BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF036K04

Length=663
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009771440.1|  PREDICTED: uncharacterized protein LOC104221976    241   3e-74   Nicotiana sylvestris
ref|XP_009617293.1|  PREDICTED: uncharacterized protein LOC104109646    236   3e-72   Nicotiana tomentosiformis
ref|XP_006364278.1|  PREDICTED: uncharacterized protein LOC102598357    231   2e-70   Solanum tuberosum [potatoes]
ref|XP_004245192.1|  PREDICTED: uncharacterized protein LOC101262737    231   2e-70   Solanum lycopersicum
ref|XP_011085499.1|  PREDICTED: uncharacterized protein LOC105167438    230   4e-70   Sesamum indicum [beniseed]
emb|CDP04798.1|  unnamed protein product                                229   7e-70   Coffea canephora [robusta coffee]
gb|EYU21948.1|  hypothetical protein MIMGU_mgv1a0096341mg               228   2e-69   Erythranthe guttata [common monkey flower]
ref|XP_011081926.1|  PREDICTED: uncharacterized protein LOC105164832    227   2e-68   Sesamum indicum [beniseed]
ref|XP_010254319.1|  PREDICTED: uncharacterized protein LOC104595325    221   1e-66   Nelumbo nucifera [Indian lotus]
ref|XP_002515557.1|  conserved hypothetical protein                     221   2e-66   
gb|KDP33619.1|  hypothetical protein JCGZ_07190                         219   9e-66   Jatropha curcas
ref|XP_004138737.1|  PREDICTED: uncharacterized protein LOC101219952    219   9e-66   Cucumis sativus [cucumbers]
ref|XP_006399647.1|  hypothetical protein EUTSA_v10013887mg             217   2e-65   
ref|XP_010419712.1|  PREDICTED: uncharacterized protein LOC104705408    218   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010491872.1|  PREDICTED: uncharacterized protein LOC104769372    218   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010453190.1|  PREDICTED: uncharacterized protein LOC104735158    218   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_008445161.1|  PREDICTED: uncharacterized protein LOC103488281    219   3e-65   
ref|XP_006399646.1|  hypothetical protein EUTSA_v10013887mg             217   3e-65   Eutrema salsugineum [saltwater cress]
dbj|BAH57107.1|  AT5G25460                                              211   5e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010106829.1|  hypothetical protein L484_006602                   211   1e-64   
ref|XP_010249980.1|  PREDICTED: uncharacterized protein LOC104592350    216   1e-64   Nelumbo nucifera [Indian lotus]
ref|NP_196703.1|  uncharacterized protein                               216   1e-64   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63507.1|  unknown                                                 216   1e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287989.1|  hypothetical protein CARUB_v10001222mg             216   2e-64   Capsella rubella
ref|XP_002871473.1|  hypothetical protein ARALYDRAFT_487977             215   2e-64   
dbj|BAD93856.1|  hypothetical protein                                   210   3e-64   Arabidopsis thaliana [mouse-ear cress]
gb|AAN31807.1|  unknown protein                                         214   4e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006483312.1|  PREDICTED: uncharacterized protein LOC102608149    214   4e-64   Citrus sinensis [apfelsine]
gb|EPS73289.1|  hypothetical protein M569_01466                         214   5e-64   Genlisea aurea
ref|XP_010541619.1|  PREDICTED: uncharacterized protein LOC104815031    214   6e-64   Tarenaya hassleriana [spider flower]
ref|XP_010454874.1|  PREDICTED: uncharacterized protein LOC104736571    214   7e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010048991.1|  PREDICTED: uncharacterized protein LOC104437692    213   7e-64   Eucalyptus grandis [rose gum]
ref|XP_010421395.1|  PREDICTED: uncharacterized protein LOC104706866    214   8e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010493802.1|  PREDICTED: uncharacterized protein LOC104771027    214   8e-64   Camelina sativa [gold-of-pleasure]
ref|XP_006287976.1|  hypothetical protein CARUB_v10001211mg             214   8e-64   Capsella rubella
ref|XP_010519935.1|  PREDICTED: uncharacterized protein LOC104799224    213   9e-64   Tarenaya hassleriana [spider flower]
ref|XP_010526203.1|  PREDICTED: uncharacterized protein LOC104803829    213   1e-63   Tarenaya hassleriana [spider flower]
ref|XP_011026488.1|  PREDICTED: uncharacterized protein LOC105127071    213   2e-63   Populus euphratica
ref|XP_002324280.2|  hypothetical protein POPTR_0018s01390g             213   2e-63   
ref|XP_007223355.1|  hypothetical protein PRUPE_ppa007452mg             213   2e-63   Prunus persica
ref|XP_011019764.1|  PREDICTED: uncharacterized protein LOC105122387    212   2e-63   Populus euphratica
ref|XP_009121952.1|  PREDICTED: uncharacterized protein LOC103846721    213   2e-63   Brassica rapa
gb|KHG29602.1|  Allergen Act d 3                                        213   3e-63   Gossypium arboreum [tree cotton]
ref|XP_009125805.1|  PREDICTED: uncharacterized protein LOC103850771    212   3e-63   Brassica rapa
ref|XP_006450498.1|  hypothetical protein CICLE_v10008711mg             212   3e-63   Citrus clementina [clementine]
ref|XP_002284962.1|  PREDICTED: uncharacterized protein LOC100252479    212   3e-63   Vitis vinifera
ref|XP_008219896.1|  PREDICTED: uncharacterized protein LOC103320060    212   3e-63   Prunus mume [ume]
gb|KFK27809.1|  hypothetical protein AALP_AA8G432300                    212   3e-63   Arabis alpina [alpine rockcress]
ref|XP_004291483.1|  PREDICTED: uncharacterized protein LOC101294330    212   3e-63   Fragaria vesca subsp. vesca
emb|CDX85713.1|  BnaA02g01000D                                          212   4e-63   
emb|CDY19801.1|  BnaA09g04540D                                          212   4e-63   Brassica napus [oilseed rape]
ref|XP_011019761.1|  PREDICTED: uncharacterized protein LOC105122382    212   4e-63   Populus euphratica
emb|CDX91217.1|  BnaC02g03800D                                          212   5e-63   
gb|KJB80694.1|  hypothetical protein B456_013G110800                    210   5e-63   Gossypium raimondii
gb|KHN06654.1|  hypothetical protein glysoja_037506                     211   6e-63   Glycine soja [wild soybean]
ref|XP_007161233.1|  hypothetical protein PHAVU_001G053100g             211   6e-63   Phaseolus vulgaris [French bean]
ref|XP_006601137.1|  PREDICTED: uncharacterized protein LOC100813...    211   6e-63   
ref|NP_197928.1|  UF642 l-GalL-responsive protein 1                     211   7e-63   Arabidopsis thaliana [mouse-ear cress]
gb|KJB80693.1|  hypothetical protein B456_013G110800                    211   8e-63   Gossypium raimondii
gb|AAL06839.1|  AT5g25460/F18G18_200                                    211   1e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394799.1|  hypothetical protein EUTSA_v10004442mg             210   2e-62   Eutrema salsugineum [saltwater cress]
ref|XP_009345289.1|  PREDICTED: uncharacterized protein LOC103937097    210   2e-62   Pyrus x bretschneideri [bai li]
ref|XP_009334778.1|  PREDICTED: uncharacterized protein LOC103927565    210   2e-62   Pyrus x bretschneideri [bai li]
ref|XP_006412472.1|  hypothetical protein EUTSA_v10025706mg             209   2e-62   
emb|CAA22573.1|  putative protein                                       209   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006285882.1|  hypothetical protein CARUB_v10007385mg             209   2e-62   
ref|XP_002872166.1|  hypothetical protein ARALYDRAFT_910605             210   2e-62   Arabidopsis lyrata subsp. lyrata
ref|XP_003544618.1|  PREDICTED: uncharacterized protein LOC100776765    210   2e-62   Glycine max [soybeans]
gb|KFK25408.1|  hypothetical protein AALP_AA8G110600                    210   3e-62   Arabis alpina [alpine rockcress]
ref|XP_008378299.1|  PREDICTED: uncharacterized protein LOC103441403    209   3e-62   
ref|XP_002867243.1|  hypothetical protein ARALYDRAFT_913203             209   4e-62   Arabidopsis lyrata subsp. lyrata
gb|AAM61720.1|  unknown                                                 209   4e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006841925.1|  hypothetical protein AMTR_s00042p00185900          208   5e-62   
gb|ABK94923.1|  unknown                                                 209   6e-62   Populus trichocarpa [western balsam poplar]
ref|XP_007013814.1|  Uncharacterized protein isoform 2                  209   6e-62   Theobroma cacao [chocolate]
ref|XP_008394047.1|  PREDICTED: uncharacterized protein LOC103456171    209   7e-62   
emb|CAA06490.1|  hypothetical protein                                   202   7e-62   Cicer arietinum [garbanzo]
dbj|BAE98407.1|  hypothetical protein                                   209   7e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009151074.1|  PREDICTED: uncharacterized protein LOC103874406    209   7e-62   Brassica rapa
ref|NP_567894.1|  uncharacterized protein                               208   8e-62   Arabidopsis thaliana [mouse-ear cress]
emb|CDY54909.1|  BnaC02g48660D                                          207   8e-62   Brassica napus [oilseed rape]
ref|XP_009129962.1|  PREDICTED: uncharacterized protein LOC103854751    208   1e-61   Brassica rapa
ref|XP_002308647.2|  hypothetical protein POPTR_0006s26630g             209   1e-61   
ref|XP_007013813.1|  Uncharacterized protein isoform 1                  209   1e-61   
gb|KJB07801.1|  hypothetical protein B456_001G045200                    208   2e-61   Gossypium raimondii
emb|CDX80516.1|  BnaC07g29280D                                          206   2e-61   
gb|KJB07802.1|  hypothetical protein B456_001G045200                    208   2e-61   Gossypium raimondii
ref|XP_010447383.1|  PREDICTED: uncharacterized protein LOC104730027    207   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010432718.1|  PREDICTED: uncharacterized protein LOC104716937    207   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_003588711.1|  hypothetical protein MTR_1g011800                  206   2e-61   
gb|KHG19965.1|  putative e3 ubiquitin-protein ligase hul4               207   3e-61   Gossypium arboreum [tree cotton]
emb|CDX97108.1|  BnaC09g45170D                                          207   4e-61   
ref|XP_010110340.1|  GTP-binding nuclear protein                        212   4e-61   
emb|CDX68849.1|  BnaC01g06040D                                          206   5e-61   
gb|AES58962.2|  plant/F18G18-200 protein                                206   7e-61   Medicago truncatula
gb|ACJ84308.1|  unknown                                                 206   8e-61   Medicago truncatula
ref|XP_010670694.1|  PREDICTED: uncharacterized protein LOC104887687    206   8e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009407651.1|  PREDICTED: uncharacterized protein LOC103990295    205   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009125963.1|  PREDICTED: uncharacterized protein LOC103850912    205   2e-60   Brassica rapa
ref|XP_004241713.1|  PREDICTED: uncharacterized protein LOC101268115    204   4e-60   Solanum lycopersicum
ref|XP_006356190.1|  PREDICTED: uncharacterized protein LOC102589576    204   4e-60   Solanum tuberosum [potatoes]
ref|XP_006341715.1|  PREDICTED: uncharacterized protein LOC102601890    204   5e-60   
ref|XP_004235717.1|  PREDICTED: uncharacterized protein LOC101252763    204   7e-60   Solanum lycopersicum
gb|AAB41813.1|  unknown protein                                         203   1e-59   Medicago sativa [alfalfa]
ref|XP_009778816.1|  PREDICTED: uncharacterized protein LOC104228110    203   1e-59   Nicotiana sylvestris
ref|XP_009590498.1|  PREDICTED: uncharacterized protein LOC104087663    203   1e-59   Nicotiana tomentosiformis
ref|XP_004498654.1|  PREDICTED: uncharacterized protein LOC101508759    202   2e-59   Cicer arietinum [garbanzo]
gb|KHN07099.1|  hypothetical protein glysoja_023282                     201   4e-59   Glycine soja [wild soybean]
ref|XP_010918669.1|  PREDICTED: uncharacterized protein LOC105042950    202   4e-59   Elaeis guineensis
ref|XP_006581022.1|  PREDICTED: uncharacterized protein LOC100802...    201   5e-59   
ref|XP_009591297.1|  PREDICTED: uncharacterized protein LOC104088341    201   6e-59   Nicotiana tomentosiformis
emb|CDX69757.1|  BnaA10g21060D                                          212   6e-59   
ref|XP_009401767.1|  PREDICTED: uncharacterized protein LOC103985700    201   9e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009758146.1|  PREDICTED: uncharacterized protein LOC104210873    201   1e-58   Nicotiana sylvestris
ref|XP_009389493.1|  PREDICTED: uncharacterized protein LOC103976040    200   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG21629.1|  GTPase Der                                              198   2e-58   Gossypium arboreum [tree cotton]
ref|XP_006346648.1|  PREDICTED: uncharacterized protein LOC102598480    199   5e-58   
gb|KJB70569.1|  hypothetical protein B456_011G080100                    197   5e-58   Gossypium raimondii
gb|KHG06895.1|  Agmatine deiminase                                      198   8e-58   Gossypium arboreum [tree cotton]
gb|KJB70568.1|  hypothetical protein B456_011G080100                    198   9e-58   Gossypium raimondii
ref|XP_010048243.1|  PREDICTED: uncharacterized protein LOC104437065    197   2e-57   Eucalyptus grandis [rose gum]
ref|XP_007150706.1|  hypothetical protein PHAVU_005G1745000g            195   2e-57   Phaseolus vulgaris [French bean]
gb|KHN07098.1|  hypothetical protein glysoja_023281                     195   4e-57   Glycine soja [wild soybean]
ref|XP_009598172.1|  PREDICTED: uncharacterized protein LOC104094024    196   6e-57   Nicotiana tomentosiformis
gb|AGV54541.1|  hypothetical protein                                    196   8e-57   Phaseolus vulgaris [French bean]
ref|NP_001242447.1|  uncharacterized protein LOC100802444 precursor     196   9e-57   Glycine max [soybeans]
ref|XP_010654739.1|  PREDICTED: uncharacterized protein LOC100261739    196   1e-56   Vitis vinifera
gb|KHN47787.1|  hypothetical protein glysoja_029205                     195   1e-56   Glycine soja [wild soybean]
ref|XP_003531698.1|  PREDICTED: uncharacterized protein LOC100779277    195   1e-56   Glycine max [soybeans]
gb|KDO83473.1|  hypothetical protein CISIN_1g017636mg                   192   2e-56   Citrus sinensis [apfelsine]
ref|XP_003526423.1|  PREDICTED: uncharacterized protein LOC100801917    194   2e-56   
ref|XP_010914930.1|  PREDICTED: uncharacterized protein LOC105040204    194   2e-56   Elaeis guineensis
emb|CBI36253.3|  unnamed protein product                                195   2e-56   Vitis vinifera
ref|XP_008792101.1|  PREDICTED: uncharacterized protein LOC103708794    194   3e-56   Phoenix dactylifera
ref|XP_008775036.1|  PREDICTED: uncharacterized protein LOC103695476    194   3e-56   Phoenix dactylifera
ref|XP_011072257.1|  PREDICTED: uncharacterized protein LOC105157546    195   3e-56   
ref|XP_002517567.1|  conserved hypothetical protein                     194   4e-56   Ricinus communis
ref|XP_011081171.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    194   5e-56   Sesamum indicum [beniseed]
gb|AFK48067.1|  unknown                                                 189   5e-56   Lotus japonicus
gb|KHG10708.1|  Allergen Act d 3                                        194   6e-56   Gossypium arboreum [tree cotton]
ref|XP_004252488.1|  PREDICTED: uncharacterized protein LOC101250580    193   8e-56   Solanum lycopersicum
ref|XP_007023946.1|  Uncharacterized protein TCM_028364                 193   8e-56   Theobroma cacao [chocolate]
ref|XP_009764126.1|  PREDICTED: uncharacterized protein LOC104215887    193   1e-55   Nicotiana sylvestris
ref|XP_006439076.1|  hypothetical protein CICLE_v10031881mg             192   1e-55   Citrus clementina [clementine]
gb|EMS52012.1|  hypothetical protein TRIUR3_31218                       191   1e-55   Triticum urartu
gb|KJB68131.1|  hypothetical protein B456_010G227400                    192   2e-55   Gossypium raimondii
ref|XP_004486698.1|  PREDICTED: uncharacterized protein LOC101495368    192   2e-55   Cicer arietinum [garbanzo]
dbj|BAK03126.1|  predicted protein                                      192   3e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN44154.1|  hypothetical protein glysoja_031815                     191   4e-55   Glycine soja [wild soybean]
ref|XP_011035644.1|  PREDICTED: uncharacterized protein LOC105133377    191   6e-55   Populus euphratica
ref|XP_002303263.1|  hypothetical protein POPTR_0003s05850g             191   8e-55   
ref|XP_011040006.1|  PREDICTED: uncharacterized protein LOC105136392    191   9e-55   Populus euphratica
gb|KJB70570.1|  hypothetical protein B456_011G080200                    185   1e-54   Gossypium raimondii
gb|EMT16005.1|  hypothetical protein F775_13621                         189   2e-54   
ref|XP_002298115.2|  hypothetical protein POPTR_0001s17430g             190   2e-54   Populus trichocarpa [western balsam poplar]
gb|EYU24667.1|  hypothetical protein MIMGU_mgv1a008541mg                189   2e-54   Erythranthe guttata [common monkey flower]
ref|XP_003597843.1|  hypothetical protein MTR_2g103170                  189   3e-54   Medicago truncatula
ref|XP_008347484.1|  PREDICTED: uncharacterized protein LOC103410579    189   3e-54   Malus domestica [apple tree]
ref|XP_010061944.1|  PREDICTED: uncharacterized protein LOC104449472    188   5e-54   Eucalyptus grandis [rose gum]
ref|XP_007218161.1|  hypothetical protein PRUPE_ppa007461mg             185   1e-53   
gb|EYU21602.1|  hypothetical protein MIMGU_mgv1a008411mg                187   1e-53   Erythranthe guttata [common monkey flower]
gb|KDP37140.1|  hypothetical protein JCGZ_06196                         187   1e-53   Jatropha curcas
ref|XP_004149718.1|  PREDICTED: uncharacterized protein LOC101216438    187   2e-53   Cucumis sativus [cucumbers]
ref|XP_010534242.1|  PREDICTED: uncharacterized protein LOC104809851    187   2e-53   Tarenaya hassleriana [spider flower]
ref|XP_010241207.1|  PREDICTED: uncharacterized protein LOC104585883    186   3e-53   Nelumbo nucifera [Indian lotus]
ref|XP_004307221.1|  PREDICTED: uncharacterized protein LOC101292742    186   3e-53   Fragaria vesca subsp. vesca
dbj|BAD16016.1|  unknown protein                                        184   5e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007218160.1|  hypothetical protein PRUPE_ppa007461mg             186   6e-53   Prunus persica
ref|XP_009348421.1|  PREDICTED: uncharacterized protein LOC103940075    186   6e-53   Pyrus x bretschneideri [bai li]
ref|XP_008377611.1|  PREDICTED: uncharacterized protein LOC103440696    186   7e-53   Malus domestica [apple tree]
gb|ABF99456.1|  expressed protein                                       183   1e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011466738.1|  PREDICTED: uncharacterized protein LOC101306...    184   1e-52   Fragaria vesca subsp. vesca
ref|XP_009333642.1|  PREDICTED: uncharacterized protein LOC103926567    185   1e-52   Pyrus x bretschneideri [bai li]
gb|KHG21630.1|  Adenosylhomocysteinase                                  184   2e-52   Gossypium arboreum [tree cotton]
gb|EEE56530.1|  hypothetical protein OsJ_05823                          184   2e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007217604.1|  hypothetical protein PRUPE_ppa018156mg             184   2e-52   Prunus persica
ref|NP_001046247.2|  Os02g0205200                                       184   3e-52   
gb|EEC72709.1|  hypothetical protein OsI_06304                          184   3e-52   Oryza sativa Indica Group [Indian rice]
ref|XP_002453515.1|  hypothetical protein SORBIDRAFT_04g007160          183   3e-52   
ref|XP_011466736.1|  PREDICTED: uncharacterized protein LOC101306...    184   3e-52   Fragaria vesca subsp. vesca
ref|XP_010257157.1|  PREDICTED: uncharacterized protein LOC104597377    183   4e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010088264.1|  hypothetical protein L484_005140                   184   4e-52   Morus notabilis
emb|CDO98109.1|  unnamed protein product                                182   4e-52   Coffea canephora [robusta coffee]
ref|XP_010539514.1|  PREDICTED: uncharacterized protein LOC104813570    182   7e-52   Tarenaya hassleriana [spider flower]
gb|EAY92272.1|  hypothetical protein OsI_13995                          182   9e-52   Oryza sativa Indica Group [Indian rice]
ref|XP_008245331.1|  PREDICTED: uncharacterized protein LOC103343457    182   1e-51   Prunus mume [ume]
ref|XP_008231461.1|  PREDICTED: uncharacterized protein LOC103330638    184   1e-51   Prunus mume [ume]
ref|XP_003564086.1|  PREDICTED: uncharacterized protein LOC100845370    182   2e-51   Brachypodium distachyon [annual false brome]
ref|NP_001051644.1|  Os03g0807700                                       182   2e-51   
ref|XP_008461812.1|  PREDICTED: uncharacterized protein LOC103500323    181   4e-51   Cucumis melo [Oriental melon]
ref|XP_008228640.1|  PREDICTED: uncharacterized protein LOC103328032    181   4e-51   Prunus mume [ume]
ref|XP_007052493.1|  F17A17.37 protein                                  181   6e-51   
ref|XP_004951511.1|  PREDICTED: uncharacterized protein LOC101755979    180   6e-51   Setaria italica
ref|XP_007201993.1|  hypothetical protein PRUPE_ppa024647mg             180   9e-51   
ref|XP_010057181.1|  PREDICTED: uncharacterized protein LOC104445070    180   1e-50   Eucalyptus grandis [rose gum]
gb|EMT25156.1|  hypothetical protein F775_26385                         180   1e-50   
ref|XP_002466246.1|  hypothetical protein SORBIDRAFT_01g004270          180   1e-50   Sorghum bicolor [broomcorn]
dbj|BAJ89665.1|  predicted protein                                      180   1e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB24990.1|  hypothetical protein B456_004G171200                    179   2e-50   Gossypium raimondii
emb|CDO98108.1|  unnamed protein product                                179   2e-50   Coffea canephora [robusta coffee]
ref|XP_006845336.1|  hypothetical protein AMTR_s00141p00085330          179   2e-50   Amborella trichopoda
ref|XP_008375195.1|  PREDICTED: uncharacterized protein LOC103438421    179   2e-50   Malus domestica [apple tree]
gb|KFK42429.1|  hypothetical protein AALP_AA2G255100                    179   3e-50   Arabis alpina [alpine rockcress]
gb|KJB24991.1|  hypothetical protein B456_004G171200                    179   3e-50   Gossypium raimondii
ref|XP_002517797.1|  conserved hypothetical protein                     178   3e-50   Ricinus communis
gb|KHG12815.1|  DNA-directed RNA polymerase subunit beta''              179   3e-50   Gossypium arboreum [tree cotton]
ref|XP_010067858.1|  PREDICTED: uncharacterized protein LOC104454644    178   4e-50   Eucalyptus grandis [rose gum]
ref|XP_011016219.1|  PREDICTED: uncharacterized protein LOC105119742    178   5e-50   Populus euphratica
ref|XP_008362680.1|  PREDICTED: uncharacterized protein LOC103426358    177   6e-50   
ref|XP_009354784.1|  PREDICTED: uncharacterized protein LOC103945912    177   6e-50   Pyrus x bretschneideri [bai li]
ref|XP_008363312.1|  PREDICTED: uncharacterized protein LOC103427013    177   8e-50   
ref|XP_006411450.1|  hypothetical protein EUTSA_v10016825mg             177   9e-50   Eutrema salsugineum [saltwater cress]
ref|NP_001144239.1|  uncharacterized protein LOC100277106 precursor     177   1e-49   
gb|KDP43556.1|  hypothetical protein JCGZ_16843                         177   1e-49   Jatropha curcas
gb|KJB19256.1|  hypothetical protein B456_003G091800                    175   1e-49   Gossypium raimondii
ref|XP_006465391.1|  PREDICTED: uncharacterized protein LOC102618171    177   1e-49   Citrus sinensis [apfelsine]
gb|AFK44456.1|  unknown                                                 171   1e-49   Lotus japonicus
gb|KDP26060.1|  hypothetical protein JCGZ_21093                         177   1e-49   Jatropha curcas
ref|XP_004981346.1|  PREDICTED: uncharacterized protein LOC101768647    177   1e-49   Setaria italica
tpg|DAA52069.1|  TPA: hypothetical protein ZEAMMB73_133538              176   2e-49   
ref|XP_002299934.2|  hypothetical protein POPTR_0001s27110g             176   3e-49   Populus trichocarpa [western balsam poplar]
gb|KJB36028.1|  hypothetical protein B456_006G137000                    176   3e-49   Gossypium raimondii
gb|KJB19257.1|  hypothetical protein B456_003G091800                    175   3e-49   Gossypium raimondii
ref|XP_011048055.1|  PREDICTED: uncharacterized protein LOC105142230    176   3e-49   Populus euphratica
emb|CDP07813.1|  unnamed protein product                                176   3e-49   Coffea canephora [robusta coffee]
ref|XP_002308027.2|  hypothetical protein POPTR_0006s04880g             176   3e-49   
ref|XP_011047367.1|  PREDICTED: uncharacterized protein LOC105141733    176   3e-49   Populus euphratica
ref|XP_011013325.1|  PREDICTED: uncharacterized protein LOC105117377    176   3e-49   Populus euphratica
gb|KHG07966.1|  Imidazolonepropionase                                   176   4e-49   Gossypium arboreum [tree cotton]
ref|XP_002276894.1|  PREDICTED: uncharacterized protein LOC100258445    175   4e-49   Vitis vinifera
ref|XP_006826721.1|  hypothetical protein AMTR_s00264p00012960          175   6e-49   
ref|XP_002887838.1|  hypothetical protein ARALYDRAFT_340195             175   7e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_010695068.1|  PREDICTED: uncharacterized protein LOC104907775    174   1e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008364711.1|  PREDICTED: uncharacterized protein LOC103428382    174   1e-48   
ref|NP_178141.1|  protein DUF642 L-GALL RESPONSIVE GENE 1               174   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002308942.2|  hypothetical protein POPTR_0006s04890g             174   2e-48   Populus trichocarpa [western balsam poplar]
ref|XP_008392232.1|  PREDICTED: uncharacterized protein LOC103454416    173   3e-48   
ref|XP_003534397.1|  PREDICTED: uncharacterized protein LOC100812299    173   4e-48   Glycine max [soybeans]
gb|KHN11697.1|  hypothetical protein glysoja_006150                     173   4e-48   Glycine soja [wild soybean]
ref|XP_006427179.1|  hypothetical protein CICLE_v10025880mg             172   5e-48   Citrus clementina [clementine]
dbj|BAD52536.1|  unknown protein                                        171   7e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010417734.1|  PREDICTED: uncharacterized protein LOC104703420    172   7e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010429991.1|  PREDICTED: uncharacterized protein LOC104714356    172   8e-48   Camelina sativa [gold-of-pleasure]
ref|XP_009355525.1|  PREDICTED: uncharacterized protein LOC103946533    172   8e-48   Pyrus x bretschneideri [bai li]
ref|XP_009142779.1|  PREDICTED: uncharacterized protein LOC103866589    172   8e-48   Brassica rapa
ref|XP_009379646.1|  PREDICTED: uncharacterized protein LOC103968043    176   9e-48   
ref|XP_007028767.1|  F17A17.37 protein                                  172   9e-48   
ref|XP_006296392.1|  hypothetical protein CARUB_v10025565mg             172   1e-47   Capsella rubella
ref|XP_006301335.1|  hypothetical protein CARUB_v10021745mg             172   1e-47   Capsella rubella
emb|CDY54317.1|  BnaC06g43150D                                          172   1e-47   Brassica napus [oilseed rape]
gb|ACL52831.1|  unknown                                                 165   1e-47   Zea mays [maize]
ref|XP_002313314.1|  hypothetical protein POPTR_0009s06370g             171   1e-47   Populus trichocarpa [western balsam poplar]
gb|AGV54808.1|  hypothetical protein                                    171   2e-47   Phaseolus vulgaris [French bean]
ref|XP_007148907.1|  hypothetical protein PHAVU_005G024100g             171   2e-47   Phaseolus vulgaris [French bean]
ref|NP_001239749.1|  uncharacterized protein LOC100804119 precursor     171   2e-47   Glycine max [soybeans]
gb|EYU43005.1|  hypothetical protein MIMGU_mgv1a011073mg                169   2e-47   Erythranthe guttata [common monkey flower]
gb|KHN45084.1|  hypothetical protein glysoja_040000                     171   2e-47   Glycine soja [wild soybean]
ref|NP_001140426.1|  hypothetical protein precursor                     171   2e-47   Zea mays [maize]
ref|NP_001241275.1|  uncharacterized protein LOC100796094 precursor     171   2e-47   Glycine max [soybeans]
ref|XP_006489949.1|  PREDICTED: uncharacterized protein LOC102629059    171   2e-47   Citrus sinensis [apfelsine]
ref|XP_010472958.1|  PREDICTED: uncharacterized protein LOC104752499    171   2e-47   Camelina sativa [gold-of-pleasure]
ref|XP_003605795.1|  hypothetical protein MTR_4g039740                  171   2e-47   
ref|XP_010546243.1|  PREDICTED: uncharacterized protein LOC104818346    171   3e-47   Tarenaya hassleriana [spider flower]
gb|AFK39148.1|  unknown                                                 171   3e-47   Lotus japonicus
gb|AFK34548.1|  unknown                                                 171   3e-47   Lotus japonicus
emb|CDY57694.1|  BnaA07g38340D                                          171   3e-47   Brassica napus [oilseed rape]
ref|XP_011025472.1|  PREDICTED: uncharacterized protein LOC105126334    171   3e-47   Populus euphratica
gb|EAY74932.1|  hypothetical protein OsI_02826                          170   3e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_009355498.1|  PREDICTED: uncharacterized protein LOC103946508    170   3e-47   Pyrus x bretschneideri [bai li]
gb|KDO53673.1|  hypothetical protein CISIN_1g017355mg                   171   4e-47   Citrus sinensis [apfelsine]
ref|XP_002322719.1|  hypothetical protein POPTR_0016s05640g             170   4e-47   Populus trichocarpa [western balsam poplar]
ref|XP_006489938.1|  PREDICTED: uncharacterized protein LOC102625022    170   4e-47   Citrus sinensis [apfelsine]
ref|XP_009104452.1|  PREDICTED: uncharacterized protein LOC103830427    171   5e-47   Brassica rapa
dbj|BAB21293.1|  unknown protein                                        170   5e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010241208.1|  PREDICTED: uncharacterized protein LOC104585885    169   7e-47   Nelumbo nucifera [Indian lotus]
ref|NP_001043549.2|  Os01g0611000                                       170   7e-47   
emb|CDX79912.1|  BnaA05g02440D                                          171   1e-46   
gb|KHN32410.1|  hypothetical protein glysoja_026304                     168   1e-46   Glycine soja [wild soybean]
ref|XP_011033339.1|  PREDICTED: uncharacterized protein LOC105131855    169   1e-46   Populus euphratica
ref|XP_004506314.1|  PREDICTED: uncharacterized protein LOC101488216    169   1e-46   
ref|XP_010257158.1|  PREDICTED: uncharacterized protein LOC104597378    169   1e-46   
ref|XP_002283940.2|  PREDICTED: uncharacterized protein LOC100257236    169   1e-46   
ref|XP_009758716.1|  PREDICTED: uncharacterized protein LOC104211372    169   2e-46   
ref|XP_010554835.1|  PREDICTED: uncharacterized protein LOC104824444    169   2e-46   
ref|XP_002532070.1|  conserved hypothetical protein                     169   2e-46   
ref|XP_002881799.1|  hypothetical protein ARALYDRAFT_483261             168   2e-46   
ref|XP_006421407.1|  hypothetical protein CICLE_v10006613mg             167   3e-46   
ref|XP_010508668.1|  PREDICTED: uncharacterized protein LOC104785200    168   3e-46   
ref|XP_010517673.1|  PREDICTED: uncharacterized protein LOC104793095    168   3e-46   
gb|AES87990.2|  DUF642 family protein                                   168   4e-46   
ref|XP_003605793.1|  hypothetical protein MTR_4g039720                  167   4e-46   
gb|AFK39561.1|  unknown                                                 167   6e-46   
gb|KEH17090.1|  DUF642 family protein                                   167   6e-46   
ref|XP_004969140.1|  PREDICTED: uncharacterized protein LOC101755969    167   6e-46   
ref|XP_008776092.1|  PREDICTED: uncharacterized protein LOC103696299    167   6e-46   
ref|XP_010937268.1|  PREDICTED: uncharacterized protein LOC105056672    167   8e-46   
dbj|BAK03627.1|  predicted protein                                      167   8e-46   
ref|XP_006345424.1|  PREDICTED: uncharacterized protein LOC102582371    167   9e-46   
ref|XP_006421409.1|  hypothetical protein CICLE_v10005198mg             167   9e-46   
ref|XP_010672846.1|  PREDICTED: uncharacterized protein LOC104889...    167   9e-46   
ref|XP_010505974.1|  PREDICTED: uncharacterized protein LOC104782672    166   1e-45   
ref|XP_009630913.1|  PREDICTED: uncharacterized protein LOC104120779    166   1e-45   
ref|XP_010672845.1|  PREDICTED: uncharacterized protein LOC104889...    167   1e-45   
ref|XP_004229647.1|  PREDICTED: uncharacterized protein LOC101251618    167   1e-45   
ref|NP_181712.1|  uncharacterized protein                               166   1e-45   
emb|CDY48765.1|  BnaC04g02180D                                          167   2e-45   
ref|XP_006407770.1|  hypothetical protein EUTSA_v10020990mg             166   2e-45   
ref|XP_009418805.1|  PREDICTED: uncharacterized protein LOC103998920    166   2e-45   
ref|XP_010461096.1|  PREDICTED: uncharacterized protein LOC104741840    165   3e-45   
ref|XP_009142006.1|  PREDICTED: uncharacterized protein LOC103865900    165   4e-45   
ref|XP_004499913.1|  PREDICTED: uncharacterized protein LOC101495888    165   4e-45   
emb|CDY14785.1|  BnaC04g47820D                                          165   5e-45   
ref|XP_002882567.1|  hypothetical protein ARALYDRAFT_478145             164   5e-45   
ref|XP_010486384.1|  PREDICTED: uncharacterized protein LOC104764532    164   5e-45   
emb|CAN80832.1|  hypothetical protein VITISV_002505                     168   8e-45   
ref|XP_010464451.1|  PREDICTED: uncharacterized protein LOC104744998    164   8e-45   
ref|XP_010673134.1|  PREDICTED: uncharacterized protein LOC104889574    164   8e-45   
ref|NP_974254.1|  germination-related protein                           163   9e-45   
ref|XP_006297975.1|  hypothetical protein CARUB_v10014019mg             164   9e-45   
gb|EMT06486.1|  hypothetical protein F775_26416                         164   9e-45   
ref|XP_003605789.1|  hypothetical protein MTR_4g039680                  164   1e-44   
ref|XP_006294452.1|  hypothetical protein CARUB_v10023465mg             164   1e-44   
ref|XP_011087959.1|  PREDICTED: uncharacterized protein LOC105169285    163   2e-44   
ref|XP_010673133.1|  PREDICTED: uncharacterized protein LOC104889573    163   2e-44   
emb|CDX79913.1|  BnaA05g02430D                                          159   2e-44   
ref|XP_002455939.1|  hypothetical protein SORBIDRAFT_03g027650          163   2e-44   
ref|NP_566328.1|  germination-related protein                           162   3e-44   
ref|NP_181711.1|  uncharacterized protein                               162   3e-44   
ref|XP_008460770.1|  PREDICTED: uncharacterized protein LOC103499530    162   3e-44   
ref|XP_003569339.1|  PREDICTED: uncharacterized protein LOC100821501    162   4e-44   
gb|EYU20746.1|  hypothetical protein MIMGU_mgv1a008437mg                162   4e-44   
ref|XP_010097437.1|  hypothetical protein L484_003208                   162   5e-44   
ref|XP_010505975.1|  PREDICTED: uncharacterized protein LOC104782673    162   5e-44   
ref|XP_006389772.1|  hypothetical protein EUTSA_v10018730mg             162   6e-44   
ref|XP_002881800.1|  hypothetical protein ARALYDRAFT_483262             162   7e-44   
ref|XP_011091660.1|  PREDICTED: uncharacterized protein LOC105172024    162   7e-44   
emb|CDY48764.1|  BnaC04g02170D                                          157   7e-44   
gb|EYU20209.1|  hypothetical protein MIMGU_mgv1a008620mg                161   9e-44   
ref|XP_009123974.1|  PREDICTED: uncharacterized protein LOC103848900    161   1e-43   
emb|CDY22149.1|  BnaC01g39520D                                          161   1e-43   
emb|CDY28002.1|  BnaC05g44040D                                          161   1e-43   
ref|XP_010517674.1|  PREDICTED: uncharacterized protein LOC104793096    161   1e-43   
gb|EPS66311.1|  hypothetical protein M569_08463                         160   2e-43   
ref|XP_004162183.1|  PREDICTED: uncharacterized LOC101213859            160   2e-43   
ref|XP_004149398.1|  PREDICTED: uncharacterized protein LOC101213859    160   2e-43   
tpg|DAA58940.1|  TPA: hypothetical protein ZEAMMB73_364218              155   3e-43   
ref|XP_006411449.1|  hypothetical protein EUTSA_v10017674mg             160   3e-43   
ref|XP_009147007.1|  PREDICTED: uncharacterized protein LOC103870618    159   4e-43   
emb|CDY06908.1|  BnaA04g24070D                                          160   4e-43   
gb|KFK37021.1|  hypothetical protein AALP_AA4G201900                    159   5e-43   
ref|XP_010508664.1|  PREDICTED: uncharacterized protein LOC104785...    159   5e-43   
ref|XP_009142778.1|  PREDICTED: uncharacterized protein LOC103866588    159   8e-43   
ref|XP_010673132.1|  PREDICTED: uncharacterized protein LOC104889572    158   1e-42   
ref|XP_006411448.1|  hypothetical protein EUTSA_v10016810mg             158   2e-42   
ref|XP_010541767.1|  PREDICTED: uncharacterized protein LOC104815148    150   3e-42   
emb|CDP21696.1|  unnamed protein product                                157   5e-42   
gb|KJB36031.1|  hypothetical protein B456_006G137000                    157   6e-42   
ref|XP_006350194.1|  PREDICTED: uncharacterized protein LOC102578783    155   2e-41   
gb|ACG40327.1|  hypothetical protein                                    155   3e-41   
ref|XP_008672703.1|  PREDICTED: hypothetical protein isoform X1         155   3e-41   
ref|NP_001145978.1|  hypothetical protein                               155   5e-41   
ref|XP_009587019.1|  PREDICTED: uncharacterized protein LOC104084774    154   6e-41   
ref|XP_004236613.1|  PREDICTED: uncharacterized protein LOC101245049    153   1e-40   
ref|XP_009775467.1|  PREDICTED: uncharacterized protein LOC104225390    153   1e-40   
ref|XP_010445004.1|  PREDICTED: uncharacterized protein LOC104727612    151   2e-40   
ref|XP_010691193.1|  PREDICTED: uncharacterized protein LOC104904598    151   5e-40   
ref|XP_011078904.1|  PREDICTED: uncharacterized protein LOC105162545    151   7e-40   
ref|XP_006845338.1|  hypothetical protein AMTR_s00141p00087190          145   1e-39   
gb|EMT04285.1|  hypothetical protein F775_14657                         149   5e-39   
ref|XP_004236614.1|  PREDICTED: uncharacterized protein LOC101245348    148   8e-39   
emb|CAE01677.2|  OSJNBb0091E11.19                                       148   1e-38   
gb|EEC81716.1|  hypothetical protein OsI_25327                          148   1e-38   
emb|CAH67378.1|  OSIGBa0159F11.2                                        148   1e-38   
ref|XP_006350197.1|  PREDICTED: uncharacterized protein LOC102579762    148   1e-38   
gb|EMS63052.1|  hypothetical protein TRIUR3_01733                       147   2e-38   
ref|XP_003580051.1|  PREDICTED: uncharacterized protein LOC100841904    147   2e-38   
ref|XP_007147896.1|  hypothetical protein PHAVU_006G164100g             147   4e-38   
gb|AGV54847.1|  hypothetical protein                                    147   4e-38   
ref|XP_010549485.1|  PREDICTED: uncharacterized protein LOC104820646    145   3e-37   
tpg|DAA37152.1|  TPA: hypothetical protein ZEAMMB73_071426              144   3e-37   
gb|AGV54803.1|  hypothetical protein                                    144   3e-37   
emb|CAH67292.1|  OSIGBa0103O01.10                                       143   8e-37   
gb|EAY94676.1|  hypothetical protein OsI_16455                          143   8e-37   
ref|XP_003546086.1|  PREDICTED: uncharacterized protein LOC100807088    143   8e-37   
ref|XP_010911072.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    143   9e-37   
ref|XP_008792993.1|  PREDICTED: uncharacterized protein LOC103709448    143   1e-36   
ref|XP_010919817.1|  PREDICTED: uncharacterized protein LOC105043799    143   1e-36   
gb|AFK48735.1|  unknown                                                 143   1e-36   
ref|XP_009396509.1|  PREDICTED: uncharacterized protein LOC103981490    143   1e-36   
gb|KDO52908.1|  hypothetical protein CISIN_1g0399092mg                  141   2e-36   
ref|XP_002893594.1|  predicted protein                                  142   2e-36   
gb|KHN47316.1|  hypothetical protein glysoja_020184                     141   5e-36   
emb|CAE01676.2|  OSJNBb0091E11.17                                       141   5e-36   
ref|XP_004293568.1|  PREDICTED: uncharacterized protein LOC101302531    141   5e-36   
tpg|DAA37149.1|  TPA: hypothetical protein ZEAMMB73_398073              141   5e-36   
ref|NP_001053189.1|  Os04g0494800                                       141   6e-36   
ref|XP_004978108.1|  PREDICTED: uncharacterized protein LOC101762525    141   6e-36   
ref|XP_008669229.1|  PREDICTED: uncharacterized protein LOC103646276    141   6e-36   
ref|XP_003542933.1|  PREDICTED: uncharacterized protein LOC100788675    141   6e-36   
ref|XP_008669227.1|  PREDICTED: uncharacterized protein LOC103646275    141   6e-36   
gb|KDO78161.1|  hypothetical protein CISIN_1g0159862mg                  140   6e-36   
ref|XP_006415525.1|  hypothetical protein EUTSA_v10007784mg             141   6e-36   
ref|NP_973938.1|  uncharacterized protein                               140   7e-36   
ref|XP_010504914.1|  PREDICTED: uncharacterized protein LOC104781...    140   9e-36   
ref|XP_006467477.1|  PREDICTED: uncharacterized protein LOC102617...    140   9e-36   
ref|XP_010504912.1|  PREDICTED: uncharacterized protein LOC104781...    140   1e-35   
ref|XP_006467478.1|  PREDICTED: uncharacterized protein LOC102617...    140   1e-35   
ref|XP_002446728.1|  hypothetical protein SORBIDRAFT_06g021320          140   1e-35   
ref|XP_009788467.1|  PREDICTED: uncharacterized protein LOC104236274    140   1e-35   
ref|NP_564344.1|  uncharacterized protein                               140   1e-35   
ref|XP_006449683.1|  hypothetical protein CICLE_v10015527mg             140   1e-35   
ref|XP_009603034.1|  PREDICTED: uncharacterized protein LOC104098081    140   1e-35   
gb|KHN33140.1|  La-related protein 7                                    143   2e-35   
ref|XP_010540565.1|  PREDICTED: uncharacterized protein LOC104814294    140   2e-35   
ref|XP_002446724.1|  hypothetical protein SORBIDRAFT_06g021280          139   2e-35   
emb|CAH67377.1|  OSIGBa0159F11.1                                        139   2e-35   
ref|XP_006294334.1|  hypothetical protein CARUB_v10023341mg             139   3e-35   
ref|XP_002317331.2|  hypothetical protein POPTR_0011s08980g             139   4e-35   
ref|XP_006652463.1|  PREDICTED: uncharacterized protein LOC102714172    139   4e-35   
ref|XP_006352963.1|  PREDICTED: uncharacterized protein LOC102582541    139   5e-35   
ref|XP_011015145.1|  PREDICTED: uncharacterized protein LOC105118803    138   5e-35   
ref|XP_010516598.1|  PREDICTED: uncharacterized protein LOC104792204    139   6e-35   
gb|KHG06200.1|  Periplasmic nitrate reductase                           138   6e-35   
ref|XP_007213876.1|  hypothetical protein PRUPE_ppa006814mg             138   7e-35   
ref|XP_004233117.1|  PREDICTED: uncharacterized protein LOC101246207    138   7e-35   
ref|XP_003593943.1|  hypothetical protein MTR_2g019600                  138   7e-35   
ref|XP_008225474.1|  PREDICTED: uncharacterized protein LOC103325117    138   7e-35   
ref|NP_001053188.1|  Os04g0494600                                       138   8e-35   
ref|XP_009394197.1|  PREDICTED: uncharacterized protein LOC103979736    139   8e-35   
gb|KJB69807.1|  hypothetical protein B456_011G043300                    138   8e-35   
ref|XP_010460777.1|  PREDICTED: uncharacterized protein LOC104741589    138   9e-35   
ref|XP_010478373.1|  PREDICTED: uncharacterized protein LOC104757341    138   9e-35   
ref|XP_009143769.1|  PREDICTED: uncharacterized protein LOC103867448    138   9e-35   
ref|XP_010509742.1|  PREDICTED: uncharacterized protein LOC104786108    138   1e-34   
ref|XP_008812841.1|  PREDICTED: uncharacterized protein LOC103723648    138   1e-34   
emb|CAD41548.2|  OSJNBb0091E11.18                                       137   1e-34   
ref|NP_180998.1|  uncharacterized protein                               138   1e-34   
emb|CDX84311.1|  BnaC04g10730D                                          137   1e-34   
ref|XP_002881340.1|  hypothetical protein ARALYDRAFT_902536             137   1e-34   
gb|KJB69808.1|  hypothetical protein B456_011G043300                    137   1e-34   
gb|KDP37968.1|  hypothetical protein JCGZ_04611                         137   1e-34   
gb|KHG28355.1|  putative metabolite transport                           137   1e-34   
ref|NP_001053190.1|  Os04g0494900                                       137   1e-34   
gb|KJB57253.1|  hypothetical protein B456_009G155400                    137   1e-34   
gb|ACJ84883.1|  unknown                                                 134   1e-34   
ref|XP_006410597.1|  hypothetical protein EUTSA_v10016749mg             137   1e-34   
ref|XP_004486030.1|  PREDICTED: uncharacterized protein LOC101488455    137   1e-34   
gb|EYU43266.1|  hypothetical protein MIMGU_mgv1a007866mg                137   1e-34   
ref|XP_002519690.1|  conserved hypothetical protein                     137   1e-34   
gb|KJB57254.1|  hypothetical protein B456_009G155400                    137   2e-34   
ref|XP_010110985.1|  hypothetical protein L484_021680                   138   2e-34   
ref|XP_008383561.1|  PREDICTED: uncharacterized protein LOC103446251    137   2e-34   
ref|XP_006653557.1|  PREDICTED: uncharacterized protein LOC102718925    137   2e-34   
ref|XP_006307659.1|  hypothetical protein CARUB_v10009287mg             137   2e-34   
emb|CDY17255.1|  BnaA05g09330D                                          137   2e-34   
emb|CBI30867.3|  unnamed protein product                                137   2e-34   
ref|XP_002275370.1|  PREDICTED: uncharacterized protein LOC100253669    137   2e-34   
gb|AFK49395.1|  unknown                                                 137   2e-34   
ref|XP_003593942.1|  Glutamate-gated kainate-type ion channel rec...    138   3e-34   
ref|XP_007025094.1|  Uncharacterized protein TCM_029497                 137   3e-34   
emb|CDP19178.1|  unnamed protein product                                136   3e-34   
ref|XP_008371603.1|  PREDICTED: uncharacterized protein LOC103434995    136   3e-34   
dbj|BAD87481.1|  unknown protein                                        132   4e-34   
ref|XP_003581385.1|  PREDICTED: uncharacterized protein LOC100824265    135   4e-34   
ref|XP_009360881.1|  PREDICTED: uncharacterized protein LOC103951270    136   4e-34   
emb|CDX99870.1|  BnaC05g22920D                                          136   5e-34   
emb|CDY26302.1|  BnaA09g26530D                                          136   5e-34   
ref|XP_009115202.1|  PREDICTED: uncharacterized protein LOC103840445    136   6e-34   
gb|EPS66859.1|  hypothetical protein M569_07917                         135   9e-34   
gb|KCW59326.1|  hypothetical protein EUGRSUZ_H02015                     129   9e-34   
ref|XP_004978106.1|  PREDICTED: uncharacterized protein LOC101761311    135   1e-33   
ref|XP_010275001.1|  PREDICTED: uncharacterized protein LOC104610185    135   1e-33   
gb|ACN30906.1|  unknown                                                 135   1e-33   
ref|XP_002446725.1|  hypothetical protein SORBIDRAFT_06g021290          134   1e-33   
gb|ACF86181.1|  unknown                                                 135   1e-33   
ref|XP_010499517.1|  PREDICTED: uncharacterized protein LOC104777028    135   1e-33   
ref|NP_001141282.1|  hypothetical protein precursor                     134   2e-33   
ref|XP_002456374.1|  hypothetical protein SORBIDRAFT_03g034960          134   2e-33   
ref|XP_002446723.1|  hypothetical protein SORBIDRAFT_06g021270          134   2e-33   
ref|XP_004976082.1|  PREDICTED: uncharacterized protein LOC101765204    134   2e-33   
ref|XP_011096549.1|  PREDICTED: uncharacterized protein LOC105175704    134   2e-33   
dbj|BAJ96954.1|  predicted protein                                      134   2e-33   
ref|NP_001143445.1|  uncharacterized protein LOC100276100               132   3e-33   
ref|XP_010056890.1|  PREDICTED: uncharacterized protein LOC104444833    134   3e-33   
gb|EEC70811.1|  hypothetical protein OsI_02272                          134   3e-33   
tpg|DAA57583.1|  TPA: hypothetical protein ZEAMMB73_913803              134   3e-33   
gb|EMT04284.1|  hypothetical protein F775_14656                         133   4e-33   
ref|XP_011085252.1|  PREDICTED: uncharacterized protein LOC105167296    133   4e-33   
ref|XP_006845348.1|  hypothetical protein AMTR_s00141p00103540          133   5e-33   
ref|NP_001044289.1|  Os01g0756600                                       133   6e-33   
ref|XP_010279657.1|  PREDICTED: uncharacterized protein LOC104613510    133   6e-33   
ref|XP_004970002.1|  PREDICTED: uncharacterized protein LOC101758272    133   7e-33   
gb|EMS63053.1|  hypothetical protein TRIUR3_01734                       131   9e-33   
gb|EYU33356.1|  hypothetical protein MIMGU_mgv1a007799mg                132   1e-32   
gb|KFK36341.1|  hypothetical protein AALP_AA4G110000                    132   1e-32   
ref|XP_003569841.1|  PREDICTED: uncharacterized protein LOC100844886    132   1e-32   
gb|ABK24630.1|  unknown                                                 132   2e-32   
ref|NP_001043243.2|  Os01g0531400                                       132   2e-32   
gb|ACN40837.1|  unknown                                                 132   2e-32   
ref|XP_006644728.1|  PREDICTED: uncharacterized protein LOC102722258    131   2e-32   



