1e-52   
ref|XP_008655408.1|  PREDICTED: sucrose synthase 4-like                 191   1e-52   
ref|NP_001268888.1|  sucrose synthase 2-like                            191   1e-52   
gb|ABE73120.1|  SUS1                                                    188   2e-52   
gb|KGN52828.1|  hypothetical protein Csa_4G001950                       191   2e-52   
ref|NP_001105194.1|  sucrose synthase2                                  191   2e-52   
ref|XP_009352312.1|  PREDICTED: sucrose synthase 2-like                 191   2e-52   
gb|AFW88069.1|  sucrose synthase1                                       184   2e-52   
gb|AAA34304.1|  sucrose synthase type 1                                 179   3e-52   
gb|AAM95944.1|  sucrose synthase                                        190   3e-52   
ref|XP_008800466.1|  PREDICTED: sucrose synthase 2                      190   3e-52   
ref|XP_002465303.1|  hypothetical protein SORBIDRAFT_01g035890          190   3e-52   
gb|ADE77562.1|  unknown                                                 181   4e-52   
sp|O24301.1|SUS2_PEA  RecName: Full=Sucrose synthase 2; AltName: ...    190   4e-52   
ref|XP_008454320.1|  PREDICTED: sucrose synthase 2                      190   4e-52   
ref|XP_009380139.1|  PREDICTED: sucrose synthase 2-like                 190   4e-52   
ref|XP_006474683.1|  PREDICTED: sucrose synthase-like                   189   4e-52   
dbj|BAE06059.1|  sucrose synthase                                       190   4e-52   
gb|KJB07349.1|  hypothetical protein B456_001G017700                    189   5e-52   
gb|KDP28192.1|  hypothetical protein JCGZ_13963                         189   5e-52   
ref|XP_010939862.1|  PREDICTED: sucrose synthase 1                      189   6e-52   
dbj|BAM05651.1|  sucrose synthase 3                                     189   6e-52   
dbj|BAM05650.1|  sucrose synthase 3                                     189   7e-52   
ref|XP_010482198.1|  PREDICTED: sucrose synthase 2-like                 176   7e-52   
gb|AEV40461.1|  sucrose synthase 2                                      189   7e-52   
ref|XP_002516963.1|  sucrose synthase, putative                         189   7e-52   
gb|AAL27096.1|  sucrose synthase                                        189   7e-52   
gb|KDO87158.1|  hypothetical protein CISIN_1g003492mg                   188   8e-52   
ref|XP_006444401.1|  hypothetical protein CICLE_v10018889mg             188   8e-52   
gb|ABR15470.1|  sucrose synthase                                        189   8e-52   
gb|KDO87153.1|  hypothetical protein CISIN_1g003492mg                   188   8e-52   
gb|AGW23638.1|  sucrose synthase                                        189   8e-52   
gb|KDO71750.1|  hypothetical protein CISIN_1g003726mg                   189   1e-51   
ref|XP_010051346.1|  PREDICTED: sucrose synthase-like                   189   1e-51   
gb|AGM14950.1|  sucrose synthase 5                                      189   1e-51   
ref|XP_006480003.1|  PREDICTED: sucrose synthase 3-like                 189   1e-51   
ref|XP_006489034.1|  PREDICTED: sucrose synthase 2-like isoform X2      188   1e-51   
gb|KDO87151.1|  hypothetical protein CISIN_1g003492mg                   188   1e-51   
dbj|BAA88904.1|  sucrose synthase                                       188   1e-51   
ref|XP_006444402.1|  hypothetical protein CICLE_v10018889mg             188   1e-51   
ref|XP_008223239.1|  PREDICTED: sucrose synthase 2                      178   1e-51   
ref|XP_006419508.1|  hypothetical protein CICLE_v10004341mg             188   1e-51   
gb|EMT20174.1|  Sucrose synthase 2                                      187   1e-51   
ref|XP_006378062.1|  hypothetical protein POPTR_0010s01360g             182   1e-51   
gb|ABY82048.1|  sucrose synthase                                        182   2e-51   
dbj|BAJ10424.1|  sucrose synthase                                       187   2e-51   
tpg|DAA45281.1|  TPA: putative sucrose synthase family protein          187   2e-51   
gb|ACN36258.1|  unknown                                                 184   2e-51   
gb|AEO09338.2|  sucrose synthase                                        187   3e-51   
gb|KDO73800.1|  hypothetical protein CISIN_1g003947mg                   187   3e-51   
ref|XP_009359754.1|  PREDICTED: sucrose synthase                        187   3e-51   
ref|XP_010092252.1|  Sucrose synthase 2                                 187   3e-51   
ref|XP_006452875.1|  hypothetical protein CICLE_v10010343mg             187   4e-51   
gb|AHM02468.1|  sucrose synthase                                        187   4e-51   
gb|EMS65561.1|  Sucrose synthase 2                                      187   5e-51   
gb|AJA37527.1|  sucrose synthase                                        187   5e-51   
gb|AFY03626.1|  sucrose synthase                                        187   5e-51   
gb|AAL50570.1|AF412037_1  sucrose synthase                              187   6e-51   
ref|XP_007163138.1|  hypothetical protein PHAVU_001G209600g             186   6e-51   
ref|XP_009390318.1|  PREDICTED: sucrose synthase 2-like                 186   7e-51   
gb|AEN71088.1|  sucrose synthase SusA1                                  186   8e-51   
gb|AEN71092.1|  sucrose synthase SusA1                                  186   8e-51   
gb|AEN71096.1|  sucrose synthase SusA1                                  186   8e-51   
gb|AEZ00746.1|  SusA1                                                   186   8e-51   
gb|AEN71094.1|  sucrose synthase SusA1                                  186   8e-51   
gb|AEN71090.1|  sucrose synthase SusA1                                  186   8e-51   
gb|AEV40896.1|  sucrose synthase                                        186   8e-51   
gb|AEV40893.1|  sucrose synthase                                        186   8e-51   
gb|AEN71091.1|  sucrose synthase SusA1                                  186   8e-51   
gb|AEN71083.1|  sucrose synthase SusA1                                  186   8e-51   
gb|AEN71099.1|  sucrose synthase SusA1                                  186   8e-51   
gb|AEN71093.1|  sucrose synthase SusA1                                  186   8e-51   
gb|AEN71086.1|  sucrose synthase SusA1                                  186   8e-51   
gb|AEZ00745.1|  SusA1                                                   186   8e-51   
gb|AEN71089.1|  sucrose synthase SusA1                                  186   8e-51   
gb|AEN71101.1|  sucrose synthase SusA1                                  186   9e-51   
gb|AEV40894.1|  sucrose synthase                                        186   9e-51   
gb|AEN71106.1|  sucrose synthase SusA1                                  186   9e-51   
gb|AEN71104.1|  sucrose synthase SusA1                                  186   9e-51   
gb|AEN71085.1|  sucrose synthase SusA1                                  186   9e-51   
gb|AEN71084.1|  sucrose synthase SusA1                                  186   9e-51   
gb|AEN71105.1|  sucrose synthase SusA1                                  186   1e-50   
gb|AEN71103.1|  sucrose synthase SusA1                                  186   1e-50   
ref|XP_010556726.1|  PREDICTED: sucrose synthase 3                      186   1e-50   
gb|ABF95854.1|  Sucrose synthase 2, putative, expressed                 185   1e-50   
ref|XP_006651359.1|  PREDICTED: sucrose synthase 4-like                 186   1e-50   
dbj|BAA88981.1|  sucrose synthase                                       186   1e-50   
emb|CAL25362.2|  sucrose synthase                                       186   1e-50   
ref|XP_008246168.1|  PREDICTED: sucrose synthase 2-like                 176   1e-50   
ref|XP_007200961.1|  hypothetical protein PRUPE_ppa002723mg             185   1e-50   
gb|AIL88516.1|  sucrose synthase type 2-1                               186   1e-50   
gb|AIL88517.1|  sucrose synthase type 2-2                               186   1e-50   
ref|XP_002523115.1|  sucrose synthase, putative                         185   1e-50   
gb|AFM52237.1|  putative sucrose synthase 6                             185   2e-50   
ref|NP_001050064.1|  Os03g0340500                                       185   2e-50   
ref|NP_001280838.1|  sucrose synthase 3                                 185   2e-50   
ref|XP_008386674.1|  PREDICTED: sucrose synthase 3                      185   2e-50   
ref|XP_008235123.1|  PREDICTED: sucrose synthase 3                      185   2e-50   
ref|XP_004495938.1|  PREDICTED: sucrose synthase 2-like                 185   2e-50   
gb|AGV22111.1|  sucrose synthase 1                                      185   2e-50   
ref|XP_010921619.1|  PREDICTED: sucrose synthase 4                      185   2e-50   
ref|XP_003562658.1|  PREDICTED: sucrose synthase 2                      185   2e-50   
dbj|BAB20799.1|  sucrose synthase 1                                     185   3e-50   
ref|XP_006287087.1|  hypothetical protein CARUB_v10000249mg             185   3e-50   
gb|AEN71087.1|  sucrose synthase SusA1                                  184   3e-50   
ref|XP_008659017.1|  PREDICTED: sucrose synthase 2 isoform X1           184   3e-50   
gb|AIS75087.1|  sus1                                                    184   4e-50   
ref|XP_010685729.1|  PREDICTED: sucrose synthase-like                   184   4e-50   
ref|XP_002465161.1|  hypothetical protein SORBIDRAFT_01g033060          184   4e-50   
ref|XP_007050984.1|  Sucrose synthase 3 isoform 1                       184   4e-50   
gb|KJB24380.1|  hypothetical protein B456_004G142700                    183   4e-50   
gb|AGI56230.1|  sucrose synthase 1                                      184   5e-50   
ref|XP_010456053.1|  PREDICTED: sucrose synthase 3-like                 184   5e-50   
ref|XP_004984086.1|  PREDICTED: sucrose synthase 2-like                 184   5e-50   
gb|EPS58089.1|  sucrose synthase                                        181   5e-50   
ref|NP_001050319.1|  Os03g0401300                                       184   5e-50   
dbj|BAE06058.1|  sucrose synthase                                       184   6e-50   
ref|XP_010429475.1|  PREDICTED: sucrose synthase 3                      184   6e-50   
gb|EAY90371.1|  hypothetical protein OsI_11950                          184   6e-50   
ref|XP_011462741.1|  PREDICTED: sucrose synthase 2                      184   6e-50   
ref|XP_003557752.1|  PREDICTED: sucrose synthase 1                      184   6e-50   
gb|AAC41682.1|  sucrose synthase 3                                      184   6e-50   
ref|XP_010088307.1|  Sucrose synthase 2                                 183   6e-50   
ref|NP_001060278.1|  Os07g0616800                                       184   7e-50   
emb|CDX86250.1|  BnaA06g29670D                                          183   7e-50   
gb|AEV40895.1|  sucrose synthase                                        183   7e-50   
gb|EAZ04713.1|  hypothetical protein OsI_26874                          184   8e-50   
gb|KJB24379.1|  hypothetical protein B456_004G142700                    183   8e-50   
ref|XP_006657957.1|  PREDICTED: sucrose synthase 3-like                 183   8e-50   
gb|AAM95943.1|  sucrose synthase                                        183   9e-50   
gb|AEA76429.1|  sucrose synthase 1                                      183   9e-50   
ref|XP_009151715.1|  PREDICTED: sucrose synthase 2                      183   1e-49   
gb|KEH24408.1|  sucrose synthase                                        183   1e-49   
ref|XP_009390882.1|  PREDICTED: sucrose synthase 2-like                 183   1e-49   
ref|XP_004287544.1|  PREDICTED: sucrose synthase-like                   183   1e-49   
gb|KHN43494.1|  Sucrose synthase 2                                      182   1e-49   
ref|XP_002302727.1|  sucrose synthase family protein                    183   1e-49   
ref|NP_001105323.1|  sucrose synthase 2                                 183   1e-49   
ref|XP_003554531.1|  PREDICTED: sucrose synthase 2-like                 182   2e-49   
ref|XP_004494391.1|  PREDICTED: sucrose synthase 2-like isoform X2      182   2e-49   
ref|XP_002271896.1|  PREDICTED: sucrose synthase 2                      182   2e-49   
emb|CAA03935.1|  sucrose synthase type 2                                182   2e-49   
ref|XP_003521575.1|  PREDICTED: sucrose synthase 2-like                 182   2e-49   
ref|XP_010269598.1|  PREDICTED: sucrose synthase 2-like                 182   2e-49   
ref|XP_003564156.1|  PREDICTED: sucrose synthase 1                      182   2e-49   
gb|AFR41908.1|  sucrose synthase                                        169   2e-49   
gb|KFK30802.1|  hypothetical protein AALP_AA6G027800                    182   2e-49   
gb|KDO87150.1|  hypothetical protein CISIN_1g003492mg                   182   2e-49   
gb|AAL50572.2|AF412039_1  sucrose synthase                              182   2e-49   
ref|XP_006650177.1|  PREDICTED: sucrose synthase 1-like isoform X2      182   3e-49   
gb|AAL50571.1|AF412038_1  sucrose synthase                              182   3e-49   
ref|XP_003557951.1|  PREDICTED: sucrose synthase 4                      182   3e-49   
ref|XP_009800149.1|  PREDICTED: sucrose synthase 2-like                 182   3e-49   
gb|AIL88515.1|  sucrose synthase type 3                                 181   4e-49   
gb|AFR41929.1|  sucrose synthase                                        169   4e-49   
gb|KCW81848.1|  hypothetical protein EUGRSUZ_C03199                     182   4e-49   
gb|AAA68209.1|  sus1                                                    181   4e-49   
ref|XP_004488141.1|  PREDICTED: sucrose synthase-like isoform X1        181   4e-49   
ref|XP_010422613.1|  PREDICTED: sucrose synthase 3-like                 181   4e-49   
gb|EMS66266.1|  Sucrose synthase 1                                      181   4e-49   
emb|CDX85398.1|  BnaC07g27090D                                          181   4e-49   
gb|EMT06653.1|  Sucrose synthase 1                                      181   5e-49   
gb|KCW58409.1|  hypothetical protein EUGRSUZ_H01094                     180   5e-49   
dbj|BAM05652.1|  sucrose synthase 3                                     181   6e-49   
dbj|BAK02964.1|  predicted protein                                      181   6e-49   
gb|AIO11846.1|  sucrose synthase                                        181   6e-49   
gb|KFK36302.1|  hypothetical protein AALP_AA4G104600                    181   7e-49   
ref|XP_004290813.1|  PREDICTED: sucrose synthase 2                      181   7e-49   
dbj|BAM05645.1|  sucrose synthase 1                                     181   7e-49   
gb|EMT33394.1|  Sucrose synthase 1                                      181   8e-49   
sp|P31923.1|SUS2_HORVU  RecName: Full=Sucrose synthase 2; AltName...    181   8e-49   
emb|CAA04543.1|  sucrose synthase type I                                181   9e-49   
ref|XP_010938368.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...    181   9e-49   
ref|XP_010069893.1|  PREDICTED: sucrose synthase 2                      181   9e-49   
gb|AFR41915.1|  sucrose synthase                                        167   1e-48   
ref|XP_007035651.1|  Sucrose synthase 2 isoform 1                       180   1e-48   
gb|AAV64256.2|  sucrose synthase                                        180   1e-48   
ref|XP_010259474.1|  PREDICTED: sucrose synthase 4-like                 181   1e-48   
ref|XP_007225257.1|  hypothetical protein PRUPE_ppa001573mg             180   1e-48   
ref|XP_002271530.1|  PREDICTED: sucrose synthase 2                      180   1e-48   
gb|AFR41912.1|  sucrose synthase                                        167   1e-48   
ref|XP_006396436.1|  hypothetical protein EUTSA_v10028435mg             180   1e-48   
gb|AFR41917.1|  sucrose synthase                                        167   1e-48   



