BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF036J04

Length=710
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP07923.1|  unnamed protein product                                261   6e-81   Coffea canephora [robusta coffee]
ref|XP_004160525.1|  PREDICTED: UBX domain-containing protein 2-like    253   8e-80   
ref|XP_010270774.1|  PREDICTED: UBX domain-containing protein 2 i...    256   3e-79   Nelumbo nucifera [Indian lotus]
ref|XP_004140414.1|  PREDICTED: UBX domain-containing protein 7-like    254   3e-78   Cucumis sativus [cucumbers]
ref|XP_008456878.1|  PREDICTED: UBX domain-containing protein 2         254   3e-78   
ref|XP_010270775.1|  PREDICTED: UBX domain-containing protein 2 i...    253   7e-78   Nelumbo nucifera [Indian lotus]
ref|XP_010270773.1|  PREDICTED: UBX domain-containing protein 2 i...    253   1e-77   Nelumbo nucifera [Indian lotus]
ref|XP_009775836.1|  PREDICTED: UBX domain-containing protein 2         251   3e-77   Nicotiana sylvestris
ref|XP_011070500.1|  PREDICTED: UBX domain-containing protein 2         251   8e-77   Sesamum indicum [beniseed]
ref|XP_009587838.1|  PREDICTED: UBX domain-containing protein 2         250   9e-77   Nicotiana tomentosiformis
ref|XP_006355016.1|  PREDICTED: UBX domain-containing protein 2-like    250   2e-76   Solanum tuberosum [potatoes]
ref|XP_007222574.1|  hypothetical protein PRUPE_ppa008429mg             242   5e-75   
ref|XP_008220984.1|  PREDICTED: UBX domain-containing protein 2 i...    246   6e-75   Prunus mume [ume]
ref|XP_004236895.1|  PREDICTED: UBX domain-containing protein 2         244   3e-74   Solanum lycopersicum
gb|KHG06883.1|  UBX domain-containing 7                                 244   3e-74   Gossypium arboreum [tree cotton]
ref|XP_008220982.1|  PREDICTED: UBX domain-containing protein 2 i...    243   4e-74   Prunus mume [ume]
gb|KJB30690.1|  hypothetical protein B456_005G158000                    243   5e-74   Gossypium raimondii
ref|XP_007045358.1|  UBX domain-containing protein isoform 3            242   1e-73   
ref|XP_010088526.1|  UBX domain-containing protein 2                    243   1e-73   Morus notabilis
gb|KJB30689.1|  hypothetical protein B456_005G158000                    240   4e-73   Gossypium raimondii
gb|KDO53546.1|  hypothetical protein CISIN_1g013325mg                   234   5e-73   Citrus sinensis [apfelsine]
gb|KDP38216.1|  hypothetical protein JCGZ_04859                         241   5e-73   Jatropha curcas
gb|KJB30687.1|  hypothetical protein B456_005G158000                    240   7e-73   Gossypium raimondii
ref|XP_007045357.1|  UBX domain-containing protein isoform 2            239   2e-72   
ref|XP_006470883.1|  PREDICTED: UBX domain-containing protein 2-like    239   2e-72   Citrus sinensis [apfelsine]
ref|XP_007045359.1|  UBX domain-containing protein isoform 4            238   2e-72   
ref|XP_007045356.1|  UBX domain-containing protein isoform 1            240   2e-72   
ref|XP_003531952.1|  PREDICTED: UBX domain-containing protein 7-l...    238   5e-72   Glycine max [soybeans]
gb|KDO53545.1|  hypothetical protein CISIN_1g013325mg                   234   8e-72   Citrus sinensis [apfelsine]
ref|XP_010680042.1|  PREDICTED: UBX domain-containing protein 2         236   2e-71   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO53543.1|  hypothetical protein CISIN_1g013325mg                   236   3e-71   Citrus sinensis [apfelsine]
gb|KDO53544.1|  hypothetical protein CISIN_1g013325mg                   236   4e-71   Citrus sinensis [apfelsine]
gb|EYU30238.1|  hypothetical protein MIMGU_mgv1a006061mg                234   2e-70   Erythranthe guttata [common monkey flower]
gb|EYU30237.1|  hypothetical protein MIMGU_mgv1a006061mg                234   2e-70   Erythranthe guttata [common monkey flower]
gb|EYU30239.1|  hypothetical protein MIMGU_mgv1a006061mg                234   2e-70   Erythranthe guttata [common monkey flower]
ref|XP_002521873.1|  UBX domain-containing protein, putative            233   5e-70   
ref|XP_003547850.1|  PREDICTED: UBX domain-containing protein 7-l...    233   9e-70   Glycine max [soybeans]
gb|KHN06997.1|  UBX domain-containing protein 7                         233   1e-69   Glycine soja [wild soybean]
ref|XP_007156392.1|  hypothetical protein PHAVU_003G282600g             230   6e-69   Phaseolus vulgaris [French bean]
ref|XP_004509607.1|  PREDICTED: UBX domain-containing protein 7-like    230   1e-68   Cicer arietinum [garbanzo]
ref|XP_011025166.1|  PREDICTED: UBX domain-containing protein 7-like    227   1e-67   Populus euphratica
ref|XP_010654914.1|  PREDICTED: UBX domain-containing protein 2 i...    226   3e-67   Vitis vinifera
ref|XP_002311564.2|  hypothetical protein POPTR_0008s14230g             226   3e-67   
ref|XP_006855568.1|  hypothetical protein AMTR_s00044p00018360          225   4e-67   Amborella trichopoda
ref|XP_010654910.1|  PREDICTED: UBX domain-containing protein 2 i...    225   4e-67   Vitis vinifera
ref|XP_003631347.1|  PREDICTED: UBX domain-containing protein 2 i...    225   4e-67   Vitis vinifera
ref|XP_011463491.1|  PREDICTED: UBX domain-containing protein 2 i...    224   3e-66   Fragaria vesca subsp. vesca
ref|XP_004297788.1|  PREDICTED: UBX domain-containing protein 2 i...    224   3e-66   Fragaria vesca subsp. vesca
gb|EYU30240.1|  hypothetical protein MIMGU_mgv1a006061mg                222   5e-66   Erythranthe guttata [common monkey flower]
ref|XP_003628976.1|  UBX domain-containing protein                      222   7e-66   Medicago truncatula
ref|XP_010527852.1|  PREDICTED: UBX domain-containing protein 2 i...    219   2e-65   Tarenaya hassleriana [spider flower]
ref|XP_009351644.1|  PREDICTED: UBX domain-containing protein 2 i...    221   2e-65   Pyrus x bretschneideri [bai li]
ref|XP_010527851.1|  PREDICTED: UBX domain-containing protein 2 i...    220   3e-65   Tarenaya hassleriana [spider flower]
ref|XP_010554359.1|  PREDICTED: UBX domain-containing protein 2-like    220   5e-65   Tarenaya hassleriana [spider flower]
ref|XP_008389122.1|  PREDICTED: UBX domain-containing protein 2-l...    218   1e-64   Malus domestica [apple tree]
ref|XP_002315828.1|  UBX domain-containing family protein               218   2e-64   
ref|XP_006378421.1|  hypothetical protein POPTR_0010s10910g             218   2e-64   
ref|XP_009351643.1|  PREDICTED: UBX domain-containing protein 2 i...    218   4e-64   Pyrus x bretschneideri [bai li]
ref|XP_009351642.1|  PREDICTED: UBX domain-containing protein 2 i...    217   9e-64   Pyrus x bretschneideri [bai li]
ref|XP_007052064.1|  UBX domain-containing protein                      215   2e-63   
ref|XP_008389121.1|  PREDICTED: UBX domain-containing protein 2-l...    215   2e-63   Malus domestica [apple tree]
ref|XP_008389120.1|  PREDICTED: UBX domain-containing protein 2-l...    214   4e-63   Malus domestica [apple tree]
ref|XP_010043889.1|  PREDICTED: UBX domain-containing protein 2 i...    214   8e-63   Eucalyptus grandis [rose gum]
ref|XP_010043888.1|  PREDICTED: UBX domain-containing protein 2 i...    214   1e-62   Eucalyptus grandis [rose gum]
ref|XP_011021683.1|  PREDICTED: UBX domain-containing protein 2-like    213   3e-62   Populus euphratica
gb|AFK35082.1|  unknown                                                 203   1e-61   Medicago truncatula
ref|XP_008804300.1|  PREDICTED: UBX domain-containing protein 7         210   2e-61   Phoenix dactylifera
ref|XP_010935374.1|  PREDICTED: UBX domain-containing protein 2 i...    209   6e-61   Elaeis guineensis
emb|CDY69105.1|  BnaCnng61890D                                          209   7e-61   Brassica napus [oilseed rape]
emb|CDY45269.1|  BnaA06g09390D                                          207   6e-60   Brassica napus [oilseed rape]
ref|XP_006307428.1|  hypothetical protein CARUB_v10009052mg             206   2e-59   Capsella rubella
ref|XP_002890064.1|  UBX domain-containing protein                      206   2e-59   Arabidopsis lyrata subsp. lyrata
gb|EPS73806.1|  hypothetical protein M569_00949                         203   1e-58   Genlisea aurea
emb|CDY68911.1|  BnaAnng28760D                                          201   2e-58   Brassica napus [oilseed rape]
ref|NP_001077535.1|  UBX domain-containing protein                      202   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|NP_563954.1|  UBX domain-containing protein                         202   3e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496241.1|  PREDICTED: UBX domain-containing protein 2-like    202   4e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010458959.1|  PREDICTED: UBX domain-containing protein 2-like    202   5e-58   Camelina sativa [gold-of-pleasure]
emb|CDX84023.1|  BnaC08g16220D                                          201   8e-58   
ref|XP_009148836.1|  PREDICTED: UBX domain-containing protein 2         201   1e-57   Brassica rapa
ref|XP_006416998.1|  hypothetical protein EUTSA_v10007578mg             199   4e-57   Eutrema salsugineum [saltwater cress]
ref|XP_009110537.1|  PREDICTED: UBX domain-containing protein 2-like    199   4e-57   Brassica rapa
gb|AAF63167.1|AC010657_3  T5E21.7                                       200   6e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010476513.1|  PREDICTED: UBX domain-containing protein 2-like    198   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_009599661.1|  PREDICTED: UBX domain-containing protein 7 h...    193   1e-55   Nicotiana tomentosiformis
ref|XP_010253434.1|  PREDICTED: UBX domain-containing protein 7-like    192   3e-55   Nelumbo nucifera [Indian lotus]
ref|XP_009401234.1|  PREDICTED: UBX domain-containing protein 2         193   7e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009759130.1|  PREDICTED: UBX domain-containing protein 7-like    191   1e-54   Nicotiana sylvestris
ref|XP_008801336.1|  PREDICTED: UBX domain-containing protein 2-like    182   1e-51   
ref|NP_001054216.1|  Os04g0670800                                       181   2e-51   
ref|XP_006653862.1|  PREDICTED: UBX domain-containing protein 2-like    181   5e-51   
gb|AEV40978.1|  putative UBX domain-containing protein                  182   9e-51   Oryza punctata
gb|AEV41122.1|  putative UBX domain-containing protein                  182   1e-50   Oryza officinalis
gb|AIE88273.1|  hypothetical protein OG_BBa0063K01.4                    183   2e-50   Oryza glaberrima
emb|CAE02831.2|  OSJNBa0043A12.36                                       181   3e-50   Oryza sativa Japonica Group [Japonica rice]
gb|AEV41029.1|  putative UBX domain-containing protein                  179   2e-49   Oryza minuta
gb|AEV41076.1|  putative UBX domain-containing protein                  177   3e-49   Oryza minuta
ref|XP_004960126.1|  PREDICTED: UBX domain-containing protein 2-like    176   2e-48   Setaria italica
ref|XP_010325366.1|  PREDICTED: LOW QUALITY PROTEIN: UBX domain-c...    174   2e-48   
ref|XP_002447303.1|  hypothetical protein SORBIDRAFT_06g032400          176   3e-48   Sorghum bicolor [broomcorn]
ref|XP_003580790.1|  PREDICTED: UBX domain-containing protein 2 i...    176   3e-48   Brachypodium distachyon [annual false brome]
gb|EMT10976.1|  hypothetical protein F775_30110                         171   6e-47   
ref|NP_001170636.1|  uncharacterized protein LOC100384688               171   2e-46   Zea mays [maize]
dbj|BAK05667.1|  predicted protein                                      171   2e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA35438.1|  TPA: hypothetical protein ZEAMMB73_856149              169   7e-46   
tpg|DAA35439.1|  TPA: hypothetical protein ZEAMMB73_856149              169   1e-45   
ref|XP_010935375.1|  PREDICTED: UBX domain-containing protein 5 i...    167   2e-45   
ref|XP_008668717.1|  PREDICTED: UBX domain-containing protein 2-like    169   4e-45   