>ref|XP_009771440.1| PREDICTED: uncharacterized protein LOC104221976 [Nicotiana sylvestris]
Length=373

 Score =   241 bits (615),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW VESLKAVKY+D++HFSVP G+RA+ELVAGKESA+ Q+ART  GK Y+L+F VGDAS
Sbjct  231  PAWMVESLKAVKYLDSDHFSVPQGKRAIELVAGKESAIAQVARTTIGKMYELSFKVGDAS  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  TLKVPYESKG+GGYK A LRF+ATANRTR+MF STYYHTRSDDF
Sbjct  291  NSCEGSMIVEAFAGMDTLKVPYESKGKGGYKRAVLRFKATANRTRIMFLSTYYHTRSDDF  350

Query  302  VSLCGPVVDFVKLVSVRNPHRRL  234
            VSLCGPVVD VKL+SVRNP R L
Sbjct  351  VSLCGPVVDDVKLLSVRNPRRFL  373



>ref|XP_009617293.1| PREDICTED: uncharacterized protein LOC104109646 [Nicotiana tomentosiformis]
Length=373

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW VESLKAVKY+D++HFSVP G+RA+ELVAGKESA+ Q+ART  GK Y+L+F VGDAS
Sbjct  231  PAWMVESLKAVKYLDSDHFSVPQGKRAIELVAGKESAIAQVARTTIGKMYELSFKVGDAS  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  TLKVPYESKG+GG+K A LRF+A ANRTR+MF STYYHTRSDD+
Sbjct  291  NSCEGSMIVEAFAGRDTLKVPYESKGKGGFKRAVLRFKANANRTRIMFLSTYYHTRSDDY  350

Query  302  VSLCGPVVDFVKLVSVRNPHRRL  234
            VSLCGPVVD VKL+SVRNP R L
Sbjct  351  VSLCGPVVDDVKLLSVRNPRRFL  373



>ref|XP_006364278.1| PREDICTED: uncharacterized protein LOC102598357 [Solanum tuberosum]
Length=371

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW VESLKAVKY+D++HFSVPHG+RA+ELVAGKESA+ Q+ART  GK Y L+F VGDAS
Sbjct  229  PAWMVESLKAVKYLDSDHFSVPHGKRAIELVAGKESAIAQVARTTIGKMYQLSFKVGDAS  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  TLKVPYES G+GGYK A LRF+ATA+RTR+MF STYYHTRSDDF
Sbjct  289  NACEGSMIVEAFAGRDTLKVPYESMGKGGYKRAILRFKATASRTRIMFLSTYYHTRSDDF  348

Query  302  VSLCGPVVDFVKLVSVRNPHRRL  234
            VSLCGPVVD V L+SVR  HRR+
Sbjct  349  VSLCGPVVDDVTLLSVRT-HRRV  370



>ref|XP_004245192.1| PREDICTED: uncharacterized protein LOC101262737 [Solanum lycopersicum]
Length=371

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW VESLKAVKY+D++HFSVPHG+RA+ELVAGKESA+ Q+ART  GK Y L+F VGDAS
Sbjct  229  PAWMVESLKAVKYLDSDHFSVPHGKRAIELVAGKESAIAQVARTTIGKMYQLSFKVGDAS  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  TLKVPYES G+GGYK A LRF+ATA+RTR+MF STYYHTRSDDF
Sbjct  289  NACEGSMIVEAFAGRDTLKVPYESMGKGGYKRAILRFKATASRTRIMFLSTYYHTRSDDF  348

Query  302  VSLCGPVVDFVKLVSVRNPHRRL  234
            VSLCGPVVD V L+SVR  HRR+
Sbjct  349  VSLCGPVVDDVTLLSVRT-HRRV  370



>ref|XP_011085499.1| PREDICTED: uncharacterized protein LOC105167438 [Sesamum indicum]
Length=369

 Score =   230 bits (587),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW VESLKAVKYIDA HFSVPHG+RA+ELV GKESA+ Q+ART+ GK Y+LTF +GDAS
Sbjct  227  PAWIVESLKAVKYIDAAHFSVPHGQRAIELVGGKESAIAQVARTIIGKTYELTFAIGDAS  286

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  T+KVPYESKG+GGYK A LRF ATA RTR+MFFSTYYH RSDDF
Sbjct  287  NSCEGSMIVEAFAGRDTVKVPYESKGKGGYKRAVLRFAATAARTRIMFFSTYYHMRSDDF  346

Query  302  VSLCGPVVDFVKLVSVRNPHR  240
             SLCGPVVD VKL+SV  P R
Sbjct  347  ASLCGPVVDDVKLLSVHKPRR  367



>emb|CDP04798.1| unnamed protein product [Coffea canephora]
Length=371

 Score =   229 bits (585),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYIDA HFSVPH  RAVELVAGKESA+ Q+ART+ GK Y LTFLVGDAS
Sbjct  229  PGWMIESLKAVKYIDAAHFSVPHNSRAVELVAGKESAIAQVARTIIGKTYTLTFLVGDAS  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EA+AG  T+K+PY S+G+GGYKPA L F AT NRTR+MFFSTYYHTRSDD 
Sbjct  289  NSCEGSMIVEAYAGIVTVKIPYTSQGKGGYKPAVLHFVATTNRTRIMFFSTYYHTRSDDN  348

Query  302  VSLCGPVVDFVKLVSVRNPHRRL  234
             SLCGPV+D VKL+SVRNP + +
Sbjct  349  ASLCGPVIDDVKLLSVRNPRKLM  371



>gb|EYU21948.1| hypothetical protein MIMGU_mgv1a0096341mg [Erythranthe guttata]
Length=336

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW VESLKAVKYID  HFSVPHG RA+ELV GKESA+ Q+ART+AGK Y LTF VGDAS
Sbjct  194  PAWMVESLKAVKYIDRAHFSVPHGERAIELVGGKESAIAQVARTIAGKTYQLTFAVGDAS  253

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  T+KVPYES+G+GGYK A LRF A  NRTR+MF STYYH RSDD+
Sbjct  254  NSCEGSMIVEAFAGRDTVKVPYESRGKGGYKRAVLRFVAPTNRTRIMFLSTYYHMRSDDY  313

Query  302  VSLCGPVVDFVKLVSVRNPHR  240
             SLCGPVVD VKL+SVRNP +
Sbjct  314  ASLCGPVVDDVKLLSVRNPRK  334



>ref|XP_011081926.1| PREDICTED: uncharacterized protein LOC105164832 [Sesamum indicum]
Length=405

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW VESLKAVKYIDA HFSVPHG+RA+ELV GKESA+ Q+ART+ GK Y LTF VGDAS
Sbjct  263  PAWMVESLKAVKYIDAAHFSVPHGQRAIELVGGKESAIAQVARTIVGKTYQLTFAVGDAS  322

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  T+KVPYESKG+GGYK A LRF AT  RTR+MF ST+YH RSDD+
Sbjct  323  NSCEGSMIVEAFAGRDTVKVPYESKGKGGYKRAVLRFVATTTRTRIMFLSTFYHMRSDDY  382

Query  302  VSLCGPVVDFVKLVSVRNPHR  240
             SLCGPVVD VKL+SVR P R
Sbjct  383  ASLCGPVVDDVKLLSVRKPRR  403



>ref|XP_010254319.1| PREDICTED: uncharacterized protein LOC104595325 [Nelumbo nucifera]
 ref|XP_010254320.1| PREDICTED: uncharacterized protein LOC104595325 [Nelumbo nucifera]
Length=370

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYIDAEHFSVP GRRAVELVAGKESA+ QIART+ GK Y LTF VGDA+
Sbjct  229  PGWMIESLKAVKYIDAEHFSVPQGRRAVELVAGKESAIAQIARTIPGKVYTLTFAVGDAN  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            NKCEGSMV+EAFA  +T+KVPYESKG GG+K A LRF A + RTR+MF ST+Y  RSDD 
Sbjct  289  NKCEGSMVVEAFADRNTVKVPYESKGTGGFKRAVLRFTAVSTRTRIMFLSTFYTMRSDDM  348

Query  302  VSLCGPVVDFVKLVSVRNPHR  240
             SLCGPVVD VKL+S+RNP R
Sbjct  349  ASLCGPVVDDVKLLSIRNPRR  369



>ref|XP_002515557.1| conserved hypothetical protein [Ricinus communis]
 emb|CAB02653.1| unknown [Ricinus communis]
 gb|EEF47006.1| conserved hypothetical protein [Ricinus communis]
Length=364

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID +HFSVP GRRA+ELVAGKESA+ Q+ARTV GK Y L+F VGDAS
Sbjct  226  PGWMVESLKAVKYIDVDHFSVPQGRRAIELVAGKESAIAQVARTVIGKTYTLSFAVGDAS  285

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSMV+EAFAG  TLKVPYESKG+GG+K A LRF A ANRTR+MF+ST+Y  RSDDF
Sbjct  286  NSCEGSMVVEAFAGKDTLKVPYESKGKGGFKRAVLRFVAVANRTRIMFYSTFYTMRSDDF  345

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SVR P
Sbjct  346  SSLCGPVLDDVKLLSVRKP  364



>gb|KDP33619.1| hypothetical protein JCGZ_07190 [Jatropha curcas]
Length=364

 Score =   219 bits (557),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYID++HFSVP  RRAVELVAGKESA+ Q+ARTV GK Y L+F VGDAS
Sbjct  226  PGWMIESLKAVKYIDSDHFSVPQARRAVELVAGKESAIAQVARTVVGKTYTLSFAVGDAS  285

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSMV+EAFAG  TLKVPYESKG+GG+K A LRF A +NRTR+MF+ST+Y  RSDDF
Sbjct  286  NSCEGSMVVEAFAGKDTLKVPYESKGKGGFKRAVLRFVAASNRTRIMFYSTFYTMRSDDF  345

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SVR P
Sbjct  346  SSLCGPVIDDVKLLSVRKP  364



>ref|XP_004138737.1| PREDICTED: uncharacterized protein LOC101219952 [Cucumis sativus]
 ref|XP_004164530.1| PREDICTED: uncharacterized protein LOC101227825 [Cucumis sativus]
 gb|KGN62919.1| hypothetical protein Csa_2G379990 [Cucumis sativus]
Length=368

 Score =   219 bits (557),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVP G+RAVELVAGKESA+ QI RT+ GK Y L+F+VGDAS
Sbjct  228  PGWMVESLKAVKYIDSDHFSVPSGKRAVELVAGKESAIAQIVRTIPGKTYILSFVVGDAS  287

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSMV+EAFAG +TLKVPY+SKG GG KPA L+F+A + RTR+MF ST+Y  RSDDF
Sbjct  288  NSCEGSMVVEAFAGKNTLKVPYQSKGNGGSKPAALKFKAESTRTRIMFLSTFYTMRSDDF  347

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D V+L+SVRNP
Sbjct  348  SSLCGPVLDKVRLLSVRNP  366



>ref|XP_006399647.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
 gb|ESQ41100.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
Length=340

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW +ESLKA+KY+D EHFSVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+
Sbjct  202  PAWMIESLKAIKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDAN  261

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSM++EAFAG  TLKVPYES+G+GG+K A +RF A +NRTRVMF+ST+Y  RSDDF
Sbjct  262  NACQGSMIVEAFAGKDTLKVPYESRGKGGFKRASMRFVAVSNRTRVMFYSTFYAMRSDDF  321

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SVR P
Sbjct  322  SSLCGPVIDDVKLLSVRKP  340



>ref|XP_010419712.1| PREDICTED: uncharacterized protein LOC104705408 [Camelina sativa]
Length=367