>ref|XP_009625446.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
Length=805

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/116 (93%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELL DFFE+CKK+PSHWE IS GGLKRIQE
Sbjct  690  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLADFFERCKKEPSHWEAISEGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  750  KYTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEAVPLAVE  805



>ref|XP_009792656.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
Length=805

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/116 (93%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FATNHGGPAEIIVHGKSGFHIDPYHG+QAAELL DFFEKCKK+PSHWE IS GGLKRIQE
Sbjct  690  FATNHGGPAEIIVHGKSGFHIDPYHGDQAAELLADFFEKCKKEPSHWEAISEGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  750  KYTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEAVPLAVE  805



>gb|ADA68250.1| sucrose synthase, partial [Schiedea globosa]
 dbj|BAN18490.1| sucrose synthase, partial [Schiedea spergulina]
 dbj|BAN18491.1| sucrose synthase, partial [Schiedea kealiae]
 dbj|BAN18492.1| sucrose synthase, partial [Schiedea mannii]
 dbj|BAN18493.1| sucrose synthase, partial [Schiedea menziesii]
 dbj|BAN18494.1| sucrose synthase, partial [Schiedea hookeri]
 dbj|BAN18495.1| sucrose synthase, partial [Schiedea sarmentosa]
 dbj|BAN18496.1| sucrose synthase, partial [Schiedea lydgatei]
 dbj|BAN18497.1| sucrose synthase, partial [Schiedea haleakalensis]
 dbj|BAN18498.1| sucrose synthase, partial [Schiedea salicaria]
 dbj|BAN18499.1| sucrose synthase, partial [Schiedea globosa]
Length=118

 Score =   212 bits (540),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT HGGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+E
Sbjct  2    FATCHGGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEE  61

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   KYTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  117



>ref|NP_001275286.1| sucrose synthase [Solanum tuberosum]
 emb|CAD61188.1| sucrose synthase 4 [Solanum tuberosum]
Length=805

 Score =   229 bits (584),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/116 (91%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FATNHGGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKK+PSHWETIS GGLKRIQE
Sbjct  690  FATNHGGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKEPSHWETISTGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  750  KYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>dbj|BAN18500.1| sucrose synthase, partial [Schiedea pentandra]
 dbj|BAN18501.1| sucrose synthase, partial [Schiedea kauaiensis]
 dbj|BAN18502.1| sucrose synthase, partial [Schiedea perlmanii]
 dbj|BAN18509.1| sucrose synthase, partial [Schiedea stellarioides]
Length=118

 Score =   212 bits (539),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT HGGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE +S GGLKRI+E
Sbjct  2    FATCHGGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAVSLGGLKRIEE  61

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   KYTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  117



>ref|XP_006345244.1| PREDICTED: uncharacterized LOC102577594 [Solanum tuberosum]
Length=805

 Score =   229 bits (584),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/116 (91%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FATNHGGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKKDPSHWETIS GGLKRI+E
Sbjct  690  FATNHGGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKDPSHWETISMGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  750  KYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>emb|CAA09681.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   229 bits (584),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/116 (91%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FATNHGGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKK+PSHWETIS GGLKRIQE
Sbjct  690  FATNHGGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKEPSHWETISTGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  750  KYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>ref|NP_001234655.1| sucrose synthase [Solanum lycopersicum]
 sp|P49037.1|SUSY_SOLLC RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Solanum lycopersicum]
 gb|AAA34196.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   229 bits (583),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/116 (91%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FATNHGGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKK+PSHWETIS GGLKRIQE
Sbjct  690  FATNHGGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKEPSHWETISTGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  750  KYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>dbj|BAN18504.1| sucrose synthase, partial [Schiedea trinervis]
 dbj|BAN18505.1| sucrose synthase, partial [Schiedea obovata]
 dbj|BAN18506.1| sucrose synthase, partial [Schiedea viscosa]
 dbj|BAN18507.1| sucrose synthase, partial [Schiedea verticillata]
Length=118

 Score =   211 bits (538),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT HGGPAEIIV+G+SGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+E
Sbjct  2    FATCHGGPAEIIVNGQSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEE  61

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   KYTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  117



>gb|AAA97571.1| sucrose synthase [Solanum tuberosum]
Length=805

 Score =   228 bits (582),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 105/116 (91%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FATNHGGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCK++PSHWETIS GGLKRIQE
Sbjct  690  FATNHGGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKREPSHWETISTGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  750  KYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>sp|P10691.1|SUS1_SOLTU RecName: Full=Sucrose synthase; AltName: Full=SS16; AltName: 
Full=Sucrose-UDP glucosyltransferase [Solanum tuberosum]
 gb|AAA33841.1| sucrase synthase (EC 2.4.1.13) [Solanum tuberosum]
Length=805

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/116 (91%), Positives = 111/116 (96%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FATNHGGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKKDPSHWETIS GGLKRI+E
Sbjct  690  FATNHGGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKDPSHWETISMGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+ LLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  750  KYTWQIYSESLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>gb|ADA68252.1| sucrose synthase, partial [Honckenya peploides]
Length=118

 Score =   209 bits (533),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT HGGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+E
Sbjct  2    FATCHGGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIKE  61

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTLA VYGFWK+VS LD LE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   KYTWQIYSDRLLTLAGVYGFWKYVSNLDHLEARRYLEMFYALKYRKLAESVPLAIE  117