ref|XP_006343881.1|  PREDICTED: UBX domain-containing protein 7-like    166   5e-45   Solanum tuberosum [potatoes]
gb|EMS63720.1|  UBX domain-containing protein 7                         166   8e-45   Triticum urartu
ref|XP_010519525.1|  PREDICTED: UBX domain-containing protein 2-like    162   4e-44   Tarenaya hassleriana [spider flower]
ref|XP_006414754.1|  hypothetical protein EUTSA_v10027144mg             163   6e-44   
ref|XP_009398016.1|  PREDICTED: UBX domain-containing protein 2-like    161   8e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB30688.1|  hypothetical protein B456_005G158000                    159   2e-42   Gossypium raimondii
ref|XP_002868299.1|  predicted protein                                  162   2e-42   
ref|XP_010450084.1|  PREDICTED: UBX domain-containing protein 7-like    157   9e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010519462.1|  PREDICTED: UBX domain-containing protein 2-like    155   2e-41   Tarenaya hassleriana [spider flower]
ref|NP_001190727.1|  UBX domain-containing pseudogene                   159   7e-41   
emb|CAB10204.1|  hypothetical protein                                   157   1e-40   Arabidopsis thaliana [mouse-ear cress]
gb|EYU24728.1|  hypothetical protein MIMGU_mgv1a025994mg                152   3e-40   Erythranthe guttata [common monkey flower]
ref|XP_001758899.1|  predicted protein                                  154   4e-40   
emb|CDY12748.1|  BnaC04g28930D                                          152   5e-40   Brassica napus [oilseed rape]
ref|XP_009139539.1|  PREDICTED: UBX domain-containing protein 2-like    152   8e-40   Brassica rapa
ref|XP_006285858.1|  hypothetical protein CARUB_v10007353mg             150   2e-39   
ref|XP_006470475.1|  PREDICTED: UBX domain-containing protein 7-like    150   4e-39   
ref|NP_193161.3|  UBX domain-containing pseudogene                      153   9e-39   
emb|CDY01207.1|  BnaA04g06120D                                          152   1e-38   
ref|XP_009139538.1|  PREDICTED: UBX domain-containing protein 2         149   3e-38   Brassica rapa
ref|XP_010436606.1|  PREDICTED: UBX domain-containing protein 2-like    146   5e-38   
ref|XP_010490003.1|  PREDICTED: UBX domain-containing protein 2-like    145   6e-38   
gb|KFK22408.1|  hypothetical protein AALP_AAs65522U000100               146   7e-38   Arabis alpina [alpine rockcress]
emb|CDY12747.1|  BnaC04g28940D                                          145   2e-37   Brassica napus [oilseed rape]
gb|EEE61882.1|  hypothetical protein OsJ_16574                          145   3e-37   Oryza sativa Japonica Group [Japonica rice]
gb|AGH62811.1|  UBX1                                                    145   4e-37   Brassica napus [oilseed rape]
ref|XP_006446591.1|  hypothetical protein CICLE_v10017670mg             144   6e-37   Citrus clementina [clementine]
ref|XP_009139540.1|  PREDICTED: UBX domain-containing protein 7-like    143   2e-36   Brassica rapa
ref|XP_006414812.1|  hypothetical protein EUTSA_v10027208mg             140   2e-35   
ref|NP_176165.1|  pseudo                                                137   8e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002886675.1|  predicted protein                                  133   2e-33   
emb|CDY01206.1|  BnaA04g06130D                                          132   1e-32   
ref|XP_002883438.1|  hypothetical protein ARALYDRAFT_898874             125   4e-32   
gb|KFK22146.1|  hypothetical protein AALP_AAs62910U000300               131   5e-32   Arabis alpina [alpine rockcress]
ref|XP_006414811.1|  hypothetical protein EUTSA_v10027532mg             131   6e-32   
ref|XP_010436605.1|  PREDICTED: uncharacterized protein LOC104720396    129   1e-31   Camelina sativa [gold-of-pleasure]
gb|AAF79774.1|AC009317_33  T30E16.10                                    127   3e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010445452.1|  PREDICTED: UBX domain-containing protein 7         128   7e-31   Camelina sativa [gold-of-pleasure]
emb|CDY12746.1|  BnaC04g28950D                                          128   7e-31   Brassica napus [oilseed rape]
gb|KFK39659.1|  hypothetical protein AALP_AA3G272700                    120   3e-30   Arabis alpina [alpine rockcress]
ref|XP_010450078.1|  PREDICTED: UBX domain-containing protein 2-like    125   9e-30   Camelina sativa [gold-of-pleasure]
ref|XP_006406007.1|  hypothetical protein EUTSA_v10021701mg             119   1e-29   Eutrema salsugineum [saltwater cress]
ref|XP_006285935.1|  hypothetical protein CARUB_v10007447mg             124   1e-29   
ref|XP_006296631.1|  hypothetical protein CARUB_v10014834mg             117   5e-29   Capsella rubella
ref|XP_010514980.1|  PREDICTED: uncharacterized protein LOC104790878    117   9e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010488437.1|  PREDICTED: uncharacterized protein LOC104766...    117   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010466708.1|  PREDICTED: uncharacterized protein LOC104746864    117   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010488435.1|  PREDICTED: uncharacterized protein LOC104766...    117   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010488436.1|  PREDICTED: uncharacterized protein LOC104766...    115   4e-28   Camelina sativa [gold-of-pleasure]
ref|XP_009136068.1|  PREDICTED: uncharacterized protein LOC103860231    114   1e-27   Brassica rapa
ref|XP_006414759.1|  hypothetical protein EUTSA_v10027233mg             118   2e-27   
ref|XP_009106587.1|  PREDICTED: uncharacterized protein LOC103832346    112   5e-27   Brassica rapa
emb|CDY50464.1|  BnaCnng19430D                                          112   6e-27   Brassica napus [oilseed rape]
ref|XP_010512639.1|  PREDICTED: UBX domain-containing protein 1-like    112   7e-27   Camelina sativa [gold-of-pleasure]
emb|CDY18108.1|  BnaA01g23690D                                          111   8e-27   Brassica napus [oilseed rape]
ref|NP_566733.1|  UBX domain-containing protein                         111   2e-26   Arabidopsis thaliana [mouse-ear cress]
gb|AAM66019.1|  unknown                                                 110   2e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KDO55137.1|  hypothetical protein CISIN_1g036413mg                 98.6    1e-20   Citrus sinensis [apfelsine]
emb|CDX92988.1|  BnaA03g37100D                                        89.4    1e-18   
emb|CDX94853.1|  BnaC03g43350D                                        87.8    5e-18   
ref|XP_005643712.1|  hypothetical protein COCSUDRAFT_59648            84.3    2e-15   Coccomyxa subellipsoidea C-169
ref|XP_010274053.1|  PREDICTED: homeobox-leucine zipper protein H...  82.4    3e-15   Nelumbo nucifera [Indian lotus]
gb|KDO53547.1|  hypothetical protein CISIN_1g013325mg                 81.3    8e-15   Citrus sinensis [apfelsine]
ref|XP_006420698.1|  hypothetical protein CICLE_v10005240mg           80.5    2e-14   
gb|KEH28763.1|  structural constituent of ribosome protein            78.6    8e-14   Medicago truncatula
ref|XP_010270205.1|  PREDICTED: uncharacterized protein LOC104606607  73.2    1e-12   
ref|XP_002874517.1|  predicted protein                                75.1    1e-12   
ref|XP_002891290.1|  hypothetical protein ARALYDRAFT_891395           70.5    6e-12   
ref|XP_002900938.1|  conserved hypothetical protein                   74.3    7e-12   Phytophthora infestans T30-4
gb|ETI31731.1|  hypothetical protein F443_21327                       73.6    1e-11   Phytophthora parasitica P1569
ref|XP_008915021.1|  hypothetical protein PPTG_18885                  73.6    1e-11   Phytophthora parasitica INRA-310
gb|ETI31732.1|  hypothetical protein, variant 1                       72.0    4e-11   Phytophthora parasitica P1569
ref|XP_008915022.1|  hypothetical protein, variant                    72.0    4e-11   Phytophthora parasitica INRA-310
ref|XP_008383892.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  65.9    7e-11   
ref|XP_010497037.1|  PREDICTED: UBX domain-containing protein 7-like  68.9    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_002872422.1|  hypothetical protein ARALYDRAFT_911175           63.2    6e-10   
gb|KDO48110.1|  hypothetical protein CISIN_1g021440mg                 66.2    2e-09   Citrus sinensis [apfelsine]
ref|XP_009533837.1|  hypothetical protein PHYSODRAFT_352438           66.6    2e-09   Phytophthora sojae
gb|KDO48111.1|  hypothetical protein CISIN_1g021440mg                 65.5    3e-09   Citrus sinensis [apfelsine]
emb|CCI43060.1|  unnamed protein product                              65.9    3e-09   Albugo candida
emb|CDY51383.1|  BnaC02g46180D                                        62.4    6e-09   Brassica napus [oilseed rape]
ref|XP_003604169.1|  UBX domain-containing protein                    64.7    7e-09   
gb|KEH28537.1|  UBX domain protein                                    63.9    8e-09   Medicago truncatula
gb|KEH28538.1|  UBX domain protein                                    64.3    8e-09   Medicago truncatula
ref|XP_008864408.1|  hypothetical protein H310_02617                  63.2    3e-08   Aphanomyces invadans
ref|XP_005843123.1|  hypothetical protein CHLNCDRAFT_55386            62.8    3e-08   Chlorella variabilis
gb|KDO22673.1|  hypothetical protein SPRG_10988                       60.8    2e-07   Saprolegnia parasitica CBS 223.65
gb|AFW86620.1|  hypothetical protein ZEAMMB73_563531                  59.3    4e-07   
ref|XP_002957220.1|  hypothetical protein VOLCADRAFT_98325            59.3    7e-07   Volvox carteri f. nagariensis
ref|XP_011463688.1|  PREDICTED: uncharacterized protein LOC105351367  58.5    1e-06   Fragaria vesca subsp. vesca
ref|XP_010240593.1|  PREDICTED: UBX domain-containing protein 7 i...  57.8    2e-06   
ref|XP_008617322.1|  hypothetical protein SDRG_13017                  57.0    4e-06   Saprolegnia diclina VS20
emb|CCA23196.1|  conserved hypothetical protein                       56.6    5e-06   Albugo laibachii Nc14
ref|XP_003604178.1|  UBX domain-containing protein                    56.2    6e-06   Medicago truncatula
ref|NP_594518.1|  UBX domain protein Ubx2                             55.5    1e-05   Schizosaccharomyces pombe
gb|EPY51977.1|  UB Xdomain protein Ubx2                               54.7    2e-05   Schizosaccharomyces cryophilus OY26
ref|XP_006480636.1|  PREDICTED: UBX domain-containing protein 7-l...  54.3    3e-05   
ref|XP_006480635.1|  PREDICTED: UBX domain-containing protein 7-l...  54.3    3e-05   
ref|XP_006480637.1|  PREDICTED: UBX domain-containing protein 7-l...  53.9    3e-05   
ref|XP_009844374.1|  hypothetical protein H257_17329                  53.9    4e-05   Aphanomyces astaci
ref|XP_001691879.1|  hypothetical protein CHLREDRAFT_145485           53.1    8e-05   Chlamydomonas reinhardtii
emb|CDH49981.1|  ubx domain protein                                   52.8    9e-05   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_008812862.1|  PREDICTED: uncharacterized protein LOC103723...  49.7    1e-04   Phoenix dactylifera
ref|XP_011399212.1|  UBX domain-containing protein 7                  50.8    4e-04   Auxenochlorella protothecoides
ref|XP_006677415.1|  hypothetical protein BATDEDRAFT_34588            50.8    5e-04   Batrachochytrium dendrobatidis JAM81
emb|CDS04684.1|  hypothetical protein LRAMOSA07234                    50.8    5e-04   Lichtheimia ramosa
gb|EPX70813.1|  UB Xdomain protein Ubx2                               50.4    5e-04   Schizosaccharomyces octosporus yFS286
ref|XP_010440502.1|  PREDICTED: UBX domain-containing protein 7-like  49.7    8e-04   
ref|XP_002173242.1|  UB Xdomain protein Ubx2                          50.1    9e-04   Schizosaccharomyces japonicus yFS275
ref|XP_002461860.1|  hypothetical protein SORBIDRAFT_02g009430        50.1    9e-04   Sorghum bicolor [broomcorn]