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW +ESLKAVKY+D EHFSVP GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDA+
Sbjct  229  PAWMIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDAN  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+EAFAG  TLKVPYES+G+GG+K A +RF A +NRTR+MF+ST+Y  RSDDF
Sbjct  289  NACQGSMVVEAFAGRDTLKVPYESRGKGGFKRASMRFVAVSNRTRIMFYSTFYAMRSDDF  348

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SVR P
Sbjct  349  SSLCGPVIDDVKLLSVRKP  367



>ref|XP_010491872.1| PREDICTED: uncharacterized protein LOC104769372 [Camelina sativa]
Length=367

 Score =   218 bits (554),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW +ESLKAVKY+D EHFSVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+
Sbjct  229  PAWMIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIVGKTYVLSFAVGDAN  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+EAFAG  TLKVPYES+G+GG+K A +RF A +NRTR+MF+ST+Y  RSDDF
Sbjct  289  NACQGSMVVEAFAGRDTLKVPYESRGKGGFKRASMRFVAVSNRTRIMFYSTFYAMRSDDF  348

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SVR P
Sbjct  349  SSLCGPVIDDVKLLSVRKP  367



>ref|XP_010453190.1| PREDICTED: uncharacterized protein LOC104735158 [Camelina sativa]
Length=367

 Score =   218 bits (554),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW +ESLKAVKY+D EHFSVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+
Sbjct  229  PAWMIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIVGKTYVLSFAVGDAN  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+EAFAG  TLKVPYES+G+GG+K A +RF A +NRTR+MF+ST+Y  RSDDF
Sbjct  289  NACQGSMVVEAFAGRDTLKVPYESRGKGGFKRASMRFVAVSNRTRIMFYSTFYAMRSDDF  348

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SVR P
Sbjct  349  SSLCGPVIDDVKLLSVRKP  367



>ref|XP_008445161.1| PREDICTED: uncharacterized protein LOC103488281 [Cucumis melo]
Length=422

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVP G+RAVELVAGKESA+ QI RT+ GK Y L+F+VGDAS
Sbjct  282  PGWMVESLKAVKYIDSDHFSVPSGKRAVELVAGKESAIAQIVRTIPGKTYILSFVVGDAS  341

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSMV+EAFAG +TLKVPY+SKG GG KPA L+F+A + RTR+MF ST+Y  RSDDF
Sbjct  342  NSCEGSMVVEAFAGKNTLKVPYQSKGNGGSKPAALKFKAESTRTRIMFLSTFYTMRSDDF  401

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D V+L+SVRNP
Sbjct  402  SSLCGPVLDKVRLLSVRNP  420



>ref|XP_006399646.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
 gb|ESQ41099.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
Length=366

 Score =   217 bits (553),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW +ESLKA+KY+D EHFSVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+
Sbjct  228  PAWMIESLKAIKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDAN  287

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSM++EAFAG  TLKVPYES+G+GG+K A +RF A +NRTRVMF+ST+Y  RSDDF
Sbjct  288  NACQGSMIVEAFAGKDTLKVPYESRGKGGFKRASMRFVAVSNRTRVMFYSTFYAMRSDDF  347

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SVR P
Sbjct  348  SSLCGPVIDDVKLLSVRKP  366



>dbj|BAH57107.1| AT5G25460 [Arabidopsis thaliana]
Length=186

 Score =   211 bits (537),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D EHFSVP GRRA+ELVAGKESA+ Q+ RTV GK Y L+F VGDA+
Sbjct  48   PGWMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDAN  107

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+EAFAG  TLKVPYESKG GG+K A +RF A + R+R+MF+ST+Y  RSDDF
Sbjct  108  NACKGSMVVEAFAGKDTLKVPYESKGTGGFKRASIRFVAVSTRSRIMFYSTFYAMRSDDF  167

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SVR P
Sbjct  168  SSLCGPVIDDVKLISVRKP  186



>ref|XP_010106829.1| hypothetical protein L484_006602 [Morus notabilis]
 gb|EXC12058.1| hypothetical protein L484_006602 [Morus notabilis]
Length=217

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVPHG+RAVELVAGKESA+ Q+ RT+ GK Y LTF VGDAS
Sbjct  78   PYWMVESLKAVKYIDSDHFSVPHGKRAVELVAGKESAIAQVVRTIVGKTYRLTFSVGDAS  137

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG +T+KVPYESKG+GG+K   L F AT  RTR+MF ST+Y  RSDDF
Sbjct  138  NSCEGSMIVEAFAGRATVKVPYESKGKGGFKRGVLTFVATETRTRIMFLSTFYSMRSDDF  197

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D +KL+SVR P
Sbjct  198  SSLCGPVLDDIKLLSVRKP  216



>ref|XP_010249980.1| PREDICTED: uncharacterized protein LOC104592350 [Nelumbo nucifera]
Length=369

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYIDAEHFSVP G+RAVELVAGKESA+ Q+ARTV GK Y L F VGDA+
Sbjct  228  PGWMIESLKAVKYIDAEHFSVPEGKRAVELVAGKESAIAQVARTVPGKAYALMFAVGDAN  287

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N+CEGSMV+EAFAG  T+KVPYESKG GG+K A L+F A + RTR+MF ST+Y  RSDD 
Sbjct  288  NRCEGSMVVEAFAGRDTVKVPYESKGTGGFKRAVLKFTAASPRTRIMFLSTFYTMRSDDM  347

Query  302  VSLCGPVVDFVKLVSVRNPHR  240
             SLCGPVVD VKL+S+RNP R
Sbjct  348  ASLCGPVVDDVKLLSIRNPRR  368



>ref|NP_196703.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB87702.1| putative protein [Arabidopsis thaliana]
 gb|AAK76721.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20000.1| unknown protein [Arabidopsis thaliana]
 gb|AED91677.1| uncharacterized protein AT5G11420 [Arabidopsis thaliana]
Length=366

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW VESLKA+KY+D EHFSVP GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDA+
Sbjct  228  PAWMVESLKAIKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDAN  287

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+EAFAG  TLKVPYES+G+GG+K A LRF A + RTRVMF+ST+Y  RSDDF
Sbjct  288  NACQGSMVVEAFAGKDTLKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDF  347

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+S R P
Sbjct  348  SSLCGPVIDDVKLLSARKP  366



>gb|AAM63507.1| unknown [Arabidopsis thaliana]
Length=366

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW VESLKA+KY+D EHFSVP GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDA+
Sbjct  228  PAWMVESLKAIKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDAN  287

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+EAFAG  TLKVPYES+G+GG+K A LRF A + RTRVMF+ST+Y  RSDDF
Sbjct  288  NACQGSMVVEAFAGKDTLKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDF  347

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+S R P
Sbjct  348  SSLCGPVIDDVKLLSARKP  366



>ref|XP_006287989.1| hypothetical protein CARUB_v10001222mg [Capsella rubella]
 gb|EOA20887.1| hypothetical protein CARUB_v10001222mg [Capsella rubella]
Length=367

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW +ESLKAVKY+D EHFSVP GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDA+
Sbjct  229  PAWMIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFSVGDAN  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+EAFAG  TLKVPYES+G+GG+K A +RF A +NRTR+MF+ST+Y  RSDDF
Sbjct  289  NACQGSMVVEAFAGRDTLKVPYESRGKGGFKRATMRFVAVSNRTRIMFYSTFYAMRSDDF  348

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+ VR P
Sbjct  349  SSLCGPVIDDVKLLGVRKP  367



>ref|XP_002871473.1| hypothetical protein ARALYDRAFT_487977 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47732.1| hypothetical protein ARALYDRAFT_487977 [Arabidopsis lyrata subsp. 
lyrata]
Length=366

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW +ESLKA+KY+D EHFSVP GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDA+
Sbjct  228  PAWMIESLKAIKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDAN  287

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSM++EAFAG  TLKVPYES+G+GG+K A LRF A + RTRVMF+ST+Y  RSDDF
Sbjct  288  NACQGSMIVEAFAGKDTLKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDF  347

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+S R P
Sbjct  348  SSLCGPVIDDVKLLSARKP  366



>dbj|BAD93856.1| hypothetical protein [Arabidopsis thaliana]
Length=224

 Score =   210 bits (535),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D EHFSVP GRRA+ELVAGKESA+ Q+ RTV GK Y L+F VGDA+
Sbjct  86   PGWMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDAN  145

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+EAFAG  TLKVPYESKG GG+K A +RF A + R+R+MF+ST+Y  RSDDF
Sbjct  146  NACKGSMVVEAFAGKDTLKVPYESKGTGGFKRASIRFVAVSTRSRIMFYSTFYAMRSDDF  205

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SVR P
Sbjct  206  SSLCGPVIDDVKLISVRKP  224



>gb|AAN31807.1| unknown protein [Arabidopsis thaliana]
Length=366

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW VESLKA+KY+D EHFSVP GRRAVELVAGKESA+ Q+A+TV GK Y L+F VGDA+
Sbjct  228  PAWMVESLKAIKYVDVEHFSVPQGRRAVELVAGKESAIAQVAKTVVGKTYVLSFAVGDAN  287

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+EAFAG  TLKVPYES+G+GG+K A LRF A + RTRVMF+ST+Y  RSDDF
Sbjct  288  NACQGSMVVEAFAGKDTLKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDF  347

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+S R P
Sbjct  348  SSLCGPVIDDVKLLSARKP  366



>ref|XP_006483312.1| PREDICTED: uncharacterized protein LOC102608149 [Citrus sinensis]
Length=366

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYID++HFSVP G+RA+ELVAGKESA+ QIART+ GK Y LTF VGDA+
Sbjct  227  PGWMIESLKAVKYIDSDHFSVPQGKRAIELVAGKESAIAQIARTIPGKTYTLTFTVGDAN  286

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSMV+EAFAG  T+KVPYESKG+GG+K A LRF A +NRTR+MF ST+Y  RSDDF
Sbjct  287  NACAGSMVVEAFAGKGTIKVPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDF  346

Query  302  VSLCGPVVDFVKLVSVRN  249
             SLCGPV+D VKL+SVRN
Sbjct  347  SSLCGPVIDDVKLLSVRN  364



>gb|EPS73289.1| hypothetical protein M569_01466, partial [Genlisea aurea]
Length=348

 Score =   214 bits (544),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW VESLKAV+YID+ HFSVP GRRA+ELV G+ESA+ Q+ART AGKFY LTF VGDAS
Sbjct  207  PAWMVESLKAVRYIDSAHFSVPRGRRAIELVGGRESAIAQVARTAAGKFYRLTFAVGDAS  266

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSMV+EAFAG S++++PYES G+GGYK A L+F A ++RTR+MF STYYH RSDD+
Sbjct  267  NSCEGSMVVEAFAGGSSVRIPYESSGRGGYKRAILQFVAASDRTRIMFTSTYYHMRSDDY  326

Query  302  VSLCGPVVDFVKLVSVRNPHR  240
             SLCGPVVD V+L+SVR   R
Sbjct  327  ASLCGPVVDDVELLSVRETPR  347



>ref|XP_010541619.1| PREDICTED: uncharacterized protein LOC104815031 [Tarenaya hassleriana]
Length=364

 Score =   214 bits (545),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID EHFSVP GRRA+ELVAGKESA+ Q+A  +AGK Y L+F VGDAS
Sbjct  226  PGWMVESLKAVKYIDIEHFSVPQGRRAIELVAGKESAIAQVAPAIAGKTYVLSFAVGDAS  285

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSM++EAFAG  TLKVPYES+G GG+K A +RF AT+NRTRVMF+ST+Y  RSDDF
Sbjct  286  NACKGSMIVEAFAGRDTLKVPYESRGTGGFKRAAMRFVATSNRTRVMFYSTFYAMRSDDF  345

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SVR P
Sbjct  346  SSLCGPVIDDVKLLSVRKP  364



>ref|XP_010454874.1| PREDICTED: uncharacterized protein LOC104736571 [Camelina sativa]
Length=369

 Score =   214 bits (544),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D EHFSVP GRRA+ELVAGKESA+ QI RTV GK Y L+F VGDA+
Sbjct  231  PGWMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDAN  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+EAFAG  TLKVPYES+G GG+K A +RF A +NR+RVMF+ST+Y  RSDDF
Sbjct  291  NACKGSMVVEAFAGKETLKVPYESRGTGGFKRASIRFVAVSNRSRVMFYSTFYSMRSDDF  350

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SVR P
Sbjct  351  SSLCGPVIDDVKLISVRKP  369



>ref|XP_010048991.1| PREDICTED: uncharacterized protein LOC104437692 [Eucalyptus grandis]
 gb|KCW81432.1| hypothetical protein EUGRSUZ_C02812 [Eucalyptus grandis]
Length=325

 Score =   213 bits (541),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID+ HFSVP G+RAVELVAGKESA+ Q+ART+ GK Y L+F VGDAS
Sbjct  187  PGWMVESLKAVKYIDSGHFSVPEGKRAVELVAGKESAIAQVARTIPGKTYVLSFAVGDAS  246

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSMV+EAFAG  T+KVPYESKG+GGYK A LRF+A + RTR+MF+ST+Y  RSDDF
Sbjct  247  NSCEGSMVVEAFAGKDTVKVPYESKGKGGYKRAVLRFKAVSVRTRIMFYSTFYTMRSDDF  306

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SVR P
Sbjct  307  SSLCGPVLDDVKLLSVRFP  325



>ref|XP_010421395.1| PREDICTED: uncharacterized protein LOC104706866 [Camelina sativa]
Length=369

 Score =   214 bits (544),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D EHFSVP GRRA+ELVAGKESA+ QI RTV GK Y L+F VGDA+
Sbjct  231  PGWMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDAN  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+EAFAG  TLKVPYES+G GG+K A +RF A +NR+RVMF+ST+Y  RSDDF
Sbjct  291  NACKGSMVVEAFAGKETLKVPYESRGTGGFKRASIRFVAVSNRSRVMFYSTFYSMRSDDF  350

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SVR P
Sbjct  351  SSLCGPVIDDVKLISVRKP  369



>ref|XP_010493802.1| PREDICTED: uncharacterized protein LOC104771027 [Camelina sativa]
Length=370

 Score =   214 bits (544),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D EHFSVP GRRA+ELVAGKESA+ QI RTV GK Y L+F VGDA+
Sbjct  232  PGWMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDAN  291

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+EAFAG  TLKVPYES+G GG+K A +RF A +NR+RVMF+ST+Y  RSDDF
Sbjct  292  NACKGSMVVEAFAGKETLKVPYESRGTGGFKRASIRFVAVSNRSRVMFYSTFYSMRSDDF  351

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SVR P
Sbjct  352  SSLCGPVIDDVKLISVRKP  370



>ref|XP_006287976.1| hypothetical protein CARUB_v10001211mg [Capsella rubella]
 gb|EOA20874.1| hypothetical protein CARUB_v10001211mg [Capsella rubella]
Length=370

 Score =   214 bits (544),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D EHFSVP GRRA+ELVAGKESA+ QI RTV GK Y L+F VGDA+
Sbjct  232  PGWMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDAN  291

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+EAFAG  TLKVPYES+G GG+K A +RF A +NR+R+MF+ST+Y  RSDDF
Sbjct  292  NACKGSMVVEAFAGKETLKVPYESRGTGGFKRASIRFVAVSNRSRIMFYSTFYSMRSDDF  351

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SVR P
Sbjct  352  SSLCGPVIDDVKLISVRKP  370



>ref|XP_010519935.1| PREDICTED: uncharacterized protein LOC104799224 [Tarenaya hassleriana]
Length=365

 Score =   213 bits (543),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID EHFSVP GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDA+
Sbjct  227  PGWMVESLKAVKYIDVEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDAN  286

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSM++EAFAG  T+KVPYES+G GG+K A LRF A ++RTR+MF+ST+Y  RSDDF
Sbjct  287  NACKGSMIVEAFAGRDTIKVPYESRGTGGFKRAALRFVAASDRTRIMFYSTFYSMRSDDF  346

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPVVD VKL+SVR P
Sbjct  347  SSLCGPVVDDVKLLSVRKP  365



>ref|XP_010526203.1| PREDICTED: uncharacterized protein LOC104803829 [Tarenaya hassleriana]
Length=363

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVK+ID++HFSVP GRRAVELVAGKESA+ Q+ RT+ GK Y L+F VGDAS
Sbjct  225  PGWIVESLKAVKFIDSDHFSVPQGRRAVELVAGKESAIAQVVRTIPGKTYVLSFAVGDAS  284

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSMV+EAFAG  T+KVPYESKG+GG+K A LRF A +NRTR+MFFST+Y  RSDDF
Sbjct  285  NACSGSMVVEAFAGKDTVKVPYESKGKGGFKRASLRFVAISNRTRIMFFSTFYSMRSDDF  344

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+S R P
Sbjct  345  SSLCGPVIDDVKLLSARKP  363



>ref|XP_011026488.1| PREDICTED: uncharacterized protein LOC105127071 [Populus euphratica]
Length=366

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID EHFSVP GRRAVELVAGKES + Q+ARTV GK Y L+F VGDAS
Sbjct  228  PGWMVESLKAVKYIDVEHFSVPQGRRAVELVAGKESTIAQVARTVIGKTYTLSFAVGDAS  287

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSMV+EAFAG  TLKVPYESKG+GG+K A L+F A + RTR+MF+ST+Y  RSDDF
Sbjct  288  NSCEGSMVVEAFAGKDTLKVPYESKGKGGFKRAVLKFVAVSTRTRIMFYSTFYTMRSDDF  347

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D +KL+S+R
Sbjct  348  SSLCGPVIDDIKLLSLR  364



>ref|XP_002324280.2| hypothetical protein POPTR_0018s01390g [Populus trichocarpa]
 gb|EEF02845.2| hypothetical protein POPTR_0018s01390g [Populus trichocarpa]
Length=398

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID EHFSVP GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDAS
Sbjct  260  PGWMVESLKAVKYIDVEHFSVPQGRRAVELVAGKESAIAQVARTVIGKTYTLSFAVGDAS  319

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSMV+EAFAG  TLKVPYESKG+GG+K A L+F A + RTR+MF+ST+Y  RSDDF
Sbjct  320  NSCEGSMVVEAFAGKDTLKVPYESKGKGGFKRAVLKFVAVSTRTRIMFYSTFYTMRSDDF  379

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D +KL+S+R
Sbjct  380  SSLCGPVIDDIKLLSLR  396



>ref|XP_007223355.1| hypothetical protein PRUPE_ppa007452mg [Prunus persica]
 gb|EMJ24554.1| hypothetical protein PRUPE_ppa007452mg [Prunus persica]
Length=367

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID+ HFSVP G+RAVELVAGKESA+ Q+ART+ GK Y L+F VGDAS
Sbjct  227  PGWMVESLKAVKYIDSNHFSVPEGKRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDAS  286

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  T+KVPYESKG+GG+K A L+F A + RTRVMF STYY  RSDDF
Sbjct  287  NSCEGSMIVEAFAGRDTVKVPYESKGKGGFKRAVLKFVAVSTRTRVMFLSTYYTMRSDDF  346

Query  302  VSLCGPVVDFVKLVSVRNPHR  240
             SLCGPV+D VKL+S++NP +
Sbjct  347  SSLCGPVLDDVKLLSLKNPRQ  367



>ref|XP_011019764.1| PREDICTED: uncharacterized protein LOC105122387 [Populus euphratica]
Length=343

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVK+ID EHFSVP GRRA+ELVAGKESA+ Q+ RT+ GK Y L+F VGDAS
Sbjct  205  PGWMVESLKAVKFIDIEHFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYSLSFAVGDAS  264

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSMV+EAFAG  TLKVPYESKG+GG+K A L+F A ++RTRVMF+ST+Y  RSDDF
Sbjct  265  NSCEGSMVVEAFAGKDTLKVPYESKGKGGFKRAVLKFVAVSSRTRVMFYSTFYTMRSDDF  324

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPVVD VKL+S+R
Sbjct  325  SSLCGPVVDDVKLLSLR  341



>ref|XP_009121952.1| PREDICTED: uncharacterized protein LOC103846721 [Brassica rapa]
Length=366

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW +ESLKAVKY+D EHFSVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+
Sbjct  228  PAWIIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIVGKSYVLSFAVGDAN  287

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSM++EAFAG  TLKV YESKG+GG+K A LRF A +NRTRVMF+ST+Y  RSDDF
Sbjct  288  NACKGSMIVEAFAGKDTLKVAYESKGKGGFKRAALRFVAVSNRTRVMFYSTFYAMRSDDF  347

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SV  P
Sbjct  348  SSLCGPVIDDVKLLSVGKP  366



>gb|KHG29602.1| Allergen Act d 3 [Gossypium arboreum]
Length=369

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW VESLKAVKYID+ H+ VP GRRAVELV GKESA+ QI RT+ GK Y L+F VGDA+
Sbjct  231  PAWVVESLKAVKYIDSAHYFVPQGRRAVELVGGKESAIAQITRTIVGKTYRLSFSVGDAN  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GS+V+EAFAG +TLKVPYESKG GG+K A LRF A +NRTR+MF ST+Y  RSDDF
Sbjct  291  NSCAGSLVVEAFAGKATLKVPYESKGTGGFKRAALRFVAVSNRTRIMFLSTFYTMRSDDF  350

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPVVD VKL+S+RNP
Sbjct  351  SSLCGPVVDDVKLLSIRNP  369



>ref|XP_009125805.1| PREDICTED: uncharacterized protein LOC103850771 [Brassica rapa]
Length=366

 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW +ESLKAVKY+D EHFSVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+
Sbjct  228  PAWMIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDAN  287

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  TLKVPYESKG+GG+K A LRF A + RTRVMF+ST+Y  RSDDF
Sbjct  288  NACEGSMIVEAFAGRDTLKVPYESKGKGGFKRATLRFVAVSTRTRVMFYSTFYAMRSDDF  347

Query  302  VSLCGPVVDFVKLVSV  255
             SLCGPV+D VKL+SV
Sbjct  348  SSLCGPVIDDVKLLSV  363



>ref|XP_006450498.1| hypothetical protein CICLE_v10008711mg [Citrus clementina]
 gb|ESR63738.1| hypothetical protein CICLE_v10008711mg [Citrus clementina]
 gb|KDO61660.1| hypothetical protein CISIN_1g017767mg [Citrus sinensis]
Length=366

 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYID++HFSVP G+RA+ELVAGKESA+ QIART+ GK Y LTF VGDA+
Sbjct  227  PGWMIESLKAVKYIDSDHFSVPQGKRAIELVAGKESAIAQIARTIPGKTYTLTFTVGDAN  286

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSMV+EAFAG  T+KVPYESKG+GG+K A LRF A +NRTR+MF ST+Y  RSDDF
Sbjct  287  NACAGSMVVEAFAGKGTIKVPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDF  346

Query  302  VSLCGPVVDFVKLVSVRN  249
             SLCGPV+D VKL+SVR+
Sbjct  347  SSLCGPVIDDVKLLSVRS  364



>ref|XP_002284962.1| PREDICTED: uncharacterized protein LOC100252479 [Vitis vinifera]
Length=368

 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVP  +RAVELVAGKESA+ Q+ART+ GK Y L+F VGDAS
Sbjct  226  PGWMVESLKAVKYIDSDHFSVPQEKRAVELVAGKESAIAQVARTIPGKTYALSFSVGDAS  285

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSMV+EAFAG  T+KVPYESKG+GG+K A LRF A +NRTR+MF ST+Y  RSDD+
Sbjct  286  NSCEGSMVVEAFAGRDTIKVPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDY  345

Query  302  VSLCGPVVDFVKLVSVRNPHRRL  234
             SLCGPV+D VKL+S+R P R +
Sbjct  346  ASLCGPVLDDVKLLSLRTPPRHI  368



>ref|XP_008219896.1| PREDICTED: uncharacterized protein LOC103320060 [Prunus mume]
Length=367

 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID+ HFSVP G+RAVELVAGKESA+ Q+ART+ GK Y L+F VGDAS
Sbjct  227  PGWMVESLKAVKYIDSNHFSVPEGKRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDAS  286

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  T+KVPYESKG+GG+K A L+F A + RTRVMF STYY  RSDDF
Sbjct  287  NSCEGSMIVEAFAGRDTVKVPYESKGKGGFKRAVLKFVAVSTRTRVMFLSTYYTMRSDDF  346

Query  302  VSLCGPVVDFVKLVSVRNPHR  240
             SLCGPV+D VKL+S++NP +
Sbjct  347  SSLCGPVLDDVKLLSLKNPRQ  367



>gb|KFK27809.1| hypothetical protein AALP_AA8G432300 [Arabis alpina]
Length=370

 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D EHFSVP GRRA+ELVAGKESA+ Q+ART+ GK Y L+F VGDA+
Sbjct  232  PGWMVESLKAVKYVDTEHFSVPQGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDAN  291

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+EAFAG  TLKVPYES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF
Sbjct  292  NACKGSMVVEAFAGKETLKVPYESRGTGGFKRASVRFVAVSTRTRVMFYSTFYAMRSDDF  351

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SVR P
Sbjct  352  SSLCGPVIDDVKLLSVRKP  370



>ref|XP_004291483.1| PREDICTED: uncharacterized protein LOC101294330 [Fragaria vesca 
subsp. vesca]
Length=368

 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVP G+RAVELVAGKESA+ QI RT+ GK Y LTF VGDAS
Sbjct  228  PGWMVESLKAVKYIDSDHFSVPEGKRAVELVAGKESAIAQIVRTIPGKTYMLTFSVGDAS  287

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  T+KVPYESKG+GG+K A L+FRA   RTR+MF ST+Y  RSDDF
Sbjct  288  NSCEGSMIVEAFAGRDTIKVPYESKGKGGFKRAVLKFRAVGPRTRIMFLSTFYTMRSDDF  347

Query  302  VSLCGPVVDFVKLVSVRNPHR  240
             SLCGPV+D VKL+S+R P +
Sbjct  348  SSLCGPVLDDVKLLSLRRPRQ  368



>emb|CDX85713.1| BnaA02g01000D [Brassica napus]
Length=366

 Score =   212 bits (539),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW +ESLKAVKY+D EHFSVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+
Sbjct  228  PAWMIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDAN  287

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  TLKVPYESKG+GG+K A LRF A + RTRVMF+ST+Y  RSDDF
Sbjct  288  NACEGSMIVEAFAGRDTLKVPYESKGKGGFKRATLRFVAVSTRTRVMFYSTFYAMRSDDF  347

Query  302  VSLCGPVVDFVKLVSV  255
             SLCGPV+D VKL+SV
Sbjct  348  SSLCGPVIDDVKLLSV  363



>emb|CDY19801.1| BnaA09g04540D [Brassica napus]
Length=370

 Score =   212 bits (540),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D EHFS+P GRRA+ELVAGKESA+ Q+ARTV GK Y L+F VGDA+
Sbjct  232  PGWMVESLKAVKYVDTEHFSIPQGRRAIELVAGKESAIAQVARTVIGKTYVLSFAVGDAN  291

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+EAFAG  TLKVPYES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF
Sbjct  292  NACKGSMVVEAFAGRDTLKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDF  351

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SVR P
Sbjct  352  SSLCGPVIDDVKLLSVRKP  370



>ref|XP_011019761.1| PREDICTED: uncharacterized protein LOC105122382 [Populus euphratica]
Length=365

 Score =   212 bits (539),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVK+ID EHFSVP GRRA+ELVAGKESA+ Q+ RT+ GK Y L+F VGDAS
Sbjct  227  PGWMVESLKAVKFIDIEHFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYSLSFAVGDAS  286

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSMV+EAFAG  TLKVPYESKG+GG+K A L+F A ++RTRVMF+ST+Y  RSDDF
Sbjct  287  NSCEGSMVVEAFAGKDTLKVPYESKGKGGFKRAVLKFVAVSSRTRVMFYSTFYTMRSDDF  346

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPVVD VKL+S+R
Sbjct  347  SSLCGPVVDDVKLLSLR  363



>emb|CDX91217.1| BnaC02g03800D [Brassica napus]
Length=366

 Score =   212 bits (539),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW VESLKAVKY+D EHFSVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+
Sbjct  228  PAWMVESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDAN  287

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  TLKVPY+SKG+GG+K A LRF A + RTRVMF+ST+Y  RSDDF
Sbjct  288  NACEGSMIVEAFAGRDTLKVPYQSKGKGGFKRATLRFVAVSTRTRVMFYSTFYAMRSDDF  347

Query  302  VSLCGPVVDFVKLVSV  255
             SLCGPV+D VKL+SV
Sbjct  348  SSLCGPVIDDVKLLSV  363



>gb|KJB80694.1| hypothetical protein B456_013G110800 [Gossypium raimondii]
Length=325

 Score =   210 bits (535),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW VESLKAVKYID+ H+ +P GRRAVELV GKESA+ QI RT+ GK Y L+F VGDA+
Sbjct  187  PAWVVESLKAVKYIDSAHYFMPQGRRAVELVGGKESAIAQITRTIVGKTYRLSFSVGDAN  246

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GS+V+EAFAG +TLKVPYESKG GG+K A LRF A +NRTR+MF ST+Y  RSDDF
Sbjct  247  NSCAGSLVVEAFAGKATLKVPYESKGTGGFKRAALRFVAVSNRTRIMFLSTFYTMRSDDF  306

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPVVD VKL+S+RNP
Sbjct  307  SSLCGPVVDDVKLLSIRNP  325



>gb|KHN06654.1| hypothetical protein glysoja_037506 [Glycine soja]
Length=366

 Score =   211 bits (538),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVP G+RAVEL+AGKESA+ Q+ART+ GK Y L+F VGDAS
Sbjct  228  PGWMVESLKAVKYIDSDHFSVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDAS  287

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  T+KVPYESKG GG+K A L+F A   RTRVMF ST+Y  RSDDF
Sbjct  288  NSCEGSMIVEAFAGKDTIKVPYESKGNGGFKRAALKFVAVTPRTRVMFLSTFYTMRSDDF  347

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKLVS+R P
Sbjct  348  SSLCGPVIDDVKLVSLRKP  366



>ref|XP_007161233.1| hypothetical protein PHAVU_001G053100g [Phaseolus vulgaris]
 gb|ESW33227.1| hypothetical protein PHAVU_001G053100g [Phaseolus vulgaris]
Length=366

 Score =   211 bits (538),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVP G+RAVEL+AGKESA+ Q+ART+ GK Y L+F VGDAS
Sbjct  228  PGWMVESLKAVKYIDSDHFSVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDAS  287

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  T+KVPYESKG+GG+K A L+F A   RTRVMF ST+Y  RSDDF
Sbjct  288  NYCEGSMIVEAFAGKDTIKVPYESKGKGGFKRAALKFVAVGPRTRVMFLSTFYTMRSDDF  347

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPVVD VKLVS+R P
Sbjct  348  SSLCGPVVDDVKLVSLRKP  366



>ref|XP_006601137.1| PREDICTED: uncharacterized protein LOC100813910 isoform X1 [Glycine 
max]
 ref|XP_006601138.1| PREDICTED: uncharacterized protein LOC100813910 isoform X2 [Glycine 
max]
Length=366

 Score =   211 bits (538),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVP G+RAVEL+AGKESA+ Q+ART+ GK Y L+F VGDAS
Sbjct  228  PGWMVESLKAVKYIDSDHFSVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDAS  287

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  T+KVPYESKG GG+K A L+F A   RTRVMF ST+Y  RSDDF
Sbjct  288  NSCEGSMIVEAFAGKDTIKVPYESKGNGGFKRAALKFVAVTPRTRVMFLSTFYTMRSDDF  347

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKLVS+R P
Sbjct  348  SSLCGPVIDDVKLVSLRKP  366



>ref|NP_197928.1| UF642 l-GalL-responsive protein 1 [Arabidopsis thaliana]
 gb|AAK62407.1|AF386962_1 Unknown protein [Arabidopsis thaliana]
 gb|AAP37805.1| At5g25460 [Arabidopsis thaliana]
 gb|AED93446.1| uncharacterized protein AT5G25460 [Arabidopsis thaliana]
Length=369