>gb|ADA68251.1| sucrose synthase, partial [Schiedea membranacea]
 dbj|BAN18503.1| sucrose synthase, partial [Schiedea helleri]
 dbj|BAN18508.1| sucrose synthase, partial [Schiedea membranacea]
Length=118

 Score =   209 bits (531),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT HGGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK D SHWE IS GGLKRI+E
Sbjct  2    FATCHGGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDLSHWEAISLGGLKRIEE  61

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   KYTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  117



>gb|ABV02029.1| sucrose sythase [Nicotiana langsdorffii x Nicotiana sanderae]
Length=805

 Score =   225 bits (574),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 104/116 (90%), Positives = 111/116 (96%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FATNHGGPAEIIV+GKSGFHIDPYHGEQAA+LL DFFEKCK +PSHWETIS GGLKRIQE
Sbjct  690  FATNHGGPAEIIVNGKSGFHIDPYHGEQAADLLADFFEKCKTEPSHWETISTGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  750  KYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>ref|XP_006353766.1| PREDICTED: sucrose synthase 2 isoform X2 [Solanum tuberosum]
Length=805

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/116 (91%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FATN GGPAEIIVHGKSGF IDPYHGEQAA+LL DFFEKCK DPSHWE IS GGLKRIQE
Sbjct  690  FATNQGGPAEIIVHGKSGFQIDPYHGEQAADLLADFFEKCKVDPSHWEAISEGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLA+ VPLA+E
Sbjct  750  KYTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAQLVPLAVE  805



>ref|NP_001274911.1| sucrose synthase 2 [Solanum tuberosum]
 gb|AAO34668.1| sucrose synthase 2 [Solanum tuberosum]
Length=805

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/116 (91%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FATN GGPAEIIVHGKSGF IDPYHGEQAA+LL DFFEKCK DPSHWE IS GGLKRIQE
Sbjct  690  FATNQGGPAEIIVHGKSGFQIDPYHGEQAADLLADFFEKCKVDPSHWEAISEGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLA+ VPLA+E
Sbjct  750  KYTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAQLVPLAVE  805



>ref|XP_011093886.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093887.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093888.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093889.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093890.1| PREDICTED: sucrose synthase [Sesamum indicum]
Length=805

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/116 (91%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT HGGPAEIIVHGKSGFHIDPY+GEQ AE+LVDFFEKCK DPSHWETISAGGLKRIQE
Sbjct  690  FATLHGGPAEIIVHGKSGFHIDPYNGEQVAEVLVDFFEKCKHDPSHWETISAGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTLA VYGFWK+VSKLDR EIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  750  KYTWQIYSDRLLTLAGVYGFWKYVSKLDRREIRRYLEMFYALKFRKLAEAVPLAVE  805



>sp|P49039.1|SUS2_SOLTU RecName: Full=Sucrose synthase; AltName: Full=SS65; AltName: 
Full=Sucrose-UDP glucosyltransferase [Solanum tuberosum]
 gb|AAA97572.1| sucrose synthase [Solanum tuberosum]
Length=805

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/116 (91%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FATN GGPAEIIVHGKSGF IDPYHGEQAA+LL DFFEKCK DPSHWE IS GGLKRIQE
Sbjct  690  FATNQGGPAEIIVHGKSGFQIDPYHGEQAADLLADFFEKCKVDPSHWEAISEGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLA+ VPLA+E
Sbjct  750  KYTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAQLVPLAVE  805



>ref|XP_009589756.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
 ref|XP_009589757.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
Length=805

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/116 (90%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FATNHGGPAEIIV+GKSGFHIDPYHGEQAA+LL DFFEKCK  PSHWETIS GGLKRIQE
Sbjct  690  FATNHGGPAEIIVNGKSGFHIDPYHGEQAADLLADFFEKCKTQPSHWETISTGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  750  KYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>ref|XP_010323602.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323603.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323604.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323605.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 gb|ADM47608.1| sucrose synthase isoform 3 [Solanum lycopersicum]
Length=805

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/116 (91%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FATN GGPAEIIVHGKSGF IDPYHGEQAA+LL +FFEKCK DPSHWE IS GGLKRIQE
Sbjct  690  FATNQGGPAEIIVHGKSGFQIDPYHGEQAADLLAEFFEKCKVDPSHWEAISKGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  750  KYTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAELVPLAVE  805



>gb|AHL84158.1| sucrose synthase [Nicotiana tabacum]
Length=805

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/116 (89%), Positives = 111/116 (96%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FATNHGGPAEIIV+GKSGFHIDPYHGEQAA+LL DFFEKCK +PSHWETIS GGLKRIQE
Sbjct  690  FATNHGGPAEIIVNGKSGFHIDPYHGEQAADLLADFFEKCKTEPSHWETISTGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYL+MFYALK+RK+AE VPLA E
Sbjct  750  KYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLDMFYALKYRKMAEAVPLAAE  805



>ref|NP_001234804.1| sucrose synthase [Solanum lycopersicum]
 emb|CAA09593.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/116 (91%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FATN GGPAEIIVHGKSGF IDPYHGEQAA+LL +FFEKCK DPSHWE IS GGLKRIQE
Sbjct  690  FATNQGGPAEIIVHGKSGFQIDPYHGEQAADLLAEFFEKCKVDPSHWEAISKGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  750  KYTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAELVPLAVE  805



>gb|ADK98097.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98098.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98099.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98100.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98104.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98105.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98106.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98107.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98108.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98110.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98111.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98114.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98115.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98117.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98119.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADW09893.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09894.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09899.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09900.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09902.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09909.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09910.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09919.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09920.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09931.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09932.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09935.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09937.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09938.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   206 bits (525),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -3

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW09901.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   206 bits (523),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -3

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGPAEIIV+G+SGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGRSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_009760458.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
 ref|XP_009760459.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
Length=805

 Score =   223 bits (567),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/116 (89%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FATNHGGPAEIIV+GKSGFHIDPYHGEQAA+LL DFFEKCK +P HWETIS GGLKRIQE
Sbjct  690  FATNHGGPAEIIVNGKSGFHIDPYHGEQAADLLADFFEKCKTEPYHWETISTGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  750  KYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>gb|ADK98109.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98118.1| sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   205 bits (522),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -3

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGPAEIIV+GKSGFHIDPYHG++AA LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGKSGFHIDPYHGDKAAXLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW09936.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -3

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGPAEIIV+GKSGFHIDPYHG++AA LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGKSGFHIDPYHGDKAAHLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_011078145.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078146.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078147.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078148.1| PREDICTED: sucrose synthase [Sesamum indicum]
Length=805

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/116 (91%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT HGGPAEIIVHGKSGFHIDPY+GEQ AE LV+FFEKCKKDPSHWETISAGGLKRI E
Sbjct  690  FATVHGGPAEIIVHGKSGFHIDPYNGEQVAETLVNFFEKCKKDPSHWETISAGGLKRIME  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTLA VYGFWK+VSKLDRLEIRRYLEMFYALK+RKLAE VPLA E
Sbjct  750  KYTWQIYSDRLLTLAGVYGFWKYVSKLDRLEIRRYLEMFYALKYRKLAEAVPLAAE  805



>gb|ADW09933.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09934.1| putative sucrose synthase, partial [Schiedea globosa]
Length=113

 Score =   204 bits (520),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -3

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGP EIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  1    HGGPXEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  60

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  61   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  112



>gb|ADK98101.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98102.1| sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   204 bits (520),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -3

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGPAEIIV+G SGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGXSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW09904.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09911.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09912.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09913.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09925.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09929.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09930.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   204 bits (520),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -3

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGP EIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPXEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADK98116.1| sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   204 bits (520),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -3

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGPAEIIV+GKSGFHIDPYHG++AA+LL DFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGKSGFHIDPYHGDKAADLLXDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADK98120.1| sucrose synthase, partial [Schiedea adamantis]
 gb|ADW09897.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09898.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   204 bits (518),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -3

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGPAEIIV+GKSG HIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGKSGXHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADK98103.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98113.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADW09889.1| putative sucrose synthase, partial [Schiedea adamantis]
 gb|ADW09890.1| putative sucrose synthase, partial [Schiedea adamantis]
 gb|ADW09915.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09916.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   203 bits (517),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -3

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGPAEIIV+GKSG HIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGKSGSHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW09903.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   203 bits (517),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -3

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGP EIIV+G+SGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPXEIIVNGRSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW09926.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   203 bits (517),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -3

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGP EIIV+GKSGFHIDPYHG++AA LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPXEIIVNGKSGFHIDPYHGDKAAHLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>sp|P49035.1|SUS1_DAUCA RecName: Full=Sucrose synthase isoform 1; AltName: Full=Sucrose 
synthase isoform I; AltName: Full=Sucrose-UDP glucosyltransferase 
1; AltName: Full=Susy*Dc1 [Daucus carota]
 emb|CAA53081.1| sucrose synthase [Daucus carota]
 emb|CAA76056.1| sucrose synthase isoform I [Daucus carota]
Length=808

 Score =   220 bits (561),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT HGGPAEIIVHGKSGFHIDPYHGEQ AELLV+FFEKCK DPS W+ ISAGGLKRIQE
Sbjct  692  FATLHGGPAEIIVHGKSGFHIDPYHGEQVAELLVNFFEKCKTDPSQWDAISAGGLKRIQE  751

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  341
            KYTWQIYS+RLLTLA VYGFWKHVSKLDRLEIRRYLEMFYALK+RKLAE VPLA
Sbjct  752  KYTWQIYSERLLTLAGVYGFWKHVSKLDRLEIRRYLEMFYALKYRKLAESVPLA  805



>gb|ADK98112.1| sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   202 bits (515),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -3

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYT 
Sbjct  2    HGGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTX  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>emb|CAJ32596.1| sucrose synthase [Coffea arabica]
Length=806

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FATNHGGPAEII+HGKSGFHIDPYHGEQ +ELL +FFE+CKK+PS+W+TISAGGLKRIQE
Sbjct  690  FATNHGGPAEIIIHGKSGFHIDPYHGEQVSELLANFFERCKKEPSYWDTISAGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTLA VYGFWK VSKLDR EIRRYLEMFYALK+RKLAE VPLA++
Sbjct  750  KYTWQIYSDRLLTLAGVYGFWKCVSKLDRQEIRRYLEMFYALKYRKLAEAVPLAVD  805



>emb|CAI56307.1| sucrose synthase [Coffea canephora]
 emb|CDP03035.1| unnamed protein product [Coffea canephora]
Length=806