>emb|CDP07923.1| unnamed protein product [Coffea canephora]
Length=448

 Score =   261 bits (667),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 160/199 (80%), Gaps = 6/199 (3%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            V+DP+ GQKMRSWRGMVQPETLLEDLLPFMDGSP+DH V+LSHKRPRESP   P      
Sbjct  255  VIDPVTGQKMRSWRGMVQPETLLEDLLPFMDGSPTDHHVNLSHKRPRESPVIRPHRVQGE  314

Query  533  keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNL  354
             EEDE++L+ALAASMEG+KD +     +  ES     +T + K P YPPLPEEPKGDKNL
Sbjct  315  TEEDEDMLRALAASMEGVKDMDKKEADDVDES----PQTLLTKNPAYPPLPEEPKGDKNL  370

Query  353  VCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFES  174
            +CRVG+RLPDGRRLQRNFLRSDPIQLLWSFC S LEE   +PFRLTQAIPG + SLD+  
Sbjct  371  LCRVGVRLPDGRRLQRNFLRSDPIQLLWSFCCSQLEEAKTRPFRLTQAIPG-SKSLDYNI  429

Query  173  NLTFEESGLANSMISVTWD  117
            +LTFE SGLANSMISVTW+
Sbjct  430  DLTFEASGLANSMISVTWE  448



>ref|XP_004160525.1| PREDICTED: UBX domain-containing protein 2-like [Cucumis sativus]
Length=288

 Score =   253 bits (646),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 158/200 (79%), Gaps = 6/200 (3%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            V+DPI GQKM SW GMVQPE LLEDLLPFMDG P DH V+LSHKRPRES   PP  ++  
Sbjct  93   VIDPITGQKMHSWFGMVQPERLLEDLLPFMDGGPKDHHVTLSHKRPRESSLTPPKVREVE  152

Query  533  keedeellqalaASMEGMKDTNVDALKESSE-SDVLGKETNVVKKPVYPPLPEEPKGDKN  357
             EEDEE+ +ALA S+EGMK+    A+K SSE  D    E    K P YPPLPEEPKGD+ 
Sbjct  153  YEEDEEVQRALAVSLEGMKE----AVKLSSEDKDTKVAEKEEEKCPTYPPLPEEPKGDRK  208

Query  356  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  177
            L+CR+G+RLP+GRR QRNFLR+DPIQLLWSFCSS LE+ + KPF+LT AIPGAT +LD++
Sbjct  209  LLCRIGVRLPNGRRCQRNFLRTDPIQLLWSFCSSQLEDGETKPFKLTHAIPGATKTLDYD  268

Query  176  SNLTFEESGLANSMISVTWD  117
            + +TFEESGLANSMISVTWD
Sbjct  269  TQMTFEESGLANSMISVTWD  288



>ref|XP_010270774.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Nelumbo 
nucifera]
Length=448

 Score =   256 bits (655),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 159/200 (80%), Gaps = 6/200 (3%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAP-Plhkdd  537
            V+DPI GQKMR W GMVQPE LLEDLLPFMD  P DH VSL HKRPRES Q P P  +++
Sbjct  253  VIDPITGQKMRLWNGMVQPERLLEDLLPFMDNGPKDHHVSLPHKRPRESSQTPIPKLQEE  312

Query  536  akeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN  357
              EEDEE+L ALAASME  K T  D  +  +E      E++  KK  YPPLPEEPKGD+N
Sbjct  313  TNEEDEEVLLALAASMENTKPTYTDKEEPKTEE----AESSSAKKTTYPPLPEEPKGDRN  368

Query  356  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  177
            L+CRVGIRLPDGRRLQRNFLR DPIQLLWSFC + LEE++A+PFRLTQAIPGA+ SLD++
Sbjct  369  LLCRVGIRLPDGRRLQRNFLRKDPIQLLWSFCHAELEESEARPFRLTQAIPGASKSLDYD  428

Query  176  SNLTFEESGLANSMISVTWD  117
            S LTFEESGLANSMISVTWD
Sbjct  429  SKLTFEESGLANSMISVTWD  448



>ref|XP_004140414.1| PREDICTED: UBX domain-containing protein 7-like [Cucumis sativus]
Length=450

 Score =   254 bits (649),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 161/204 (79%), Gaps = 14/204 (7%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            V+DPI GQKM SW GMVQPE LLEDLLPFMDG P DH V+LSHKRPRES   PP  ++  
Sbjct  255  VIDPITGQKMHSWFGMVQPERLLEDLLPFMDGGPKDHHVTLSHKRPRESSLTPPKVREVE  314

Query  533  keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKK-----PVYPPLPEEPK  369
             EEDEE+ +ALA S+EGMK+    A+K SSE     K+T V +K     P YPPLPEEPK
Sbjct  315  YEEDEEVQRALAVSLEGMKE----AVKLSSED----KDTKVAEKEEEKCPTYPPLPEEPK  366

Query  368  GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSS  189
            GD+ L+CR+G+RLP+GRR QRNFLR+DPIQLLWSFCSS LE+ + KPF+LT AIPGAT +
Sbjct  367  GDRKLLCRIGVRLPNGRRCQRNFLRTDPIQLLWSFCSSQLEDGETKPFKLTHAIPGATKT  426

Query  188  LDFESNLTFEESGLANSMISVTWD  117
            LD+++ +TFEESGLANSMISVTWD
Sbjct  427  LDYDTQMTFEESGLANSMISVTWD  450



>ref|XP_008456878.1| PREDICTED: UBX domain-containing protein 2 [Cucumis melo]
 ref|XP_008456880.1| PREDICTED: UBX domain-containing protein 2 [Cucumis melo]
 ref|XP_008456881.1| PREDICTED: UBX domain-containing protein 2 [Cucumis melo]
Length=450

 Score =   254 bits (648),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 161/204 (79%), Gaps = 14/204 (7%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            V+DPI GQKM SW GMVQPE LLEDLLPFMDG P DH V+LSHKRPRES   PP  ++  
Sbjct  255  VIDPITGQKMHSWFGMVQPERLLEDLLPFMDGGPKDHHVTLSHKRPRESSLTPPKVREVD  314

Query  533  keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKK-----PVYPPLPEEPK  369
             EEDEE+ +ALA S+EGMK+    A+K SSE     K+T V +K     P YPPLPEEPK
Sbjct  315  YEEDEEVQRALAVSLEGMKE----AVKLSSED----KDTKVAEKEEEKCPTYPPLPEEPK  366

Query  368  GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSS  189
            GD+NL+CR+G+RLP+GRR QRNFLR+DPIQLLWSFCSS LE+ + KPF+LT AIPGAT +
Sbjct  367  GDRNLLCRIGVRLPNGRRCQRNFLRTDPIQLLWSFCSSQLEDGETKPFKLTHAIPGATKT  426

Query  188  LDFESNLTFEESGLANSMISVTWD  117
            LD+++ +TFEESGLANSMISV WD
Sbjct  427  LDYDTQMTFEESGLANSMISVVWD  450



>ref|XP_010270775.1| PREDICTED: UBX domain-containing protein 2 isoform X3 [Nelumbo 
nucifera]
Length=427

 Score =   253 bits (645),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 157/202 (78%), Gaps = 8/202 (4%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPP---lhk  543
            V+DPI GQKMR W GMVQPE LLEDLLPFMD  P DH VSL HKRPRES Q P       
Sbjct  230  VIDPITGQKMRLWNGMVQPERLLEDLLPFMDNGPKDHHVSLPHKRPRESSQTPIPKLQVA  289

Query  542  ddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD  363
            ++  EEDEE+L ALAASME  K T  D  +  +E      E++  KK  YPPLPEEPKGD
Sbjct  290  EETNEEDEEVLLALAASMENTKPTYTDKEEPKTEE----AESSSAKKTTYPPLPEEPKGD  345

Query  362  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  183
            +NL+CRVGIRLPDGRRLQRNFLR DPIQLLWSFC + LEE++A+PFRLTQAIPGA+ SLD
Sbjct  346  RNLLCRVGIRLPDGRRLQRNFLRKDPIQLLWSFCHAELEESEARPFRLTQAIPGASKSLD  405

Query  182  FESNLTFEESGLANSMISVTWD  117
            ++S LTFEESGLANSMISVTWD
Sbjct  406  YDSKLTFEESGLANSMISVTWD  427



>ref|XP_010270773.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Nelumbo 
nucifera]
Length=450

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 157/202 (78%), Gaps = 8/202 (4%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPP---lhk  543
            V+DPI GQKMR W GMVQPE LLEDLLPFMD  P DH VSL HKRPRES Q P       
Sbjct  253  VIDPITGQKMRLWNGMVQPERLLEDLLPFMDNGPKDHHVSLPHKRPRESSQTPIPKLQVA  312

Query  542  ddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD  363
            ++  EEDEE+L ALAASME  K T  D  +  +E      E++  KK  YPPLPEEPKGD
Sbjct  313  EETNEEDEEVLLALAASMENTKPTYTDKEEPKTEE----AESSSAKKTTYPPLPEEPKGD  368

Query  362  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  183
            +NL+CRVGIRLPDGRRLQRNFLR DPIQLLWSFC + LEE++A+PFRLTQAIPGA+ SLD
Sbjct  369  RNLLCRVGIRLPDGRRLQRNFLRKDPIQLLWSFCHAELEESEARPFRLTQAIPGASKSLD  428

Query  182  FESNLTFEESGLANSMISVTWD  117
            ++S LTFEESGLANSMISVTWD
Sbjct  429  YDSKLTFEESGLANSMISVTWD  450



>ref|XP_009775836.1| PREDICTED: UBX domain-containing protein 2 [Nicotiana sylvestris]
Length=454

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 167/202 (83%), Gaps = 4/202 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhkdda  534
            V+DPI GQKMRSWRGMVQPETLLEDL+ FMD SPS+ HV+LSHKRPRE+PQAPP      
Sbjct  253  VLDPITGQKMRSWRGMVQPETLLEDLISFMDASPSEYHVNLSHKRPRETPQAPPRQPQPQ  312

Query  533  ke---edeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD  363
             E   EDEEL +ALAASMEG++D    A KE++E++  G+E +++KKP YPPLPEEPKGD
Sbjct  313  NEIGEEDEELQRALAASMEGIEDPGAVASKETNEANNDGEEKHLIKKPSYPPLPEEPKGD  372

Query  362  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  183
            + L+CRV IR PDGRRLQRNFLRSD I+LLWSFCS+ LEE + +PFR TQAIPGA+  L+
Sbjct  373  RALLCRVAIRFPDGRRLQRNFLRSDSIKLLWSFCSTQLEEAETRPFRFTQAIPGASKFLE  432

Query  182  FESNLTFEESGLANSMISVTWD  117
            +++N+TFEESGLANS+IS TW+
Sbjct  433  YDNNITFEESGLANSIISFTWE  454



>ref|XP_011070500.1| PREDICTED: UBX domain-containing protein 2 [Sesamum indicum]
Length=453

 Score =   251 bits (640),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 160/202 (79%), Gaps = 8/202 (4%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdd-  537
            V+DPI GQKM SWRGMVQPE LLEDLLPFMDG+PSDH VSLSHKRPRES QAP  H    
Sbjct  256  VIDPITGQKMHSWRGMVQPENLLEDLLPFMDGNPSDHHVSLSHKRPRESSQAPIPHVKSM  315