 Score =   211 bits (538),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D EHFSVP GRRA+ELVAGKESA+ Q+ RTV GK Y L+F VGDA+
Sbjct  231  PGWMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDAN  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+EAFAG  TLKVPYESKG GG+K A +RF A + R+R+MF+ST+Y  RSDDF
Sbjct  291  NACKGSMVVEAFAGKDTLKVPYESKGTGGFKRASIRFVAVSTRSRIMFYSTFYAMRSDDF  350

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SVR P
Sbjct  351  SSLCGPVIDDVKLISVRKP  369



>gb|KJB80693.1| hypothetical protein B456_013G110800 [Gossypium raimondii]
Length=369

 Score =   211 bits (537),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW VESLKAVKYID+ H+ +P GRRAVELV GKESA+ QI RT+ GK Y L+F VGDA+
Sbjct  231  PAWVVESLKAVKYIDSAHYFMPQGRRAVELVGGKESAIAQITRTIVGKTYRLSFSVGDAN  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GS+V+EAFAG +TLKVPYESKG GG+K A LRF A +NRTR+MF ST+Y  RSDDF
Sbjct  291  NSCAGSLVVEAFAGKATLKVPYESKGTGGFKRAALRFVAVSNRTRIMFLSTFYTMRSDDF  350

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPVVD VKL+S+RNP
Sbjct  351  SSLCGPVVDDVKLLSIRNP  369



>gb|AAL06839.1| AT5g25460/F18G18_200 [Arabidopsis thaliana]
Length=369

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D EHFSVP GRRA+ELVAGKESA+ Q+ RTV GK Y L+F VGDA+
Sbjct  231  PGWMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDAN  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+EAFAG  TLKVPYESKG GG+K A +RF A   R+R+MF+ST+Y  RSDDF
Sbjct  291  NACKGSMVVEAFAGKDTLKVPYESKGTGGFKRASIRFVAVLTRSRIMFYSTFYAMRSDDF  350

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SVR P
Sbjct  351  SSLCGPVIDDVKLISVRKP  369



>ref|XP_006394799.1| hypothetical protein EUTSA_v10004442mg [Eutrema salsugineum]
 gb|ESQ32085.1| hypothetical protein EUTSA_v10004442mg [Eutrema salsugineum]
Length=367

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D EHFSVP GRRA+ELVAGKESA+ Q+ARTV GK Y L+F VGDA+
Sbjct  229  PGWMVESLKAVKYVDTEHFSVPQGRRAIELVAGKESAIAQVARTVVGKTYVLSFAVGDAN  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+EAFAG  TLKVPYES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF
Sbjct  289  NACKGSMVVEAFAGKDTLKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDF  348

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D VKL+SVR
Sbjct  349  SSLCGPVIDDVKLLSVR  365



>ref|XP_009345289.1| PREDICTED: uncharacterized protein LOC103937097 [Pyrus x bretschneideri]
Length=369

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVP G+RAVELVAGKESA+ Q+ RT+ GK Y L+F VGDAS
Sbjct  231  PGWMVESLKAVKYIDSDHFSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDAS  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFA  +T+KVPYESKG+GGYK A L+F A + RTRVMF STYY  RSDDF
Sbjct  291  NSCEGSMIVEAFADKNTVKVPYESKGKGGYKRAVLKFVAASTRTRVMFLSTYYTMRSDDF  350

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPVVD VKL+S+R P
Sbjct  351  SSLCGPVVDDVKLLSLRKP  369



>ref|XP_009334778.1| PREDICTED: uncharacterized protein LOC103927565 [Pyrus x bretschneideri]
Length=365

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVP G+RAVELVAGKESA+ Q+ RT+ GK Y L+F VGDAS
Sbjct  227  PGWMVESLKAVKYIDSDHFSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDAS  286

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFA  +T+KVPYESKG+GGYK A L+F A + RTRVMF STYY  RSDDF
Sbjct  287  NSCEGSMIVEAFADKNTVKVPYESKGKGGYKRAVLKFVAASTRTRVMFLSTYYTMRSDDF  346

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPVVD VKL+S+R P
Sbjct  347  SSLCGPVVDDVKLLSLRKP  365



>ref|XP_006412472.1| hypothetical protein EUTSA_v10025706mg [Eutrema salsugineum]
 gb|ESQ53925.1| hypothetical protein EUTSA_v10025706mg [Eutrema salsugineum]
Length=325

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDAS
Sbjct  187  PGWMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDAS  246

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  T+KVPYESKG+GG+K A LRF A + RTRVMF+ST+Y  R DDF
Sbjct  247  NACAGSMIVEAFAGKDTIKVPYESKGKGGFKRASLRFVAVSARTRVMFYSTFYAMREDDF  306

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+S R P
Sbjct  307  SSLCGPVIDDVKLLSARRP  325



>emb|CAA22573.1| putative protein [Arabidopsis thaliana]
 emb|CAB79963.1| putative protein [Arabidopsis thaliana]
Length=325

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDAS
Sbjct  187  PGWMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDAS  246

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  T+KVPYESKG+GG+K + LRF A ++RTRVMF+ST+Y  R+DDF
Sbjct  247  NACAGSMIVEAFAGKDTIKVPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDF  306

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+S R P
Sbjct  307  SSLCGPVIDDVKLLSARRP  325



>ref|XP_006285882.1| hypothetical protein CARUB_v10007385mg [Capsella rubella]
 gb|EOA18780.1| hypothetical protein CARUB_v10007385mg [Capsella rubella]
Length=354

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDAS
Sbjct  216  PGWMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDAS  275

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  T+KVPYESKG+GG+K A LRF A + RTRVMF+ST+Y  R+DDF
Sbjct  276  NACAGSMIVEAFAGKDTIKVPYESKGKGGFKRASLRFVAASGRTRVMFYSTFYAMRNDDF  335

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+S R P
Sbjct  336  SSLCGPVIDDVKLLSARRP  354



>ref|XP_002872166.1| hypothetical protein ARALYDRAFT_910605 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48425.1| hypothetical protein ARALYDRAFT_910605 [Arabidopsis lyrata subsp. 
lyrata]
Length=369

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D EHFSVP GRRA+ELVAGKESA+ Q+ RT+ GK Y L+F VGDA+
Sbjct  231  PGWMVESLKAVKYVDIEHFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYVLSFAVGDAN  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+EAFAG  TLKVPYES+G GG+K A +RF A ++R+R+MF+ST+Y  RSDDF
Sbjct  291  NACKGSMVVEAFAGKETLKVPYESQGTGGFKRASIRFVAVSSRSRIMFYSTFYAMRSDDF  350

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SVR P
Sbjct  351  SSLCGPVIDDVKLISVRKP  369



>ref|XP_003544618.1| PREDICTED: uncharacterized protein LOC100776765 [Glycine max]
 gb|KHN05403.1| hypothetical protein glysoja_046455 [Glycine soja]
Length=366

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID+ HFSVP G+RAVEL+AGKESA+ Q+ART+ GK Y L+F VGDAS
Sbjct  228  PGWMVESLKAVKYIDSGHFSVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDAS  287

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  T+KVPYESKG+GG+K A L+F A   RTR+MF ST+Y  RSDDF
Sbjct  288  NSCEGSMIVEAFAGKDTIKVPYESKGKGGFKRAALKFVAVTPRTRIMFLSTFYTMRSDDF  347

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKLVS+R P
Sbjct  348  SSLCGPVIDDVKLVSLRKP  366



>gb|KFK25408.1| hypothetical protein AALP_AA8G110600 [Arabis alpina]
Length=367

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW +ESLKA+KY+D EHFSVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+
Sbjct  229  PAWMIESLKAIKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIVGKTYVLSFAVGDAN  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  TLKVPY+S G+GG+K A LRF A + RTR+MF+ST+Y  RSDDF
Sbjct  289  NACEGSMIVEAFAGRDTLKVPYKSLGKGGFKRASLRFIAVSTRTRIMFYSTFYAMRSDDF  348

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL++ R P
Sbjct  349  SSLCGPVIDDVKLLTARKP  367



>ref|XP_008378299.1| PREDICTED: uncharacterized protein LOC103441403, partial [Malus 
domestica]
Length=345

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVP G+RAVELVAGKESA+ Q+ RT+ GK Y L+F VGDAS
Sbjct  207  PGWMVESLKAVKYIDSDHFSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDAS  266

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGS+++EAFAG +T+KVPYESKG+GG+K A L+F A + RTRVMF STYY  RSDDF
Sbjct  267  NSCEGSLIVEAFAGKNTVKVPYESKGKGGFKRAVLKFVAVSTRTRVMFLSTYYTMRSDDF  326

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+S+R P
Sbjct  327  SSLCGPVLDDVKLLSLRKP  345



>ref|XP_002867243.1| hypothetical protein ARALYDRAFT_913203 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43502.1| hypothetical protein ARALYDRAFT_913203 [Arabidopsis lyrata subsp. 
lyrata]
Length=365

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDAS
Sbjct  227  PGWMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDAS  286

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  T+KVPYESKG+GG+K + LRF A ++RTRVMF+ST+Y  R+DDF
Sbjct  287  NACAGSMIVEAFAGKDTIKVPYESKGKGGFKRSSLRFVAVSDRTRVMFYSTFYAMRNDDF  346

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+S R P
Sbjct  347  SSLCGPVIDDVKLLSARRP  365



>gb|AAM61720.1| unknown [Arabidopsis thaliana]
Length=369

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D EHFSVP GRRA+ELVAGKESA+ Q+ RTV GK Y L+F VGDA+
Sbjct  231  PGWMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDAN  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+E+FAG  TLKVPYESKG GG+K A +RF A + R+R+MF+ST+Y  RSDDF
Sbjct  291  NACKGSMVVESFAGKDTLKVPYESKGTGGFKRASIRFVAVSTRSRMMFYSTFYAMRSDDF  350

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SVR P
Sbjct  351  SSLCGPVIDDVKLISVRKP  369



>ref|XP_006841925.1| hypothetical protein AMTR_s00042p00185900 [Amborella trichopoda]
 gb|ERN03600.1| hypothetical protein AMTR_s00042p00185900 [Amborella trichopoda]
Length=332

 Score =   208 bits (529),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 113/141 (80%), Gaps = 0/141 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID+ HFSVP G+RAVELVAGKESA+ Q+ART+ GK Y LTF VGDAS
Sbjct  187  PGWMVESLKAVKYIDSNHFSVPEGKRAVELVAGKESAIAQVARTIPGKLYALTFAVGDAS  246

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSMV+EAFAG  TLKVPYESKG GG+K A LRF A + RTRV+F ST+Y  RSDDF
Sbjct  247  NACTGSMVVEAFAGRDTLKVPYESKGTGGFKRAVLRFTAVSERTRVVFLSTFYSMRSDDF  306

Query  302  VSLCGPVVDFVKLVSVRNPHR  240
             SLCGPV+D VKL+SV    R
Sbjct  307  SSLCGPVIDDVKLLSVHGAPR  327



>gb|ABK94923.1| unknown [Populus trichocarpa]
Length=365

 Score =   209 bits (531),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVK+ID EHFSVP GRRA+ELVAGKESA+ Q+ RT+ GK Y L+F VGDAS
Sbjct  227  PGWMVESLKAVKFIDVEHFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYTLSFAVGDAS  286

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+EAFAG  T+KVPYESKG+GG+K A L+F A ++RTR+MF+ST+Y  RSDDF
Sbjct  287  NSCQGSMVVEAFAGKDTVKVPYESKGKGGFKRAVLKFVAASSRTRIMFYSTFYTMRSDDF  346

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPVVD VKL+S+R
Sbjct  347  SSLCGPVVDDVKLLSLR  363



>ref|XP_007013814.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY31433.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=375

 Score =   209 bits (532),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++H+ VP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+
Sbjct  237  PGWMVESLKAVKYIDSDHYFVPQGRRAVELVAGKESAIAQVARTIIGKTYTLSFSVGDAN  296

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSMV+EAFAG  TLKVPYESKG GG+K A L F+A + RTR+MF ST+Y  RSDDF
Sbjct  297  NSCAGSMVVEAFAGKDTLKVPYESKGTGGFKRAVLTFKAVSTRTRIMFLSTFYTMRSDDF  356

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPVVD VKL+SVR P
Sbjct  357  SSLCGPVVDDVKLLSVRKP  375



>ref|XP_008394047.1| PREDICTED: uncharacterized protein LOC103456171 [Malus domestica]
Length=365

 Score =   209 bits (531),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVP G+RAVELVAGKESA+ Q+ RT+ GK Y L+F VGDAS
Sbjct  227  PGWMVESLKAVKYIDSDHFSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDAS  286

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFA  +T+KVPYESKG+GG+K A L+F A + RTRVMF STYY  RSDDF
Sbjct  287  NSCEGSMIVEAFADKNTVKVPYESKGKGGFKRAVLKFVAASTRTRVMFLSTYYTMRSDDF  346

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPVVD VKL+S+R P
Sbjct  347  SSLCGPVVDDVKLLSLRKP  365



>emb|CAA06490.1| hypothetical protein [Cicer arietinum]
Length=180

 Score =   202 bits (515),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D+ HFSVP G RA+ELVAGKESA+ Q+ART+ GK Y L+F VGDAS
Sbjct  42   PGWMVESLKAVKYLDSSHFSVPEGTRAIELVAGKESAIAQVARTIPGKTYVLSFSVGDAS  101

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  T+KVPY+SKG+GG+K A L+F A  +RTR+MF ST+Y  R+DD 
Sbjct  102  NSCEGSMIVEAFAGRDTVKVPYQSKGKGGFKRAVLKFVAVGSRTRIMFLSTFYSMRTDDL  161

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+S+R P
Sbjct  162  SSLCGPVIDDVKLLSLRKP  180



>dbj|BAE98407.1| hypothetical protein [Arabidopsis thaliana]
Length=365

 Score =   209 bits (531),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDAS
Sbjct  227  PGWMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDAS  286

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  T+KVPYESKG+GG+K + LRF A ++RTRVMF+ST+Y  R+DDF
Sbjct  287  NACAGSMIVEAFAGKDTIKVPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDF  346

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+S R P
Sbjct  347  SSLCGPVIDDVKLLSARRP  365



>ref|XP_009151074.1| PREDICTED: uncharacterized protein LOC103874406 [Brassica rapa]
 emb|CDX88180.1| BnaA06g27710D [Brassica napus]
 emb|CDX80511.1| BnaC07g29330D [Brassica napus]
Length=367

 Score =   209 bits (531),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D EHFS+P GRRA+ELVAGKESA+ Q+ART+ GK Y L+F VGDA+
Sbjct  229  PGWMVESLKAVKYVDTEHFSIPQGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDAN  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+EAFAG  TLKVPYES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF
Sbjct  289  NACKGSMVVEAFAGRDTLKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDF  348

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D VKL+SVR
Sbjct  349  SSLCGPVIDDVKLLSVR  365



>ref|NP_567894.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_974661.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM65206.1| unknown [Arabidopsis thaliana]
 gb|ABF19001.1| At4g32460 [Arabidopsis thaliana]
 gb|AEE86063.1| uncharacterized protein AT4G32460 [Arabidopsis thaliana]
 gb|AEE86064.1| uncharacterized protein AT4G32460 [Arabidopsis thaliana]
Length=365

 Score =   208 bits (530),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDAS
Sbjct  227  PGWMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDAS  286

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  T+KVPYESKG+GG+K + LRF A ++RTRVMF+ST+Y  R+DDF
Sbjct  287  NACAGSMIVEAFAGKDTIKVPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDF  346

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+S R P
Sbjct  347  SSLCGPVIDDVKLLSARRP  365



>emb|CDY54909.1| BnaC02g48660D [Brassica napus]
Length=339

 Score =   207 bits (528),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D EHFS+P GRRA+ELVAGKESA+ Q+ART+ GK Y L+F VGDA+
Sbjct  202  PGWMVESLKAVKYVDTEHFSIPQGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDAN  261

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+EAFAG  TLKVPYES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF
Sbjct  262  NACKGSMVVEAFAGRDTLKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDF  321

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D VKL+S R
Sbjct  322  SSLCGPVIDDVKLISAR  338



>ref|XP_009129962.1| PREDICTED: uncharacterized protein LOC103854751 [Brassica rapa]
 emb|CDY05493.1| BnaA02g31980D [Brassica napus]
Length=366

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D EHFS+P GRRA+ELVAGKESA+ Q+ART+ GK Y L+F VGDA+
Sbjct  229  PGWMVESLKAVKYVDTEHFSIPQGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDAN  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+EAFAG  TLKVPYES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF
Sbjct  289  NACKGSMVVEAFAGRDTLKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDF  348

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D VKL+S R
Sbjct  349  SSLCGPVIDDVKLISAR  365



>ref|XP_002308647.2| hypothetical protein POPTR_0006s26630g [Populus trichocarpa]
 gb|EEE92170.2| hypothetical protein POPTR_0006s26630g [Populus trichocarpa]
Length=415

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVK+ID EHFSVP GRRA+ELVAGKESA+ Q+ RT+ GK Y L+F VGDAS
Sbjct  277  PGWMVESLKAVKFIDVEHFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYTLSFAVGDAS  336

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSMV+EAFAG  T+KVPYESKG+GG+K A L+F A ++RTR+MF+ST+Y  RSDDF
Sbjct  337  NSCEGSMVVEAFAGKDTVKVPYESKGKGGFKRAVLKFVAASSRTRIMFYSTFYTMRSDDF  396

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPVVD VKL+S+R
Sbjct  397  SSLCGPVVDDVKLLSLR  413



>ref|XP_007013813.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY31432.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=412

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++H+ VP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+
Sbjct  274  PGWMVESLKAVKYIDSDHYFVPQGRRAVELVAGKESAIAQVARTIIGKTYTLSFSVGDAN  333

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSMV+EAFAG  TLKVPYESKG GG+K A L F+A + RTR+MF ST+Y  RSDDF
Sbjct  334  NSCAGSMVVEAFAGKDTLKVPYESKGTGGFKRAVLTFKAVSTRTRIMFLSTFYTMRSDDF  393

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPVVD VKL+SVR P
Sbjct  394  SSLCGPVVDDVKLLSVRKP  412



>gb|KJB07801.1| hypothetical protein B456_001G045200 [Gossypium raimondii]
Length=372

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW VESLKAVKYID+ H+ VP GRRAVELVAGKESA+ QI RT+ GK Y L+F VGDA+
Sbjct  231  PAWIVESLKAVKYIDSAHYFVPQGRRAVELVAGKESAIAQIVRTIVGKMYRLSFAVGDAN  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GS+V+EAFAG  TLKVPYESKG+GG+K A+L+F+A +NRTR+MF ST+Y  RSDDF
Sbjct  291  NSCVGSLVVEAFAGKDTLKVPYESKGKGGFKRAELKFKAVSNRTRIMFLSTFYTMRSDDF  350

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D VKL+S++
Sbjct  351  SSLCGPVLDDVKLLSIQ  367



>emb|CDX80516.1| BnaC07g29280D [Brassica napus]
Length=306

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D EHFS+P GRRA+ELV GKESA+ Q+ART+ GK Y L+F VGDA+
Sbjct  168  PGWMVESLKAVKYVDTEHFSIPQGRRAIELVVGKESAIAQVARTIIGKTYVLSFAVGDAN  227

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSMV+EAFAG  TLKVPYES+G GG+K A +RF A + RT+VMF+ST+Y  RSDDF
Sbjct  228  NACKGSMVVEAFAGRDTLKVPYESRGTGGFKRASIRFVAVSTRTKVMFYSTFYAMRSDDF  287

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D VKL+SVR
Sbjct  288  SSLCGPVIDDVKLLSVR  304



>gb|KJB07802.1| hypothetical protein B456_001G045200 [Gossypium raimondii]
Length=377

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW VESLKAVKYID+ H+ VP GRRAVELVAGKESA+ QI RT+ GK Y L+F VGDA+
Sbjct  236  PAWIVESLKAVKYIDSAHYFVPQGRRAVELVAGKESAIAQIVRTIVGKMYRLSFAVGDAN  295

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GS+V+EAFAG  TLKVPYESKG+GG+K A+L+F+A +NRTR+MF ST+Y  RSDDF
Sbjct  296  NSCVGSLVVEAFAGKDTLKVPYESKGKGGFKRAELKFKAVSNRTRIMFLSTFYTMRSDDF  355

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D VKL+S++
Sbjct  356  SSLCGPVLDDVKLLSIQ  372



>ref|XP_010447383.1| PREDICTED: uncharacterized protein LOC104730027 [Camelina sativa]
Length=365

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D++HFSVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDAS
Sbjct  227  PGWMVESLKAVKYLDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDAS  286

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  T+KVPYESKG+GG+K A LRF A + RTRVMF+ST+Y  R+DDF
Sbjct  287  NACAGSMIVEAFAGKDTIKVPYESKGKGGFKRASLRFVAVSVRTRVMFYSTFYAMRNDDF  346

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+S R P
Sbjct  347  SSLCGPVIDDVKLLSARRP  365



>ref|XP_010432718.1| PREDICTED: uncharacterized protein LOC104716937 [Camelina sativa]
Length=365

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDAS
Sbjct  227  PGWMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDAS  286

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  T+KVPYESKG+GG++ A LRF A + RTRVMF+ST+Y  R+DDF
Sbjct  287  NACAGSMIVEAFAGKDTIKVPYESKGKGGFRRASLRFVAVSVRTRVMFYSTFYAMRNDDF  346

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+S R P
Sbjct  347  SSLCGPVIDDVKLLSARRP  365



>ref|XP_003588711.1| hypothetical protein MTR_1g011800 [Medicago truncatula]
Length=326

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D+ HFSVP G RAVELVAGKESA+ Q+ART+ GK Y L+F VGDAS
Sbjct  188  PGWMVESLKAVKYLDSAHFSVPQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDAS  247

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  T+KVPY SKG+GG+K A L+F A   RTRVMF ST+Y  RSDD 
Sbjct  248  NSCEGSMIVEAFAGKDTIKVPYTSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDL  307

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SVR P
Sbjct  308  SSLCGPVIDDVKLLSVRKP  326



>gb|KHG19965.1| putative e3 ubiquitin-protein ligase hul4 [Gossypium arboreum]
Length=377

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW VESLKAVKYID+ H+ VP GRRAVELVAGKESA+ QI RT+ GK Y L+F VGDA+
Sbjct  236  PAWIVESLKAVKYIDSAHYFVPQGRRAVELVAGKESAIAQIVRTIVGKMYRLSFAVGDAN  295

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GS+V+EAFAG  TLKVPYESKG+GG+K A+L+F+A +NRTR+MF ST+Y  RSDDF
Sbjct  296  NSCVGSLVVEAFAGKDTLKVPYESKGKGGFKRAELKFKAVSNRTRIMFLSTFYTMRSDDF  355

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D VKL+S++
Sbjct  356  SSLCGPVLDDVKLLSIQ  372



>emb|CDX97108.1| BnaC09g45170D [Brassica napus]
Length=366

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW +ESLKAVKY+D EHFSVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+
Sbjct  228  PAWIIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIVGKSYVLSFAVGDAN  287

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSM++EAFAG  TLKV YES G+GG+K A LRF A ++RTRVMF+ST+Y  RSDDF
Sbjct  288  NACKGSMIVEAFAGKDTLKVAYESNGKGGFKRAALRFVAVSSRTRVMFYSTFYAMRSDDF  347

Query  302  VSLCGPVVDFVKLVSV  255
             SLCGPV+D VKL+SV
Sbjct  348  SSLCGPVIDDVKLLSV  363



>ref|XP_010110340.1| GTP-binding nuclear protein [Morus notabilis]
 gb|EXC26027.1| GTP-binding nuclear protein [Morus notabilis]
Length=573

 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVPHG+RAVELVAGKESA+ Q+ RT+ GK Y LTF VGDAS
Sbjct  225  PYWMVESLKAVKYIDSDHFSVPHGKRAVELVAGKESAIAQVVRTIVGKTYRLTFSVGDAS  284

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG +T+KVPYESKG+GG+K   L F AT  RTR+MF ST+Y  RSDDF
Sbjct  285  NSCEGSMIVEAFAGRATVKVPYESKGKGGFKRGVLTFVATETRTRIMFLSTFYSMRSDDF  344

Query  302  VSLCGPVVDFVKLVSVRNPHR  240
             SLCGPV+D +KL+SVR P++
Sbjct  345  SSLCGPVLDDIKLLSVRKPNQ  365



>emb|CDX68849.1| BnaC01g06040D [Brassica napus]
Length=365

 Score =   206 bits (525),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVP GRRAVEL+AGKESAV Q+ RT  GK Y L+F VGDAS
Sbjct  227  PGWMVESLKAVKYIDSDHFSVPQGRRAVELIAGKESAVAQVVRTTPGKIYVLSFAVGDAS  286

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  TLKVPYESKG+GG+K A L+F A ++RTR+MF+ST+Y  R+DDF
Sbjct  287  NACAGSMIVEAFAGKDTLKVPYESKGKGGFKRASLKFVAVSDRTRIMFYSTFYAMRNDDF  346

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D VKL+S R
Sbjct  347  SSLCGPVIDDVKLLSAR  363



>gb|AES58962.2| plant/F18G18-200 protein [Medicago truncatula]
Length=376

 Score =   206 bits (525),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D+ HFSVP G RAVELVAGKESA+ Q+ART+ GK Y L+F VGDAS
Sbjct  238  PGWMVESLKAVKYLDSAHFSVPQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDAS  297

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  T+KVPY SKG+GG+K A L+F A   RTRVMF ST+Y  RSDD 
Sbjct  298  NSCEGSMIVEAFAGKDTIKVPYTSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDL  357

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SVR P
Sbjct  358  SSLCGPVIDDVKLLSVRKP  376



>gb|ACJ84308.1| unknown [Medicago truncatula]
Length=376

 Score =   206 bits (524),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D+ HFSVP G RAVELVAGKESA+ Q+ART+ GK Y L+F VGDAS
Sbjct  238  PGWMVESLKAVKYLDSAHFSVPQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDAS  297

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  T+KVPY SKG+GG+K A L+F A   RTRVMF ST+Y  RSDD 
Sbjct  298  NSCEGSMIVEAFAGKDTIKVPYTSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDL  357

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+SVR P
Sbjct  358  SSLCGPVIDDVKLLSVRKP  376



>ref|XP_010670694.1| PREDICTED: uncharacterized protein LOC104887687 [Beta vulgaris 
subsp. vulgaris]
Length=367

 Score =   206 bits (524),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKY+D++HF VP G+RA+ELVAGKESA+ Q+ RTV GK Y LTF VGDA+
Sbjct  229  PGWMIESLKAVKYLDSDHFFVPSGKRAIELVAGKESAIAQVVRTVPGKLYALTFTVGDAN  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSMV+EAFAG  T KVPY SKG+GG+K A LRF AT  RTR+MF+ST+Y  RSDDF
Sbjct  289  NACSGSMVVEAFAGKDTAKVPYNSKGKGGFKRAVLRFVATQTRTRIMFYSTFYSMRSDDF  348

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D V+LVSVR P
Sbjct  349  SSLCGPVIDDVRLVSVRRP  367



>ref|XP_009407651.1| PREDICTED: uncharacterized protein LOC103990295 [Musa acuminata 
subsp. malaccensis]
Length=367

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+DAEHFSVP GRRAVEL+AGKESA+ Q+ RTV G+ Y L+F VGDAS
Sbjct  226  PGWMVESLKAVKYLDAEHFSVPRGRRAVELLAGKESAIAQVVRTVPGRRYALSFAVGDAS  285

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGS+++EAFAG  T+KVPYESKG+GG K A L+F AT  RTRV+F+S+YY+TRSDD 
Sbjct  286  NACEGSLLVEAFAGEHTIKVPYESKGRGGSKRAVLQFTATTARTRVVFWSSYYNTRSDDL  345

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D V LVSVR P
Sbjct  346  SSLCGPVLDDVALVSVRYP  364



>ref|XP_009125963.1| PREDICTED: uncharacterized protein LOC103850912 [Brassica rapa]
 emb|CDX75247.1| BnaA01g04550D [Brassica napus]
Length=365

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVP GRRAVELVAGKESAV Q+ RT  GK Y L+F VGDAS
Sbjct  227  PGWMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTTPGKIYVLSFAVGDAS  286

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  TLKVP+ESKG+GG+K A L+F A ++RTR+MF+ST+Y  R+DDF
Sbjct  287  NACAGSMIVEAFAGKDTLKVPHESKGKGGFKRASLKFVAVSDRTRIMFYSTFYAMRNDDF  346

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D VKL+S R
Sbjct  347  SSLCGPVIDDVKLLSAR  363



>ref|XP_004241713.1| PREDICTED: uncharacterized protein LOC101268115 [Solanum lycopersicum]
Length=372

 Score =   204 bits (519),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = -2

Query  659  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASN  480
             W +ESLKAVKYID+EHF VP G+RAVELVAG+ESA+ Q+ RT  GK YDL F +GDASN
Sbjct  232  GWMIESLKAVKYIDSEHFHVPQGKRAVELVAGRESAIAQVVRTRPGKIYDLLFSIGDASN  291

Query  479  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  300
             CEGSM++EAFAG  T++ PYESKG+GG+K A+LRF A + RTRV F STYYH +SD+  
Sbjct  292  SCEGSMLVEAFAGKITMQFPYESKGKGGFKRARLRFTAISPRTRVRFLSTYYHMKSDNSG  351

Query  299  SLCGPVVDFVKLVSVRNPH  243
            SLCGPVVD V+LV +RNPH
Sbjct  352  SLCGPVVDDVRLVGLRNPH  370



>ref|XP_006356190.1| PREDICTED: uncharacterized protein LOC102589576 [Solanum tuberosum]
Length=371

 Score =   204 bits (519),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = -2

Query  659  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASN  480
             W +ESLKAVKYID+EHF VP G+RAVELVAG+ESA+ Q+ RT  GK YDL F +GDASN
Sbjct  231  GWMIESLKAVKYIDSEHFHVPEGKRAVELVAGRESALAQVVRTRPGKIYDLLFSIGDASN  290

Query  479  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  300
             CEGSM++EAFAG  T++ PYESKG+GG+K A+LRF A + RTRV F STYYH +SD+  
Sbjct  291  SCEGSMLVEAFAGKITMQFPYESKGKGGFKRARLRFTAISPRTRVRFLSTYYHMKSDNSG  350

Query  299  SLCGPVVDFVKLVSVRNPH  243
            SLCGPVVD V+LV VRNPH
Sbjct  351  SLCGPVVDDVRLVGVRNPH  369



>ref|XP_006341715.1| PREDICTED: uncharacterized protein LOC102601890 [Solanum tuberosum]
Length=368

 Score =   204 bits (518),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYIDAEHF+VP G+RA+ELVAG+ESA+ QI RT  GK YDL F VGDAS
Sbjct  230  PGWMIESLKAVKYIDAEHFTVPEGKRAIELVAGRESAIAQIVRTQKGKVYDLMFSVGDAS  289

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSM++EAFAG  TL+VPYES G+GG+K AKLRF A   RTRV F STYYH +SD  
Sbjct  290  NSCQGSMLIEAFAGNITLRVPYESAGKGGFKRAKLRFTAVTERTRVRFLSTYYHMKSDHS  349

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPVVD V+LV VR P
Sbjct  350  GSLCGPVVDDVRLVGVRYP  368



>ref|XP_004235717.1| PREDICTED: uncharacterized protein LOC101252763 [Solanum lycopersicum]
Length=373

 Score =   204 bits (518),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYIDAEHF+VP G+RA+ELVAG+ESA+ QI RT  GK YDL F VGDAS
Sbjct  235  PGWMIESLKAVKYIDAEHFTVPEGKRAIELVAGRESAIAQIVRTQKGKVYDLMFSVGDAS  294