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FATNHGGPAEII+HGKSGFHIDPYHGEQ +ELL +FFE+CKK+PS+W+TISAGGLKRIQE
Sbjct  690  FATNHGGPAEIIIHGKSGFHIDPYHGEQVSELLANFFERCKKEPSYWDTISAGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTLA VYGFWK VSKLDR EIRRYLEMFYALK+RKLAE VPLA++
Sbjct  750  KYTWQIYSDRLLTLAGVYGFWKCVSKLDRQEIRRYLEMFYALKYRKLAEAVPLAVD  805



>gb|ADW09905.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09906.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   202 bits (513),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -3

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGP EIIV+GKSG HIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPXEIIVNGKSGSHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|AEN79500.1| sucrose synthase 1 [Orobanche ramosa]
Length=805

 Score =   218 bits (554),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT HGGPAEIIV GKSGFHIDPY+GEQ AE LV FFEKC KDPSHWE IS GGLKRIQE
Sbjct  690  FATLHGGPAEIIVDGKSGFHIDPYNGEQVAETLVSFFEKCNKDPSHWEAISTGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTLA VYGFWK+VSKLDRLEIRRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWQIYSDRLLTLAGVYGFWKYVSKLDRLEIRRYLEMFYALKYRKLAEAVPLAVE  805



>gb|ABI17891.1| sucrose synthase [Coffea canephora]
Length=806

 Score =   217 bits (553),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FATNHGGPAEII+HGKSGFHIDPYHGEQ +ELL +FFE+CKK+PS+W+TI AGGLKRIQE
Sbjct  690  FATNHGGPAEIIIHGKSGFHIDPYHGEQVSELLANFFERCKKEPSYWDTIPAGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTLA VYGFWK VSKLDR EIRRYLEMFYALK+RKLAE VPLA++
Sbjct  750  KYTWQIYSDRLLTLAGVYGFWKCVSKLDRQEIRRYLEMFYALKYRKLAEAVPLAVD  805



>gb|ADW09914.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   200 bits (509),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -3

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGP EIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYT 
Sbjct  2    HGGPXEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTR  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW09891.1| putative sucrose synthase, partial [Schiedea membranacea]
 gb|ADW09892.1| putative sucrose synthase, partial [Schiedea membranacea]
Length=114

 Score =   200 bits (509),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -3

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK D S WE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDLSRWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW09895.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09896.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   200 bits (508),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = -3

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGGP EIIV+G SG HIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPXEIIVNGXSGXHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>sp|O49845.1|SUS2_DAUCA RecName: Full=Sucrose synthase isoform 2; AltName: Full=Sucrose 
synthase isoform II; AltName: Full=Sucrose-UDP glucosyltransferase 
2; AltName: Full=Susy*Dc2 [Daucus carota]
 emb|CAA76057.1| sucrose synthase isoform II [Daucus carota]
Length=801

 Score =   215 bits (548),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT HGGPAEIIVHG SGFHIDPYHGE+AAEL+V+FFE+CK +PSHWETISAGGLKRIQE
Sbjct  686  FATIHGGPAEIIVHGTSGFHIDPYHGEKAAELIVNFFERCKTEPSHWETISAGGLKRIQE  745

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLLTL  VYGFWKHVSKLDR+EIRRYLEMF ALK+R LAE VPLA++
Sbjct  746  KYTWQIYSERLLTLGGVYGFWKHVSKLDRIEIRRYLEMFCALKYRNLAESVPLAVD  801



>gb|AHL29281.1| sucrose synthase 1 [Camellia sinensis]
Length=805

 Score =   213 bits (542),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT++GGPAEII+HGKSGFHIDPYHG+Q AELLV+F+E+C KDPSHW+ ISAGGL+RI E
Sbjct  690  FATSYGGPAEIIIHGKSGFHIDPYHGDQVAELLVNFYERCSKDPSHWDEISAGGLQRIME  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RL+TLA VYGFWK+VSKLDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  750  KYTWQIYSERLMTLAGVYGFWKYVSKLDRLETRRYLEMFYALKYRKLAESVPLAIE  805



>gb|ADW09921.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09922.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   197 bits (500),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -3

Query  667  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  488
            GG  EI V+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTWQ
Sbjct  3    GGXXEIXVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTWQ  62

Query  487  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>emb|CAA67195.1| sucrose synthase [Pisum sativum]
Length=164

 Score =   198 bits (503),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS-AGGLKRIQ  506
            FAT +GGPAEIIVHGKSGFHIDPYHGE AA+LLV+FFEK K DPSHW+ IS  GGL+RI+
Sbjct  47   FATLNGGPAEIIVHGKSGFHIDPYHGEGAADLLVEFFEKVKSDPSHWDKISLKGGLQRIE  106

Query  505  EKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RK AE VPLA+E
Sbjct  107  EKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKSAESVPLAVE  163



>gb|ADW09887.1| putative sucrose synthase, partial [Schiedea stellarioides]
 gb|ADW09888.1| putative sucrose synthase, partial [Schiedea stellarioides]
Length=114

 Score =   196 bits (498),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = -3

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGG  EI V+GKSG HIDPYHG++AA+LLVDFF+KCK DPSHWE +S GGLKRI+EKYTW
Sbjct  2    HGGXXEIXVNGKSGXHIDPYHGDKAADLLVDFFQKCKGDPSHWEAVSLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|AFS17277.1| sucrose synthase 1 [Amaranthus cruentus/Amaranthus hypocondriacus 
mixed library]
Length=803

 Score =   212 bits (539),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT HGGPAEIIVHGKSGFHIDPYHG++AAELLVDFF+K K DP+HWETIS GGLKRI+E
Sbjct  687  FATCHGGPAEIIVHGKSGFHIDPYHGDKAAELLVDFFKKSKADPTHWETISKGGLKRIEE  746

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTLA VYGFWK+VS LDR E RRYLEMFYALK++KLAE VPLAIE
Sbjct  747  KYTWQIYSDRLLTLAGVYGFWKYVSNLDRREARRYLEMFYALKYKKLAESVPLAIE  802



>gb|ADW09917.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   196 bits (497),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -3

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGG  EIIV GKSG HIDPYHG++AA+LLVDFF+KCK DPSHWE I  GGLKRI+EKYTW
Sbjct  2    HGGXXEIIVXGKSGXHIDPYHGDKAADLLVDFFQKCKGDPSHWEAIXLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADR00484.1| sucrose synthase [Arachis hypogaea var. vulgaris]
Length=490

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFF+KCK DP+HW+ IS GGL+RI+E
Sbjct  374  FATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFDKCKVDPTHWDNISQGGLQRIEE  433

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  434  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  489



>gb|ADW09918.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   195 bits (495),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -3

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGG  EIIV GKSG HIDPYHG++AA+LL+DFF+KCK DPSHWE I  GGLKRI+EKYTW
Sbjct  2    HGGXXEIIVXGKSGXHIDPYHGDKAADLLIDFFQKCKGDPSHWEAIXLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_004508035.1| PREDICTED: sucrose synthase-like isoform X3 [Cicer arietinum]
Length=806

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGE+AA+LLV+FFEKCK DPSHW+ IS GGLKRI+E
Sbjct  690  FATLNGGPAEIIVHGKSGFHIDPYHGERAADLLVEFFEKCKVDPSHWDKISQGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AEE60913.1| nodule-enhanced sucrose synthase [Cicer arietinum]
Length=806

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGE+AA+LLV+FFEKCK DPSHW+ IS GGLKRI+E
Sbjct  690  FATLNGGPAEIIVHGKSGFHIDPYHGERAADLLVEFFEKCKVDPSHWDKISQGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|KDP33978.1| hypothetical protein JCGZ_07549 [Jatropha curcas]
Length=805

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHGEQAA+LLVDFFEKCK DPSHW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGEQAAQLLVDFFEKCKVDPSHWDKISQGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|AGH29112.1| sucrose synthase [Jatropha curcas]
Length=805

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHGEQAA+LLVDFFEKCK DPSHW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGEQAAQLLVDFFEKCKVDPSHWDKISQGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>ref|XP_004287669.1| PREDICTED: sucrose synthase [Fragaria vesca subsp. vesca]
 ref|XP_011461050.1| PREDICTED: sucrose synthase [Fragaria vesca subsp. vesca]
Length=806

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSG+HIDPYHGEQAAE+LVDFFEKCKKDPSHW+ IS GGLKRI+E
Sbjct  691  FATCKGGPAEIIVHGKSGYHIDPYHGEQAAEILVDFFEKCKKDPSHWDKISQGGLKRIEE  750

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK++KLA+ VPLA E
Sbjct  751  KYTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYKKLADSVPLAEE  806



>dbj|BAD94975.1| sucrose-UDP glucosyltransferase [Arabidopsis thaliana]
Length=279

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+E
Sbjct  163  FATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISKGGLQRIEE  222

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  341
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA
Sbjct  223  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLA  276



>ref|XP_011010969.1| PREDICTED: sucrose synthase-like isoform X2 [Populus euphratica]
Length=805

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFF+KCK DP+HWE IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFDKCKVDPAHWEKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLTKE  805



>ref|XP_011010968.1| PREDICTED: sucrose synthase-like isoform X1 [Populus euphratica]
Length=812

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFF+KCK DP+HWE IS GGL+RIQE
Sbjct  697  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFDKCKVDPAHWEKISHGGLQRIQE  756

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPL  E
Sbjct  757  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLTKE  812



>gb|ADW09907.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09908.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   194 bits (493),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = -3

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGG  EIIV+GKSG HIDPYHG++AA+LLVDFF+K K DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGXXEIIVNGKSGXHIDPYHGDKAADLLVDFFQKXKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW80565.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80556.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80541.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80542.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80547.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80553.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80554.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80564.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80534.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80570.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80559.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80548.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80540.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80546.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80539.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80569.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80562.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80558.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADV71181.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80538.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80557.1| sucrose synthase 1 [Populus tomentosa]
 gb|AFZ78658.1| sucrose synthase [Populus tomentosa]
Length=805

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80560.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80555.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80543.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80536.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80544.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80561.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80567.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80568.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80550.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80563.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   210 bits (534),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80551.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   210 bits (534),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80535.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80537.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   210 bits (534),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80552.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   210 bits (534),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80549.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   210 bits (534),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80566.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80571.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|KJB65372.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
 gb|KJB65373.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
 gb|KJB65374.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
Length=806

 Score =   209 bits (532),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFF+KCKKDPSHW  IS GGLKRIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFDKCKKDPSHWNDISEGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA E
Sbjct  750  KYTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ABD61653.1| sucrose synthase [Cichorium intybus]
Length=806