Query  536  --akeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD  363
                 EDEEL +ALAASME  K+ +   LKE S ++   K    +KKP Y PLPEEPKGD
Sbjct  316  PDENNEDEELQRALAASMENFKEIDGVDLKEVSNTNAEEK----MKKPTYSPLPEEPKGD  371

Query  362  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  183
            ++LVCRVG+RLPDGRR+QRNFLR+DP+QLLWSFC S L+E   +PFRLTQAIPGA+ SLD
Sbjct  372  RSLVCRVGVRLPDGRRVQRNFLRTDPVQLLWSFCYSELKEDRERPFRLTQAIPGASRSLD  431

Query  182  FESNLTFEESGLANSMISVTWD  117
            F+ + TFEESGLAN+M+SVTW+
Sbjct  432  FDVHSTFEESGLANTMVSVTWE  453



>ref|XP_009587838.1| PREDICTED: UBX domain-containing protein 2 [Nicotiana tomentosiformis]
Length=453

 Score =   250 bits (639),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 167/201 (83%), Gaps = 3/201 (1%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhkdda  534
            V+DPI GQKMRSWRGMVQPETLLEDL+ FMD SPS+ HV+LSHKRPRE+PQAP   +   
Sbjct  253  VLDPITGQKMRSWRGMVQPETLLEDLISFMDASPSEYHVNLSHKRPRETPQAPRQPQPQN  312

Query  533  k--eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDK  360
            +  EEDEEL +ALAASMEG++D    A KE++E++  G+E +++KKP YP LPEEPKGD+
Sbjct  313  EIGEEDEELQRALAASMEGIEDPGAVASKETNEANDDGEEKHLIKKPSYPSLPEEPKGDR  372

Query  359  NLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDF  180
             L+CRV IR PDGRRLQRNFLR+D I+LLWSFCS+ LEE + +PFR TQAIPGA+  L++
Sbjct  373  TLLCRVAIRFPDGRRLQRNFLRTDSIKLLWSFCSTQLEEAETRPFRFTQAIPGASKFLEY  432

Query  179  ESNLTFEESGLANSMISVTWD  117
            +SN+TFEESGLANS+IS TW+
Sbjct  433  DSNITFEESGLANSIISFTWE  453



>ref|XP_006355016.1| PREDICTED: UBX domain-containing protein 2-like [Solanum tuberosum]
Length=462

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 171/211 (81%), Gaps = 14/211 (7%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhk---  543
            V+DPI GQKMRSWRGMVQPETLLEDLL FMD SPS+ HV+LSHKRPRE+PQAP   +   
Sbjct  253  VIDPITGQKMRSWRGMVQPETLLEDLLSFMDASPSEYHVNLSHKRPRETPQAPRHPQPQP  312

Query  542  -------ddakeedeellqalaASMEGMKDTNVDALKESSE--SDVLGKETNVVKKPVYP  390
                   ++  EEDEEL +ALAASMEG++D+   A KE++E  SDV+ KE N++KKP YP
Sbjct  313  QPLPQPQNEVGEEDEELQRALAASMEGIEDSGSVASKETNEAASDVV-KEENLIKKPSYP  371

Query  389  PLPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQA  210
            PLPEEPKGD+NL+CRV IR PDGRRLQRNFLR+D I+LLWSFCS+  EE +++PF+ TQA
Sbjct  372  PLPEEPKGDRNLLCRVAIRFPDGRRLQRNFLRTDSIKLLWSFCSTQFEEAESRPFKFTQA  431

Query  209  IPGATSSLDFESNLTFEESGLANSMISVTWD  117
            IPG +  L+F++N+TFEESGLANS+IS TW+
Sbjct  432  IPGVSKFLEFDNNMTFEESGLANSIISFTWE  462



>ref|XP_007222574.1| hypothetical protein PRUPE_ppa008429mg [Prunus persica]
 gb|EMJ23773.1| hypothetical protein PRUPE_ppa008429mg [Prunus persica]
Length=332

 Score =   242 bits (618),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 160/203 (79%), Gaps = 8/203 (4%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES--PQAPPlhkd  540
            ++DPI GQ+MRSW GMVQPE LLEDLLPF+D  P DH V+LSHKRPRES  PQ P   KD
Sbjct  133  IIDPITGQRMRSWNGMVQPECLLEDLLPFLDSGPRDHHVTLSHKRPRESSLPQ-PQKTKD  191

Query  539  dakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETN--VVKKPVYPPLPEEPKG  366
            +  EEDEE+ +ALAASMEGM++T    + +  +  +  KE    + K P YPPLPEEPKG
Sbjct  192  ETNEEDEEVQRALAASMEGMQETG--GISKDKDEIITDKEEEKCLAKTPAYPPLPEEPKG  249

Query  365  DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSL  186
            DKNL+CRVG+RLPDGRR+QRNFLR+DPIQ+LWSFC S L+E + + FRLTQAIPGA+ SL
Sbjct  250  DKNLLCRVGVRLPDGRRVQRNFLRTDPIQMLWSFCYSQLKEAETRRFRLTQAIPGASKSL  309

Query  185  DFESNLTFEESGLANSMISVTWD  117
            D++   TFEESGLANSM+SVTW+
Sbjct  310  DYDCQSTFEESGLANSMVSVTWE  332



>ref|XP_008220984.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Prunus 
mume]
Length=454

 Score =   246 bits (627),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 160/203 (79%), Gaps = 8/203 (4%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES--PQAPPlhkd  540
            ++DPI GQ+MRSW GMVQPE LLEDLLPF+D  P DH V+LSHKRPRES  PQ P   KD
Sbjct  255  IIDPITGQRMRSWNGMVQPECLLEDLLPFLDSGPRDHHVTLSHKRPRESSLPQ-PQKTKD  313

Query  539  dakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETN--VVKKPVYPPLPEEPKG  366
            +  EEDEE+ +ALAASMEGM++T    + +  +  +  KE      K P YPPLPEEPKG
Sbjct  314  ETNEEDEEVQRALAASMEGMQETG--GISKDKDEIITDKEEEKCSAKAPAYPPLPEEPKG  371

Query  365  DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSL  186
            DKNL+CRVG+RLPDGRR+QRNFLR+DPIQ+LWSFC S L+E + +PFRLTQAIPGA+ SL
Sbjct  372  DKNLLCRVGVRLPDGRRVQRNFLRTDPIQMLWSFCYSQLKEAETRPFRLTQAIPGASKSL  431

Query  185  DFESNLTFEESGLANSMISVTWD  117
            D++   TFEESGLANSM+SVTW+
Sbjct  432  DYDCQSTFEESGLANSMVSVTWE  454



>ref|XP_004236895.1| PREDICTED: UBX domain-containing protein 2 [Solanum lycopersicum]
Length=466

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 167/215 (78%), Gaps = 18/215 (8%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhkdda  534
            V+DPI GQKMRSWRGMVQPETLLEDL+ FMD SPS+ HV+LSHKRPRE+PQAP   +   
Sbjct  253  VIDPITGQKMRSWRGMVQPETLLEDLISFMDASPSEYHVNLSHKRPRETPQAPRHPQPQP  312

Query  533  keed--------------eellqalaASMEGMKDTNVDALKESSE--SDVLGKETNVVKK  402
            + +               EEL +ALAASM G++D+   A KE++E  SDV+ KE N++KK
Sbjct  313  QPQPQPQSQPQNEIGEEDEELQRALAASMVGIEDSGSVASKETNEATSDVV-KEENLIKK  371

Query  401  PVYPPLPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFR  222
            P YPPLPEEPKGD+NL+CRV IR PDGRRLQRNFLR+D I+LLWSFCS+  EE +++PF+
Sbjct  372  PSYPPLPEEPKGDRNLLCRVAIRFPDGRRLQRNFLRTDSIKLLWSFCSTQFEEAESRPFK  431

Query  221  LTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  117
             TQAIPG +  L+F++N+TFEESGLANS+IS TW+
Sbjct  432  FTQAIPGVSKFLEFDNNMTFEESGLANSIISFTWE  466



>gb|KHG06883.1| UBX domain-containing 7 [Gossypium arboreum]
Length=453

 Score =   244 bits (622),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 156/202 (77%), Gaps = 5/202 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRES---PQAPPlhk  543
            V+DPI GQKMRSW GMVQPE+LLEDL+ FMDG P D H +LSHKRPR S   PQ      
Sbjct  253  VIDPITGQKMRSWFGMVQPESLLEDLVQFMDGGPRDYHATLSHKRPRGSSVTPQQKIKVS  312

Query  542  ddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD  363
             D   ED+E+L+A+AASME  KD+ +   ++   S    +E+ + KKP YPPLPEEPKGD
Sbjct  313  TDETNEDKEMLRAIAASMENAKDS-IKTTEDDKVSSTTEEESCLTKKPAYPPLPEEPKGD  371

Query  362  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  183
            +NL+CRVG+RLPDGRR+QRNFLR+DPIQLLWSFC S L E ++KPFRLTQ IPGA+ SLD
Sbjct  372  RNLLCRVGVRLPDGRRVQRNFLRTDPIQLLWSFCYSQLGEAESKPFRLTQPIPGASKSLD  431

Query  182  FESNLTFEESGLANSMISVTWD  117
            ++S LTFEESGLANSMI V W+
Sbjct  432  YDSKLTFEESGLANSMILVAWE  453



>ref|XP_008220982.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Prunus 
mume]
Length=456

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 155/204 (76%), Gaps = 8/204 (4%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            ++DPI GQ+MRSW GMVQPE LLEDLLPF+D  P DH V+LSHKRPRES    P     A
Sbjct  255  IIDPITGQRMRSWNGMVQPECLLEDLLPFLDSGPRDHHVTLSHKRPRESSLPQPQKTKVA  314

Query  533  keedee---llqalaASMEGMKDTNVDALKESSESDVLGKETN--VVKKPVYPPLPEEPK  369
             E +EE   + +ALAASMEGM++T    + +  +  +  KE      K P YPPLPEEPK
Sbjct  315  DETNEEDEEVQRALAASMEGMQETG--GISKDKDEIITDKEEEKCSAKAPAYPPLPEEPK  372

Query  368  GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSS  189
            GDKNL+CRVG+RLPDGRR+QRNFLR+DPIQ+LWSFC S L+E + +PFRLTQAIPGA+ S
Sbjct  373  GDKNLLCRVGVRLPDGRRVQRNFLRTDPIQMLWSFCYSQLKEAETRPFRLTQAIPGASKS  432

Query  188  LDFESNLTFEESGLANSMISVTWD  117
            LD++   TFEESGLANSM+SVTW+
Sbjct  433  LDYDCQSTFEESGLANSMVSVTWE  456



>gb|KJB30690.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
Length=450

 Score =   243 bits (621),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 154/199 (77%), Gaps = 2/199 (1%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhkdda  534
            V+DPI GQKMRSW GMVQPE+LLEDL+ FMDG P D H +LSHKRPR S   P     D 
Sbjct  253  VIDPITGQKMRSWFGMVQPESLLEDLVQFMDGGPRDYHATLSHKRPRGSSVTPQQKIKDE  312

Query  533  keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNL  354
              ED+E+L+A+AASME  K++ +   ++   S    +E  + KKP YPPLPEEPKGD+NL
Sbjct  313  TNEDKEMLRAIAASMENAKES-IKTTEDDKVSSTTEEEPCLTKKPAYPPLPEEPKGDRNL  371

Query  353  VCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFES  174
            +CRVG+RLPDGRR+QRNFLR+DPIQLLWSFC S L E ++KPFRLTQ IPGA+ SLD++S
Sbjct  372  LCRVGVRLPDGRRVQRNFLRTDPIQLLWSFCYSQLGEAESKPFRLTQPIPGASKSLDYDS  431

Query  173  NLTFEESGLANSMISVTWD  117
             LTFEESGLANSMI V W+
Sbjct  432  KLTFEESGLANSMILVAWE  450



>ref|XP_007045358.1| UBX domain-containing protein isoform 3 [Theobroma cacao]
 gb|EOY01190.1| UBX domain-containing protein isoform 3 [Theobroma cacao]
Length=451