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSM++EAFAG  TL+VPYES G+GG+K AKLRF A   RTRV F STYYH ++D  
Sbjct  295  NSCQGSMLIEAFAGKITLRVPYESAGKGGFKRAKLRFTAVTERTRVRFLSTYYHMKNDHS  354

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPVVD ++LV VR+P
Sbjct  355  GSLCGPVVDDMRLVGVRHP  373



>gb|AAB41813.1| unknown protein [Medicago sativa]
Length=375

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D+ HFSVP G RAVELVAGKESA+ Q+ART+ GK Y L+F VGDAS
Sbjct  237  PGWMVESLKAVKYLDSGHFSVPQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDAS  296

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  T+KVPY SKG+GG+K A L+F A   RTRVMF ST+Y  RSDD 
Sbjct  297  NSCEGSMIVEAFAGKDTIKVPYSSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDL  356

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D VKL+SVR
Sbjct  357  SSLCGPVIDDVKLLSVR  373



>ref|XP_009778816.1| PREDICTED: uncharacterized protein LOC104228110 [Nicotiana sylvestris]
Length=372

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYIDA HF+VP G+RA+ELVAG+ESA+ Q+  T  GK YDL F VGDAS
Sbjct  234  PGWMIESLKAVKYIDAAHFTVPEGKRAIELVAGRESAIAQVVITTKGKVYDLMFSVGDAS  293

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSM++EAFAG  TL+VPYESKG GG+K AKLRF+A + RTRV F STYYH +SD  
Sbjct  294  NSCQGSMLIEAFAGQITLRVPYESKGSGGFKRAKLRFKAVSERTRVRFLSTYYHMKSDHS  353

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPVVD V+LV VR+P
Sbjct  354  GSLCGPVVDDVRLVGVRHP  372



>ref|XP_009590498.1| PREDICTED: uncharacterized protein LOC104087663 [Nicotiana tomentosiformis]
Length=372

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -2

Query  659  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASN  480
             W +ESLKAVKYIDAEHF+VP G+RAVELVAG+ESA+ Q+ RT  GK YDL F +GDASN
Sbjct  232  GWMIESLKAVKYIDAEHFTVPEGKRAVELVAGRESAIAQVVRTRPGKVYDLIFSIGDASN  291

Query  479  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  300
             CEGSM++EAFAG  T++ PYESKG+GG+K A+LRF A + RTRV F STYYH +SD+  
Sbjct  292  SCEGSMLVEAFAGKITMQFPYESKGKGGFKRARLRFTAISPRTRVRFLSTYYHMKSDNSG  351

Query  299  SLCGPVVDFVKLVSVRNP  246
            SLCGPVVD V+LV VRNP
Sbjct  352  SLCGPVVDDVRLVGVRNP  369



>ref|XP_004498654.1| PREDICTED: uncharacterized protein LOC101508759 [Cicer arietinum]
Length=366

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D+ HFSVP G RA+ELVAGKESA+ Q+ART+ GK Y L+F VGDAS
Sbjct  228  PGWMVESLKAVKYLDSSHFSVPEGTRAIELVAGKESAIAQVARTIPGKTYVLSFSVGDAS  287

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  T+KVPY+SKG+GG+K A L+F A  +RTR+MF ST+Y  R+DD 
Sbjct  288  NSCEGSMIVEAFAGRDTVKVPYQSKGKGGFKRAVLKFVAVGSRTRIMFLSTFYSMRTDDL  347

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+S+R P
Sbjct  348  SSLCGPVIDDVKLLSLRKP  366



>gb|KHN07099.1| hypothetical protein glysoja_023282 [Glycine soja]
Length=359

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAV+YID++HFSVP G+RAVEL+ GKESA+ Q+ART+ GK Y L F VGDA 
Sbjct  215  PGWMVESLKAVRYIDSDHFSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDAG  274

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGS+ +EA+ G  ++KVPYESKG+GG+K A L+F A + RTR++F ST+Y+ RSDD 
Sbjct  275  NSCEGSLSVEAYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYNMRSDDL  334

Query  302  VSLCGPVVDFVKLVSVRNPHRRL  234
             SLCGPV+D V L+S+R PHRR 
Sbjct  335  ASLCGPVIDDVTLISLRKPHRRF  357



>ref|XP_010918669.1| PREDICTED: uncharacterized protein LOC105042950 [Elaeis guineensis]
Length=370

 Score =   202 bits (513),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 113/143 (79%), Gaps = 2/143 (1%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAV YID+ HF VP G+RAVELV GKESA+ Q+ARTV G+ Y L+FLVGDA 
Sbjct  227  PGWMVESLKAVNYIDSAHFKVPQGKRAVELVGGKESALAQVARTVVGRVYTLSFLVGDAG  286

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C G MV+EAFA  ST+KVPY+SKG GG+K A LRF A A RTRV+F STYY+TR+D  
Sbjct  287  NACTGPMVVEAFAARSTVKVPYDSKGTGGFKRAVLRFTAVAERTRVVFLSTYYNTRTDG-  345

Query  302  VSLCGPVVDFVKLVSVRNPHRRL  234
             SLCGPVVD V L+SVRNP RRL
Sbjct  346  -SLCGPVVDDVTLLSVRNPSRRL  367



>ref|XP_006581022.1| PREDICTED: uncharacterized protein LOC100802444 isoform X1 [Glycine 
max]
Length=372

 Score =   201 bits (512),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAV+YID++HFSVP G+RAVEL+ GKESA+ Q+ART+ GK Y L F VGDA 
Sbjct  228  PGWMVESLKAVRYIDSDHFSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDAG  287

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGS+ +EA+ G  ++KVPYESKG+GG+K A L+F A + RTR++F ST+Y+ RSDD 
Sbjct  288  NSCEGSLSVEAYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYNMRSDDL  347

Query  302  VSLCGPVVDFVKLVSVRNPHRRL  234
             SLCGPV+D V L+S+R PHRR 
Sbjct  348  ASLCGPVIDDVTLISLRKPHRRF  370



>ref|XP_009591297.1| PREDICTED: uncharacterized protein LOC104088341 [Nicotiana tomentosiformis]
Length=372

 Score =   201 bits (511),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYIDA HF+VP G+RA+ELVAG+ESA+ Q   T  GK YDL F VGDAS
Sbjct  234  PGWMIESLKAVKYIDAAHFAVPEGKRAIELVAGRESAIAQQVITTKGKVYDLMFSVGDAS  293

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSM++EAFAG  TL+VPYESKG GG+K AKLRF+A + RTRV F STYYH +SD  
Sbjct  294  NSCQGSMLIEAFAGQITLRVPYESKGNGGFKRAKLRFKAVSERTRVRFLSTYYHMKSDHS  353

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPVVD V+LV VR+P
Sbjct  354  GSLCGPVVDDVRLVGVRHP  372



>emb|CDX69757.1| BnaA10g21060D [Brassica napus]
Length=1312

 Score =   212 bits (539),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW +ESLKAVKY+D EHFSVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+
Sbjct  228  PAWIIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIVGKSYVLSFAVGDAN  287

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSM++EAFAG  TLKV YESKG+GG+K A LRF A +NRTRVMF+ST+Y  RSDDF
Sbjct  288  NACKGSMIVEAFAGKDTLKVAYESKGKGGFKRAALRFVAVSNRTRVMFYSTFYAMRSDDF  347

Query  302  VSLCGPVVDFVKLVSV  255
             SLCGPV+D VKL+SV
Sbjct  348  SSLCGPVIDDVKLLSV  363



>ref|XP_009401767.1| PREDICTED: uncharacterized protein LOC103985700 [Musa acuminata 
subsp. malaccensis]
Length=368

 Score =   201 bits (510),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 113/139 (81%), Gaps = 2/139 (1%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVPHG+RAVELVAGKESA+ Q+ART+ GK Y LTF VGDA 
Sbjct  227  PGWMVESLKAVKYIDSDHFSVPHGKRAVELVAGKESALAQVARTIPGKVYTLTFSVGDAG  286

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSMV+EAFA   T+K+PYESKG GGYK A LRF A   RTRV+F ST+YHT++D  
Sbjct  287  NGCVGSMVVEAFASRGTVKIPYESKGTGGYKRAVLRFTAAVERTRVVFLSTFYHTKTDG-  345

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPVVD V L+SVR+P
Sbjct  346  -SLCGPVVDDVSLLSVRSP  363



>ref|XP_009758146.1| PREDICTED: uncharacterized protein LOC104210873 [Nicotiana sylvestris]
Length=372

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -2

Query  659  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASN  480
             W +ESLKAVKYIDAEHF+VP G+RAVELVAG+ESA+ Q+ RT  GK YDL F +GDASN
Sbjct  232  GWMIESLKAVKYIDAEHFTVPEGKRAVELVAGRESAIAQVVRTRPGKVYDLIFSIGDASN  291

Query  479  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  300
             CEGSM++EAFAG  T++ PYESKG+GG K ++LRF A + RTRV F STYYH +SD+  
Sbjct  292  SCEGSMLVEAFAGKITMQFPYESKGKGGVKRSRLRFTAISPRTRVRFLSTYYHMKSDNSG  351

Query  299  SLCGPVVDFVKLVSVRNP  246
            SLCGPVVD V+LV VRNP
Sbjct  352  SLCGPVVDDVRLVGVRNP  369



>ref|XP_009389493.1| PREDICTED: uncharacterized protein LOC103976040 [Musa acuminata 
subsp. malaccensis]
Length=369

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 113/142 (80%), Gaps = 2/142 (1%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P WTVESLKAVKYID++HFSVP G+RAVELVAGKESA+ Q+ARTV GK Y L F +GDA 
Sbjct  229  PGWTVESLKAVKYIDSDHFSVPRGKRAVELVAGKESALAQVARTVPGKVYALAFSIGDAG  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSMV+EAFAG  T K+PYESKG GGYK   LRF A A RTRV+FFST+YHT+ D  
Sbjct  289  NGCVGSMVVEAFAGRGTAKIPYESKGTGGYKRGVLRFTAVAERTRVVFFSTFYHTKVDG-  347

Query  302  VSLCGPVVDFVKLVSVRNPHRR  237
             SLCGP +D V L+SVR+P RR
Sbjct  348  -SLCGPSLDDVSLLSVRSPVRR  368



>gb|KHG21629.1| GTPase Der [Gossypium arboreum]
Length=302

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKA+KYID+EHFSVP G+RA+EL+AGKESAV QI +T  G+ Y L+FLVGDA+
Sbjct  161  PGWIIESLKAIKYIDSEHFSVPKGKRAIELIAGKESAVAQIVKTTIGRNYVLSFLVGDAN  220

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEG MV+EAFAG +T+KV Y SKG+GG+K A+L FRA + RTR+MF+ST+Y  +SD+ 
Sbjct  221  NGCEGPMVVEAFAGKNTVKVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNS  280

Query  302  VSLCGPVVDFVKLVSVRNPH  243
             SLCGPV+D VKL+SVR  H
Sbjct  281  GSLCGPVLDDVKLLSVRKLH  300



>ref|XP_006346648.1| PREDICTED: uncharacterized protein LOC102598480 [Solanum tuberosum]
Length=380

 Score =   199 bits (506),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+DA+HF+VP G+RA+ELVAG+ESA+ Q   T AG+ YDLTF VGDA+
Sbjct  239  PGWIVESLKAVKYVDADHFTVPEGKRAIELVAGRESAIAQQVITKAGRIYDLTFSVGDAN  298

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSMV+EAFAG   L+  Y SKG+GG+K AKLRF AT+ RTRV F S+YYH +SD+ 
Sbjct  299  NSCEGSMVVEAFAGNVALQFKYVSKGKGGFKRAKLRFTATSQRTRVRFLSSYYHMKSDNS  358

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPVVD V+LVSVRNP
Sbjct  359  GSLCGPVVDDVRLVSVRNP  377



>gb|KJB70569.1| hypothetical protein B456_011G080100 [Gossypium raimondii]
Length=328

 Score =   197 bits (502),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKA+KYID+EHFSVP G+RA+EL+AGKESAV QI +T  G+ Y L+FLVGDA+
Sbjct  187  PGWIIESLKAIKYIDSEHFSVPKGKRAIELIAGKESAVAQIVKTAIGRNYVLSFLVGDAN  246

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEG MV+EAFAG +T+KV Y SKG+GG+K A+L FRA + RTR+MF+ST+Y  +SD+ 
Sbjct  247  NGCEGPMVVEAFAGKNTVKVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNS  306

Query  302  VSLCGPVVDFVKLVSVRNPH  243
             SLCGPV+D VKL+SVR  H
Sbjct  307  GSLCGPVLDDVKLLSVRKLH  326



>gb|KHG06895.1| Agmatine deiminase [Gossypium arboreum]
Length=374

 Score =   198 bits (504),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKA+KYID+EHFSVP G+RA+EL+AGKESAV QI +T  G+ Y L+FLVGDA+
Sbjct  233  PGWIIESLKAIKYIDSEHFSVPKGKRAIELIAGKESAVAQIVKTTIGRNYVLSFLVGDAN  292

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEG MV+EAFAG +T+KV Y SKG+GG+K A+L FRA + RTR+MF+ST+Y  +SD+ 
Sbjct  293  NGCEGPMVVEAFAGKNTVKVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNS  352

Query  302  VSLCGPVVDFVKLVSVRNPH  243
             SLCGPV+D VKL+SVR  H
Sbjct  353  GSLCGPVLDDVKLLSVRKLH  372



>gb|KJB70568.1| hypothetical protein B456_011G080100 [Gossypium raimondii]
Length=374

 Score =   198 bits (504),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKA+KYID+EHFSVP G+RA+EL+AGKESAV QI +T  G+ Y L+FLVGDA+
Sbjct  233  PGWIIESLKAIKYIDSEHFSVPKGKRAIELIAGKESAVAQIVKTAIGRNYVLSFLVGDAN  292

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEG MV+EAFAG +T+KV Y SKG+GG+K A+L FRA + RTR+MF+ST+Y  +SD+ 
Sbjct  293  NGCEGPMVVEAFAGKNTVKVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNS  352

Query  302  VSLCGPVVDFVKLVSVRNPH  243
             SLCGPV+D VKL+SVR  H
Sbjct  353  GSLCGPVLDDVKLLSVRKLH  372



>ref|XP_010048243.1| PREDICTED: uncharacterized protein LOC104437065 [Eucalyptus grandis]
 gb|KCW80448.1| hypothetical protein EUGRSUZ_C01791 [Eucalyptus grandis]
Length=369

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID+ HFSVP G RA+ELVAGKESA+ Q+ART+ GK Y L F VGDAS
Sbjct  228  PGWMVESLKAVKYIDSAHFSVPGGYRAIELVAGKESAIAQVARTIPGKTYTLFFAVGDAS  287

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  T+KVPYESKG+GG+K A LRF+A + RTR+MF+ST+Y  RSDDF
Sbjct  288  NSCEGSMIVEAFAGRDTIKVPYESKGKGGFKRAVLRFKAVSTRTRIMFYSTFYTMRSDDF  347

Query  302  VSLCGPVVDFVKLVSVRNPH  243
             SLCGPVVD V L+SVRNP 
Sbjct  348  SSLCGPVVDDVVLLSVRNPR  367



>ref|XP_007150706.1| hypothetical protein PHAVU_005G1745000g, partial [Phaseolus vulgaris]
 gb|ESW22700.1| hypothetical protein PHAVU_005G1745000g, partial [Phaseolus vulgaris]
Length=294

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 113/141 (80%), Gaps = 0/141 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HF+VP G+RA+ELVAGKESA+ Q+  T  G+ YDLTF VGDA+
Sbjct  153  PGWIVESLKAVKYIDSDHFAVPEGKRAIELVAGKESALAQVVITTIGRVYDLTFAVGDAN  212

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  T+++PY+SKG+GG    KLRF+A A RTR+ F ST+Y  +SD+ 
Sbjct  213  NACEGSMIVEAFAGAETVQIPYQSKGKGGSVRGKLRFKAVATRTRLRFLSTFYTMKSDNS  272

Query  302  VSLCGPVVDFVKLVSVRNPHR  240
             SLCGPV+D VKL+SVR P R
Sbjct  273  GSLCGPVIDDVKLLSVRYPRR  293



>gb|KHN07098.1| hypothetical protein glysoja_023281 [Glycine soja]
Length=328

 Score =   195 bits (496),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVP G+ AVEL+ GKESA+ Q+ART+ GK Y L+F VGDA 
Sbjct  190  PGWIVESLKAVKYIDSDHFSVPLGKGAVELIGGKESAIAQVARTIPGKTYTLSFAVGDAG  249

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGS+ +EA+ G  ++KVPYESKG+GG+K A L+F A + RTR++F ST+Y  RSDDF
Sbjct  250  NSCEGSLSVEAYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYTMRSDDF  309

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D V L+S+R P
Sbjct  310  ASLCGPVIDDVTLISLRKP  328



>ref|XP_009598172.1| PREDICTED: uncharacterized protein LOC104094024 [Nicotiana tomentosiformis]
Length=379

 Score =   196 bits (498),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYID EHF+VP G+RAVELVAG+ESA+ Q   T AGK YDL F VGDA+
Sbjct  238  PGWIIESLKAVKYIDTEHFAVPEGKRAVELVAGRESALAQQVITKAGKIYDLIFTVGDAN  297

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG   L+VPY SKG+GG+K AK RF A + RTRV F ST YH ++D+ 
Sbjct  298  NSCEGSMLIEAFAGKVALQVPYMSKGKGGFKRAKFRFTAISRRTRVRFLSTNYHMKTDNS  357

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D V+LVSVRNP
Sbjct  358  GSLCGPVIDDVRLVSVRNP  376



>gb|AGV54541.1| hypothetical protein [Phaseolus vulgaris]
Length=376

 Score =   196 bits (497),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 113/141 (80%), Gaps = 0/141 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HF+VP G+RA+ELVAGKESA+ Q+  T  G+ YDLTF VGDA+
Sbjct  235  PGWIVESLKAVKYIDSDHFAVPEGKRAIELVAGKESALAQVVITTIGRVYDLTFAVGDAN  294

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  T+++PY+SKG+GG    KLRF+A A RTR+ F ST+Y  +SD+ 
Sbjct  295  NACEGSMIVEAFAGAETVQIPYQSKGKGGSVRGKLRFKAVATRTRLRFLSTFYTMKSDNS  354

Query  302  VSLCGPVVDFVKLVSVRNPHR  240
             SLCGPV+D VKL+SVR P R
Sbjct  355  GSLCGPVIDDVKLLSVRYPRR  375



>ref|NP_001242447.1| uncharacterized protein LOC100802444 precursor [Glycine max]
 gb|ACU22816.1| unknown [Glycine max]
Length=370

 Score =   196 bits (497),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAV+YID++HFSVP G+RAVEL+ GKESA+ Q+ART+ GK Y L F VGDA 
Sbjct  226  PGWMVESLKAVRYIDSDHFSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDAG  285

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N  EGS+ +EA+ G  ++KVPYESKG+GG+K A L+F A + RT ++F ST+Y+ RSDD 
Sbjct  286  NSSEGSLSVEAYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTHILFLSTFYNMRSDDL  345

Query  302  VSLCGPVVDFVKLVSVRNPHRRL  234
             SLCGPV+D V L+S+R PHRR 
Sbjct  346  ASLCGPVIDDVTLISLRKPHRRF  368



>ref|XP_010654739.1| PREDICTED: uncharacterized protein LOC100261739 [Vitis vinifera]
Length=372

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYID++HF+VP G+R VELVAGKESA++Q+  T+  + Y L+F VGDA+
Sbjct  232  PGWMIESLKAVKYIDSDHFAVPEGKRGVELVAGKESALSQVVFTIPNRVYVLSFSVGDAN  291

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSMV+EAFAG  T+KVPYESKG+GG+K AKLRF+A + RTRVMF STYY  ++D+ 
Sbjct  292  NSCEGSMVVEAFAGLDTVKVPYESKGKGGFKRAKLRFKAISKRTRVMFLSTYYTMKNDNS  351

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D VKL+SVR
Sbjct  352  GSLCGPVLDDVKLLSVR  368



>gb|KHN47787.1| hypothetical protein glysoja_029205 [Glycine soja]
Length=369

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HF+VP G+RA+ELVAGKESA+ Q+  T+ GK YDLTF+VGDA+
Sbjct  231  PGWMVESLKAVKYIDSDHFAVPEGKRAIELVAGKESAIAQVVITIIGKVYDLTFVVGDAN  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSMV+EAFAG  T++V Y+SKG+GG+   KLRF+A + RTR+ F ST+Y T+SD+ 
Sbjct  291  NSCEGSMVVEAFAGKDTIQVQYQSKGKGGFIRGKLRFKAMSTRTRIRFLSTFYTTKSDNT  350

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGP++D ++L+SVR
Sbjct  351  GSLCGPIIDDIRLLSVR  367


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 63/153 (41%), Gaps = 24/153 (16%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEH------FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTF  501
            P WT+  +  V+YI +          VPHG  AV L  G E+++ Q  + V G FY LTF
Sbjct  52   PHWTISGM--VEYIKSGQKQGDMVLVVPHGTYAVRL--GNEASIKQKIQVVKGMFYSLTF  107

Query  500  LVGDASNKCEGSMVLEAFAGPSTLK-----VPYESK-GQGGYKPAKLRFRATANRTRVMF  339
                AS  C     L     PS  K      P ++  G  G       FRA   R  ++ 
Sbjct  108  ---SASRTCAQEEKLNVSVVPSNEKSDWGVFPIQTMYGSNGCDSYACGFRADYPRVEIVI  164

Query  338  FSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHR  240
                 H    D    CGP++D V L  + +P R
Sbjct  165  -----HNPGVDEDPACGPLIDSVALKLLHSPKR  192



>ref|XP_003531698.1| PREDICTED: uncharacterized protein LOC100779277 [Glycine max]
Length=371

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HF+VP G+RA+ELVAGKESA+ Q+  T+ GK YDLTF+VGDA+
Sbjct  233  PGWMVESLKAVKYIDSDHFAVPEGKRAIELVAGKESAIAQVVITIIGKVYDLTFVVGDAN  292

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSMV+EAFAG  T++V Y+SKG+GG+   KLRF+A + RTR+ F ST+Y T+SD+ 
Sbjct  293  NSCEGSMVVEAFAGKDTIQVQYQSKGKGGFIRGKLRFKAMSTRTRIRFLSTFYTTKSDNT  352

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGP++D ++L+SVR
Sbjct  353  GSLCGPIIDDIRLLSVR  369


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 63/153 (41%), Gaps = 24/153 (16%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEH------FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTF  501
            P WT+  +  V+YI +          VPHG  AV L  G E+++ Q  + V G FY LTF
Sbjct  54   PHWTISGM--VEYIKSGQKQGDMVLVVPHGTYAVRL--GNEASIKQKIQVVKGMFYSLTF  109

Query  500  LVGDASNKCEGSMVLEAFAGPSTLK-----VPYESK-GQGGYKPAKLRFRATANRTRVMF  339
                AS  C     L     PS  K      P ++  G  G       FRA   R  ++ 
Sbjct  110  ---SASRTCAQEEKLNVSVVPSNEKSDWGVFPIQTMYGSNGCDSYACGFRADYPRVEIVI  166

Query  338  FSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHR  240
                 H    D    CGP++D V L  + +P R
Sbjct  167  -----HNPGVDEDPACGPLIDSVALKLLHSPKR  194



>gb|KDO83473.1| hypothetical protein CISIN_1g017636mg [Citrus sinensis]
Length=291

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+IDA+HF+VP+G  AVELVAG+ESA+ QI RTV  K Y+LTF +GDA 
Sbjct  154  PGWIIESLKAVKFIDAKHFNVPYGHAAVELVAGRESAIAQILRTVPNKEYNLTFTIGDAK  213

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM +EAFAG  T+ VP+ESKG+GG+K A L+F+A A RTR+ FFSTYYHT+ +DF
Sbjct  214  NGCHGSMRVEAFAGKDTVAVPFESKGKGGFKSASLKFKAIAARTRITFFSTYYHTKINDF  273

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D V+++S+R
Sbjct  274  GSLCGPVLDEVRVLSIR  290



>ref|XP_003526423.1| PREDICTED: uncharacterized protein LOC100801917 [Glycine max]
Length=365

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HFSVP G+ AVEL+ GKESA+ Q+ART+ GK Y L+F VGDA 
Sbjct  227  PGWIVESLKAVKYIDSDHFSVPLGKGAVELIGGKESAIAQVARTIPGKTYTLSFAVGDAG  286

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGS+ +EA+ G  ++KVPYESKG+GG+K A L+F A + RTR++F ST+Y  RSDDF
Sbjct  287  NSCEGSLSVEAYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYTMRSDDF  346

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D V L+S+R P
Sbjct  347  ASLCGPVIDDVTLISLRKP  365



>ref|XP_010914930.1| PREDICTED: uncharacterized protein LOC105040204 [Elaeis guineensis]
Length=370

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W V+S KAVKY+D+ HFSVP G RAVEL+AGKESA+ Q  RTV G+ Y L F VGDAS
Sbjct  226  PGWMVDSPKAVKYLDSTHFSVPRGSRAVELLAGKESALAQEVRTVPGRAYALAFSVGDAS  285

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+G+M++EAFAG  T+KVPYESKG GG K A LRFRA+  RTR++FFS+ Y+TRSDD 
Sbjct  286  NACQGTMIVEAFAGEHTVKVPYESKGAGGAKRAVLRFRASKARTRIVFFSSNYNTRSDDL  345

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D V LVS+RNP
Sbjct  346  SSLCGPVLDDVALVSIRNP  364



>emb|CBI36253.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYID++HF+VP G+R VELVAGKESA++Q+  T+  + Y L+F VGDA+
Sbjct  232  PGWMIESLKAVKYIDSDHFAVPEGKRGVELVAGKESALSQVVFTIPNRVYVLSFSVGDAN  291

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSMV+EAFAG  T+KVPYESKG+GG+K AKLRF+A + RTRVMF STYY  ++D+ 
Sbjct  292  NSCEGSMVVEAFAGLDTVKVPYESKGKGGFKRAKLRFKAISKRTRVMFLSTYYTMKNDNS  351

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D VKL+SVR
Sbjct  352  GSLCGPVLDDVKLLSVR  368



>ref|XP_008792101.1| PREDICTED: uncharacterized protein LOC103708794 [Phoenix dactylifera]
Length=371

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W V+S KAVKY+D+ HF VPHGRRAVEL+AGKESA+ Q  RTV G+ Y L F VGDAS
Sbjct  227  PGWMVDSPKAVKYLDSAHFFVPHGRRAVELLAGKESALAQEVRTVPGRAYALAFSVGDAS  286

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG  T+KVPYESKG GG K A LRFRA+  RTR++F S+ Y TR DD 
Sbjct  287  NACEGSMIVEAFAGEHTVKVPYESKGAGGAKRAVLRFRASKARTRIVFLSSNYSTRRDDL  346

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D V LVS+RNP
Sbjct  347  SSLCGPVLDDVALVSIRNP  365



>ref|XP_008775036.1| PREDICTED: uncharacterized protein LOC103695476 [Phoenix dactylifera]
Length=376

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 112/143 (78%), Gaps = 2/143 (1%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P+W VESLKAV YID+ HF VP G+RAVELV GKESA+ Q+ RTV G+ Y L+F VGDA 
Sbjct  233  PSWMVESLKAVNYIDSAHFKVPQGKRAVELVGGKESALAQVVRTVVGRVYTLSFSVGDAG  292

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C G+M++EAFA  ST+KVPY+SKG GG+K A LRF A A RTRV+F STYY+TR+D  
Sbjct  293  NACAGTMMVEAFAARSTVKVPYDSKGTGGFKRAVLRFTAEAERTRVVFLSTYYNTRTDG-  351

Query  302  VSLCGPVVDFVKLVSVRNPHRRL  234
             SLCGPVVD V L+SVR P RRL
Sbjct  352  -SLCGPVVDDVTLLSVRKPSRRL  373



>ref|XP_011072257.1| PREDICTED: uncharacterized protein LOC105157546 [Sesamum indicum]
Length=401

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKY+D+ HF+VP G+RAVELVAG+ESA+ Q  RTV GK Y+L F +GDA 
Sbjct  260  PGWMIESLKAVKYVDSNHFAVPEGKRAVELVAGRESALAQTVRTVPGKTYNLIFSIGDAK  319

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM +EA AG   L+VPYESKG GG+K AKLRF+A ++RTRV F ST+YH +SD+ 
Sbjct  320  NSCEGSMTVEANAGRDILQVPYESKGNGGFKRAKLRFKAVSSRTRVRFLSTFYHIKSDNS  379

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGP++D V+LVS+R P
Sbjct  380  GSLCGPIIDDVRLVSIRYP  398



>ref|XP_002517567.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44731.1| conserved hypothetical protein [Ricinus communis]
Length=378

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYID +HF+VP G+RA+ELVAGKESA+ Q+ +T+ GK Y LTF VGDA+
Sbjct  236  PGWIIESLKAVKYIDLDHFAVPEGKRAIELVAGKESALAQVVKTIPGKTYVLTFSVGDAN  295

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EA+AG   ++ PY SKG+GG+K AKL+F+A +  TR+MF S++Y  +SD+ 
Sbjct  296  NACEGSMIVEAYAGKDKIQFPYVSKGKGGFKTAKLQFKAVSTHTRIMFLSSFYTMKSDNS  355

Query  302  VSLCGPVVDFVKLVSVRNPHRRL  234
             SLCGPV+D VKL+SVR P R L
Sbjct  356  GSLCGPVLDDVKLISVRQPRRLL  378



>ref|XP_011081171.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105164253 
[Sesamum indicum]
Length=373

 Score =   194 bits (492),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 110/144 (76%), Gaps = 3/144 (2%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVA---GKESAVTQIARTVAGKFYDLTFLVG  492
            P W +ESLKAVKYID++HF VP G+RAVELVA   G+E A+ Q  RTV GK YDL F +G
Sbjct  229  PGWMIESLKAVKYIDSDHFGVPEGKRAVELVAVGKGRERALAQTVRTVPGKTYDLIFSIG  288

Query  491  DASNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRS  312
            DA N CEGSM++EA AG   L+VPYESKG GG+K AKLRF+A + RTR+ F STYYH +S
Sbjct  289  DAKNSCEGSMMVEATAGKVILQVPYESKGAGGFKRAKLRFKAISTRTRIRFLSTYYHMKS  348

Query  311  DDFVSLCGPVVDFVKLVSVRNPHR  240
            D+  SLCGPV+D VKLV VR P R
Sbjct  349  DNSGSLCGPVIDDVKLVGVRRPGR  372



>gb|AFK48067.1| unknown [Lotus japonicus]
Length=204

 Score =   189 bits (479),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 111/141 (79%), Gaps = 0/141 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID+ HF+VP G+RAVELVAGKES + Q  +T  GK Y LTF VGDA+
Sbjct  63   PGWMVESLKAVKYIDSNHFAVPAGKRAVELVAGKESVIAQNVKTTIGKVYVLTFAVGDAN  122

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSMV+EAFAG  T++VPY+SKG+GG+   KLRF+A + RTRV F ST+Y  ++D+ 
Sbjct  123  NSCEGSMVVEAFAGGDTVQVPYQSKGKGGFVRGKLRFKAVSARTRVRFLSTFYTMKNDNS  182

Query  302  VSLCGPVVDFVKLVSVRNPHR  240
             SLCGP++D ++L+SVR P R
Sbjct  183  GSLCGPIIDDIRLLSVRYPGR  203



>gb|KHG10708.1| Allergen Act d 3 [Gossypium arboreum]
Length=374

 Score =   194 bits (492),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W ++SLKAVKYID++HF+VP G+RA+EL+AGKES+++Q+ RT  G+ Y L+F +GDA+
Sbjct  233  PGWIIDSLKAVKYIDSDHFTVPEGKRAIELIAGKESSLSQVVRTTIGRDYVLSFTIGDAN  292