 Score =   209 bits (532),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT HGGPAEIIVHGKSGFHIDPYHG+Q  +LLV FFEK K DPSHWE IS G  +RIQE
Sbjct  690  FATLHGGPAEIIVHGKSGFHIDPYHGDQVTDLLVKFFEKTKVDPSHWEAISKGAEQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTLA VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA++
Sbjct  750  KYTWQIYSDRLLTLAGVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAESVPLAVD  805



>ref|XP_007012546.1| Sucrose synthase 4 isoform 1 [Theobroma cacao]
 gb|EOY30165.1| Sucrose synthase 4 isoform 1 [Theobroma cacao]
Length=852

 Score =   209 bits (532),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS GGLKRIQE
Sbjct  736  FATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKADPSYWNKISEGGLKRIQE  795

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  796  KYTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  851



>ref|XP_007012547.1| Sucrose synthase 4 isoform 2 [Theobroma cacao]
 gb|EOY30166.1| Sucrose synthase 4 isoform 2 [Theobroma cacao]
Length=806

 Score =   209 bits (531),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS GGLKRIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKADPSYWNKISEGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AIJ28960.1| sucrose synthase [Manihot esculenta subsp. flabellifolia]
Length=806

 Score =   209 bits (531),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLV+FFEKCK DPSHW+ IS G ++RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVEFFEKCKADPSHWDKISQGAMQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVSKLDRLE RRYLEMFYALK+RKLAE VPL +E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSKLDRLESRRYLEMFYALKYRKLAESVPLTVE  805



>ref|XP_003551045.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006600427.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=805

 Score =   208 bits (530),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEKCK DP+HWETIS  GL+RI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFEKCKLDPTHWETISKAGLQRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|KHN17754.1| Sucrose synthase [Glycine soja]
Length=805

 Score =   208 bits (530),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEKCK DP+HWETIS  GL+RI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFEKCKLDPTHWETISKAGLQRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AFO84090.1| sucrose synthase [Actinidia chinensis]
Length=806

 Score =   208 bits (530),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT HGGPAEII+HGKSGFHIDPYHG+Q AELLV+F+EKCK DPSHW+ IS GGLKRI E
Sbjct  690  FATCHGGPAEIIIHGKSGFHIDPYHGDQVAELLVNFYEKCKVDPSHWDAISEGGLKRILE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RL+TLA VYGFWK+VSKLDR E RRYLEMFYALK+RKLAE VPLA++
Sbjct  750  KYTWQIYSERLMTLAGVYGFWKYVSKLDRRETRRYLEMFYALKYRKLAEAVPLAVD  805



>gb|KJB82966.1| hypothetical protein B456_013G222400 [Gossypium raimondii]
Length=806

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS GGLKRI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKTDPSYWTKISEGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWKIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AEV40460.1| sucrose synthase 1 [Gossypium arboreum]
 gb|AFM52232.1| putative sucrose synthase 1 [Gossypium arboreum]
Length=806

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS GGLKRI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKTDPSYWTKISEGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWKIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|KHG00606.1| Sucrose synthase [Gossypium arboreum]
Length=814

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS GGLKRI+E
Sbjct  698  FATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKTDPSYWTKISEGGLKRIEE  757

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  758  KYTWKIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  813



>dbj|BAM68521.1| sucrose synthase [Mangifera indica]
 dbj|BAM68528.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPSHW+ IS GGLKRI+E
Sbjct  685  FATCNGGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKADPSHWDKISQGGLKRIEE  744

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  745  KYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>dbj|BAM37539.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPSHW+ IS GGLKRI+E
Sbjct  685  FATCNGGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKADPSHWDKISQGGLKRIEE  744

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  745  KYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>gb|AHA41509.1| sucrose synthase [Populus deltoides]
Length=805

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIV+GKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVNGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>ref|XP_007154543.1| hypothetical protein PHAVU_003G127500g [Phaseolus vulgaris]
 gb|ESW26537.1| hypothetical protein PHAVU_003G127500g [Phaseolus vulgaris]
Length=805

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEKCK +PSHW+TIS  GL+RI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKCKVEPSHWDTISQAGLQRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|ADW80545.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RI E
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIHE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>dbj|BAA88905.1| sucrose synthase [Citrus unshiu]
Length=805

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS GGLKRI+E
Sbjct  690  FATCKGGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKISLGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AAN76498.1|AF315375_1 sucrose synthase [Phaseolus vulgaris]
Length=805

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEKCK +PSHW+TIS  GL+RI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKCKVEPSHWDTISQAGLQRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|KDO73788.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
Length=783

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS GGLKRI+E
Sbjct  668  FATCKGGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKISLGGLKRIEE  727

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  728  KYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  783



>ref|XP_006474580.1| PREDICTED: sucrose synthase-like isoform X1 [Citrus sinensis]
 ref|XP_006474581.1| PREDICTED: sucrose synthase-like isoform X2 [Citrus sinensis]
 ref|XP_006474582.1| PREDICTED: sucrose synthase-like isoform X3 [Citrus sinensis]
 ref|XP_006474583.1| PREDICTED: sucrose synthase-like isoform X4 [Citrus sinensis]
 ref|XP_006474584.1| PREDICTED: sucrose synthase-like isoform X5 [Citrus sinensis]
 ref|XP_006474585.1| PREDICTED: sucrose synthase-like isoform X6 [Citrus sinensis]
 ref|XP_006474586.1| PREDICTED: sucrose synthase-like isoform X7 [Citrus sinensis]
 ref|XP_006474587.1| PREDICTED: sucrose synthase-like isoform X8 [Citrus sinensis]
 gb|KDO73779.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73780.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73781.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73782.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73783.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73784.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73785.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|AIN45138.1| sucrose synthase [Citrus suavissima]
Length=805

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS GGLKRI+E
Sbjct  690  FATCKGGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKISLGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>dbj|BAA89049.1| sucrose synthase [Citrus unshiu]
Length=805

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS GGLKRI+E
Sbjct  690  FATCKGGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKISLGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_006452883.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452884.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452885.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452886.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452887.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452888.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452889.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452890.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452891.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66123.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66124.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66125.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66126.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66127.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66128.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66129.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66130.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66131.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
Length=806

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS GGLKRI+E
Sbjct  690  FATCKGGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKISLGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AEV40463.1| sucrose synthase 4 [Gossypium arboreum]
 gb|AFM52235.1| putative sucrose synthase 4 [Gossypium arboreum]
 gb|KHG06249.1| Sucrose synthase [Gossypium arboreum]
Length=806

 Score =   207 bits (526),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFF+KCKK+PSHW  IS GGLKRIQE
Sbjct  690  FATCKGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFDKCKKEPSHWNDISEGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA E
Sbjct  750  KYTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEV40464.1| sucrose synthase 5 [Gossypium arboreum]
Length=833

 Score =   206 bits (525),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFF+KCKK+PSHW  IS GGLKRIQE
Sbjct  717  FATCKGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFDKCKKEPSHWNDISEGGLKRIQE  776

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA E
Sbjct  777  KYTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAEE  832



>gb|AEQ94149.1| sucrose synthase1 [Elaeis guineensis]
Length=235

 Score =   194 bits (494),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT HGGPAEIIVHG SGFHIDPY G++AAELLVDFFEKCK+DPSHW  IS GGL+RI+E
Sbjct  111  FATCHGGPAEIIVHGVSGFHIDPYQGDKAAELLVDFFEKCKEDPSHWAKISQGGLQRIEE  170

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPL  344
            KYTW++YS+RL+TL+ VYGFWK+VS LDR E RRYLEMFYALK+R LA+ VPL
Sbjct  171  KYTWKLYSERLMTLSGVYGFWKYVSNLDRRETRRYLEMFYALKYRNLAKSVPL  223



>gb|AFK45264.1| unknown [Medicago truncatula]
Length=175

 Score =   192 bits (488),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -3

Query  667  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  488
            GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GG +RI+EKYTW 
Sbjct  65   GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKISQGGFQRIEEKYTWT  124

Query  487  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            IY  RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  125  IYFQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  175



>gb|AEF56625.1| sucrose synthase [Arachis hypogaea var. vulgaris]
Length=806

 Score =   206 bits (523),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFF+KCK DP+HW+ IS GGL+RI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFDKCKVDPTHWDKISQGGLQRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|ADR81996.1| sucrose synthase 1 [Populus trichocarpa]
 gb|ADV71183.1| sucrose synthase 1 [Populus trichocarpa]
Length=805

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIV+GKSGFHIDPYHGE+AAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVNGKSGFHIDPYHGEKAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>ref|XP_002324136.2| sucrose synthase family protein [Populus trichocarpa]
 gb|EEF02701.2| sucrose synthase family protein [Populus trichocarpa]
Length=805

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIV+GKSGFHIDPYHGE+AAELLVDFFEKCK DP+HW+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVNGKSGFHIDPYHGEKAAELLVDFFEKCKVDPAHWDKISHGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW09927.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09928.1| putative sucrose synthase, partial [Schiedea globosa]
Length=113

 Score =   190 bits (482),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -3

Query  667  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  488
            GG  E   +GKSG HIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTWQ
Sbjct  2    GGXXEXXXNGKSGXHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTWQ  61

Query  487  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  112



>dbj|BAM68527.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPS+W+ IS GGLKRI+E
Sbjct  685  FATCNGGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKADPSYWDKISQGGLKRIEE  744

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  745  KYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>dbj|BAM68520.1| sucrose synthase [Mangifera indica]
 dbj|BAM68522.1| sucrose synthase [Mangifera indica]
 dbj|BAM68523.1| sucrose synthase [Mangifera indica]
 dbj|BAM68524.1| sucrose synthase [Mangifera indica]
 dbj|BAM68525.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPS+W+ IS GGLKRI+E
Sbjct  685  FATCNGGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKADPSYWDKISQGGLKRIEE  744

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  745  KYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>ref|XP_003609947.1| Sucrose synthase [Medicago truncatula]
Length=531

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+E
Sbjct  416  FATLNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKISQGGLQRIEE  475

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  476  KYTWTIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  531



>gb|ADW09923.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09924.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   190 bits (482),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -3

Query  670  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  491
            HGG  E  V+GKSG HIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGXXEXXVNGKSGXHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  490  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            QIYSD LLTLA VYGFWK+VS LDRLE RRYLEMFY LK+RKLAE VPLAIE
Sbjct  62   QIYSDXLLTLAGVYGFWKYVSNLDRLEARRYLEMFYXLKYRKLAESVPLAIE  113



>emb|CAB39757.2| sucrose synthase [Lotus japonicus]
Length=233

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSG+HIDPYHG++AAE LV+FFEK K DPS+W+ IS GGL+RI E
Sbjct  117  FATCNGGPAEIIVHGKSGYHIDPYHGDRAAETLVEFFEKSKADPSYWDKISQGGLQRIHE  176