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 154/199 (77%), Gaps = 1/199 (1%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhkdda  534
            V+DPI GQKMR W GMVQPE+LLEDL+ FMDG P D H +LSHKRPR S   P     D 
Sbjct  253  VIDPITGQKMRFWCGMVQPESLLEDLVQFMDGGPRDYHATLSHKRPRGSSVTPQQKVKDE  312

Query  533  keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNL  354
              EDEE+L+A+AASME +KD    A  +   S++  +E  + KKP YPPLPEEPKGD++L
Sbjct  313  TIEDEEMLRAVAASMENVKDFCKTASGDKVLSNIDKEEPCLTKKPTYPPLPEEPKGDRSL  372

Query  353  VCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFES  174
            +CRVG+RLPDGRR+QRNFLR+D IQLLWSFC + L E ++KPFRLTQ IPGA+ SLDF+S
Sbjct  373  LCRVGVRLPDGRRVQRNFLRTDSIQLLWSFCCAQLGEAESKPFRLTQPIPGASKSLDFDS  432

Query  173  NLTFEESGLANSMISVTWD  117
             LTFEESGLANSMISV W+
Sbjct  433  KLTFEESGLANSMISVAWE  451



>ref|XP_010088526.1| UBX domain-containing protein 2 [Morus notabilis]
 gb|EXB36443.1| UBX domain-containing protein 2 [Morus notabilis]
Length=486

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 159/209 (76%), Gaps = 13/209 (6%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQA-------P  555
            V+DPI GQKMRSW GMV+PE LLEDLLPFM+G P DH V+LSHKRPRES  A        
Sbjct  280  VIDPITGQKMRSWNGMVEPERLLEDLLPFMEGGPRDHHVTLSHKRPRESSFARPQKTKDA  339

Query  554  PlhkddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVV---KKPVYPPL  384
            P+  D   EEDEE+LQA+AASMEG+K T+        E + L  +  +    KKP YPPL
Sbjct  340  PVVADKTSEEDEEVLQAIAASMEGIKGTS--GWGSDDEDENLTNQEEITCQDKKPSYPPL  397

Query  383  PEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIP  204
            PEEPKGDK L+CRVGIRLP GRR+QRNFLR+DPIQLLWSFC S L E + +PFRLT+AIP
Sbjct  398  PEEPKGDKTLLCRVGIRLPGGRRVQRNFLRTDPIQLLWSFCCSQLTEGETRPFRLTEAIP  457

Query  203  GATSSLDFESNLTFEESGLANSMISVTWD  117
            GA+ SLD++S LTFEESGLANSMISVTW+
Sbjct  458  GASKSLDYDSQLTFEESGLANSMISVTWE  486



>gb|KJB30689.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
Length=430

 Score =   240 bits (613),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 155/202 (77%), Gaps = 5/202 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRES---PQAPPlhk  543
            V+DPI GQKMRSW GMVQPE+LLEDL+ FMDG P D H +LSHKRPR S   PQ      
Sbjct  230  VIDPITGQKMRSWFGMVQPESLLEDLVQFMDGGPRDYHATLSHKRPRGSSVTPQQKIKVS  289

Query  542  ddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD  363
             D   ED+E+L+A+AASME  K++ +   ++   S    +E  + KKP YPPLPEEPKGD
Sbjct  290  TDETNEDKEMLRAIAASMENAKES-IKTTEDDKVSSTTEEEPCLTKKPAYPPLPEEPKGD  348

Query  362  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  183
            +NL+CRVG+RLPDGRR+QRNFLR+DPIQLLWSFC S L E ++KPFRLTQ IPGA+ SLD
Sbjct  349  RNLLCRVGVRLPDGRRVQRNFLRTDPIQLLWSFCYSQLGEAESKPFRLTQPIPGASKSLD  408

Query  182  FESNLTFEESGLANSMISVTWD  117
            ++S LTFEESGLANSMI V W+
Sbjct  409  YDSKLTFEESGLANSMILVAWE  430



>gb|KDO53546.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=248

 Score =   234 bits (597),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 154/200 (77%), Gaps = 2/200 (1%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhkdda  534
            VVDPI GQKMRSW GMVQPE+LLEDL+PFMDG P + H  +SHKRPR S   P     D 
Sbjct  49   VVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTPQQKNKDK  108

Query  533  -keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN  357
               E+EELLQALAASME +KD +  +  ++  +     E +  +KP YP LPEEPK D++
Sbjct  109  PDIENEELLQALAASMETIKDASGVSSSDTDVASTDKDEASATEKPAYPILPEEPKVDRS  168

Query  356  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  177
            L+CRVG+RLPDGRR+QRNFLR+DPIQLLWS+C S LE ++ KPFRLT AIPGAT SLD++
Sbjct  169  LLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYD  228

Query  176  SNLTFEESGLANSMISVTWD  117
            S LTFE+SGLAN+MISVTW+
Sbjct  229  SKLTFEDSGLANAMISVTWE  248



>gb|KDP38216.1| hypothetical protein JCGZ_04859 [Jatropha curcas]
Length=454

 Score =   241 bits (614),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 158/203 (78%), Gaps = 6/203 (3%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            V+DPI GQKMR+W GM+QPE+LLEDL+PF+DG P +H ++LSHKRPR S QAP  +   +
Sbjct  253  VIDPITGQKMRAWSGMIQPESLLEDLVPFLDGGPREHHLTLSHKRPRGSSQAPQKNTASS  312

Query  533  keedee---llqalaASMEGMKDTNVDALKESSESDV-LGKETNVVKKPVYPPLPEEPKG  366
               ++E   + +ALAAS++GMKD+NV A      +    G++T  +KKP YPPLPEEPKG
Sbjct  313  NATNKEDEEVQRALAASLDGMKDSNVMASDNKGATTAEKGEDTYSIKKPTYPPLPEEPKG  372

Query  365  DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSL  186
            D +L+CRVG+RLPDGRR+QR+FL++DP+QLLWSFC S LEE   +PFRLTQAIPGA  +L
Sbjct  373  DSSLMCRVGLRLPDGRRVQRHFLKTDPVQLLWSFCVSQLEEASRRPFRLTQAIPGA-KTL  431

Query  185  DFESNLTFEESGLANSMISVTWD  117
            D+ES LTF ESGLANSM+ V W+
Sbjct  432  DYESKLTFGESGLANSMMLVAWE  454



>gb|KJB30687.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
 gb|KJB30691.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
Length=453

 Score =   240 bits (613),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 155/202 (77%), Gaps = 5/202 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRES---PQAPPlhk  543
            V+DPI GQKMRSW GMVQPE+LLEDL+ FMDG P D H +LSHKRPR S   PQ      
Sbjct  253  VIDPITGQKMRSWFGMVQPESLLEDLVQFMDGGPRDYHATLSHKRPRGSSVTPQQKIKVS  312

Query  542  ddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD  363
             D   ED+E+L+A+AASME  K++ +   ++   S    +E  + KKP YPPLPEEPKGD
Sbjct  313  TDETNEDKEMLRAIAASMENAKES-IKTTEDDKVSSTTEEEPCLTKKPAYPPLPEEPKGD  371

Query  362  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  183
            +NL+CRVG+RLPDGRR+QRNFLR+DPIQLLWSFC S L E ++KPFRLTQ IPGA+ SLD
Sbjct  372  RNLLCRVGVRLPDGRRVQRNFLRTDPIQLLWSFCYSQLGEAESKPFRLTQPIPGASKSLD  431

Query  182  FESNLTFEESGLANSMISVTWD  117
            ++S LTFEESGLANSMI V W+
Sbjct  432  YDSKLTFEESGLANSMILVAWE  453



>ref|XP_007045357.1| UBX domain-containing protein isoform 2 [Theobroma cacao]
 gb|EOY01189.1| UBX domain-containing protein isoform 2 [Theobroma cacao]
Length=454

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRES---PQAPPlhk  543
            V+DPI GQKMR W GMVQPE+LLEDL+ FMDG P D H +LSHKRPR S   PQ      
Sbjct  253  VIDPITGQKMRFWCGMVQPESLLEDLVQFMDGGPRDYHATLSHKRPRGSSVTPQQKVKVS  312

Query  542  ddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD  363
             D   EDEE+L+A+AASME +KD    A  +   S++  +E  + KKP YPPLPEEPKGD
Sbjct  313  TDETIEDEEMLRAVAASMENVKDFCKTASGDKVLSNIDKEEPCLTKKPTYPPLPEEPKGD  372

Query  362  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  183
            ++L+CRVG+RLPDGRR+QRNFLR+D IQLLWSFC + L E ++KPFRLTQ IPGA+ SLD
Sbjct  373  RSLLCRVGVRLPDGRRVQRNFLRTDSIQLLWSFCCAQLGEAESKPFRLTQPIPGASKSLD  432

Query  182  FESNLTFEESGLANSMISVTWD  117
            F+S LTFEESGLANSMISV W+
Sbjct  433  FDSKLTFEESGLANSMISVAWE  454



>ref|XP_006470883.1| PREDICTED: UBX domain-containing protein 2-like [Citrus sinensis]
Length=444

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 156/200 (78%), Gaps = 2/200 (1%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhkdda  534
            VVDPI GQKMRSW GMVQPE+LLEDL+PFMDG P + H  +SHKRPR S   P     D 
Sbjct  245  VVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTPQQKNKDK  304

Query  533  -keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN  357
               E+EELLQALAASME +KD +  +  ++  +    +ET+  +KP YP LPEEPK D++
Sbjct  305  PDIENEELLQALAASMETIKDASGVSSSDTDVASTDKEETSATEKPAYPALPEEPKVDRS  364

Query  356  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  177
            L+CRVG+RLPDGRR+QRNFLR+DPIQLLWS+C S LE ++ KPFRLT AIPGAT SLD++
Sbjct  365  LLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYD  424

Query  176  SNLTFEESGLANSMISVTWD  117
            S LTFE+SGLAN+MISVTW+
Sbjct  425  SKLTFEDSGLANAMISVTWE  444



>ref|XP_007045359.1| UBX domain-containing protein isoform 4, partial [Theobroma cacao]
 gb|EOY01191.1| UBX domain-containing protein isoform 4, partial [Theobroma cacao]
Length=429

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRES---PQAPPlhk  543
            V+DPI GQKMR W GMVQPE+LLEDL+ FMDG P D H +LSHKRPR S   PQ      
Sbjct  228  VIDPITGQKMRFWCGMVQPESLLEDLVQFMDGGPRDYHATLSHKRPRGSSVTPQQKVKVS  287

Query  542  ddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD  363
             D   EDEE+L+A+AASME +KD    A  +   S++  +E  + KKP YPPLPEEPKGD
Sbjct  288  TDETIEDEEMLRAVAASMENVKDFCKTASGDKVLSNIDKEEPCLTKKPTYPPLPEEPKGD  347

Query  362  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  183
            ++L+CRVG+RLPDGRR+QRNFLR+D IQLLWSFC + L E ++KPFRLTQ IPGA+ SLD
Sbjct  348  RSLLCRVGVRLPDGRRVQRNFLRTDSIQLLWSFCCAQLGEAESKPFRLTQPIPGASKSLD  407

Query  182  FESNLTFEESGLANSMISVTWD  117
            F+S LTFEESGLANSMISV W+
Sbjct  408  FDSKLTFEESGLANSMISVAWE  429



>ref|XP_007045356.1| UBX domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY01188.1| UBX domain-containing protein isoform 1 [Theobroma cacao]
Length=479

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRES---PQAPPlhk  543
            V+DPI GQKMR W GMVQPE+LLEDL+ FMDG P D H +LSHKRPR S   PQ      
Sbjct  278  VIDPITGQKMRFWCGMVQPESLLEDLVQFMDGGPRDYHATLSHKRPRGSSVTPQQKVKVS  337

Query  542  ddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD  363
             D   EDEE+L+A+AASME +KD    A  +   S++  +E  + KKP YPPLPEEPKGD
Sbjct  338  TDETIEDEEMLRAVAASMENVKDFCKTASGDKVLSNIDKEEPCLTKKPTYPPLPEEPKGD  397

Query  362  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  183
            ++L+CRVG+RLPDGRR+QRNFLR+D IQLLWSFC + L E ++KPFRLTQ IPGA+ SLD
Sbjct  398  RSLLCRVGVRLPDGRRVQRNFLRTDSIQLLWSFCCAQLGEAESKPFRLTQPIPGASKSLD  457