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSMV+EAFA  +T+KV Y+SKG+GG+K A+LRF+A + RTR+MF+ST+Y  ++D+ 
Sbjct  293  NACEGSMVVEAFANKNTVKVTYDSKGKGGFKQARLRFKADSTRTRIMFYSTFYTMKNDNS  352

Query  302  VSLCGPVVDFVKLVSVRNPH  243
             SLCGPVVD VKLVS+R  H
Sbjct  353  GSLCGPVVDDVKLVSIRKLH  372



>ref|XP_004252488.1| PREDICTED: uncharacterized protein LOC101250580 [Solanum lycopersicum]
Length=380

 Score =   193 bits (491),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+DA+HF+VP G+RA+ELVAG+ESA+ Q   T  G+ YDL F VGDA+
Sbjct  239  PGWIVESLKAVKYVDADHFTVPEGKRAIELVAGRESAIAQQVITKTGRIYDLIFSVGDAN  298

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSMV+EAFAG   L+  Y SKG+GG+K AKLRF A + RTRV F S+YYH +SD+ 
Sbjct  299  NACEGSMVVEAFAGNVALQFQYVSKGKGGFKRAKLRFTAMSQRTRVRFLSSYYHMKSDNS  358

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D V+LVSVRNP
Sbjct  359  GSLCGPVIDDVRLVSVRNP  377



>ref|XP_007023946.1| Uncharacterized protein TCM_028364 [Theobroma cacao]
 gb|EOY26568.1| Uncharacterized protein TCM_028364 [Theobroma cacao]
Length=372

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYID+EHFSVP G+RA+ELVAGKESA+ Q+ +T  G+ Y L+F VGDA+
Sbjct  231  PGWIIESLKAVKYIDSEHFSVPEGKRAIELVAGKESALAQVVKTTIGRSYVLSFTVGDAN  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSMV+EAFAG +T+K  Y+SKG+GG+K A L F+A ++RTR+MF+ST+Y  +SD+ 
Sbjct  291  NACEGSMVVEAFAGKNTVKASYQSKGKGGFKRAILAFKAESSRTRIMFYSTFYTMKSDNS  350

Query  302  VSLCGPVVDFVKLVSVRNPH  243
             SLCGPV+D VKL+SVR  H
Sbjct  351  GSLCGPVLDDVKLLSVRKLH  370



>ref|XP_009764126.1| PREDICTED: uncharacterized protein LOC104215887 [Nicotiana sylvestris]
Length=379

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKY+DAEHF+VP G+RAVELVAG+ESA+ Q   T AGK YDL F VGDA+
Sbjct  238  PGWIIESLKAVKYVDAEHFTVPEGKRAVELVAGRESALAQQVITKAGKIYDLIFTVGDAN  297

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EAFAG   L+V Y SKG+GG+K AKLRF A + RT V F ST YH +SD+ 
Sbjct  298  NSCEGSMLIEAFAGKVALQVRYMSKGKGGFKRAKLRFTAISRRTGVRFLSTNYHMKSDNS  357

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D V+LVSVRNP
Sbjct  358  GSLCGPVIDDVRLVSVRNP  376



>ref|XP_006439076.1| hypothetical protein CICLE_v10031881mg [Citrus clementina]
 ref|XP_006482850.1| PREDICTED: uncharacterized protein LOC102610407 [Citrus sinensis]
 gb|ESR52316.1| hypothetical protein CICLE_v10031881mg [Citrus clementina]
 gb|KDO83472.1| hypothetical protein CISIN_1g017636mg [Citrus sinensis]
Length=368

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+IDA+HF+VP+G  AVELVAG+ESA+ QI RTV  K Y+LTF +GDA 
Sbjct  231  PGWIIESLKAVKFIDAKHFNVPYGHAAVELVAGRESAIAQILRTVPNKEYNLTFTIGDAK  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM +EAFAG  T+ VP+ESKG+GG+K A L+F+A A RTR+ FFSTYYHT+ +DF
Sbjct  291  NGCHGSMRVEAFAGKDTVAVPFESKGKGGFKSASLKFKAIAARTRITFFSTYYHTKINDF  350

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D V+++S+R
Sbjct  351  GSLCGPVLDEVRVLSIR  367



>gb|EMS52012.1| hypothetical protein TRIUR3_31218 [Triticum urartu]
Length=312

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 117/144 (81%), Gaps = 2/144 (1%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HF+VP GRRAVEL+AG+ESA+ Q+ RTV GK Y L+F VGDAS
Sbjct  168  PGWMVESLKAVKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGKQYALSFSVGDAS  227

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDD  306
            N C GS+++EA+AG  + KVPYES GQGG  K A L FRAT++RTRV+FFS++Y+TR+DD
Sbjct  228  NTCRGSLMVEAYAGRESTKVPYESAGQGGAAKRAVLPFRATSSRTRVVFFSSFYNTRTDD  287

Query  305  FVSLCGPVVDFVKLVSVR-NPHRR  237
              SLCGPV+D V +VSVR  P +R
Sbjct  288  MSSLCGPVIDDVAVVSVRARPPKR  311



>gb|KJB68131.1| hypothetical protein B456_010G227400 [Gossypium raimondii]
Length=374

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W ++SLKAVKYID++HF+VP G+RA+EL+AGKES+++Q+ RT  G  Y L+F +GDA+
Sbjct  233  PGWIIDSLKAVKYIDSDHFTVPEGKRAIELIAGKESSLSQVVRTTIGGDYVLSFTIGDAN  292

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSMV+EAFA  +T+KV Y+SKG+GG+K A+LRF+A + RTR+MF+ST+Y  ++D+ 
Sbjct  293  NACEGSMVVEAFANKNTVKVTYDSKGKGGFKQARLRFKADSTRTRIMFYSTFYTMKNDNS  352

Query  302  VSLCGPVVDFVKLVSVRNPH  243
             SLCGPVVD VKLVS+R  H
Sbjct  353  GSLCGPVVDDVKLVSIRKLH  372



>ref|XP_004486698.1| PREDICTED: uncharacterized protein LOC101495368 [Cicer arietinum]
Length=373

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HF VP G RA+ELVAGKESA+ Q+  T  GK YDLTF VGDA+
Sbjct  231  PGWIVESLKAVKYIDSKHFYVPEGNRAIELVAGKESALAQVVITTIGKVYDLTFSVGDAN  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM +EAFAG  T++VPYESKG+GG+   KLRF A + RTR+ F ST+Y  ++D+ 
Sbjct  291  NSCEGSMTVEAFAGGDTVQVPYESKGKGGFVRGKLRFTALSTRTRIRFLSTFYTMKNDNS  350

Query  302  VSLCGPVVDFVKLVSVRNPHRR  237
             SLCGPV+D VKL+SVR P++ 
Sbjct  351  GSLCGPVIDDVKLLSVRYPNKH  372



>dbj|BAK03126.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 114/141 (81%), Gaps = 1/141 (1%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HF+VP GRRAVEL+AG+ESA+ Q+ RTV GK Y L+F VGDAS
Sbjct  230  PGWMVESLKAVKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGKQYALSFSVGDAS  289

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDD  306
            N C GS+++EA+AG  + KVPYES GQGG  K A L FRAT+ RTRV+FFS++Y+TR+DD
Sbjct  290  NTCRGSLMVEAYAGRESAKVPYESAGQGGAAKRAVLPFRATSPRTRVVFFSSFYNTRTDD  349

Query  305  FVSLCGPVVDFVKLVSVRNPH  243
              SLCGPV+D V +VSVR  H
Sbjct  350  MSSLCGPVIDDVAVVSVRARH  370



>gb|KHN44154.1| hypothetical protein glysoja_031815 [Glycine soja]
Length=374

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HF+VP G+RA+ELVAGKESA+ Q+  T  GK YDLTF VGDA+
Sbjct  233  PGWIVESLKAVKYIDSDHFAVPEGKRAIELVAGKESALAQVVITTIGKTYDLTFAVGDAN  292

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N+CE SM++EAFAG +T++VPY+SKG+GG+   KLRF+A + RTR+ F ST+Y  +SD+ 
Sbjct  293  NECEASMMVEAFAGANTVQVPYQSKGKGGFVRGKLRFKAVSTRTRLRFLSTFYTMKSDNS  352

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D VKL+ VR P
Sbjct  353  GSLCGPVIDDVKLLGVRYP  371



>ref|XP_011035644.1| PREDICTED: uncharacterized protein LOC105133377 [Populus euphratica]
Length=373

 Score =   191 bits (485),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W V+SLKAVKYID+EHF+VP G+RAVEL+AGKESA++QI +T+  K Y LTF VGD S
Sbjct  231  PGWIVDSLKAVKYIDSEHFTVPEGKRAVELIAGKESAISQIVKTIINKIYVLTFNVGDTS  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSMV+E +AG    +VPY+S G+GG+K AK  F+A +N TR+ F S++Y  +SD+ 
Sbjct  291  NSCVGSMVVEVYAGKDRTQVPYKSNGKGGFKRAKFVFKAVSNHTRITFLSSFYTMKSDNS  350

Query  302  VSLCGPVVDFVKLVSVRNPHRRL  234
             SLCGPV+D VKLVSVRNP R L
Sbjct  351  GSLCGPVLDDVKLVSVRNPRRHL  373



>ref|XP_002303263.1| hypothetical protein POPTR_0003s05850g [Populus trichocarpa]
 gb|EEE78242.1| hypothetical protein POPTR_0003s05850g [Populus trichocarpa]
Length=374

 Score =   191 bits (484),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W V+SLKAVKYID++HF+VP G+RAVELVAGKESA++Q+ +T   K Y LTF VGD S
Sbjct  231  PGWMVDSLKAVKYIDSDHFTVPEGKRAVELVAGKESAISQVVKTTISKIYALTFSVGDTS  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSMV+E +AG    +VPYES G+GG+K AK  F+A +N TR+ F S++Y  +SD+ 
Sbjct  291  NSCVGSMVVEVYAGKDKTQVPYESNGKGGFKHAKFVFKAISNHTRITFLSSFYTMKSDNS  350

Query  302  VSLCGPVVDFVKLVSVRNPHRRL  234
             SLCGPV+D VKLVSVRNP R L
Sbjct  351  GSLCGPVLDDVKLVSVRNPRRHL  373



>ref|XP_011040006.1| PREDICTED: uncharacterized protein LOC105136392 [Populus euphratica]
Length=396

 Score =   191 bits (485),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W V+SLKAVKYID++HF+VP G+RAVELVAGKESA++Q+ +T   K Y LTF VGD S
Sbjct  253  PGWMVDSLKAVKYIDSDHFTVPEGKRAVELVAGKESAISQVVKTTISKIYALTFSVGDTS  312

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSMV+E +AG    +VPYES G+GG+K AK  F+A +N TR+ F S++Y  +SD+ 
Sbjct  313  NSCVGSMVVEVYAGKDKTQVPYESNGKGGFKHAKFVFKAISNHTRITFLSSFYSMKSDNS  372

Query  302  VSLCGPVVDFVKLVSVRNPHRRL  234
             SLCGPV+D VKLVSVRNP R L
Sbjct  373  GSLCGPVLDDVKLVSVRNPRRHL  395



>gb|KJB70570.1| hypothetical protein B456_011G080200 [Gossypium raimondii]
Length=203

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 109/140 (78%), Gaps = 0/140 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKA+KYID+EH SVP G+ A+EL+AGKESAV QI +T  G+ Y L+F+VGDA+
Sbjct  62   PGWIIESLKAIKYIDSEHLSVPQGKWAIELIAGKESAVAQIVKTTIGRNYVLSFVVGDAN  121

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEG M++EAFAG + + V Y SKG+GG+K A+L FRA + RTR+MF+ST Y  +SD+ 
Sbjct  122  NGCEGPMMVEAFAGKNMVMVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTIYTIKSDNS  181

Query  302  VSLCGPVVDFVKLVSVRNPH  243
             SLCGPV+D V L+SVR  H
Sbjct  182  GSLCGPVLDDVMLLSVRKLH  201



>gb|EMT16005.1| hypothetical protein F775_13621 [Aegilops tauschii]
Length=340

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 117/144 (81%), Gaps = 2/144 (1%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HF+VP GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F VG+AS
Sbjct  196  PGWMVESLKAVKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFSVGNAS  255

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDD  306
            N C GS+++EA+AG  + KVPYES GQGG  K A L FRAT++RTRV+FFS++Y+TR+DD
Sbjct  256  NTCRGSLMVEAYAGRESTKVPYESAGQGGAAKRAVLPFRATSSRTRVVFFSSFYNTRTDD  315

Query  305  FVSLCGPVVDFVKLVSVR-NPHRR  237
              SLCGPV+D V +VSVR  P +R
Sbjct  316  MSSLCGPVIDDVAVVSVRARPPKR  339



>ref|XP_002298115.2| hypothetical protein POPTR_0001s17430g [Populus trichocarpa]
 gb|EEE82920.2| hypothetical protein POPTR_0001s17430g [Populus trichocarpa]
Length=389

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W V+SLKAVKYID EHF+VP G+RAVELVAGKESA++Q  +T+  K Y LTF VGD S
Sbjct  247  PGWIVDSLKAVKYIDREHFTVPEGKRAVELVAGKESAISQTVKTIINKIYVLTFYVGDTS  306

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSMV+E +AG    +VPYES G+GG+K AK  F+A +N TR+ F S++Y  +SD+ 
Sbjct  307  NSCVGSMVVEVYAGKDRTQVPYESNGKGGFKRAKFVFKAVSNHTRITFLSSFYTMKSDNS  366

Query  302  VSLCGPVVDFVKLVSVRNPHRRL  234
             SLCGPV+D VKLVSVRNP R L
Sbjct  367  GSLCGPVLDDVKLVSVRNPRRHL  389



>gb|EYU24667.1| hypothetical protein MIMGU_mgv1a008541mg [Erythranthe guttata]
Length=370

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 110/141 (78%), Gaps = 0/141 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYID+++F VP G+RAVELV G+ES V Q+ RT   K YDL F VGD++
Sbjct  229  PGWMIESLKAVKYIDSDNFRVPEGKRAVELVGGRESVVAQVVRTEPEKVYDLVFSVGDSN  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            NKCEGSM++ A+AG   L+VPYESKG GG+K A++RF+AT+ RTR+ F S YYH +SD+ 
Sbjct  289  NKCEGSMMVVAYAGVDILQVPYESKGHGGFKSARMRFKATSTRTRIRFSSEYYHMKSDNS  348

Query  302  VSLCGPVVDFVKLVSVRNPHR  240
             SLCGPVVD V+LV +R P R
Sbjct  349  GSLCGPVVDDVRLVRIRYPSR  369



>ref|XP_003597843.1| hypothetical protein MTR_2g103170 [Medicago truncatula]
 gb|AES68094.1| plant/F18G18-200 protein [Medicago truncatula]
Length=373

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 111/141 (79%), Gaps = 0/141 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID+EHF+VP G+RA+ELVAGKESA+ Q   T  GK Y LTF VGDA+
Sbjct  231  PGWIVESLKAVKYIDSEHFTVPEGKRAIELVAGKESALAQEVFTTIGKVYVLTFAVGDAN  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM +EAFAG  T++VPY+SKG+GG+   KLRF+A+  RTR+ F ST+Y  ++D+ 
Sbjct  291  NACEGSMTVEAFAGRDTVQVPYQSKGKGGFVRGKLRFKASTRRTRIRFLSTFYTMKNDNS  350

Query  302  VSLCGPVVDFVKLVSVRNPHR  240
             SLCGPV+D VKL+SVR P+ 
Sbjct  351  GSLCGPVIDDVKLLSVRYPNN  371



>ref|XP_008347484.1| PREDICTED: uncharacterized protein LOC103410579 [Malus domestica]
Length=374

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYID+EHF VP GRRA+ELV GKESA+TQ+  T  GK Y LTF VGD++
Sbjct  234  PGWIIESLKAVKYIDSEHFFVPEGRRAIELVTGKESALTQVVFTKPGKLYALTFSVGDSN  293

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGS+V+EAFAG  TLKVPY+SKG+GG+K A+L F A   RTR+MF+ST+Y   +D  
Sbjct  294  NSCEGSLVVEAFAGKDTLKVPYQSKGKGGFKRARLIFTAVGPRTRIMFYSTFYTMVADHS  353

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGP++D VKL+SVR
Sbjct  354  GSLCGPIIDDVKLLSVR  370



>ref|XP_010061944.1| PREDICTED: uncharacterized protein LOC104449472 [Eucalyptus grandis]
 gb|KCW68990.1| hypothetical protein EUGRSUZ_F02553 [Eucalyptus grandis]
Length=372

 Score =   188 bits (478),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK++D++HF+VP G+RAVELVAGKESA+ Q+  T  GK Y LTF VGDA 
Sbjct  231  PGWIIESLKAVKFVDSDHFAVPEGKRAVELVAGKESAIAQVVSTQRGKVYVLTFAVGDAK  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM +EA+AG +++ VPY S G+GGY  AKLRF AT++RTRV F S+YY+ +SD  
Sbjct  291  NSCEGSMAVEAYAGTASVTVPYTSTGKGGYVHAKLRFTATSDRTRVRFLSSYYNMQSDHS  350

Query  302  VSLCGPVVDFVKLVSVRN  249
             SLCGPV+D V+LVSVRN
Sbjct  351  GSLCGPVIDDVRLVSVRN  368



>ref|XP_007218161.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
 gb|EMJ19360.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
Length=291

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+ID++HF+VP G+ AVELVAG+ESA+ Q+ RTV  K YDL+F+VGDA 
Sbjct  155  PGWIIESLKAVKFIDSQHFNVPFGKGAVELVAGRESAIAQVLRTVPNKIYDLSFVVGDAR  214

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  TLKVP+ S+G+GG+K A L+F+A + RTR+ F+S++YHTR DD+
Sbjct  215  NGCHGSMMVEAFAGKDTLKVPFTSQGKGGFKAASLKFKAASPRTRITFYSSFYHTRVDDY  274

Query  302  VSLCGPVVDFVKLVSV  255
             +LCGP++D V++  V
Sbjct  275  GALCGPILDQVRVYPV  290



>gb|EYU21602.1| hypothetical protein MIMGU_mgv1a008411mg [Erythranthe guttata]
Length=374

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 110/141 (78%), Gaps = 0/141 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKY+D++H+ VP G+RAVELVAG+ESA+ QI +TV GK YDL FL+GDA 
Sbjct  233  PGWIIESLKAVKYVDSDHYGVPEGKRAVELVAGRESALAQIVKTVPGKTYDLYFLLGDAK  292

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEG M +EA AG ++L+  YESKG GG++ +KLRF+A + RTRV F S  YH +SD+ 
Sbjct  293  NSCEGMMTVEAAAGKNSLQFHYESKGAGGFQRSKLRFKAVSVRTRVRFLSMLYHMKSDNT  352

Query  302  VSLCGPVVDFVKLVSVRNPHR  240
             SLCGPV+D V+LV VRNP R
Sbjct  353  GSLCGPVIDDVRLVGVRNPGR  373



>gb|KDP37140.1| hypothetical protein JCGZ_06196 [Jatropha curcas]
Length=375

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 113/143 (79%), Gaps = 0/143 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYI++EHF VP G+RA+ELVAGKESA++QI +T+  K Y LTF VGDA+
Sbjct  233  PGWIIESLKAVKYINSEHFKVPQGKRAIELVAGKESALSQIVKTIPKKSYVLTFNVGDAN  292

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGS+V+E +AG   +++PY SKG+GG+KPA+ +F+A +  TR+MF S++Y  +SD+ 
Sbjct  293  NSCEGSLVVEVYAGNDKIEIPYVSKGKGGFKPARFQFQAVSTHTRLMFLSSFYTMKSDNS  352

Query  302  VSLCGPVVDFVKLVSVRNPHRRL  234
             SLCGPV+D VKL+SVR P   L
Sbjct  353  GSLCGPVIDDVKLLSVRRPRHLL  375



>ref|XP_004149718.1| PREDICTED: uncharacterized protein LOC101216438 [Cucumis sativus]
 ref|XP_004164153.1| PREDICTED: uncharacterized LOC101216438 [Cucumis sativus]
 gb|KGN58580.1| hypothetical protein Csa_3G689790 [Cucumis sativus]
Length=368

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+ID++HF+VP G  A+ELVAG+ESAV QI RT+  K Y LTF VGDA 
Sbjct  232  PGWIIESLKAVKFIDSKHFNVPVGLAAIELVAGRESAVAQIIRTIPNKVYSLTFKVGDAK  291

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFA   T+KVP++S+G+G YK A L+F+AT+ RTR+ FFS+YYHTR+DDF
Sbjct  292  NGCHGSMMVEAFAAKETVKVPFQSQGKGLYKNAILKFKATSRRTRITFFSSYYHTRTDDF  351

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D V+++S  
Sbjct  352  GSLCGPVLDDVRVISTN  368



>ref|XP_010534242.1| PREDICTED: uncharacterized protein LOC104809851 [Tarenaya hassleriana]
Length=365

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+ID++HF+VP+G  A+ELVAGKESA+ Q+ RTV  K Y L+F VGDA 
Sbjct  229  PGWIIESLKAVKFIDSKHFNVPYGEAAIELVAGKESAIAQVIRTVPNKVYSLSFAVGDAR  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSMV+EAFAG  TLKVP+ S G G YK A L+F+A   RTR+ FFSTYYHT+ DDF
Sbjct  289  NGCHGSMVVEAFAGKDTLKVPHNSVGAGHYKTASLKFKALEARTRITFFSTYYHTKKDDF  348

Query  302  VSLCGPVVDFVKLVSV  255
             SLCGP++D +++V V
Sbjct  349  GSLCGPIIDDIRVVPV  364



>ref|XP_010241207.1| PREDICTED: uncharacterized protein LOC104585883 [Nelumbo nucifera]
Length=365

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+ID+ HF+VP+G  AVELVAGKESA+ Q+ RTV  K Y+LTF VGDA 
Sbjct  228  PGWIIESLKAVKFIDSAHFNVPYGSAAVELVAGKESAIAQVIRTVPNKLYNLTFTVGDAR  287

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM +EAFAG  TLKVP+ESKG+GG+K    +F+A   RTR+ FFS++YHTR DD+
Sbjct  288  NGCHGSMSVEAFAGAETLKVPFESKGKGGFKAVSFKFKAVGARTRITFFSSFYHTRVDDY  347

Query  302  VSLCGPVVDFVKLVSV  255
             SLCGP++D V++  V
Sbjct  348  GSLCGPILDQVRVFPV  363



>ref|XP_004307221.1| PREDICTED: uncharacterized protein LOC101292742 [Fragaria vesca 
subsp. vesca]
Length=368

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+IDA+HF+VP G+ AVELVAG+ESA+ Q+ RTV  K Y L+F +GDA 
Sbjct  232  PGWIIESLKAVKFIDAKHFNVPFGKGAVELVAGRESAIAQVLRTVPNKLYSLSFTIGDAR  291

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  TLKVP+ S+G+GG+K A  +F+AT+ RTR+ FFS++YHTR+DD+
Sbjct  292  NGCHGSMMVEAFAGKDTLKVPFNSQGKGGFKNASFKFKATSFRTRITFFSSFYHTRTDDY  351

Query  302  VSLCGPVVDFVKLVSV  255
             +LCGP++D VK+  +
Sbjct  352  GALCGPILDEVKVSPI  367



>dbj|BAD16016.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD38436.1| unknown protein [Oryza sativa Japonica Group]
Length=302

 Score =   184 bits (466),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 111/138 (80%), Gaps = 1/138 (1%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HF+VP GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F VGDAS
Sbjct  156  PGWMVESLKAVKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDAS  215

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDD  306
            N CEGS+V+EA+AG  + +V +ES G+GG  K A L FRA A RTRV+FFS++Y TRSDD
Sbjct  216  NGCEGSLVVEAYAGRESTRVAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDD  275

Query  305  FVSLCGPVVDFVKLVSVR  252
              SLCGPV+D V +VSVR
Sbjct  276  MSSLCGPVIDDVAVVSVR  293



>ref|XP_007218160.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
 gb|EMJ19359.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
Length=367

 Score =   186 bits (471),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+ID++HF+VP G+ AVELVAG+ESA+ Q+ RTV  K YDL+F+VGDA 
Sbjct  231  PGWIIESLKAVKFIDSQHFNVPFGKGAVELVAGRESAIAQVLRTVPNKIYDLSFVVGDAR  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  TLKVP+ S+G+GG+K A L+F+A + RTR+ F+S++YHTR DD+
Sbjct  291  NGCHGSMMVEAFAGKDTLKVPFTSQGKGGFKAASLKFKAASPRTRITFYSSFYHTRVDDY  350

Query  302  VSLCGPVVDFVKLVSV  255
             +LCGP++D V++  V
Sbjct  351  GALCGPILDQVRVYPV  366



>ref|XP_009348421.1| PREDICTED: uncharacterized protein LOC103940075 [Pyrus x bretschneideri]
Length=374

 Score =   186 bits (471),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYID++HF VP GRRA+ELV GKESA+ Q+  T  GK Y LTF VGD++
Sbjct  234  PGWIIESLKAVKYIDSKHFFVPEGRRAIELVGGKESALAQVVFTKPGKLYALTFSVGDSN  293

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGS+++EAFAG  TLKVPY+SKG+GG+K A+L F A   RTR+MF+ST+Y   +D  
Sbjct  294  NACEGSLIVEAFAGKDTLKVPYQSKGKGGFKRARLLFTAVGPRTRIMFYSTFYTMSADHS  353

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGP++D VKL+SVR
Sbjct  354  GSLCGPIIDDVKLLSVR  370



>ref|XP_008377611.1| PREDICTED: uncharacterized protein LOC103440696 [Malus domestica]
Length=374

 Score =   186 bits (471),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYID++HF VP GR+A+ELV GKESA+ Q+  T  GK Y LTF VGD++
Sbjct  234  PGWIIESLKAVKYIDSQHFFVPEGRKAIELVGGKESALAQVVFTKPGKLYALTFSVGDSN  293

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGS+++EAFAG  TLKVPY+SKG+GG+K A+L F A   RTR+MF+ST+Y   +D  
Sbjct  294  NACEGSLIVEAFAGKDTLKVPYQSKGKGGFKRARLLFTAVGPRTRIMFYSTFYTMSADHS  353

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGP++D VKL+SVR
Sbjct  354  GSLCGPIIDDVKLLSVR  370



>gb|ABF99456.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAH00287.1| unnamed protein product [Oryza sativa Japonica Group]
Length=295

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAV++IDA HFSVP G+ AVELVAG+ESA+ Q+ RTVA + Y+L+F+VGDA 
Sbjct  158  PGWIIESLKAVRFIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVANRAYNLSFVVGDAK  217

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  T KVP+ES G GG+KPA  RF A   RTRV F+S+YYHT+  D 
Sbjct  218  NGCHGSMLVEAFAGNVTQKVPFESVGNGGFKPASFRFVAAGVRTRVTFYSSYYHTKVSDG  277

Query  302  VSLCGPVVDFVKL  264
            VSLCGPV+D VK+
Sbjct  278  VSLCGPVLDQVKV  290



>ref|XP_011466738.1| PREDICTED: uncharacterized protein LOC101306247 isoform X2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466739.1| PREDICTED: uncharacterized protein LOC101306247 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=333

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYID++HF+VP GRRA+EL+AGKESA+ Q+  T  G+ Y LTF VGD +
Sbjct  192  PGWIIESLKAVKYIDSKHFAVPEGRRAIELIAGKESALAQVVFTKPGRRYTLTFSVGDGN  251

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGS+ +EAFAG  T+KVPYESKG+GG+K A+L F A + RTRVMF ST Y   SD  
Sbjct  252  NGCEGSLFIEAFAGKETVKVPYESKGKGGFKKARLFFTAVSPRTRVMFLSTMYTMTSDHS  311

Query  302  VSLCGPVVDFVKLVSVRNPHR  240
             SLCGPV+D VKL+S+R   R
Sbjct  312  GSLCGPVIDDVKLLSIRGRPR  332



>ref|XP_009333642.1| PREDICTED: uncharacterized protein LOC103926567 [Pyrus x bretschneideri]
Length=373

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYID++HFSVP GRRA+ELVAGKESA+ Q+  T+ GK Y LTF VGD++
Sbjct  234  PGWIIESLKAVKYIDSKHFSVPEGRRAIELVAGKESALAQVVFTLPGKLYALTFTVGDSN  293

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGS+ +EAFAG  TLKV Y+SKGQGG+K A+  F A   RTRVMF+S +Y   +D  
Sbjct  294  NACEGSLAVEAFAGKDTLKVLYQSKGQGGFKRARFLFTAVGPRTRVMFYSMFYTMAADHS  353

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D VKL+SVR
Sbjct  354  GSLCGPVIDDVKLLSVR  370



>gb|KHG21630.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=374

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 110/140 (79%), Gaps = 0/140 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKA+K+ID+EHFSVP G+RA+EL+AGKES V QI +T  G+ Y L+F+VGDA+
Sbjct  233  PGWIIESLKAIKHIDSEHFSVPQGKRAIELIAGKESTVVQIVKTSIGRNYLLSFVVGDAN  292

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEG M++EAFAG + + V Y SKG+GG+K A+L FRA + RTR+ F+ST Y  +SD+ 
Sbjct  293  NGCEGPMMVEAFAGKNMVMVSYNSKGKGGFKAARLAFRAESTRTRITFYSTIYTIKSDNS  352

Query  302  VSLCGPVVDFVKLVSVRNPH  243
             SLCGPV+D VKL+SVR  H
Sbjct  353  GSLCGPVLDDVKLLSVRKLH  372



>gb|EEE56530.1| hypothetical protein OsJ_05823 [Oryza sativa Japonica Group]
Length=379

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 111/138 (80%), Gaps = 1/138 (1%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HF+VP GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F VGDAS
Sbjct  233  PGWMVESLKAVKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDAS  292

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDD  306
            N CEGS+V+EA+AG  + +V +ES G+GG  K A L FRA A RTRV+FFS++Y TRSDD
Sbjct  293  NGCEGSLVVEAYAGRESTRVAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDD  352

Query  305  FVSLCGPVVDFVKLVSVR  252
              SLCGPV+D V +VSVR
Sbjct  353  MSSLCGPVIDDVAVVSVR  370



>ref|XP_007217604.1| hypothetical protein PRUPE_ppa018156mg [Prunus persica]
 gb|EMJ18803.1| hypothetical protein PRUPE_ppa018156mg [Prunus persica]
Length=375

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYID+ HF+VP G+RA+ELVAGKESA+ Q+  T  G+ Y LTF VGD+ 
Sbjct  235  PGWIIESLKAVKYIDSTHFAVPEGQRAIELVAGKESALAQVVFTKPGRLYALTFSVGDSK  294

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGS+V+EAFAG  TLKVPYESKG+GG+K A+L F A    TRVMF ST+Y   +D  
Sbjct  295  NACEGSLVVEAFAGKDTLKVPYESKGKGGFKRARLLFTAVETHTRVMFLSTFYTMSADHS  354

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D VKL+SVR
Sbjct  355  GSLCGPVIDDVKLLSVR  371



>ref|NP_001046247.2| Os02g0205200 [Oryza sativa Japonica Group]
 dbj|BAF08161.2| Os02g0205200, partial [Oryza sativa Japonica Group]
Length=365

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 111/138 (80%), Gaps = 1/138 (1%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HF+VP GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F VGDAS
Sbjct  219  PGWMVESLKAVKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDAS  278