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYSDRLLTL  VYGFWKHV+ LDR E +RYLEMFYALK+ KLAE VPLA+E
Sbjct  177  KYTWKIYSDRLLTLTGVYGFWKHVTNLDRRENKRYLEMFYALKYSKLAESVPLAVE  232



>gb|AEN71067.1| sucrose synthase Sus1 [Gossypium tomentosum]
Length=805

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  750  KYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ACV72640.1| sucrose synthase 1 [Gossypium hirsutum]
 gb|ADY68849.1| sucrose synthase [Gossypium hirsutum]
 gb|AEN71074.1| sucrose synthase Sus1 [Gossypium hirsutum subsp. latifolium]
Length=805

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  750  KYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AAC28107.1| nodule-enhanced sucrose synthase [Pisum sativum]
Length=806

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+E
Sbjct  690  FATLNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKTDPSHWDKISQGGLQRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>emb|CAA09910.1| sucrose synthase [Pisum sativum]
Length=806

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+E
Sbjct  690  FATLNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKTDPSHWDKISQGGLQRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>dbj|BAM68526.1| sucrose synthase [Mangifera indica]
 dbj|BAM68529.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPS+W+ IS GGLKRI+E
Sbjct  685  FATCNGGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKVDPSYWDKISQGGLKRIEE  744

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  745  KYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>gb|AEN71079.1| sucrose synthase Sus1 [Gossypium aridum]
Length=805

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  750  KYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71059.1| sucrose synthase Sus1 [Gossypium thurberi]
 gb|AEN71082.1| sucrose synthase Sus1 [Gossypium trilobum]
Length=805

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  750  KYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ADY68845.1| sucrose synthase [Gossypium barbadense]
 gb|ADY68847.1| sucrose synthase [Gossypium raimondii]
 gb|AEN71062.1| sucrose synthase Sus1 [Gossypium turneri]
 gb|AEN71064.1| sucrose synthase Sus1 [Gossypium mustelinum]
 gb|AEN71070.1| sucrose synthase Sus1 [Gossypium barbadense var. brasiliense]
 gb|AEN71072.1| sucrose synthase Sus1 [Gossypium barbadense var. peruvianum]
 gb|AEN71077.1| sucrose synthase Sus1 [Gossypium davidsonii]
 gb|KJB54536.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
 gb|KJB54537.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
 gb|KJB54538.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=805

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  750  KYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71078.1| sucrose synthase Sus1 [Gossypium klotzschianum]
Length=805

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  750  KYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEK81520.1| sucrose synthase isoform B [Gossypium hirsutum]
Length=805

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+L DFF+KCKKDPSHW  IS GGLKRIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILADFFDKCKKDPSHWNDISEGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+ KLAE VPLA E
Sbjct  750  KYTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYPKLAESVPLAEE  805



>gb|AEN71075.1| sucrose synthase Sus1 [Gossypium armourianum]
 gb|AEN71076.1| sucrose synthase Sus1 [Gossypium harknessii]
Length=805

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  750  KYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71061.1| sucrose synthase Sus1 [Gossypium schwendimanii]
Length=805

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  750  KYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71068.1| sucrose synthase Sus1 [Gossypium tomentosum]
Length=805

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  750  KYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>sp|P31926.1|SUSY_VICFA RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Vicia faba]
 emb|CAA49428.1| sucrose synthase [Vicia faba]
 gb|AAC37346.1| UDP-glucose:D-fructose-2-glucosyltransferase [Vicia faba]
Length=806

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+E
Sbjct  690  FATLNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKADPSHWDKISLGGLQRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AEK81522.1| sucrose synthase isoform D [Gossypium hirsutum]
Length=806

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK D S+W  IS GGLKRI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKTDSSYWTKISEGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWKIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AEN71080.1| sucrose synthase Sus1 [Gossypium gossypioides]
Length=805

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  750  KYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71066.1| sucrose synthase Sus1 [Gossypium darwinii]
Length=805

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  750  KYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AAD28641.1| sucrose synthase [Gossypium hirsutum]
Length=806

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+E
Sbjct  691  FATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEE  750

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  751  KYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  806



>gb|ADY68844.1| sucrose synthase [Gossypium barbadense]
Length=805

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  750  KYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71063.1| sucrose synthase Sus1 [Gossypium mustelinum]
 gb|AEN71065.1| sucrose synthase Sus1 [Gossypium darwinii]
 gb|AEN71069.1| sucrose synthase Sus1 [Gossypium barbadense var. brasiliense]
 gb|AEN71071.1| sucrose synthase Sus1 [Gossypium barbadense var. peruvianum]
 gb|AEN71073.1| sucrose synthase Sus1 [Gossypium hirsutum subsp. latifolium]
Length=805

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  750  KYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ADY68848.1| sucrose synthase [Gossypium hirsutum]
Length=805

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  750  KYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEV40462.1| sucrose synthase 3 [Gossypium arboreum]
 gb|AFM52234.1| putative sucrose synthase 3 [Gossypium arboreum]
 gb|KHG30366.1| Sucrose synthase [Gossypium arboreum]
Length=805

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  750  KYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ADY68846.1| sucrose synthase [Gossypium herbaceum subsp. africanum]
Length=805

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  750  KYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AAR03498.1| sucrose synthase [Populus tremuloides]
Length=805

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  750  KYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|AIJ28962.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLV+FFEKCK DP HW+ IS G ++RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVEFFEKCKADPPHWDKISQGAMQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|AAR19769.1| sucrose synthase [Beta vulgaris]
Length=805

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT HGGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEK   DPS+WE IS GGL+RI+E
Sbjct  687  FATCHGGPAEIIVHGKSGFHIDPYHGDKAADLLVDFFEKSTADPSYWENISKGGLQRIEE  746

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYSDRLLTLA VYGFWK+VS LDR E RRYLEMFYALK++KLAE VPLAIE
Sbjct  747  KYTWKIYSDRLLTLAGVYGFWKYVSNLDRREARRYLEMFYALKYKKLAESVPLAIE  802



>ref|XP_010687574.1| PREDICTED: sucrose synthase [Beta vulgaris subsp. vulgaris]
Length=805

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT HGGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEK   DPS+WE IS GGL+RI+E
Sbjct  687  FATCHGGPAEIIVHGKSGFHIDPYHGDKAADLLVDFFEKSTADPSYWENISKGGLQRIEE  746

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYSDRLLTLA VYGFWK+VS LDR E RRYLEMFYALK++KLAE VPLAIE
Sbjct  747  KYTWKIYSDRLLTLAGVYGFWKYVSNLDRREARRYLEMFYALKYKKLAESVPLAIE  802



>ref|XP_010047438.1| PREDICTED: sucrose synthase [Eucalyptus grandis]
 gb|KCW79350.1| hypothetical protein EUGRSUZ_C00769 [Eucalyptus grandis]
Length=805

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSGFHIDPYHG+QAAE L +FFEKCK DPSHW+ IS G ++RI+E
Sbjct  690  FATCKGGPAEIIVHGKSGFHIDPYHGDQAAETLANFFEKCKVDPSHWDKISQGAMQRIKE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLL L +VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWQIYSERLLNLTAVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_002877269.1| hypothetical protein ARALYDRAFT_484788 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53528.1| hypothetical protein ARALYDRAFT_484788 [Arabidopsis lyrata subsp. 
lyrata]
Length=808

 Score =   204 bits (519),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG+QAAE L DFF KCK DPSHW+ IS GGL+RIQE
Sbjct  692  FATCNGGPAEIIVHGKSGFHIDPYHGDQAAETLADFFTKCKHDPSHWDQISLGGLERIQE  751

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  752  KYTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  807



>emb|CAN82840.1| hypothetical protein VITISV_024563 [Vitis vinifera]
Length=806

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG++AAELL +FFEKCK DP+HWE IS  GLKRI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGDKAAELLANFFEKCKADPTHWEKISKAGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTLA VYGFWK+VS LDR E RRYLEMFYALK+RKLA+ VPLA+E
Sbjct  750  KYTWKIYSERLLTLAGVYGFWKYVSNLDRRETRRYLEMFYALKYRKLAQSVPLAVE  805



>gb|AGM14949.1| sucrose synthase 4 [Hevea brasiliensis]
Length=806

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLVDFFEK K DPSHW  IS G ++RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVDFFEKSKADPSHWNNISQGAMQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>ref|XP_002275155.1| PREDICTED: sucrose synthase [Vitis vinifera]
 ref|XP_010656083.1| PREDICTED: sucrose synthase [Vitis vinifera]
 ref|XP_010656084.1| PREDICTED: sucrose synthase [Vitis vinifera]
 emb|CBI27755.3| unnamed protein product [Vitis vinifera]
Length=806

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG++AAELL +FFEKCK DP+HWE IS  GLKRI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGDKAAELLANFFEKCKADPTHWEKISKAGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTLA VYGFWK+VS LDR E RRYLEMFYALK+RKLA+ VPLA+E
Sbjct  750  KYTWKIYSERLLTLAGVYGFWKYVSNLDRRETRRYLEMFYALKYRKLAQSVPLAVE  805



>gb|AAK59464.1| putative sucrose synthase [Arabidopsis thaliana]
Length=532

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG++AAE L DFF KCK DPSHW+ IS GGL+RIQE
Sbjct  416  FATCNGGPAEIIVHGKSGFHIDPYHGDKAAESLADFFTKCKHDPSHWDQISLGGLERIQE  475

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  476  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAHE  531



>gb|ABP88869.1| sucrose synthase [Medicago falcata]
Length=804

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHGE+AA+LLV+FFEK K DPSHW+ IS GGL+RI+E
Sbjct  689  FATLNGGPAEIIVHGKSGFHIDPYHGERAADLLVEFFEKVKADPSHWDKISQGGLQRIEE  748

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  749  KYTWTIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  804



>ref|XP_010271909.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
Length=806

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT HGGPAEIIVHGKSGFHIDPY G++AAELLV FFEKCK+DPSHWE IS GGLKRI E
Sbjct  690  FATCHGGPAEIIVHGKSGFHIDPYQGDRAAELLVHFFEKCKEDPSHWEKISQGGLKRIHE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RL+TL+ VYGFWK+VSKL+R E RRYLEMFYALK+RKLA+ VPLA++
Sbjct  750  KYTWQIYSERLMTLSGVYGFWKYVSKLERRETRRYLEMFYALKYRKLAQMVPLAVD  805



>ref|XP_010247458.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
 ref|XP_010247459.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
 ref|XP_010247460.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
Length=806