Query  182  FESNLTFEESGLANSMISVTWD  117
            F+S LTFEESGLANSMISV W+
Sbjct  458  FDSKLTFEESGLANSMISVAWE  479



>ref|XP_003531952.1| PREDICTED: UBX domain-containing protein 7-like isoform 1 [Glycine 
max]
Length=468

 Score =   238 bits (608),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 156/205 (76%), Gaps = 7/205 (3%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            V+DPI GQKMRSW GMVQPE+LLE LL F+D  P DH ++LSHKRPR S   P       
Sbjct  264  VIDPITGQKMRSWIGMVQPESLLEGLLAFLDAGPKDHHITLSHKRPRGSSSPPKSKALVE  323

Query  533  keedeel----lqalaASMEGMKDTNVDALKESSESDV--LGKETNVVKKPVYPPLPEEP  372
             +E++E      +ALAASME MK++ V   +++ ++DV   G++T + K+P+YP LPEEP
Sbjct  324  SDENKEEDEEVQRALAASMESMKESTVMTGRDNIDTDVAVYGQQTTLAKRPIYPALPEEP  383

Query  371  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  192
            K ++NL+CRVG+RLPDG R+QRNFLR+DPIQLLWSF S+ L E + KPFRLT AIPGA+ 
Sbjct  384  KVERNLLCRVGVRLPDGHRIQRNFLRTDPIQLLWSFISAQLGEDERKPFRLTHAIPGASK  443

Query  191  SLDFESNLTFEESGLANSMISVTWD  117
             LD+ESN TF+ESGLANSMISVTWD
Sbjct  444  ILDYESNSTFQESGLANSMISVTWD  468



>gb|KDO53545.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=342

 Score =   234 bits (597),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 154/200 (77%), Gaps = 2/200 (1%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhkdda  534
            VVDPI GQKMRSW GMVQPE+LLEDL+PFMDG P + H  +SHKRPR S   P     D 
Sbjct  143  VVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTPQQKNKDK  202

Query  533  -keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN  357
               E+EELLQALAASME +KD +  +  ++  +     E +  +KP YP LPEEPK D++
Sbjct  203  PDIENEELLQALAASMETIKDASGVSSSDTDVASTDKDEASATEKPAYPILPEEPKVDRS  262

Query  356  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  177
            L+CRVG+RLPDGRR+QRNFLR+DPIQLLWS+C S LE ++ KPFRLT AIPGAT SLD++
Sbjct  263  LLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYD  322

Query  176  SNLTFEESGLANSMISVTWD  117
            S LTFE+SGLAN+MISVTW+
Sbjct  323  SKLTFEDSGLANAMISVTWE  342



>ref|XP_010680042.1| PREDICTED: UBX domain-containing protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=454

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 154/202 (76%), Gaps = 5/202 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAP-Plhkdd  537
            V+DPI GQKMRSW GMV P+ LLEDLLPFMDG P +H  SLSHKRPRES  A  P  + +
Sbjct  254  VIDPITGQKMRSWSGMVHPDRLLEDLLPFMDGGPKNHHTSLSHKRPRESSHAAAPKVQVE  313

Query  536  akeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN  357
              EEDEEL +ALAASME   D      K +  +D + KET   KKPVY PLPEEPKGD+N
Sbjct  314  TNEEDEELQRALAASMEKHPDEVASEEKNAVAAD-MEKETCSTKKPVYLPLPEEPKGDRN  372

Query  356  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQA--IPGATSSLD  183
            ++CRVG RLPDGRR+QRNFLR+DPIQLLWSFCSS L E + +PFRLT A  IPG   SL+
Sbjct  373  ILCRVGFRLPDGRRVQRNFLRTDPIQLLWSFCSSQLGEAETRPFRLTHAIGIPGPAKSLE  432

Query  182  FESNLTFEESGLANSMISVTWD  117
            ++S LTFEESG++NSMISVTW+
Sbjct  433  YDSKLTFEESGVSNSMISVTWE  454



>gb|KDO53543.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=444

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 154/200 (77%), Gaps = 2/200 (1%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhkdda  534
            VVDPI GQKMRSW GMVQPE+LLEDL+PFMDG P + H  +SHKRPR S   P     D 
Sbjct  245  VVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTPQQKNKDK  304

Query  533  -keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN  357
               E+EELLQALAASME +KD +  +  ++  +     E +  +KP YP LPEEPK D++
Sbjct  305  PDIENEELLQALAASMETIKDASGVSSSDTDVASTDKDEASATEKPAYPILPEEPKVDRS  364

Query  356  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  177
            L+CRVG+RLPDGRR+QRNFLR+DPIQLLWS+C S LE ++ KPFRLT AIPGAT SLD++
Sbjct  365  LLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYD  424

Query  176  SNLTFEESGLANSMISVTWD  117
            S LTFE+SGLAN+MISVTW+
Sbjct  425  SKLTFEDSGLANAMISVTWE  444



>gb|KDO53544.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=445

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 154/200 (77%), Gaps = 2/200 (1%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhkdda  534
            VVDPI GQKMRSW GMVQPE+LLEDL+PFMDG P + H  +SHKRPR S   P     D 
Sbjct  246  VVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTPQQKNKDK  305

Query  533  -keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN  357
               E+EELLQALAASME +KD +  +  ++  +     E +  +KP YP LPEEPK D++
Sbjct  306  PDIENEELLQALAASMETIKDASGVSSSDTDVASTDKDEASATEKPAYPILPEEPKVDRS  365

Query  356  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  177
            L+CRVG+RLPDGRR+QRNFLR+DPIQLLWS+C S LE ++ KPFRLT AIPGAT SLD++
Sbjct  366  LLCRVGVRLPDGRRMQRNFLRTDPIQLLWSYCYSQLEGSEMKPFRLTHAIPGATKSLDYD  425

Query  176  SNLTFEESGLANSMISVTWD  117
            S LTFE+SGLAN+MISVTW+
Sbjct  426  SKLTFEDSGLANAMISVTWE  445



>gb|EYU30238.1| hypothetical protein MIMGU_mgv1a006061mg [Erythranthe guttata]
Length=458

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 156/205 (76%), Gaps = 10/205 (5%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            ++DPI GQK+ +WRGMVQPE LLEDL+PFMDGSPSDH VSLSHKRPR   +AP  H   A
Sbjct  257  LIDPITGQKLHAWRGMVQPENLLEDLVPFMDGSPSDHHVSLSHKRPRVHTEAPVHHIQSA  316

Query  533  keedeel------lqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP  372
              E+ +        +ALAASM   K+ +    KE +E++   ++    KKP Y PLPEEP
Sbjct  317  AAENHDEDEEEELQRALAASMVDTKEIDEGDSKEVTEANNAEEKE---KKPSYLPLPEEP  373

Query  371  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  192
            KGD++L+CRVG+RLPDGRR+QRNFLR+DP+QLLWSFC S ++E D+KPFR+TQAIPGA+ 
Sbjct  374  KGDRSLLCRVGVRLPDGRRVQRNFLRTDPVQLLWSFCYSEMKEIDSKPFRITQAIPGASR  433

Query  191  SLDFESNLTFEESGLANSMISVTWD  117
            SLD++   TF ESGLANSM+SVTW+
Sbjct  434  SLDYDVTSTFAESGLANSMVSVTWE  458



>gb|EYU30237.1| hypothetical protein MIMGU_mgv1a006061mg [Erythranthe guttata]
Length=459

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 156/205 (76%), Gaps = 10/205 (5%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            ++DPI GQK+ +WRGMVQPE LLEDL+PFMDGSPSDH VSLSHKRPR   +AP  H   A
Sbjct  258  LIDPITGQKLHAWRGMVQPENLLEDLVPFMDGSPSDHHVSLSHKRPRVHTEAPVHHIQSA  317

Query  533  keedeel------lqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP  372
              E+ +        +ALAASM   K+ +    KE +E++   ++    KKP Y PLPEEP
Sbjct  318  AAENHDEDEEEELQRALAASMVDTKEIDEGDSKEVTEANNAEEKE---KKPSYLPLPEEP  374

Query  371  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  192
            KGD++L+CRVG+RLPDGRR+QRNFLR+DP+QLLWSFC S ++E D+KPFR+TQAIPGA+ 
Sbjct  375  KGDRSLLCRVGVRLPDGRRVQRNFLRTDPVQLLWSFCYSEMKEIDSKPFRITQAIPGASR  434

Query  191  SLDFESNLTFEESGLANSMISVTWD  117
            SLD++   TF ESGLANSM+SVTW+
Sbjct  435  SLDYDVTSTFAESGLANSMVSVTWE  459



>gb|EYU30239.1| hypothetical protein MIMGU_mgv1a006061mg [Erythranthe guttata]
Length=458

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 156/204 (76%), Gaps = 9/204 (4%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            ++DPI GQK+ +WRGMVQPE LLEDL+PFMDGSPSDH VSLSHKRPR   +AP  H   A
Sbjct  258  LIDPITGQKLHAWRGMVQPENLLEDLVPFMDGSPSDHHVSLSHKRPRVHTEAPVHHIQSA  317

Query  533  keedeel-----lqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPK  369
             E  +E       +ALAASM   K+ +    KE +E++   ++    KKP Y PLPEEPK
Sbjct  318  AENHDEDEEEELQRALAASMVDTKEIDEGDSKEVTEANNAEEKE---KKPSYLPLPEEPK  374

Query  368  GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSS  189
            GD++L+CRVG+RLPDGRR+QRNFLR+DP+QLLWSFC S ++E D+KPFR+TQAIPGA+ S
Sbjct  375  GDRSLLCRVGVRLPDGRRVQRNFLRTDPVQLLWSFCYSEMKEIDSKPFRITQAIPGASRS  434

Query  188  LDFESNLTFEESGLANSMISVTWD  117
            LD++   TF ESGLANSM+SVTW+
Sbjct  435  LDYDVTSTFAESGLANSMVSVTWE  458



>ref|XP_002521873.1| UBX domain-containing protein, putative [Ricinus communis]
 gb|EEF40509.1| UBX domain-containing protein, putative [Ricinus communis]
Length=452

 Score =   233 bits (593),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 133/212 (63%), Positives = 162/212 (76%), Gaps = 17/212 (8%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAP-------  555
            V+DPI GQKMR+W GMVQPE LLEDL+P+MDG P DH V+LSHKRPR S QA        
Sbjct  244  VIDPITGQKMRAWSGMVQPECLLEDLVPYMDGGPRDHHVTLSHKRPRGSSQALQKNKGKL  303

Query  554  ---PlhkddakeedeellqalaASMEGMKDTN---VDALKESSESDVLGKETNVVKKPVY  393
               P   ++  EEDEE+L+ALAASMEGMKD+N    D  KE++ +D   K  +  K   Y
Sbjct  304  GLLPAFTNETNEEDEEMLRALAASMEGMKDSNRMPSDG-KEAASADEDEKSCST-KILAY  361

Query  392  PPLPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQ  213
            PPLPEEPKG+++++CRVG+RLPDGRR+QRNFL++DPIQLLWSFC+S LEE   +PFRLTQ
Sbjct  362  PPLPEEPKGERSILCRVGLRLPDGRRIQRNFLKTDPIQLLWSFCTSQLEEAGTRPFRLTQ  421

Query  212  AIPGATSSLDFESNLTFEESGLANSMISVTWD  117
            AIPGA  SLD++S +TF ESGLANSMISV W+
Sbjct  422  AIPGA-KSLDYDSKVTFGESGLANSMISVAWE  452



>ref|XP_003547850.1| PREDICTED: UBX domain-containing protein 7-like isoform 1 [Glycine 
max]
 gb|KHN44547.1| UBX domain-containing protein 7 [Glycine soja]
Length=467

 Score =   233 bits (593),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 153/205 (75%), Gaps = 7/205 (3%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            V+DPI GQKMRSW GMVQPE+LLE LL F+D  P DH +++SHKRPR S   P       
Sbjct  263  VIDPITGQKMRSWIGMVQPESLLEGLLAFLDAGPKDHHITMSHKRPRGSSSPPKSKALVE  322