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDD  306
            N CEGS+V+EA+AG  + +V +ES G+GG  K A L FRA A RTRV+FFS++Y TRSDD
Sbjct  279  NGCEGSLVVEAYAGRESTRVAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDD  338

Query  305  FVSLCGPVVDFVKLVSVR  252
              SLCGPV+D V +VSVR
Sbjct  339  MSSLCGPVIDDVAVVSVR  356



>gb|EEC72709.1| hypothetical protein OsI_06304 [Oryza sativa Indica Group]
Length=379

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 111/138 (80%), Gaps = 1/138 (1%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKYID++HF+VP GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F VGDAS
Sbjct  233  PGWMVESLKAVKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDAS  292

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDD  306
            N CEGS+V+EA+AG  + +V +ES G+GG  K A L FRA A RTRV+FFS++Y TRSDD
Sbjct  293  NGCEGSLVVEAYAGRESTRVAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDD  352

Query  305  FVSLCGPVVDFVKLVSVR  252
              SLCGPV+D V +VSVR
Sbjct  353  MSSLCGPVIDDVAVVSVR  370



>ref|XP_002453515.1| hypothetical protein SORBIDRAFT_04g007160 [Sorghum bicolor]
 gb|EES06491.1| hypothetical protein SORBIDRAFT_04g007160 [Sorghum bicolor]
Length=364

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 110/141 (78%), Gaps = 0/141 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKA+KYID++ F+VP GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F VGDAS
Sbjct  223  PGWMVESLKAIKYIDSDSFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDAS  282

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GS+++EA+AG  + KV YES G+GG K A L FRA + RTR++FFS++Y TRSDD 
Sbjct  283  NACRGSLMVEAYAGRESTKVAYESAGKGGVKRAVLPFRAASARTRLVFFSSFYSTRSDDL  342

Query  302  VSLCGPVVDFVKLVSVRNPHR  240
             SLCGPV+D V +VSVR   R
Sbjct  343  SSLCGPVLDDVAVVSVRTTKR  363



>ref|XP_011466736.1| PREDICTED: uncharacterized protein LOC101306247 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=373

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYID++HF+VP GRRA+EL+AGKESA+ Q+  T  G+ Y LTF VGD +
Sbjct  232  PGWIIESLKAVKYIDSKHFAVPEGRRAIELIAGKESALAQVVFTKPGRRYTLTFSVGDGN  291

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGS+ +EAFAG  T+KVPYESKG+GG+K A+L F A + RTRVMF ST Y   SD  
Sbjct  292  NGCEGSLFIEAFAGKETVKVPYESKGKGGFKKARLFFTAVSPRTRVMFLSTMYTMTSDHS  351

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D VKL+S+R
Sbjct  352  GSLCGPVIDDVKLLSIR  368



>ref|XP_010257157.1| PREDICTED: uncharacterized protein LOC104597377 [Nelumbo nucifera]
Length=366

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+ID+ HF+VP+G +AVELVAG+ESA+ QI RTV  + Y ++F VGDA 
Sbjct  229  PGWIIESLKAVKFIDSAHFNVPYGFKAVELVAGRESAIAQIIRTVPNRLYGVSFTVGDAR  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFA   TLKVPYES G+GG+K A  +F+A   RTR+ F+S++YHTR DD+
Sbjct  289  NGCHGSMMVEAFAAKETLKVPYESHGKGGFKTASFKFKAIEPRTRITFYSSFYHTRVDDY  348

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGP++D V++V VR
Sbjct  349  GSLCGPILDQVRVVPVR  365



>ref|XP_010088264.1| hypothetical protein L484_005140 [Morus notabilis]
 gb|EXB33248.1| hypothetical protein L484_005140 [Morus notabilis]
Length=378

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 106/141 (75%), Gaps = 0/141 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W ++SLKAVKYID++HF VP G+RA+ELV GKES++ QI RT  GK Y LTF VGDA 
Sbjct  234  PGWIIDSLKAVKYIDSDHFHVPEGKRAIELVGGKESSIAQIVRTEPGKEYVLTFAVGDAK  293

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GS+ +EAFAG  T KV Y S G GG+K AKLRF+AT  RTRVMFFST+Y   SD+ 
Sbjct  294  NSCVGSLGIEAFAGNGTTKVVYVSTGSGGFKRAKLRFKATQWRTRVMFFSTFYTMTSDNS  353

Query  302  VSLCGPVVDFVKLVSVRNPHR  240
             +LCGP +D VKL+SVR P R
Sbjct  354  GTLCGPTLDDVKLISVRTPPR  374



>emb|CDO98109.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   182 bits (462),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKY+D+EHFSVP G+RAVEL+AG+ESA+ QI +T+ G +YDL F VGDA 
Sbjct  192  PGWIIESLKAVKYVDSEHFSVPEGKRAVELIAGRESAIAQIVKTIPGWWYDLVFSVGDAK  251

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGSM++EA AG  TL+VPY+S G+G +  A  RFRA + RTRV F S  YH RSD+ 
Sbjct  252  NGCEGSMLIEASAGKVTLQVPYQSSGKGKFIRATHRFRAVSRRTRVRFLSINYHMRSDNT  311

Query  302  VSLCGPVVDFVKLVSVR  252
             +LCGPV+D V+L S+R
Sbjct  312  GTLCGPVIDDVRLYSLR  328



>ref|XP_010539514.1| PREDICTED: uncharacterized protein LOC104813570 [Tarenaya hassleriana]
Length=365

 Score =   182 bits (463),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAVKY+D  HF+VP G RA+ELV GKES+V QI RT   KFY LTF VGDA 
Sbjct  225  PGWIVESLKAVKYVDKAHFAVPEGHRAIELVGGKESSVAQIVRTTPNKFYKLTFAVGDAG  284

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEG M +EAFAG   + V Y S G+GG KPA+L F+A + RTRV F ST+YHT+SD  
Sbjct  285  NSCEGPMAVEAFAGRGRISVDYVSSGKGGSKPARLMFKAISARTRVTFLSTFYHTKSDHS  344

Query  302  VSLCGPVVDFVKLVSVRN  249
             SLCGPV+D V+LV VR+
Sbjct  345  GSLCGPVIDDVRLVPVRS  362



>gb|EAY92272.1| hypothetical protein OsI_13995 [Oryza sativa Indica Group]
Length=363

 Score =   182 bits (462),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAV++IDA HFSVP G+ AVELVAG+ESA+ Q+ RTVA + Y+L+F+VGDA 
Sbjct  226  PGWIIESLKAVRFIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVANRAYNLSFVVGDAK  285

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  T KVP+ES G GG+KPA  RF A   RTRV F+S+YYHT+  D 
Sbjct  286  NGCHGSMLVEAFAGNVTQKVPFESVGNGGFKPASFRFVAAGVRTRVTFYSSYYHTKVSDG  345

Query  302  VSLCGPVVDFVKLVSVR  252
            VSLCGPV+D VK+  ++
Sbjct  346  VSLCGPVLDQVKVQPLK  362



>ref|XP_008245331.1| PREDICTED: uncharacterized protein LOC103343457 [Prunus mume]
Length=373

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 106/138 (77%), Gaps = 0/138 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLK VKYID +HFSVP G  A+ELVAG+ESA+ QI RT+  KFY+LTF +GDA 
Sbjct  235  PGWIIESLKPVKYIDKKHFSVPGGLAAIELVAGRESAIAQIIRTIPNKFYNLTFTIGDAK  294

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  TLKVPY S+G+GG+K A  +F+AT+ RTR+ F+S YYHT+  DF
Sbjct  295  NACHGSMMVEAFAGKETLKVPYTSQGKGGFKTASFKFQATSPRTRITFYSAYYHTKLHDF  354

Query  302  VSLCGPVVDFVKLVSVRN  249
              +CGPV+D V ++ V +
Sbjct  355  GHMCGPVLDNVIVLPVSS  372



>ref|XP_008231461.1| PREDICTED: uncharacterized protein LOC103330638 [Prunus mume]
Length=454

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+ID++HF+VP G+ AVELVAG+ESA+ Q+ RTV  K Y+L+F+VGDA 
Sbjct  318  PGWIIESLKAVKFIDSQHFNVPFGKGAVELVAGRESAIAQVLRTVPNKIYNLSFVVGDAR  377

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  TLKVP+ S+G+GG+K A L+F+A + RTR+ F+S++YHTR DD+
Sbjct  378  NGCHGSMMVEAFAGKDTLKVPFTSQGKGGFKAASLKFKAASPRTRITFYSSFYHTRVDDY  437

Query  302  VSLCGPVVDFVKLVSV  255
             +LCGP++D V++  V
Sbjct  438  GALCGPILDQVRVYPV  453



>ref|XP_003564086.1| PREDICTED: uncharacterized protein LOC100845370 [Brachypodium 
distachyon]
Length=393

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAV+YIDA HFSVP G  AVELVAG+ESA+ Q+ RTV  + Y+++F VGDA 
Sbjct  256  PGWIIESLKAVRYIDAAHFSVPSGNYAVELVAGRESAIAQVIRTVPNRAYNVSFAVGDAK  315

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  TLKVP+ES G+GG+K A LRF A   RTRV F+S+YYHT++ D 
Sbjct  316  NGCHGSMLVEAFAGNVTLKVPFESAGKGGFKTASLRFVAGGVRTRVTFYSSYYHTKATDG  375

Query  302  VSLCGPVVDFVKLVSVR  252
            VSLCGPV+D VK+  ++
Sbjct  376  VSLCGPVLDQVKIQPLK  392



>ref|NP_001051644.1| Os03g0807700 [Oryza sativa Japonica Group]
 gb|AAP21410.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF99455.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13558.1| Os03g0807700 [Oryza sativa Japonica Group]
 gb|EAZ28993.1| hypothetical protein OsJ_13041 [Oryza sativa Japonica Group]
 dbj|BAG86944.1| unnamed protein product [Oryza sativa Japonica Group]
Length=393

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAV++IDA HFSVP G+ AVELVAG+ESA+ Q+ RTVA + Y+L+F+VGDA 
Sbjct  256  PGWIIESLKAVRFIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVANRAYNLSFVVGDAK  315

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  T KVP+ES G GG+KPA  RF A   RTRV F+S+YYHT+  D 
Sbjct  316  NGCHGSMLVEAFAGNVTQKVPFESVGNGGFKPASFRFVAAGVRTRVTFYSSYYHTKVSDG  375

Query  302  VSLCGPVVDFVKLVSVR  252
            VSLCGPV+D VK+  ++
Sbjct  376  VSLCGPVLDQVKVQPLK  392



>ref|XP_008461812.1| PREDICTED: uncharacterized protein LOC103500323 [Cucumis melo]
Length=368

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+ID++HF+VP G  A+ELVAG+ESAV QI RT+  K Y L F VGDA 
Sbjct  232  PGWIIESLKAVKFIDSKHFNVPDGEAAIELVAGRESAVAQIIRTIPNKVYSLKFKVGDAK  291

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFA   T+KVP++S+G+G YK A L+F AT+ RTR+ FFS+YYHTR+DDF
Sbjct  292  NGCHGSMMVEAFAAKETVKVPFQSEGKGLYKDAILKFTATSPRTRITFFSSYYHTRTDDF  351

Query  302  VSLCGPVVDFVKL  264
             SLCGPV+D V +
Sbjct  352  GSLCGPVLDDVSV  364



>ref|XP_008228640.1| PREDICTED: uncharacterized protein LOC103328032 [Prunus mume]
Length=375

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYID+ HF+VP G+RA+ELVAGKESA+ Q+  T  G+ Y LTF VGD+ 
Sbjct  235  PGWIIESLKAVKYIDSNHFAVPEGQRAIELVAGKESALAQVVFTKPGRLYALTFSVGDSK  294

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGS+V+EAFAG  TLKVPYES G+GG+K A+L F A    TRVMF S++Y   +D  
Sbjct  295  NSCEGSLVVEAFAGKDTLKVPYESMGKGGFKRARLLFTAVETHTRVMFLSSFYTMSADHS  354

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D VKL+SVR
Sbjct  355  GSLCGPVIDDVKLLSVR  371



>ref|XP_007052493.1| F17A17.37 protein [Theobroma cacao]
 gb|EOX96650.1| F17A17.37 protein [Theobroma cacao]
Length=385

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 108/136 (79%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+ID++HF+VP G+ AVELVAG+ESA+ QI RTV  + YDLTF++GDA 
Sbjct  249  PGWIIESLKAVKFIDSKHFNVPAGKAAVELVAGRESAIAQILRTVPNQLYDLTFIIGDAR  308

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C G M++EAFA  +T+KVP+ S+G+G +K A L+F+A   RTR+ FFS+YYHTR +DF
Sbjct  309  NGCHGEMMVEAFADKNTVKVPFTSRGKGEFKTASLKFKAVTARTRITFFSSYYHTRINDF  368

Query  302  VSLCGPVVDFVKLVSV  255
             SLCGPV+D V++  V
Sbjct  369  GSLCGPVLDEVRVSPV  384



>ref|XP_004951511.1| PREDICTED: uncharacterized protein LOC101755979 [Setaria italica]
Length=374

 Score =   180 bits (457),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLKAV+Y+D   F+VP GRRAVEL+AG+E AV Q+ RTV G+ Y L+F VGDA 
Sbjct  234  PGWMVESLKAVRYVDGGSFAVPRGRRAVELLAGREGAVAQVVRTVPGRRYALSFTVGDAG  293

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GS+V+EA+AG  ++KV YES+G+GG + A L FRA A RTR++FFS++Y TRSDD 
Sbjct  294  NACRGSLVVEAYAGRESVKVAYESEGKGGARRAVLPFRAAAARTRIVFFSSFYSTRSDDL  353

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D V +VSVR
Sbjct  354  SSLCGPVLDDVAVVSVR  370



>ref|XP_007201993.1| hypothetical protein PRUPE_ppa024647mg [Prunus persica]
 gb|EMJ03192.1| hypothetical protein PRUPE_ppa024647mg [Prunus persica]
Length=384

 Score =   180 bits (457),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLK VKYID +HF VP G  A+ELVAG+ESA+ QI RT+  KFY+LTF +GDA 
Sbjct  246  PGWIIESLKPVKYIDKKHFQVPGGLAAIELVAGRESAIAQIIRTIPNKFYNLTFTIGDAK  305

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  TLKVPY S+G+GG+K A  +F+AT+ RTR+ F+S YYHT+  DF
Sbjct  306  NACHGSMMVEAFAGKETLKVPYMSQGKGGFKTASFKFQATSPRTRITFYSAYYHTKLHDF  365

Query  302  VSLCGPVVDFVKLVSVRN  249
              +CGPV+D V ++ V +
Sbjct  366  GHMCGPVLDNVIVLPVSS  383



>ref|XP_010057181.1| PREDICTED: uncharacterized protein LOC104445070 [Eucalyptus grandis]
 gb|KCW90190.1| hypothetical protein EUGRSUZ_A02362 [Eucalyptus grandis]
Length=370

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ES+K VKY+D +HF VP G  AVELVAG+ESA+ QI RTV  KFY+LTF VGDA 
Sbjct  234  PGWIIESMKPVKYVDRKHFFVPSGLAAVELVAGRESAMAQIIRTVPNKFYNLTFTVGDAK  293

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFA   TLKVPYES  +GG K A L+F+AT+ RTR+ FFS YYHT+  D+
Sbjct  294  NGCHGSMMVEAFAAKDTLKVPYESTSKGGSKTANLKFQATSTRTRITFFSAYYHTKLHDY  353

Query  302  VSLCGPVVDFVKLVSVR  252
              +CGPV+D VK+V V+
Sbjct  354  GHMCGPVLDDVKVVPVK  370



>gb|EMT25156.1| hypothetical protein F775_26385 [Aegilops tauschii]
Length=397

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAV+YIDA HFSVP G+ AVELVAG+ESA+ Q+ RTV  + Y+L+++VGDA 
Sbjct  260  PGWIIESLKAVRYIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVPNRAYNLSYVVGDAK  319

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFA   T KVP+ES G+GG+K A LRF A   RTRV F+S+YYHT+  D 
Sbjct  320  NGCHGSMLVEAFAANVTQKVPFESTGKGGFKAASLRFVAAGVRTRVTFYSSYYHTKVTDG  379

Query  302  VSLCGPVVDFVKLVSVR  252
            VSLCGPV+D VK+V ++
Sbjct  380  VSLCGPVLDQVKIVPMK  396



>ref|XP_002466246.1| hypothetical protein SORBIDRAFT_01g004270 [Sorghum bicolor]
 gb|EER93244.1| hypothetical protein SORBIDRAFT_01g004270 [Sorghum bicolor]
Length=386

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAV++IDA HFSVP G+ AVELVAG+ESA+ Q+ RTV  + Y+L+F VGDA 
Sbjct  249  PGWIIESLKAVRFIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVPNRAYNLSFAVGDAK  308

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  T KVP+ES G+GG+K A  RF A   RTR+ F+S+YYHT+  D 
Sbjct  309  NGCHGSMLVEAFAGNVTQKVPFESAGKGGFKAAAFRFVAAGARTRLTFYSSYYHTKVTDG  368

Query  302  VSLCGPVVDFVKLVSVR  252
            VSLCGPV+D VK+V V+
Sbjct  369  VSLCGPVLDQVKVVPVK  385



>dbj|BAJ89665.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=393

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAV+YIDA HFSVP G+ AVELVAG+ESA+ Q+ RTV  + Y+L+++VGDA 
Sbjct  256  PGWIIESLKAVRYIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVPNRAYNLSYVVGDAK  315

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFA   T KVP+ES G+GG+K + LRF A   RTRV F+S+YYHT+  D 
Sbjct  316  NGCHGSMLVEAFAANVTQKVPFESTGKGGFKASSLRFVAAGARTRVTFYSSYYHTKVTDG  375

Query  302  VSLCGPVVDFVKLVSVR  252
            VSLCGPV+D VK+V ++
Sbjct  376  VSLCGPVLDQVKIVPLK  392



>gb|KJB24990.1| hypothetical protein B456_004G171200 [Gossypium raimondii]
Length=385

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+IDA+HF+VP G  AVELVAG+ESA+ QI RT+  K Y++TF++GDA 
Sbjct  249  PGWIIESLKAVKFIDAKHFNVPAGHSAVELVAGRESAIAQILRTIPNKSYNMTFIIGDAR  308

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C G M++EAFA   T+KVP+ S+G+G +K A L F+A   RTRV F+S+YYHTRSDDF
Sbjct  309  NGCNGEMMVEAFAAKHTVKVPFTSRGKGEFKAASLMFKADTARTRVTFYSSYYHTRSDDF  368

Query  302  VSLCGPVVDFVKLVSV  255
             SLCGPV+D V++  +
Sbjct  369  GSLCGPVLDEVRVYPI  384



>emb|CDO98108.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 106/139 (76%), Gaps = 2/139 (1%)
 Frame = -2

Query  659  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASN  480
             W VESLKAV+YID++HF+VP G+RAVELVAG+ES+V Q+ +TV GK YDL F VGDA N
Sbjct  231  GWMVESLKAVRYIDSDHFAVPEGKRAVELVAGRESSVAQVVKTVPGKDYDLEFYVGDARN  290

Query  479  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  300
             CEGSM++E  A  ST  VPYESKG+GG K A LRF+A   RTR+ F S+YYH +SD   
Sbjct  291  MCEGSMLVEVNASNSTFYVPYESKGKGGSKLALLRFKAETGRTRIRFLSSYYHMKSDFSG  350

Query  299  SLCGPVVDFVKLVSVRNPH  243
            SLCGPVVD V+L  VR PH
Sbjct  351  SLCGPVVDGVRL--VRVPH  367



>ref|XP_006845336.1| hypothetical protein AMTR_s00141p00085330 [Amborella trichopoda]
 gb|ERN07011.1| hypothetical protein AMTR_s00141p00085330 [Amborella trichopoda]
Length=369

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ES+KAV+Y+D+ HF+VP G  AVELVAG+ESA+ Q+ RTV  K Y L+F+VGDA 
Sbjct  234  PGWIIESIKAVRYLDSHHFTVPLGAAAVELVAGRESAIAQLIRTVPKKVYTLSFIVGDAK  293

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  T+KVP+ES+GQGGYK  K+RF A   RTR+ FFS++YHT+ DD 
Sbjct  294  NGCHGSMLVEAFAGKDTVKVPFESRGQGGYKVGKMRFMALEPRTRITFFSSFYHTKVDDP  353

Query  302  VSLCGPVVDFVKL  264
             ++CGP+VD VK+
Sbjct  354  GTMCGPIVDEVKV  366



>ref|XP_008375195.1| PREDICTED: uncharacterized protein LOC103438421 [Malus domestica]
Length=367

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 107/136 (79%), Gaps = 2/136 (1%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+ID+ HF+VP G+ AVELVAG+ESA+ QI RTV  K Y L+F VGDA 
Sbjct  233  PGWIIESLKAVKFIDSNHFNVPVGKGAVELVAGRESAIAQIIRTVPNKLYSLSFTVGDAR  292

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSM++EAFAG  TLKVP+ SKG+GG+K A  RF+A + RTR+ FFS+YYHT+  D+
Sbjct  293  NGCQGSMMVEAFAGKDTLKVPFASKGKGGFKKASFRFKAVSIRTRITFFSSYYHTK--DY  350

Query  302  VSLCGPVVDFVKLVSV  255
             +LCGP++D VK+  V
Sbjct  351  GALCGPILDEVKVSPV  366



>gb|KFK42429.1| hypothetical protein AALP_AA2G255100 [Arabis alpina]
Length=368

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKY+D  HF+VP G RA+ELVAGKESA++QI RT   +FY LTF VGDA 
Sbjct  229  PGWIIESLKAVKYVDKAHFAVPEGHRAIELVAGKESAISQIVRTSLNQFYALTFNVGDAR  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            + CEG M++EAFAG S + V Y SKG+GG+   KL F+A + RTRV F ST+YH +SD  
Sbjct  289  DTCEGPMIVEAFAGRSKIMVDYVSKGKGGFTQGKLVFKAVSTRTRVTFLSTFYHMKSDHS  348

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D V+LV++R
Sbjct  349  GSLCGPVIDDVRLVAIR  365



>gb|KJB24991.1| hypothetical protein B456_004G171200 [Gossypium raimondii]
Length=414

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+IDA+HF+VP G  AVELVAG+ESA+ QI RT+  K Y++TF++GDA 
Sbjct  278  PGWIIESLKAVKFIDAKHFNVPAGHSAVELVAGRESAIAQILRTIPNKSYNMTFIIGDAR  337

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C G M++EAFA   T+KVP+ S+G+G +K A L F+A   RTRV F+S+YYHTRSDDF
Sbjct  338  NGCNGEMMVEAFAAKHTVKVPFTSRGKGEFKAASLMFKADTARTRVTFYSSYYHTRSDDF  397

Query  302  VSLCGPVVDFVKLVSV  255
             SLCGPV+D V++  +
Sbjct  398  GSLCGPVLDEVRVYPI  413



>ref|XP_002517797.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44604.1| conserved hypothetical protein [Ricinus communis]
Length=365

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+ID++HF+VP G  AVELVAG+ESA+ QI RT+  K YDLTF VGDA 
Sbjct  229  PGWIIESLKAVKFIDSKHFNVPFGLAAVELVAGRESAIAQILRTIPNKVYDLTFSVGDAK  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFA   T KVP+ES+G+G +K     F+A + RTR+ F+S+YYHTR DDF
Sbjct  289  NGCHGSMMVEAFAAKDTFKVPFESQGKGKFKTVSFNFKAVSARTRITFYSSYYHTRIDDF  348

Query  302  VSLCGPVVDFVKL  264
             SLCGPV+D V++
Sbjct  349  GSLCGPVLDQVRV  361



>gb|KHG12815.1| DNA-directed RNA polymerase subunit beta'' [Gossypium arboreum]
Length=385

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+IDA+HF+VP G  AVELVAG+ESA+ QI RT+  K Y++TF++GDA 
Sbjct  249  PGWIIESLKAVKFIDAKHFNVPAGHSAVELVAGRESAIAQILRTIPNKSYNMTFVIGDAR  308

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C G M++EAFA   T+KVP+ S+G+G +K A L F+A   RTR+ F+S+YYHTRSDDF
Sbjct  309  NGCNGEMMVEAFAAKHTVKVPFTSRGKGEFKAASLMFKADTARTRITFYSSYYHTRSDDF  368

Query  302  VSLCGPVVDFVKLVSV  255
             SLCGPV+D V++  +
Sbjct  369  GSLCGPVLDEVRVYPI  384



>ref|XP_010067858.1| PREDICTED: uncharacterized protein LOC104454644 [Eucalyptus grandis]
 gb|KCW66091.1| hypothetical protein EUGRSUZ_G03366 [Eucalyptus grandis]
Length=369

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 108/136 (79%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+ID +HF+VP G  AVELVAG+ESA+ Q+ RT+  K Y+LTF VGDA 
Sbjct  231  PGWIIESLKAVKFIDKKHFNVPFGLAAVELVAGRESAIAQMIRTLPSKCYNLTFAVGDAR  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFA   TLKVP++S+G+G +K A L+F+A + RTR+ FFS++YHTR DDF
Sbjct  291  NGCHGSMMVEAFAAKDTLKVPFQSQGKGRFKTASLKFKALSARTRLTFFSSFYHTRIDDF  350

Query  302  VSLCGPVVDFVKLVSV  255
             SLCGPV+D V++V +
Sbjct  351  GSLCGPVLDEVRVVPL  366



>ref|XP_011016219.1| PREDICTED: uncharacterized protein LOC105119742 [Populus euphratica]
Length=369

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLK VKYID++HF VP G  A+E+VAG+ESA+ QI RT+  KFY+L+F +GDA 
Sbjct  233  PGWIIESLKPVKYIDSKHFFVPTGFAAIEMVAGRESAIAQIIRTIPNKFYNLSFTIGDAK  292

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  TLKVPY S+G+GGYK A LRF+A ++RTR+ F+S YYHT+  D+
Sbjct  293  NACHGSMMVEAFAGRETLKVPYVSRGKGGYKTATLRFKAISSRTRITFYSGYYHTKLHDY  352

Query  302  VSLCGPVVDFVKL  264
              +CGPV+D V++
Sbjct  353  GHMCGPVLDDVRV  365



>ref|XP_008362680.1| PREDICTED: uncharacterized protein LOC103426358 [Malus domestica]
Length=361

 Score =   177 bits (450),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 106/137 (77%), Gaps = 1/137 (1%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYID++HFSVP G RA+ELV GKESA+ Q+  T+ GK Y LTF VGD++
Sbjct  223  PGWIIESLKAVKYIDSKHFSVPEGWRAIELV-GKESALAQVVFTLPGKLYALTFTVGDSN  281

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N CEGS+V+EAFAG   LKVPY+SKG+GG+K  +  F A   RTR+MF+ST+Y   +D  
Sbjct  282  NACEGSLVVEAFAGKDILKVPYQSKGRGGFKRXRFLFTAVGPRTRIMFYSTFYTMAADHS  341

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D VKL+SVR
Sbjct  342  GSLCGPVIDDVKLLSVR  358



>ref|XP_009354784.1| PREDICTED: uncharacterized protein LOC103945912 [Pyrus x bretschneideri]
 ref|XP_009354785.1| PREDICTED: uncharacterized protein LOC103945913 [Pyrus x bretschneideri]
Length=367

 Score =   177 bits (450),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 107/136 (79%), Gaps = 2/136 (1%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+ID+ HF+VP G+ AVELVAG+ESA+ QI RTV  K Y L+F VGDA 
Sbjct  233  PGWIIESLKAVKFIDSNHFNVPVGKGAVELVAGRESAIAQIIRTVPNKLYSLSFTVGDAR  292

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSM++EAFAG  TLKVP+ SKG+GG+K A  RF+A + RTR+ FFS++YHT+  D+
Sbjct  293  NGCQGSMMVEAFAGKETLKVPFASKGKGGFKKASFRFKAVSIRTRITFFSSFYHTK--DY  350

Query  302  VSLCGPVVDFVKLVSV  255
             +LCGP++D VK+  V
Sbjct  351  GALCGPILDEVKVSPV  366



>ref|XP_008363312.1| PREDICTED: uncharacterized protein LOC103427013 [Malus domestica]
Length=367

 Score =   177 bits (449),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 107/136 (79%), Gaps = 2/136 (1%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKA+K+IDA+HF+VP G+ AVELVAG+ESA+ Q+ RTV  K Y L+F VGDA 
Sbjct  233  PGWIIESLKAIKFIDAKHFNVPFGKGAVELVAGRESAIAQVLRTVPNKLYSLSFTVGDAR  292

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  TLKVP+ SKG+GG+K A  RF+A + RTR+ FFS++YHT+  D+
Sbjct  293  NGCHGSMMVEAFAGKETLKVPFTSKGKGGFKTASFRFKAVSIRTRITFFSSFYHTK--DY  350

Query  302  VSLCGPVVDFVKLVSV  255
             +LCGP++D VK+  V
Sbjct  351  GALCGPILDEVKVSPV  366



>ref|XP_006411450.1| hypothetical protein EUTSA_v10016825mg [Eutrema salsugineum]
 gb|ESQ52903.1| hypothetical protein EUTSA_v10016825mg [Eutrema salsugineum]
Length=370

 Score =   177 bits (449),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLK VKYID  HF+VP G  A+E++AG+ESA+ QI RTVAGK+Y L+F+VGDA 
Sbjct  234  PGWIVESLKPVKYIDNGHFNVPSGHAAIEIIAGRESAIAQIIRTVAGKYYILSFVVGDAH  293

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG ST K+ +ES G+G  K  + RFRA +NRTR+ F+S +YHT+  DF
Sbjct  294  NGCHGSMMVEAFAGRSTFKLRFESNGKGAVKVGRFRFRADSNRTRITFYSGFYHTKLHDF  353

Query  302  VSLCGPVVDFVKLVSVR  252
              LCGPV+D V++V  R
Sbjct  354  GHLCGPVLDNVRVVMTR  370



>ref|NP_001144239.1| uncharacterized protein LOC100277106 precursor [Zea mays]
 gb|ACG38935.1| hypothetical protein [Zea mays]
Length=390

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAV++IDA HFSVP G+ AVELVAG+ESA+ Q+ RTV  + Y+L+F VGDA 
Sbjct  253  PGWIIESLKAVRFIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVPNRAYNLSFAVGDAR  312

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  T KVP++S G+GG+K A  RF A+  RTR+ F+S+YYHT+  D 
Sbjct  313  NGCHGSMLVEAFAGNVTQKVPFDSTGKGGFKTAAFRFVASGVRTRLTFYSSYYHTKVTDG  372

Query  302  VSLCGPVVDFVKLVSVR  252
            VSLCGPV+D VK+V V+
Sbjct  373  VSLCGPVLDQVKVVPVK  389



>gb|KDP43556.1| hypothetical protein JCGZ_16843 [Jatropha curcas]
Length=365

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+ID++HF+VP G  AVELVAG+ESA+ QI RT+  K Y LTF VGDA 
Sbjct  229  PGWIIESLKAVKFIDSKHFNVPFGLAAVELVAGRESAIAQILRTIPNKVYGLTFSVGDAK  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFA   T KVP+ES+G+G +K    +F+A + RTR+ F+S+YYHTR DDF
Sbjct  289  NGCHGSMMVEAFAAKDTFKVPFESQGKGKFKTVSFKFKAVSARTRITFYSSYYHTRIDDF  348

Query  302  VSLCGPVVDFVKLVSV  255
             SLCGPV+D V++  +
Sbjct  349  GSLCGPVLDQVRVFPI  364



>gb|KJB19256.1| hypothetical protein B456_003G091800 [Gossypium raimondii]
Length=307

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = -2

Query  659  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASN  480
             W +ESLK VKYID +HFSVP G  AVELVAG+ESA+ QI RTV  KFY LTF VGDA N
Sbjct  172  GWIIESLKPVKYIDKKHFSVPSGLFAVELVAGRESAIAQIIRTVPNKFYTLTFTVGDAKN  231