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT HGGPAEIIVHGKSGFHIDPYHG++AAELLV+FFEK K+DP++WE IS GGL+RI E
Sbjct  690  FATCHGGPAEIIVHGKSGFHIDPYHGDRAAELLVNFFEKSKEDPTYWEKISQGGLQRIHE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RL+TLA VYGFWK+VSKLDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWQIYSGRLMTLAGVYGFWKYVSKLDRRETRRYLEMFYALKYRKLAEMVPLAVE  805



>gb|AIJ28961.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   204 bits (518),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLV FFEKCK DPSHW  IS G ++RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVQFFEKCKADPSHWIKISEGAMQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|ABD96570.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   203 bits (517),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLV FFEKCK DPSHW  IS G ++RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVQFFEKCKADPSHWIKISEGAMQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|AGM14948.1| sucrose synthase 3 [Hevea brasiliensis]
Length=810

 Score =   203 bits (517),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLVDFFEKCK DPS+W  IS G ++RIQE
Sbjct  694  FATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVDFFEKCKVDPSYWNNISHGAMQRIQE  753

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVSKLDRLE +RYLEMFYALK+ KLAE VPL +E
Sbjct  754  KYTWQIYSQRLLTLTGVYGFWKHVSKLDRLESKRYLEMFYALKYHKLAESVPLTVE  809



>ref|NP_001237525.1| sucrose synthase [Glycine max]
 sp|P13708.2|SUSY_SOYBN RecName: Full=Sucrose synthase; AltName: Full=Nodulin-100; Short=N-100; 
AltName: Full=Sucrose-UDP glucosyltransferase [Glycine 
max]
 gb|AAC39323.1| sucrose synthase [Glycine max]
 gb|KHN45052.1| Sucrose synthase [Glycine soja]
Length=805

 Score =   203 bits (517),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEKCK DP+HW+ IS  GL+RI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFEKCKLDPTHWDKISKAGLQRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAAE  805



>gb|AGO61958.1| sucrose synthase, partial [Prunus serrulata]
Length=437

 Score =   197 bits (502),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSG+HIDPYHG+QAAE+LVDFFEK + DPSHW+ IS GGL+RI E
Sbjct  321  FATCKGGPAEIIVHGKSGYHIDPYHGDQAAEILVDFFEKSRADPSHWDKISQGGLQRIFE  380

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYT QIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA E
Sbjct  381  KYTRQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAEE  436



>gb|ADR81997.1| sucrose synthase 2 [Populus trichocarpa]
 gb|ADV71184.1| sucrose synthase 2 [Populus trichocarpa]
Length=803

 Score =   203 bits (516),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DPS+W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPSYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_006381564.1| sucrose synthase family protein [Populus trichocarpa]
 gb|ERP59361.1| sucrose synthase family protein [Populus trichocarpa]
Length=803

 Score =   203 bits (516),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DPS+W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPSYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|NP_001289655.1| sucrose synthase [Eucalyptus grandis]
 gb|ABB53602.1| sucrose synthase [Eucalyptus grandis]
Length=805

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSGFHIDPYHG+QAAE L +FFEKCK DPSHW+ IS G ++RI++
Sbjct  690  FATCKGGPAEIIVHGKSGFHIDPYHGDQAAETLANFFEKCKVDPSHWDKISQGAMQRIKD  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLL L +VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWQIYSERLLNLTAVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>sp|O65026.1|SUSY_MEDSA RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Medicago sativa]
 gb|AAC17867.1| sucrose synthase [Medicago sativa]
Length=805

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+E
Sbjct  690  FATLNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKADPSHWDKISQGGLQRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWTIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_010535796.1| PREDICTED: sucrose synthase 4 [Tarenaya hassleriana]
Length=806

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG+QAAE+L DFF KCK+DPSHW+ IS GGL+RI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGDQAAEILADFFAKCKEDPSHWDEISHGGLQRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAKAVPLAQE  805



>gb|EYU25805.1| hypothetical protein MIMGU_mgv1a001207mg [Erythranthe guttata]
Length=866

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT HGGPAEIIV G SGFHIDPY+GE  AE+L+ FFEKC KDPSHWE IS GGLKRI+E
Sbjct  751  FATLHGGPAEIIVDGISGFHIDPYNGESVAEILIGFFEKCTKDPSHWEAISTGGLKRIRE  810

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLL LA VYGFWK+VSKLDRLEI+RYLEM YALK RKLAE VPLA+E
Sbjct  811  KYTWQIYSERLLNLAGVYGFWKYVSKLDRLEIKRYLEMLYALKLRKLAEAVPLAVE  866



>gb|AEN71060.1| sucrose synthase Sus1 [Gossypium laxum]
 gb|AEN71081.1| sucrose synthase Sus1 [Gossypium lobatum]
Length=805

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFE CKKDPSHW+ IS GGLKRI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEVCKKDPSHWDKISQGGLKRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  750  KYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>ref|XP_006290612.1| hypothetical protein CARUB_v10016702mg [Capsella rubella]
 gb|EOA23510.1| hypothetical protein CARUB_v10016702mg [Capsella rubella]
Length=807

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEII HGKSGFHIDPYHG+QAAE L DFF KCK+DPSHW+ IS GGL+RIQE
Sbjct  692  FATCNGGPAEIIEHGKSGFHIDPYHGDQAAETLADFFTKCKQDPSHWDQISLGGLQRIQE  751

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  752  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  807



>gb|ADW80586.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>emb|CAB40795.1| sucrose synthase [Medicago truncatula]
Length=805

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+E
Sbjct  690  FATLNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKISQGGLQRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWTIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|ADW80611.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80589.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80587.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80580.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80593.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80592.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80609.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80600.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80575.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADV71182.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80572.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80573.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80594.1| sucrose synthase 2 [Populus tomentosa]
 gb|AFZ78659.1| sucrose synthase [Populus tomentosa]
Length=803

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80606.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80584.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80591.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80581.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80608.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80585.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80607.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80604.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80588.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80578.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80610.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80595.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80574.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80582.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80576.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_003609949.1| Sucrose synthase [Medicago truncatula]
 emb|CAB40794.1| sucrose synthase [Medicago truncatula]
 gb|AES92146.1| sucrose synthase [Medicago truncatula]
Length=805

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+E
Sbjct  690  FATLNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKISQGGLQRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWTIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|ADW80598.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80590.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80605.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80597.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|AIJ28959.1| sucrose synthase [Manihot esculenta subsp. flabellifolia]
Length=806

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLV FF KCK DPSHW  IS G ++RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVQFFVKCKADPSHWTKISEGAMQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|ABW76422.1| sucrose synthase [Populus tremuloides]
Length=803

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80596.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_007138617.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
 ref|XP_007138618.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
 gb|ESW10611.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
 gb|ESW10612.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
Length=806

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIV GKSG+HIDPYHG++AAE+LVDFFEK K DPSHW+ IS GGLKRIQE
Sbjct  690  FATFNGGPAEIIVDGKSGYHIDPYHGDRAAEILVDFFEKSKADPSHWDKISQGGLKRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  750  KYTWQIYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>ref|XP_010420928.1| PREDICTED: sucrose synthase 1-like [Camelina sativa]
Length=808

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+E
Sbjct  692  FATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISQGGLQRIEE  751

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  752  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  807



>gb|ADW80602.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFH+DPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHVDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_010454391.1| PREDICTED: sucrose synthase 1-like isoform X2 [Camelina sativa]
Length=808

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+E
Sbjct  692  FATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISQGGLQRIEE  751

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  752  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  807



>ref|XP_010454392.1| PREDICTED: sucrose synthase 1-like isoform X3 [Camelina sativa]
Length=838

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+E
Sbjct  722  FATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISQGGLQRIEE  781

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  782  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  837



>ref|XP_010493195.1| PREDICTED: sucrose synthase 1 [Camelina sativa]
Length=808

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+E
Sbjct  692  FATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISQGGLQRIEE  751

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  752  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  807



>emb|CDX70945.1| BnaC03g10290D [Brassica napus]
Length=806

 Score =   201 bits (512),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSGFHIDPYHGEQAA+ L DFF KCK+DPSHW+ IS GGL+RI+E
Sbjct  690  FATCKGGPAEIIVHGKSGFHIDPYHGEQAADTLADFFTKCKEDPSHWDEISKGGLQRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAKAVPLAEE  805



>ref|XP_010454390.1| PREDICTED: sucrose synthase 1-like isoform X1 [Camelina sativa]
Length=862

 Score =   201 bits (512),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+E
Sbjct  746  FATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISQGGLQRIEE  805

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  806  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  861



>ref|XP_008337809.1| PREDICTED: sucrose synthase [Malus domestica]
 ref|XP_008337810.1| PREDICTED: sucrose synthase [Malus domestica]
 ref|XP_008337811.1| PREDICTED: sucrose synthase [Malus domestica]
Length=807

 Score =   201 bits (511),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSG+HIDPYHG+QAAE+LVDFFEK K DPSHW+ IS GGL+RI E
Sbjct  691  FATCKGGPAEIIVHGKSGYHIDPYHGDQAAEILVDFFEKSKADPSHWDKISQGGLQRIYE  750

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+ KLA  VPLA+E
Sbjct  751  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYSKLAASVPLAVE  806



>ref|XP_003609946.1| Sucrose synthase [Medicago truncatula]
Length=893

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+E
Sbjct  778  FATLNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKISQGGLQRIEE  837

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  838  KYTWTIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  893



>ref|XP_009120766.1| PREDICTED: LOW QUALITY PROTEIN: sucrose synthase 1 [Brassica 
rapa]
Length=805

 Score =   201 bits (511),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+E
Sbjct  690  FATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDQISKGGLQRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  805



>emb|CDX92432.1| BnaA10g14710D [Brassica napus]
Length=805

 Score =   201 bits (511),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+E
Sbjct  690  FATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDQISKGGLQRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  805



>gb|KHN49081.1| Sucrose synthase [Glycine soja]
Length=806

 Score =   201 bits (511),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSG+HIDPYHG++AAE+LV+FFEK K DPSHW+ IS GGLKRI E
Sbjct  690  FATCNGGPAEIIVHGKSGYHIDPYHGDRAAEILVEFFEKSKADPSHWDKISQGGLKRIHE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  750  KYTWQIYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>ref|XP_011039917.1| PREDICTED: sucrose synthase [Populus euphratica]
Length=803

 Score =   201 bits (511),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            K+TW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLAE VPL IE
Sbjct  748  KHTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLAESVPLTIE  803



>ref|XP_003546526.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006597891.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=806