Query  533  k----eedeellqalaASMEGMKDTNVDALKESSESDVL--GKETNVVKKPVYPPLPEEP  372
                 EE EE+ +ALAASME MK++   A +++ ++DV   G+ET + K+P YP LPEEP
Sbjct  323  SDENKEEYEEVQRALAASMESMKESTAMAGRDNKDADVAVNGQETPMAKRPTYPTLPEEP  382

Query  371  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  192
            K ++NL+CRVG+RLPDGRR+QRNFLR+DPIQLLWSF S+ L E +   FRLT AIPGA+ 
Sbjct  383  KVERNLLCRVGVRLPDGRRVQRNFLRTDPIQLLWSFISAQLGEDETNSFRLTHAIPGASK  442

Query  191  SLDFESNLTFEESGLANSMISVTWD  117
             LD+E N TF+ESGLANSMISVTWD
Sbjct  443  ILDYEINSTFQESGLANSMISVTWD  467



>gb|KHN06997.1| UBX domain-containing protein 7 [Glycine soja]
Length=494

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 155/205 (76%), Gaps = 7/205 (3%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            V+DPI GQKMRSW GMVQPE+LLE LL F+D  P DH ++LSHKRPR S   P       
Sbjct  290  VIDPITGQKMRSWIGMVQPESLLEGLLAFLDAGPKDHHITLSHKRPRGSSSPPKSKALVE  349

Query  533  keedeel----lqalaASMEGMKDTNVDALKESSESDV--LGKETNVVKKPVYPPLPEEP  372
             +E++E      +ALAASME MK++ V   +++ ++DV   G++T + K+ +YP LPEEP
Sbjct  350  SDENKEEDEEVQRALAASMESMKESTVMTGRDNIDTDVAVYGQQTTLAKRLIYPALPEEP  409

Query  371  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  192
            K ++NL+CRVG+RLPDG R+QRNFLR+DPIQLLWSF S+ L E + KPFRLT AIPGA+ 
Sbjct  410  KVERNLLCRVGVRLPDGHRIQRNFLRTDPIQLLWSFISAQLGEDERKPFRLTHAIPGASK  469

Query  191  SLDFESNLTFEESGLANSMISVTWD  117
             LD+ESN TF+ESGLANSMISVTWD
Sbjct  470  ILDYESNSTFQESGLANSMISVTWD  494



>ref|XP_007156392.1| hypothetical protein PHAVU_003G282600g [Phaseolus vulgaris]
 gb|ESW28386.1| hypothetical protein PHAVU_003G282600g [Phaseolus vulgaris]
Length=461

 Score =   230 bits (587),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 160/206 (78%), Gaps = 8/206 (4%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPP----lh  546
            V+DPI GQKMRSW GMV PE+LLE LL F+D  P DH ++LSHKRPR S   P     + 
Sbjct  256  VIDPITGQKMRSWIGMVPPESLLEGLLAFLDAGPKDHHITLSHKRPRGSSSPPKPKALVE  315

Query  545  kddakeedeellqalaASMEGMKD-TNVDALKESSESDVL--GKETNVVKKPVYPPLPEE  375
             ++ KEEDEE+ +ALAASME MK+ T +    ++ ++DV   G+ET + K+P YPPLPEE
Sbjct  316  SNENKEEDEEVQRALAASMESMKESTAMAGGGDNKDADVAVNGQETKLAKRPTYPPLPEE  375

Query  374  PKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGAT  195
            PK ++NL+CRVG+RLP G+R+QRNFLR+DPIQLLWSF S+ L E + KPFRLT AIPGA+
Sbjct  376  PKAERNLLCRVGVRLPGGQRVQRNFLRTDPIQLLWSFISTQLGEDETKPFRLTHAIPGAS  435

Query  194  SSLDFESNLTFEESGLANSMISVTWD  117
             +LD+ESN TF++SGLANSMISVTWD
Sbjct  436  KNLDYESNSTFQDSGLANSMISVTWD  461



>ref|XP_004509607.1| PREDICTED: UBX domain-containing protein 7-like [Cicer arietinum]
Length=460

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 157/205 (77%), Gaps = 7/205 (3%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS-LSHKRPRESPQAPPlhkd--  540
            ++DPI GQKMRSW GMVQPE+LLE LL F+D  P DH S LSHKRPR S   P       
Sbjct  256  IIDPITGQKMRSWSGMVQPESLLEGLLTFLDVGPKDHHSTLSHKRPRGSSSPPKTKAIVD  315

Query  539  --dakeedeellqalaASMEGMKDTNVDALKESSESDVLGK--ETNVVKKPVYPPLPEEP  372
               +KEEDEE+ +ALAAS+E MK+ +  A  ++ +++V GK  ET + K+PVYP LPEEP
Sbjct  316  SDASKEEDEEVQRALAASLENMKELSAIAGGDNKDANVAGKLQETALSKRPVYPTLPEEP  375

Query  371  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  192
            K ++NL+CRVG+RLPDGRR+QRNFLRSDPIQLLWSF +  L E + K F+LT AIPGA+ 
Sbjct  376  KAERNLLCRVGLRLPDGRRVQRNFLRSDPIQLLWSFIAVQLGEDETKAFKLTHAIPGASK  435

Query  191  SLDFESNLTFEESGLANSMISVTWD  117
            +LD+ESN TF+ESGLANSMISVTW+
Sbjct  436  NLDYESNSTFDESGLANSMISVTWE  460



>ref|XP_011025166.1| PREDICTED: UBX domain-containing protein 7-like [Populus euphratica]
Length=455

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 152/205 (74%), Gaps = 8/205 (4%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAP-----Pl  549
            V+DPI GQKM SW GMVQPE+LLEDL+PFMDG P DH  +LSHKR R S   P     P+
Sbjct  252  VIDPITGQKMHSWVGMVQPESLLEDLVPFMDGGPRDHHKTLSHKRLRGSSLTPQKSKAPV  311

Query  548  hkddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKK-PVYPPLPEEP  372
               +  EED+E+ +ALAASME MK+++  A  +  E+    +E     + P+YPPLPEEP
Sbjct  312  PAYETNEEDKEVQKALAASMESMKESSAVASNDKDEASTTQEEEKCSSRMPMYPPLPEEP  371

Query  371  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  192
             GDK+L+CRVGIRLPDGRR+QRNFL++DPIQLLWSFC S LEE   K FRLT+AIPGA  
Sbjct  372  SGDKSLLCRVGIRLPDGRRVQRNFLKTDPIQLLWSFCYSQLEEAGTKLFRLTEAIPGA-K  430

Query  191  SLDFESNLTFEESGLANSMISVTWD  117
             LD++S +TF ESGLANSMISV WD
Sbjct  431  RLDYDSKMTFGESGLANSMISVAWD  455



>ref|XP_010654914.1| PREDICTED: UBX domain-containing protein 2 isoform X3 [Vitis 
vinifera]
Length=453

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 154/201 (77%), Gaps = 3/201 (1%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            V+DPI GQKMRSW GM+QPE LLEDLLPFMDG P DH V+LSHKRPRES   PP    D 
Sbjct  253  VIDPITGQKMRSWCGMIQPERLLEDLLPFMDGGPKDHHVTLSHKRPRESSLTPPQKIQDE  312

Query  533  keed-eellqalaASMEGMKDTNVDALKESSESDVLGKETNV-VKKPVYPPLPEEPKGDK  360
              E+ EE+  ALAASM  MKD +    KE   +    KE     KKP YPPLPEEPKGD+
Sbjct  313  TNEEDEEVQLALAASMASMKDPSGLTSKEKDVTTTDKKEEMCSAKKPEYPPLPEEPKGDR  372

Query  359  NLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDF  180
            NL+CRVG+RLPDGRR+QRNFLR+DPIQLLWSFC S LEE  ++PF LTQAIPGA+ +LD+
Sbjct  373  NLLCRVGVRLPDGRRIQRNFLRTDPIQLLWSFCYSQLEEVVSRPFHLTQAIPGASQNLDY  432

Query  179  ESNLTFEESGLANSMISVTWD  117
            +  LTFEESGLANSMISVTW+
Sbjct  433  DRELTFEESGLANSMISVTWE  453



>ref|XP_002311564.2| hypothetical protein POPTR_0008s14230g [Populus trichocarpa]
 gb|EEE88931.2| hypothetical protein POPTR_0008s14230g [Populus trichocarpa]
Length=455

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 152/205 (74%), Gaps = 8/205 (4%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAP-----Pl  549
            V+DPI GQKM SW GMVQPE+LLEDL+PFMDG P DH  +LSHKR R S   P     P+
Sbjct  252  VIDPITGQKMHSWVGMVQPESLLEDLVPFMDGGPRDHHKTLSHKRLRGSSLTPQKSKAPV  311

Query  548  hkddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKK-PVYPPLPEEP  372
               +  EEDEE+ +ALAASME MK+++  A  +  E+    +E N   + P+YPPLPEEP
Sbjct  312  PAYETNEEDEEVQRALAASMESMKESSAVASNDKDEASTTQEEENCSSRMPMYPPLPEEP  371

Query  371  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  192
             GDK+L+CRVGIRLPDG R+QRNFL++DPIQLLWSFC S LEE   K FRLT+AIPG + 
Sbjct  372  SGDKSLLCRVGIRLPDGHRVQRNFLKTDPIQLLWSFCYSQLEEAGTKLFRLTEAIPG-SK  430

Query  191  SLDFESNLTFEESGLANSMISVTWD  117
             LD++S +TF ESGLANSMISV WD
Sbjct  431  RLDYDSKMTFGESGLANSMISVAWD  455



>ref|XP_006855568.1| hypothetical protein AMTR_s00044p00018360 [Amborella trichopoda]
 gb|ERN17035.1| hypothetical protein AMTR_s00044p00018360 [Amborella trichopoda]
Length=442

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 148/204 (73%), Gaps = 6/204 (3%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddak  531
            V+DP+ GQKMR W GMV P+ LLEDL+P+MD  P DH  + HKRPRE+  A      D  
Sbjct  239  VIDPVTGQKMRGWSGMVGPDRLLEDLVPYMDKGPMDHHPIPHKRPRETTPAAKATLQDKH  298

Query  530  eede--ellqalaASMEGMKD----TNVDALKESSESDVLGKETNVVKKPVYPPLPEEPK  369
             EDE  E+ +A AAS+EGMK+    +N    +E+     + +      KP YPPLPEEPK
Sbjct  299  TEDEDEEIQRAFAASLEGMKEPMVPSNGGDNRETDSEAKVEQTCPSTTKPSYPPLPEEPK  358

Query  368  GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSS  189
            GD++L+CRVG+RLPDGRRLQRNFLR DPIQLLWSFC S ++E + +PF+LTQAIPGA+  
Sbjct  359  GDRSLLCRVGVRLPDGRRLQRNFLRKDPIQLLWSFCCSEVKEANIQPFKLTQAIPGASKY  418

Query  188  LDFESNLTFEESGLANSMISVTWD  117
            LD+ SNLTFEESGL NSMIS+TWD
Sbjct  419  LDYNSNLTFEESGLLNSMISLTWD  442



>ref|XP_010654910.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Vitis 
vinifera]
Length=454

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 152/204 (75%), Gaps = 6/204 (3%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            V+DPI GQKMRSW GM+QPE LLEDLLPFMDG P DH V+LSHKRPRES   PP     A
Sbjct  251  VIDPITGQKMRSWCGMIQPERLLEDLLPFMDGGPKDHHVTLSHKRPRESSLTPPQKIQVA  310

Query  533  keedeel----lqalaASMEGMKDTNVDALKESSESDVLGKETNV-VKKPVYPPLPEEPK  369
             +E  E       ALAASM  MKD +    KE   +    KE     KKP YPPLPEEPK
Sbjct  311  ADETNEEDEEVQLALAASMASMKDPSGLTSKEKDVTTTDKKEEMCSAKKPEYPPLPEEPK  370

Query  368  GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSS  189
            GD+NL+CRVG+RLPDGRR+QRNFLR+DPIQLLWSFC S LEE  ++PF LTQAIPGA+ +
Sbjct  371  GDRNLLCRVGVRLPDGRRIQRNFLRTDPIQLLWSFCYSQLEEVVSRPFHLTQAIPGASQN  430