Query  479  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  300
             C GSM+++AFAG  TL+VPY S+G+GG K A  RF+A + RTR+ FFS YYHT+ DD+ 
Sbjct  232  GCHGSMMVQAFAGKETLQVPYVSQGKGGLKTASFRFQAISARTRITFFSAYYHTKLDDYG  291

Query  299  SLCGPVVDFV  270
             +CGPV+D V
Sbjct  292  HICGPVLDDV  301



>ref|XP_006465391.1| PREDICTED: uncharacterized protein LOC102618171 [Citrus sinensis]
Length=374

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYID +HFSVP GRRAVELVAGKESA+TQ+ +T   K Y L+F VGDA 
Sbjct  231  PGWIIESLKAVKYIDLKHFSVPEGRRAVELVAGKESALTQVVKTEVNKTYALSFAVGDAG  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C G++ +EA+AG   +KV Y SKG+GG+K A LRF+A + RTR+MF ST+Y+ +SD  
Sbjct  291  NGCAGTLGVEAYAGRDNVKVTYASKGKGGFKKALLRFKAVSPRTRIMFLSTFYNMQSDSS  350

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D VKL+  R
Sbjct  351  GSLCGPVIDDVKLLVAR  367



>gb|AFK44456.1| unknown [Lotus japonicus]
Length=177

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+IDA+HF+VP G  AVELVAG+ESA+ QI RT A K Y++TF VGDA 
Sbjct  41   PGWIIESLKAVKFIDAKHFNVPFGLGAVELVAGRESAIAQIIRTEANKVYNITFSVGDAK  100

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFA   T KVP++S G+G +      F+A A RTR+ F+S+YYHTR+DDF
Sbjct  101  NGCHGSMMVEAFAAKDTFKVPFKSVGKGKFVTVSFEFKAIAPRTRLTFYSSYYHTRTDDF  160

Query  302  VSLCGPVVDFVKLVSV  255
             SLCGPV+D V +  V
Sbjct  161  GSLCGPVLDRVIVFPV  176



>gb|KDP26060.1| hypothetical protein JCGZ_21093 [Jatropha curcas]
Length=370

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLK VKYID +HFSVP G  A+ELVAG+ESA+ Q+ RTVA KFY+LTF +GDA 
Sbjct  233  PGWIIESLKPVKYIDNKHFSVPSGFAAIELVAGRESALAQVIRTVANKFYNLTFTIGDAK  292

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSMV+EAFA   TLKVP+ES+ +G +K A  +F+A +NRTR+ F+S  YHT+  DF
Sbjct  293  NGCHGSMVVEAFAAKETLKVPFESQSKGEFKTASFKFQAISNRTRITFYSANYHTKLHDF  352

Query  302  VSLCGPVVDFVKLVSVR  252
              +CGP++D V +  +R
Sbjct  353  GHMCGPILDNVSVFPIR  369



>ref|XP_004981346.1| PREDICTED: uncharacterized protein LOC101768647 [Setaria italica]
Length=389

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAV++IDA HFSVP G+ AVELVAG+ESA+ Q+ RTV  + Y+L+F VGDA 
Sbjct  250  PGWIIESLKAVRFIDAAHFSVPEGQYAVELVAGRESAIAQVIRTVPNRAYNLSFAVGDAK  309

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  T KVP+ES G+G +K A  RF A+  RTR+ F+S+YYHT++ D 
Sbjct  310  NGCHGSMLVEAFAGNVTQKVPFESAGKGAFKAAGFRFVASGVRTRLTFYSSYYHTKASDG  369

Query  302  VSLCGPVVDFVKLVSV  255
            VSLCGPV+D VK+V +
Sbjct  370  VSLCGPVLDQVKVVPL  385



>tpg|DAA52069.1| TPA: hypothetical protein ZEAMMB73_133538 [Zea mays]
Length=390

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAV++IDA HFSVP G+ AVELVAG+ESA+ Q+ RTV  + Y+L+F VGDA 
Sbjct  253  PGWIIESLKAVRFIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVPNRAYNLSFAVGDAR  312

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  T KVP++S G+GG+K A  RF A   RTR+ F+S+YYHT+  D 
Sbjct  313  NGCHGSMLVEAFAGNVTQKVPFDSAGKGGFKTAAFRFVAGGVRTRLTFYSSYYHTKVTDG  372

Query  302  VSLCGPVVDFVKLVSVR  252
            VSLCGPV+D VK+V V+
Sbjct  373  VSLCGPVLDQVKVVPVK  389



>ref|XP_002299934.2| hypothetical protein POPTR_0001s27110g [Populus trichocarpa]
 gb|ABK94155.1| unknown [Populus trichocarpa]
 gb|EEE84739.2| hypothetical protein POPTR_0001s27110g [Populus trichocarpa]
Length=365

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+ID +HF+VP G  AVELVAG+ESA+ QI RT+  K Y LTF VGDA 
Sbjct  229  PGWMIESLKAVKFIDKKHFNVPFGLAAVELVAGRESAIAQILRTIPDKVYGLTFTVGDAR  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFA   T KVP+ESKG+G +K    +F+A   RTR+ F+S+YYHTR DDF
Sbjct  289  NGCHGSMMVEAFAAKDTFKVPFESKGKGEFKTVSFKFKAVTARTRITFYSSYYHTRIDDF  348

Query  302  VSLCGPVVDFVKLVSV  255
             SLCGP++D V++  +
Sbjct  349  GSLCGPILDEVRVFPI  364



>gb|KJB36028.1| hypothetical protein B456_006G137000 [Gossypium raimondii]
 gb|KJB36029.1| hypothetical protein B456_006G137000 [Gossypium raimondii]
 gb|KJB36030.1| hypothetical protein B456_006G137000 [Gossypium raimondii]
Length=371

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLK VK+ID +HFSVP G+ A+E+VAG+ESA+ Q+ RTV  K Y LTF VGDA 
Sbjct  235  PGWIIESLKPVKFIDKKHFSVPSGQFAIEMVAGRESAIAQVIRTVPNKDYTLTFTVGDAK  294

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  TLKVPY S+G+GG+K +  RF+A + RTR+ F+S YYHT+  DF
Sbjct  295  NDCHGSMMVEAFAGKGTLKVPYVSQGKGGFKTSSFRFQAISARTRITFYSAYYHTKLHDF  354

Query  302  VSLCGPVVDFVKLVSV  255
              +CGPV+D VK++ V
Sbjct  355  GHMCGPVLDDVKVLPV  370



>gb|KJB19257.1| hypothetical protein B456_003G091800 [Gossypium raimondii]
Length=341

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = -2

Query  659  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASN  480
             W +ESLK VKYID +HFSVP G  AVELVAG+ESA+ QI RTV  KFY LTF VGDA N
Sbjct  206  GWIIESLKPVKYIDKKHFSVPSGLFAVELVAGRESAIAQIIRTVPNKFYTLTFTVGDAKN  265

Query  479  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  300
             C GSM+++AFAG  TL+VPY S+G+GG K A  RF+A + RTR+ FFS YYHT+ DD+ 
Sbjct  266  GCHGSMMVQAFAGKETLQVPYVSQGKGGLKTASFRFQAISARTRITFFSAYYHTKLDDYG  325

Query  299  SLCGPVVDFV  270
             +CGPV+D V
Sbjct  326  HICGPVLDDV  335



>ref|XP_011048055.1| PREDICTED: uncharacterized protein LOC105142230 [Populus euphratica]
Length=365

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 102/133 (77%), Gaps = 0/133 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLK VKYID++HF VP G  A+ELVAG+ESAV QI RT+  KFY+LTF VGDA 
Sbjct  229  PGWIIESLKPVKYIDSKHFFVPEGFAAIELVAGRESAVAQIIRTIPDKFYNLTFTVGDAK  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFA   T+KVPY S+G+GGYK A LRF+A + RTR+ F+S YYHT+  D+
Sbjct  289  NACHGSMMVEAFAAKETVKVPYVSQGKGGYKTAILRFQAISARTRITFYSAYYHTKLHDY  348

Query  302  VSLCGPVVDFVKL  264
              +CGPV+D V +
Sbjct  349  GHMCGPVLDDVSV  361



>emb|CDP07813.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+IDA HF+VP GR A+EL+ G+ES + QI RTV  K Y+LTF VGD  
Sbjct  240  PGWIIESLKAVKFIDAMHFNVPSGRAAIELLGGRESVIAQIIRTVPNKEYNLTFSVGDGK  299

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFA  STLKVP++S G+G YK    +F A + RTR+ FFS++YHT+ DD+
Sbjct  300  NGCHGSMMVEAFAAKSTLKVPFQSVGKGQYKTVSFKFTAISARTRLTFFSSFYHTKIDDY  359

Query  302  VSLCGPVVDFVKLVSVR  252
             +LCGPV+D VK+V+ R
Sbjct  360  GALCGPVLDNVKVVTAR  376



>ref|XP_002308027.2| hypothetical protein POPTR_0006s04880g [Populus trichocarpa]
 gb|EEE91550.2| hypothetical protein POPTR_0006s04880g [Populus trichocarpa]
Length=369

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 102/133 (77%), Gaps = 0/133 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLK VKYID +HF VP G  A+E+VAG+ESA+ Q+ RT+  KFY+LTF +GDA 
Sbjct  233  PGWIIESLKPVKYIDNKHFFVPTGFAAIEMVAGRESAIAQVIRTIPDKFYNLTFTIGDAK  292

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFA   TLKVPY S+G+GGYK A LRFRA + RTR+ F+S YYHT+  D+
Sbjct  293  NACHGSMMVEAFAARETLKVPYVSQGKGGYKTATLRFRAISARTRITFYSAYYHTKLHDY  352

Query  302  VSLCGPVVDFVKL  264
              +CGPV+D V++
Sbjct  353  GHMCGPVLDDVRV  365



>ref|XP_011047367.1| PREDICTED: uncharacterized protein LOC105141733 [Populus euphratica]
Length=365

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+ID +HF+VP G  AVELVAG+ESA+ QI RT+  K Y LTF +GDA 
Sbjct  229  PGWMIESLKAVKFIDKKHFNVPFGLAAVELVAGRESAIAQILRTIPDKVYGLTFTIGDAR  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFA   T KVP+ESKG+G +K    +F+A   RTR+ F+S+YYHTR DDF
Sbjct  289  NGCHGSMMVEAFAAKDTFKVPFESKGKGEFKTVSFKFKAVTARTRITFYSSYYHTRIDDF  348

Query  302  VSLCGPVVDFVKLVSV  255
             SLCGP++D V++  +
Sbjct  349  GSLCGPILDEVRVFPI  364



>ref|XP_011013325.1| PREDICTED: uncharacterized protein LOC105117377 [Populus euphratica]
Length=365

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+ID +HF+VP G  AVELVAG+ESA+ QI RT+  K Y LTF +GDA 
Sbjct  229  PGWMIESLKAVKFIDKKHFNVPFGLAAVELVAGRESAIAQILRTIPDKVYGLTFTIGDAR  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFA   T KVP+ESKG+G +K    +F+A   RTR+ F+S+YYHTR DDF
Sbjct  289  NGCHGSMMVEAFAAKDTFKVPFESKGKGEFKTVSFKFKAVTARTRITFYSSYYHTRIDDF  348

Query  302  VSLCGPVVDFVKLVSV  255
             SLCGP++D V++  +
Sbjct  349  GSLCGPILDEVRVFPI  364



>gb|KHG07966.1| Imidazolonepropionase [Gossypium arboreum]
Length=371

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLK VK+ID +HFSVP G+ A+E+VAG+ESA+ Q+ RT   K Y LTF VGDA 
Sbjct  235  PGWIIESLKPVKFIDKKHFSVPSGQFAIEMVAGRESAIAQVIRTAPNKDYTLTFTVGDAK  294

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  TLKVPY S+G+GG+K A  RF+A + RTR+ F+S YYHT+  DF
Sbjct  295  NDCHGSMMVEAFAGKGTLKVPYVSQGKGGFKTASFRFQAISARTRITFYSAYYHTKLHDF  354

Query  302  VSLCGPVVDFVKLVSV  255
              +CGPV+D VK++ V
Sbjct  355  GHMCGPVLDDVKVLPV  370



>ref|XP_002276894.1| PREDICTED: uncharacterized protein LOC100258445 [Vitis vinifera]
Length=368

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 104/139 (75%), Gaps = 0/139 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+ID +HF+VP G  AVEL+AG+ESA+ Q+ RTV  K Y+LTF +GD  
Sbjct  230  PGWIIESLKAVKFIDKKHFNVPFGLAAVELLAGRESAIAQVLRTVPNKLYNLTFSIGDGK  289

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C G M++EAFA   + K P++S+G+G +K    +F+A A RTR+ FFS++YHTR DDF
Sbjct  290  NGCHGDMMIEAFAAKDSFKAPFKSRGKGEFKTVSFKFKAIAARTRLTFFSSFYHTRIDDF  349

Query  302  VSLCGPVVDFVKLVSVRNP  246
             SLCGPV+D V++ S+R P
Sbjct  350  GSLCGPVLDQVRVFSIRKP  368


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 63/149 (42%), Gaps = 25/149 (17%)
 Frame = -2

Query  662  PAWTVESLKAVKYI------DAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTF  501
            P W +    +V+YI          F+V HG  AV L  G E++++Q      G  Y LTF
Sbjct  56   PKWEING--SVEYIAGGPQPGGMFFAVAHGVHAVRL--GNEASISQTIPVKPGSLYALTF  111

Query  500  LVGDASNKCEGSMVLEAFAGPSTLKVP----YESKGQGGYKPAKLRFRATANRTRVMFFS  333
                AS  C    VL     P T  +P    Y+S G   Y      FRAT+N  +V F +
Sbjct  112  ---GASRTCAQDEVLRVSVPPQTGDLPLQTLYDSFGGDVYA---WGFRATSNEAKVTFHN  165

Query  332  TYYHTRSDDFVSLCGPVVDFVKLVSVRNP  246
            T            CGP++D V +  +  P
Sbjct  166  TGVQED-----PACGPLLDAVAIKELFPP  189



>ref|XP_006826721.1| hypothetical protein AMTR_s00264p00012960 [Amborella trichopoda]
 gb|ERM93958.1| hypothetical protein AMTR_s00264p00012960 [Amborella trichopoda]
Length=372

 Score =   175 bits (444),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P WT+ SLK+V+YID+ HFSVP GR+AVEL+AGKES ++Q A TV   +Y LTFLVGDA+
Sbjct  231  PGWTILSLKSVRYIDSPHFSVPEGRKAVELLAGKESIISQTATTVPKAYYVLTFLVGDAN  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSM +EA+AG  +LKV YESKG GG+K AKL F A    TR +F+ST+Y TR+DD 
Sbjct  291  NTCKGSMAVEAYAGRGSLKVDYESKGLGGFKRAKLVFVALEKVTRFVFYSTFYMTRTDDL  350

Query  302  VSLCGPVVDFVKLV  261
             SLCGPV+D V+LV
Sbjct  351  SSLCGPVIDDVRLV  364



>ref|XP_002887838.1| hypothetical protein ARALYDRAFT_340195 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64097.1| hypothetical protein ARALYDRAFT_340195 [Arabidopsis lyrata subsp. 
lyrata]
Length=371

 Score =   175 bits (443),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 102/137 (74%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKY+D  HF+VP G RA+ELV GKESA++QI RT   KFY LTF VGDA 
Sbjct  231  PGWMIESLKAVKYVDKAHFAVPEGHRAIELVGGKESAISQIVRTSLNKFYALTFSVGDAR  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            + CEG M +EAFAG   + V Y SKG+GG++  +L F+A + RTRV F ST+YH +SD  
Sbjct  291  DGCEGPMTVEAFAGQGKVMVDYASKGKGGFRRGRLVFKAVSARTRVTFLSTFYHMKSDHS  350

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D V+LV+VR
Sbjct  351  GSLCGPVIDDVRLVAVR  367



>ref|XP_010695068.1| PREDICTED: uncharacterized protein LOC104907775 [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYID  HF+VP GR A+ELVAG+ESA+ Q+ RTV  K Y+LTF +GDA 
Sbjct  232  PGWVIESLKAVKYIDKRHFNVPFGRSAIELVAGRESAIAQVIRTVPNKVYNLTFTIGDAK  291

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSM++EAFAG  TLK P+ S+G G ++   ++F+A ++RTR+ FFS+YYH+++D F
Sbjct  292  NSCKGSMLVEAFAGRDTLKAPFLSQGLGKFQTVSMKFKAISDRTRITFFSSYYHSKADGF  351

Query  302  VSLCGPVVDFVKL  264
              LCGPV+D V++
Sbjct  352  GILCGPVLDEVRV  364



>ref|XP_008364711.1| PREDICTED: uncharacterized protein LOC103428382 [Malus domestica]
Length=367

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 106/136 (78%), Gaps = 2/136 (1%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+ID+ HF+VP G+ AVELVAG+ESA+ QI RTV  K Y L+F VGDA 
Sbjct  233  PGWIIESLKAVKFIDSNHFNVPVGKGAVELVAGRESAIAQIIRTVPNKLYSLSFTVGDAR  292

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C+GSM++EAFAG  TLKVP+ SKG+ G+K A  RF+A + RTR+ FFS++YHT+  D+
Sbjct  293  NGCQGSMMVEAFAGKDTLKVPFASKGKCGFKKASFRFKAVSIRTRITFFSSFYHTK--DY  350

Query  302  VSLCGPVVDFVKLVSV  255
             +LCGP++D VK+  V
Sbjct  351  GALCGPILDEVKVSPV  366



>ref|NP_178141.1| protein DUF642 L-GALL RESPONSIVE GENE 1 [Arabidopsis thaliana]
 gb|AAD55477.1|AC009322_17 Unknown protein [Arabidopsis thaliana]
 gb|ACD85595.1| At1g80240 [Arabidopsis thaliana]
 gb|AEE36374.1| uncharacterized protein AT1G80240 [Arabidopsis thaliana]
Length=370

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKY+D  HF+VP G RA+ELV GKESA++QI RT   KFY LTF VGDA 
Sbjct  230  PGWMIESLKAVKYVDKAHFAVPEGHRAIELVGGKESAISQIVRTSLNKFYALTFNVGDAR  289

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            + CEG M++EAFAG   + V Y SKG+GG++  +L F+A + RTRV F ST+YH +SD  
Sbjct  290  DGCEGPMIVEAFAGQGKVMVDYASKGKGGFRRGRLVFKAVSARTRVTFLSTFYHMKSDHS  349

Query  302  VSLCGPVVDFVKLVSV  255
             SLCGPV+D V+LV+V
Sbjct  350  GSLCGPVIDDVRLVAV  365



>ref|XP_002308942.2| hypothetical protein POPTR_0006s04890g [Populus trichocarpa]
 gb|EEE92465.2| hypothetical protein POPTR_0006s04890g [Populus trichocarpa]
Length=373

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 101/133 (76%), Gaps = 0/133 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLK VKYID++HF VP G  A+ELVAG+ESA+ Q+ RT+  KFY+LTF VGDA 
Sbjct  237  PGWIIESLKPVKYIDSKHFFVPEGFAAIELVAGRESAIAQVIRTIPDKFYNLTFTVGDAK  296

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFA   T+KVPY S+G+GGYK A LRF+A + RTR+ F+S YYH +  D+
Sbjct  297  NACHGSMMVEAFAAKETVKVPYVSQGKGGYKTAILRFQAVSARTRITFYSAYYHNKQHDY  356

Query  302  VSLCGPVVDFVKL  264
              +CGPV+D V +
Sbjct  357  GHMCGPVLDDVSV  369



>ref|XP_008392232.1| PREDICTED: uncharacterized protein LOC103454416 [Malus domestica]
Length=366

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLK VKYID +HF+VP G  A+ELVAG+ESA+ QI RTV  K Y+L F +GDA 
Sbjct  230  PGWIIESLKPVKYIDRKHFAVPRGLAAIELVAGRESAIAQIIRTVPNKSYNLIFTIGDAK  289

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  TLKVP+ S G+GG+K A L+F+AT+ RTR+ F+S YYHT+ DD+
Sbjct  290  NGCHGSMMVEAFAGKETLKVPFVSAGKGGFKTAILKFQATSFRTRLTFYSAYYHTKLDDY  349

Query  302  VSLCGPVVDFVKLVSV  255
              +CGPV+D V +  V
Sbjct  350  GHMCGPVLDNVIVFPV  365



>ref|XP_003534397.1| PREDICTED: uncharacterized protein LOC100812299 [Glycine max]
Length=367

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+IDA+HF+VP G+ AVEL+AG+ES + QI RTV  K Y++ F +GDA 
Sbjct  231  PGWMIESLKAVKFIDAKHFNVPFGQGAVELIAGRESVIAQILRTVPNKIYNMKFTIGDAR  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFA   TLKVP++S+G+G +K    +FRA  NRTR+ F+S++YHTR  D+
Sbjct  291  NGCHGSMMIEAFAAKDTLKVPFKSEGKGEFKTVSFKFRAIENRTRITFYSSFYHTRIHDY  350

Query  302  VSLCGPVVDFVKLVSV  255
             SLCGPV+D V +  V
Sbjct  351  GSLCGPVIDQVIVYPV  366



>gb|KHN11697.1| hypothetical protein glysoja_006150 [Glycine soja]
Length=367

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVK+IDA+HF+VP G+ AVEL+AG+ES + QI RTV  K Y++ F +GDA 
Sbjct  231  PGWMIESLKAVKFIDAKHFNVPFGQGAVELIAGRESVIAQILRTVPNKIYNMKFTIGDAR  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFA   TLKVP++S+G+G +K    +FRA  NRTR+ F+S++YHTR  D+
Sbjct  291  NGCHGSMMIEAFAAKDTLKVPFKSEGKGEFKTVSFKFRAIENRTRITFYSSFYHTRIHDY  350

Query  302  VSLCGPVVDFVKLVSV  255
             SLCGPV+D V +  V
Sbjct  351  GSLCGPVIDQVIVYPV  366



>ref|XP_006427179.1| hypothetical protein CICLE_v10025880mg [Citrus clementina]
 gb|ESR40419.1| hypothetical protein CICLE_v10025880mg [Citrus clementina]
Length=374

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 103/134 (77%), Gaps = 0/134 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKYID +HF VP GRRA+ELVAGKESA+TQ+ +T   K Y L+F VGDA 
Sbjct  231  PGWIIESLKAVKYIDLKHFFVPEGRRAIELVAGKESALTQVVKTEVNKTYALSFAVGDAG  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C G++ +EA+AG   +KV Y SKG+GG+K A LRF+A + RTR+MF ST+Y+ +SD  
Sbjct  291  NGCAGTLGVEAYAGRENVKVTYASKGKGGFKKALLRFKAVSPRTRIMFLSTFYNMQSDSS  350

Query  302  VSLCGPVVDFVKLV  261
             SLCGPV+D VKL+
Sbjct  351  GSLCGPVIDDVKLL  364



>dbj|BAD52536.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD61499.1| unknown protein [Oryza sativa Japonica Group]
Length=299

 Score =   171 bits (432),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 101/137 (74%), Gaps = 2/137 (1%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            PAW + S KAVKY+DA HF+VP G RAVELV GKESA+ Q  RTV G  Y L+F VGDA 
Sbjct  155  PAWMIMSSKAVKYVDAAHFAVPQGARAVELVGGKESALVQEVRTVPGWTYRLSFAVGDAR  214

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            + C GSMV EA+A  +++KVPYESKG GGYK A L F A ANRTRV+F ST+YHT +D  
Sbjct  215  DGCAGSMVAEAYAARASIKVPYESKGTGGYKRAVLEFAAIANRTRVVFQSTFYHTMTDG-  273

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPV+D   LV +R
Sbjct  274  -SLCGPVIDDASLVGLR  289



>ref|XP_010417734.1| PREDICTED: uncharacterized protein LOC104703420 [Camelina sativa]
Length=369

 Score =   172 bits (436),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 100/136 (74%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKY+D  HF+VP G RA+ELVAGKESA++QI RT   KFY LTF VGDA 
Sbjct  229  PGWIIESLKAVKYVDKAHFAVPEGHRAIELVAGKESAISQIVRTSVNKFYALTFNVGDAR  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            + CEG M +EA AG     V Y SKG+GG+K  +L F+A + RTRV F ST+YH +SD  
Sbjct  289  DGCEGPMTVEALAGRGKAMVDYASKGKGGFKRGRLVFKAASARTRVTFLSTFYHMKSDHS  348

Query  302  VSLCGPVVDFVKLVSV  255
             SLCGPV+D V+LV+V
Sbjct  349  GSLCGPVIDDVRLVAV  364



>ref|XP_010429991.1| PREDICTED: uncharacterized protein LOC104714356 [Camelina sativa]
Length=369

 Score =   172 bits (436),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 100/136 (74%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKY+D  HF+VP G RA+ELV GKESA++QI RT   KFY LTF VGDA 
Sbjct  229  PGWIIESLKAVKYVDKAHFAVPEGHRAIELVGGKESAISQIVRTSVNKFYALTFNVGDAR  288

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            + CEG M++EA AG     V Y SKG+GG+K  +L F+A + RTRV F ST+YH +SD  
Sbjct  289  DGCEGPMIVEALAGRGKTMVDYASKGKGGFKRGRLVFKAASARTRVTFLSTFYHMKSDHS  348

Query  302  VSLCGPVVDFVKLVSV  255
             SLCGPV+D V+LV+V
Sbjct  349  GSLCGPVIDGVRLVAV  364



>ref|XP_009355525.1| PREDICTED: uncharacterized protein LOC103946533 [Pyrus x bretschneideri]
Length=367

 Score =   172 bits (436),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLK VKYID +HF+VP G  A+ELVAG+ESA+ QI RTV  K Y+L F +GDA 
Sbjct  231  PGWIVESLKPVKYIDRKHFAVPRGLAAIELVAGRESAIAQIIRTVPNKSYNLIFTIGDAK  290

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  TLK P+ S G+GG+K A L+F+AT+ RTR+ F+S YYHT+ DD+
Sbjct  291  NGCHGSMMVEAFAGKETLKAPFVSAGKGGFKTAILKFQATSIRTRLTFYSAYYHTKLDDY  350

Query  302  VSLCGPVVDFVKLVSV  255
              +CGPV+D V +  V
Sbjct  351  GHMCGPVLDNVIVFPV  366



>ref|XP_009142779.1| PREDICTED: uncharacterized protein LOC103866589 [Brassica rapa]
Length=370

 Score =   172 bits (436),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLK VKYID+ HF VP G  AVELVAG+ESA+ QI RTVAG+ Y L+F VGDA 
Sbjct  234  PGWIIESLKPVKYIDSRHFEVPSGLAAVELVAGRESAIAQIIRTVAGRNYMLSFAVGDAQ  293

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG +  K+ +ES G+G +K  + RFRA +NRTR+ F+S +YHT+  DF
Sbjct  294  NGCHGSMMVEAFAGKAAFKLRFESNGKGAFKVGRFRFRADSNRTRLTFYSGFYHTKLHDF  353

Query  302  VSLCGPVVDFVKLVSVR  252
              LCGPV+D V +V  R
Sbjct  354  GHLCGPVLDSVSVVMTR  370



>ref|XP_009379646.1| PREDICTED: uncharacterized protein LOC103968043 [Pyrus x bretschneideri]
Length=576

 Score =   176 bits (446),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLK VKYID +HFSVP G  A+ELVAG+ESA+ Q  RTV  KFY+L F VGDA 
Sbjct  439  PGWIIESLKPVKYIDRKHFSVPKGLAAIELVAGRESAIAQTIRTVPNKFYNLIFTVGDAK  498

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  TLKVP+ S+G+GG+K A L+F+AT+ RTR+ F+S YYHT+  D+
Sbjct  499  NGCHGSMMVEAFAGKETLKVPFVSEGKGGFKTAILKFQATSMRTRLTFYSAYYHTKLHDY  558

Query  302  VSLCGPVVDFVKLVSV  255
              LCGPV+D V +  V
Sbjct  559  GHLCGPVLDNVIVFPV  574



>ref|XP_007028767.1| F17A17.37 protein [Theobroma cacao]
 gb|EOY09269.1| F17A17.37 protein [Theobroma cacao]
Length=368

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLK VKYID +HFSVP G  A+ELVAG+ESA+ Q+ RTV  KFY L F VGDA 
Sbjct  232  PGWIIESLKPVKYIDKKHFSVPSGLYAIELVAGRESAMAQVIRTVPNKFYTLAFTVGDAK  291

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG  TLKVP+ S+G+G +K A  +F+A + RTR+ F+S YYHT+  DF
Sbjct  292  NGCHGSMMVEAFAGKETLKVPFVSQGKGVFKTASFKFQAISARTRITFYSAYYHTKLHDF  351

Query  302  VSLCGPVVDFVKLVSV  255
              +CGPV+D V+++ V
Sbjct  352  GHMCGPVLDDVRVLPV  367



>ref|XP_006296392.1| hypothetical protein CARUB_v10025565mg [Capsella rubella]
 gb|EOA29290.1| hypothetical protein CARUB_v10025565mg [Capsella rubella]
Length=371

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W VESLK VKYID  HF VP G  A+E+VAG+ESA+ QI RTVAG+ Y L+F+VGDA 
Sbjct  235  PGWIVESLKPVKYIDNRHFKVPSGLAAIEIVAGRESAIAQIIRTVAGRNYILSFVVGDAH  294

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            N C GSM++EAFAG +  KV ++S GQG +K  +  FRA +NRTR+ F+S +YHT+  DF
Sbjct  295  NGCHGSMMVEAFAGKAAFKVKFDSNGQGAFKAGRFAFRADSNRTRITFYSGFYHTKLHDF  354

Query  302  VSLCGPVVDFVKLVSVR  252
              LCGPV+D V++V  R
Sbjct  355  GHLCGPVLDNVRVVLAR  371



>ref|XP_006301335.1| hypothetical protein CARUB_v10021745mg [Capsella rubella]
 gb|EOA34233.1| hypothetical protein CARUB_v10021745mg [Capsella rubella]
Length=378

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKY+D  HF VP G+RA+ELV GKESA++QI RT     Y LTF VGDA 
Sbjct  238  PGWIIESLKAVKYVDKAHFYVPEGQRAIELVGGKESAISQIVRTSVNNLYSLTFNVGDAR  297

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            + CEG M++EAFAG   + V Y SKG+GG+K  +L F+A + RTRV F ST+YH +SD  
Sbjct  298  DGCEGPMMVEAFAGGRKIMVDYASKGKGGFKRGRLVFKAASARTRVTFLSTFYHMKSDHS  357

Query  302  VSLCGPVVDFVKLVSVR  252
             S+CGPV+D V+LV+VR
Sbjct  358  GSMCGPVIDDVRLVAVR  374



>emb|CDY54317.1| BnaC06g43150D [Brassica napus]
Length=370

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 100/137 (73%), Gaps = 0/137 (0%)
 Frame = -2

Query  662  PAWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDAS  483
            P W +ESLKAVKY+D  HF VP G RA+ELV GKESAV+QI RT   KFY LTF VGDA 
Sbjct  230  PGWIIESLKAVKYVDKAHFFVPEGHRAIELVGGKESAVSQIVRTSPNKFYALTFNVGDAR  289

Query  482  NKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDF  303
            + CEG M +EAFAG     V Y SKG+GG+K  +L F+A + RTRV F ST+YH ++D  
Sbjct  290  DACEGPMAVEAFAGRGNTLVDYMSKGKGGFKQGRLVFKAVSARTRVTFLSTFYHMKNDHS  349

Query  302  VSLCGPVVDFVKLVSVR  252
             SLCGPVVD V+LV+V+
Sbjct  350  GSLCGPVVDDVRLVAVK  366



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1037156799140