 Score =   201 bits (511),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSG+HIDPYHG++AAE+LV+FFEK K DPSHW+ IS GGLKRI E
Sbjct  690  FATCNGGPAEIIVHGKSGYHIDPYHGDRAAEILVEFFEKSKADPSHWDKISQGGLKRIHE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  750  KYTWQIYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>gb|AII19313.1| sucrose synthase 1, partial [Ricinus communis]
Length=805

 Score =   201 bits (511),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLV+FFEKCK DP  W+ IS GGL+RIQE
Sbjct  690  FATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVEFFEKCKADPCVWDEISKGGLQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK++KLA+ VPL +E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYKKLADSVPLTVE  805



>ref|XP_010520519.1| PREDICTED: sucrose synthase 4-like [Tarenaya hassleriana]
Length=807

 Score =   201 bits (511),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIV+GKSGFHIDPYHG+QAAE+L DFF KCK+DPSHW+ IS GGL+RI+E
Sbjct  691  FATCNGGPAEIIVNGKSGFHIDPYHGDQAAEILADFFAKCKEDPSHWDEISHGGLQRIEE  750

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  751  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  806



>ref|XP_002516210.1| sucrose synthase, putative [Ricinus communis]
 gb|EEF46212.1| sucrose synthase, putative [Ricinus communis]
Length=773

 Score =   201 bits (510),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLV+FFEKCK DP  W+ IS GGL+RIQE
Sbjct  658  FATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVEFFEKCKADPCVWDEISKGGLQRIQE  717

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK++KLA+ VPL +E
Sbjct  718  KYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYKKLADSVPLTVE  773



>emb|CDY16569.1| BnaC09g37040D [Brassica napus]
Length=805

 Score =   201 bits (510),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+E
Sbjct  690  FATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFAKCKEDPSHWDQISKGGLQRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  805



>sp|P49034.1|SUSY_ALNGL RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Alnus glutinosa]
 emb|CAA63122.1| sucrose synthase [Alnus glutinosa]
Length=803

 Score =   201 bits (510),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSGFHIDPYHGEQAA+LLVDFFEK K DPSHW  IS GGL+RI E
Sbjct  688  FATCKGGPAEIIVHGKSGFHIDPYHGEQAAQLLVDFFEKTKADPSHWAKISLGGLQRIHE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RLLTL  V  FWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  748  KYTWKIYSERLLTLTGVTAFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  803



>ref|XP_003533802.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006587064.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=806

 Score =   201 bits (510),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSG+HIDPYHG+ AAE+LV+FFEK K DPSHW+ IS GGLKRI E
Sbjct  690  FATCNGGPAEIIVHGKSGYHIDPYHGDHAAEILVEFFEKSKADPSHWDKISQGGLKRIHE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  750  KYTWQIYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>ref|NP_566865.2| sucrose synthase 4 [Arabidopsis thaliana]
 sp|Q9LXL5.1|SUS4_ARATH RecName: Full=Sucrose synthase 4; Short=AtSUS4; AltName: Full=Sucrose-UDP 
glucosyltransferase 4 [Arabidopsis thaliana]
 emb|CAB89040.1| sucrose synthase-like protein [Arabidopsis thaliana]
 gb|AEE77773.1| sucrose synthase 4 [Arabidopsis thaliana]
Length=808

 Score =   201 bits (510),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG++AAE L DFF KCK DPSHW+ IS GGL+RIQE
Sbjct  692  FATCNGGPAEIIVHGKSGFHIDPYHGDKAAESLADFFTKCKHDPSHWDQISLGGLERIQE  751

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  752  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAHE  807



>tpg|DAA45272.1| TPA: putative sucrose synthase family protein [Zea mays]
Length=282

 Score =   191 bits (485),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT HGGPAEII HG SGFHIDPYH EQAA L+ DFFE+CK+DP HW  IS  GL+RI E
Sbjct  164  FATLHGGPAEIIEHGVSGFHIDPYHPEQAANLMADFFERCKQDPDHWVKISGAGLQRIYE  223

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS+RL+TLA VYGFWK+VSKL+RLE RRYLEMFY LKFR+LA+ VPLAI+
Sbjct  224  KYTWKIYSERLMTLAGVYGFWKYVSKLERLETRRYLEMFYILKFRELAKTVPLAID  279



>ref|NP_197583.1| sucrose synthase 1 [Arabidopsis thaliana]
 ref|NP_001031915.1| sucrose synthase 1 [Arabidopsis thaliana]
 sp|P49040.3|SUSY1_ARATH RecName: Full=Sucrose synthase 1; Short=AtSUS1; AltName: Full=Sucrose-UDP 
glucosyltransferase 1 [Arabidopsis thaliana]
 dbj|BAH19538.1| AT5G20830 [Arabidopsis thaliana]
 gb|AED92894.1| sucrose synthase 1 [Arabidopsis thaliana]
 gb|AED92895.1| sucrose synthase 1 [Arabidopsis thaliana]
Length=808

 Score =   201 bits (510),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+E
Sbjct  692  FATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISKGGLQRIEE  751

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  341
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA
Sbjct  752  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLA  805



>gb|ADW80603.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   200 bits (509),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFW+HVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWEHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|KHN47619.1| Sucrose synthase [Glycine soja]
Length=806

 Score =   200 bits (509),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSG+HIDPYHG+ AAE+LV+FFEK K DPSHW+ IS GGLKRI E
Sbjct  690  FATCNGGPAEIIVHGKSGYHIDPYHGDHAAEILVEFFEKSKADPSHWDKISQGGLKRIHE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  750  KYTWQIYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>sp|Q01390.1|SUSY_VIGRR RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Vigna radiata var. radiata]
 dbj|BAA01108.1| sucrose synthase [Vigna radiata var. radiata]
Length=805

 Score =   200 bits (509),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS  GL+RI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKISQAGLQRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>pdb|3S28|A Chain A, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|B Chain B, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|C Chain C, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|D Chain D, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|E Chain E, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|F Chain F, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|G Chain G, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|H Chain H, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S29|A Chain A, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|B Chain B, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|C Chain C, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|D Chain D, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|E Chain E, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|F Chain F, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|G Chain G, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|H Chain H, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
Length=816

 Score =   200 bits (509),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+E
Sbjct  692  FATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISKGGLQRIEE  751

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  341
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA
Sbjct  752  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLA  805



>gb|ADW80599.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   200 bits (509),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+  PL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSAPLTIE  803



>gb|AGQ57012.1| sucrose synthase 1 [Hevea brasiliensis]
Length=806

 Score =   200 bits (509),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGK GF+IDPYHG QAAELLVDFFEK K DPSHW  IS G ++RIQE
Sbjct  690  FATCNGGPAEIIVHGKPGFNIDPYHGGQAAELLVDFFEKSKADPSHWNNISRGAMQRIQE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|ADW80579.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   200 bits (509),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKH S LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYTWRIYSQRLLTLTGVYGFWKHASNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>dbj|BAH56282.1| sucrose synthase [Vigna angularis]
Length=805

 Score =   200 bits (509),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS  GL+RI+E
Sbjct  690  FATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKISEAGLQRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_009131818.1| PREDICTED: sucrose synthase 1 [Brassica rapa]
Length=806

 Score =   200 bits (509),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+E
Sbjct  690  FATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISKGGLQRIEE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  750  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAKAVPLAEE  805



>gb|ADW80601.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   200 bits (509),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KY W+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  748  KYAWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80577.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   200 bits (509),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQE
Sbjct  688  FATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQE  747

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLE+FYALK+RKLA+ VPL IE
Sbjct  748  KYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEVFYALKYRKLADSVPLTIE  803



>ref|XP_006287059.1| hypothetical protein CARUB_v10000208mg, partial [Capsella rubella]
 gb|EOA19957.1| hypothetical protein CARUB_v10000208mg, partial [Capsella rubella]
Length=850

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+E
Sbjct  734  FATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISLGGLQRIEE  793

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  341
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA
Sbjct  794  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLA  847



>gb|AFI57908.1| sucrose synthase 1 [Prunus persica]
Length=806

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSG+HIDPYHG+QAA++LVDFFEK + DPSHW+ IS GGL+RI E
Sbjct  690  FATCKGGPAEIIVHGKSGYHIDPYHGDQAADILVDFFEKSRADPSHWDKISQGGLQRIYE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VP A E
Sbjct  750  KYTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPRAEE  805



>ref|XP_008382924.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIV+GKSG+HIDPYHG+QAAE+ VDFFEK K DPSHW+ IS GGL+RI E
Sbjct  691  FATCKGGPAEIIVNGKSGYHIDPYHGDQAAEIJVDFFEKNKADPSHWDKISQGGLQRIYE  750

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  VPLA+E
Sbjct  751  KYTWQIYSERLLTLTGVYGFWKDVSNLDRLESRRYLEMFYALKFRKLAASVPLAVE  806



>emb|CDX88838.1| BnaA03g08110D [Brassica napus]
Length=743

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+E
Sbjct  627  FATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISKGGLQRIEE  686

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  687  KYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAKAVPLAEE  742



>ref|XP_008349074.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIV+GKSG+HIDPYHG+QAAE+ VDFFEK K DPSHW+ IS GGL+RI E
Sbjct  691  FATCKGGPAEIIVNGKSGYHIDPYHGDQAAEIJVDFFEKNKADPSHWDKISQGGLQRIYE  750

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  VPLA+E
Sbjct  751  KYTWQIYSERLLTLTGVYGFWKDVSNLDRLESRRYLEMFYALKFRKLAASVPLAVE  806



>ref|XP_008242292.1| PREDICTED: sucrose synthase [Prunus mume]
 ref|XP_008242293.1| PREDICTED: sucrose synthase [Prunus mume]
Length=806

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSG+HIDPYHG+QAA++LVDFFEK + DPSHW+ IS GGL+RI E
Sbjct  690  FATCKGGPAEIIVHGKSGYHIDPYHGDQAADILVDFFEKSRADPSHWDKISQGGLQRIYE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VP A E
Sbjct  750  KYTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPRAEE  805



>ref|XP_007204649.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 ref|XP_007204650.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 gb|EMJ05848.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 gb|EMJ05849.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
Length=806

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  FATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQE  503
            FAT  GGPAEIIVHGKSG+HIDPYHG+QAA++LVDFFEK + DPSHW+ IS GGL+RI E
Sbjct  690  FATCKGGPAEIIVHGKSGYHIDPYHGDQAADILVDFFEKSRADPSHWDKISQGGLQRIYE  749

Query  502  KYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  335
            KYTWQIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VP A E
Sbjct  750  KYTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPRAEE  805



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1131443780880