Query  188  LDFESNLTFEESGLANSMISVTWD  117
            LD++  LTFEESGLANSMISVTW+
Sbjct  431  LDYDRELTFEESGLANSMISVTWE  454



>ref|XP_003631347.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Vitis 
vinifera]
 emb|CBI27509.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 152/204 (75%), Gaps = 6/204 (3%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            V+DPI GQKMRSW GM+QPE LLEDLLPFMDG P DH V+LSHKRPRES   PP     A
Sbjct  253  VIDPITGQKMRSWCGMIQPERLLEDLLPFMDGGPKDHHVTLSHKRPRESSLTPPQKIQVA  312

Query  533  keedeel----lqalaASMEGMKDTNVDALKESSESDVLGKETNV-VKKPVYPPLPEEPK  369
             +E  E       ALAASM  MKD +    KE   +    KE     KKP YPPLPEEPK
Sbjct  313  ADETNEEDEEVQLALAASMASMKDPSGLTSKEKDVTTTDKKEEMCSAKKPEYPPLPEEPK  372

Query  368  GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSS  189
            GD+NL+CRVG+RLPDGRR+QRNFLR+DPIQLLWSFC S LEE  ++PF LTQAIPGA+ +
Sbjct  373  GDRNLLCRVGVRLPDGRRIQRNFLRTDPIQLLWSFCYSQLEEVVSRPFHLTQAIPGASQN  432

Query  188  LDFESNLTFEESGLANSMISVTWD  117
            LD++  LTFEESGLANSMISVTW+
Sbjct  433  LDYDRELTFEESGLANSMISVTWE  456



>ref|XP_011463491.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=486

 Score =   224 bits (571),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 153/204 (75%), Gaps = 9/204 (4%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES--PQAPPlhkd  540
            ++DPI GQKMRSW GMV PE LLEDLL FMD  P DH ++LS+KRPRES  PQ P    +
Sbjct  286  ILDPITGQKMRSWNGMVHPERLLEDLLLFMDSGPRDHHLALSNKRPRESSLPQ-PQNTNE  344

Query  539  dakeedeellqalaASMEGMKDTNVDALKESSESDVLG---KETNVVKKPVYPPLPEEPK  369
               EEDEE+ +ALAASM  MK+T+    K+  E +++    +ET++ KKP YPPLPEEP 
Sbjct  345  QTNEEDEEVQRALAASMGSMKETSGTISKD--EGEIITDKEEETSLPKKPTYPPLPEEPS  402

Query  368  GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSS  189
            GDK+ +CRVG+RLPDGRR QRNFLR DPIQLLWSFC S L+E + +P RLT A+PGAT  
Sbjct  403  GDKSRICRVGVRLPDGRRAQRNFLRVDPIQLLWSFCYSQLKEAETRPIRLTHAVPGATKC  462

Query  188  LDFESNLTFEESGLANSMISVTWD  117
            LD++   TFEESGL N+M+SVTW+
Sbjct  463  LDYDCESTFEESGLPNTMVSVTWE  486



>ref|XP_004297788.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=489

 Score =   224 bits (571),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 153/206 (74%), Gaps = 10/206 (5%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES----PQAPPlh  546
            ++DPI GQKMRSW GMV PE LLEDLL FMD  P DH ++LS+KRPRES    PQ   + 
Sbjct  286  ILDPITGQKMRSWNGMVHPERLLEDLLLFMDSGPRDHHLALSNKRPRESSLPQPQNTNVV  345

Query  545  kddakeedeellqalaASMEGMKDTNVDALKESSESDVLG---KETNVVKKPVYPPLPEE  375
             +   EEDEE+ +ALAASM  MK+T+    K+  E +++    +ET++ KKP YPPLPEE
Sbjct  346  AEQTNEEDEEVQRALAASMGSMKETSGTISKD--EGEIITDKEEETSLPKKPTYPPLPEE  403

Query  374  PKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGAT  195
            P GDK+ +CRVG+RLPDGRR QRNFLR DPIQLLWSFC S L+E + +P RLT A+PGAT
Sbjct  404  PSGDKSRICRVGVRLPDGRRAQRNFLRVDPIQLLWSFCYSQLKEAETRPIRLTHAVPGAT  463

Query  194  SSLDFESNLTFEESGLANSMISVTWD  117
              LD++   TFEESGL N+M+SVTW+
Sbjct  464  KCLDYDCESTFEESGLPNTMVSVTWE  489



>gb|EYU30240.1| hypothetical protein MIMGU_mgv1a006061mg [Erythranthe guttata]
Length=437

 Score =   222 bits (565),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 150/198 (76%), Gaps = 10/198 (5%)
 Frame = -1

Query  689  QKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkddakeedeel  513
            +K+ +WRGMVQPE LLEDL+PFMDGSPSDH VSLSHKRPR   +AP  H   A  E+ + 
Sbjct  243  KKLHAWRGMVQPENLLEDLVPFMDGSPSDHHVSLSHKRPRVHTEAPVHHIQSAAAENHDE  302

Query  512  ------lqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLV  351
                   +ALAASM   K+ +    KE +E++   ++    KKP Y PLPEEPKGD++L+
Sbjct  303  DEEEELQRALAASMVDTKEIDEGDSKEVTEANNAEEKE---KKPSYLPLPEEPKGDRSLL  359

Query  350  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESN  171
            CRVG+RLPDGRR+QRNFLR+DP+QLLWSFC S ++E D+KPFR+TQAIPGA+ SLD++  
Sbjct  360  CRVGVRLPDGRRVQRNFLRTDPVQLLWSFCYSEMKEIDSKPFRITQAIPGASRSLDYDVT  419

Query  170  LTFEESGLANSMISVTWD  117
             TF ESGLANSM+SVTW+
Sbjct  420  STFAESGLANSMVSVTWE  437



>ref|XP_003628976.1| UBX domain-containing protein [Medicago truncatula]
 ref|XP_003636613.1| UBX domain-containing protein [Medicago truncatula]
 gb|AET03452.1| structural constituent of ribosome protein, putative [Medicago 
truncatula]
Length=461

 Score =   222 bits (566),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 152/204 (75%), Gaps = 6/204 (3%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQAPPlhkd--  540
            ++DPI GQKMR+W GMVQP++LLE LLPF D  P DH  +LSHKRPR S   P       
Sbjct  258  IIDPITGQKMRAWGGMVQPDSLLEGLLPFFDAGPKDHHNTLSHKRPRGSSSPPKPKATLD  317

Query  539  --dakeedeellqalaASMEGMKDTNVDALKESSESDVLGK-ETNVVKKPVYPPLPEEPK  369
                KEEDEE+ +ALAAS+E +K+++  A  +  E++V G  +   + +P YP LPEEPK
Sbjct  318  SDANKEEDEEVQRALAASLESVKESSEMAEGDDKEANVAGNVQETALPRPAYPTLPEEPK  377

Query  368  GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSS  189
             ++NL+CRVG+RLPDGRR+QRNFLRS+PIQLLWSF +  L E + KPF+LT AIPGAT +
Sbjct  378  AERNLLCRVGVRLPDGRRVQRNFLRSEPIQLLWSFIAVQLGEDETKPFKLTHAIPGATKN  437

Query  188  LDFESNLTFEESGLANSMISVTWD  117
            LD+ESN TFEESGLA SMISVTWD
Sbjct  438  LDYESNSTFEESGLAYSMISVTWD  461



>ref|XP_010527852.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Tarenaya 
hassleriana]
Length=405

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 151/204 (74%), Gaps = 6/204 (3%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdd-  537
            V+DP  GQKMR W GM+ PE LLEDL+PFMDG P +H V+LS KRPR S   P       
Sbjct  202  VIDPTTGQKMRLWCGMIDPERLLEDLVPFMDGGPREHLVALSKKRPRASSLTPHSKAKVD  261

Query  536  -akeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKK---PVYPPLPEEPK  369
               EEDEEL +ALAAS+E M++++ +A     ++  L ++         P YPPLPEEPK
Sbjct  262  ITNEEDEELQRALAASLENMEESSEEAAIPEEQTSTLPEKDETFSSNAMPTYPPLPEEPK  321

Query  368  GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSS  189
            GD++++CRVG+RLPDGRRLQRNFL++DPIQLLWSFC S +E  + KPF+LTQAIPG  ++
Sbjct  322  GDRSILCRVGVRLPDGRRLQRNFLKTDPIQLLWSFCYSQMEGWERKPFKLTQAIPGTANT  381

Query  188  LDFESNLTFEESGLANSMISVTWD  117
            LD+ES LTFE+SGLANSMISVTW+
Sbjct  382  LDYESILTFEQSGLANSMISVTWE  405



>ref|XP_009351644.1| PREDICTED: UBX domain-containing protein 2 isoform X3 [Pyrus 
x bretschneideri]
Length=452

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 159/200 (80%), Gaps = 3/200 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            ++DPI GQKMRSW GMV P+ LLEDLL F+D  P DH V+LS+KRPRE+ Q P   KD  
Sbjct  254  LIDPITGQKMRSWNGMVHPDRLLEDLLLFLDSGPRDHHVTLSNKRPRETAQ-PQKTKDGT  312

Query  533  keedeellqalaASMEGMKDTNVDALKESSESDVLGKE-TNVVKKPVYPPLPEEPKGDKN  357
             EEDEE+ +ALAASMEGMK+T+    K+  ES    +E T+ +K P YPPLPEEPKGD++
Sbjct  313  NEEDEEVQRALAASMEGMKETSRTTSKDKDESITEKEEGTSSIKMPTYPPLPEEPKGDRS  372

Query  356  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  177
            L+CRVG+RLPDGRR+QRNFLR DPIQLLWSFC S L+E +A+PF LTQAIPGA+ +LD++
Sbjct  373  LLCRVGVRLPDGRRVQRNFLRVDPIQLLWSFCYSQLKEAEARPFHLTQAIPGASKNLDYD  432

Query  176  SNLTFEESGLANSMISVTWD  117
               TFEESGLANSM+SVTW+
Sbjct  433  CQSTFEESGLANSMVSVTWE  452



>ref|XP_010527851.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Tarenaya 
hassleriana]
Length=459

 Score =   220 bits (561),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 151/204 (74%), Gaps = 6/204 (3%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdd-  537
            V+DP  GQKMR W GM+ PE LLEDL+PFMDG P +H V+LS KRPR S   P       
Sbjct  256  VIDPTTGQKMRLWCGMIDPERLLEDLVPFMDGGPREHLVALSKKRPRASSLTPHSKAKVD  315

Query  536  -akeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKK---PVYPPLPEEPK  369
               EEDEEL +ALAAS+E M++++ +A     ++  L ++         P YPPLPEEPK
Sbjct  316  ITNEEDEELQRALAASLENMEESSEEAAIPEEQTSTLPEKDETFSSNAMPTYPPLPEEPK  375

Query  368  GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSS  189
            GD++++CRVG+RLPDGRRLQRNFL++DPIQLLWSFC S +E  + KPF+LTQAIPG  ++
Sbjct  376  GDRSILCRVGVRLPDGRRLQRNFLKTDPIQLLWSFCYSQMEGWERKPFKLTQAIPGTANT  435

Query  188  LDFESNLTFEESGLANSMISVTWD  117
            LD+ES LTFE+SGLANSMISVTW+
Sbjct  436  LDYESILTFEQSGLANSMISVTWE  459



>ref|XP_010554359.1| PREDICTED: UBX domain-containing protein 2-like [Tarenaya hassleriana]
Length=463

 Score =   220 bits (560),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 152/202 (75%), Gaps = 5/202 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQAPPlhkdda  534
            V+DP  GQKMR W G+++PETLLEDL+PFMDG P DH+ SLS KRPR S   P       
Sbjct  259  VIDPTTGQKMRLWCGVIEPETLLEDLVPFMDGGPRDHLASLSKKRPRGSSLTPHSKTKAD  318

Query  533  --keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKK--PVYPPLPEEPKG  366
               +E+EEL +ALAAS+E M++++  A  E   S +  KE   +    P +PPLPEEPKG
Sbjct  319  VPNDEEEELQRALAASLENMEESSDKATAEEKTSTMPEKEGTDLSNSMPSFPPLPEEPKG  378

Query  365  DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSL  186
            + +++CRVGIRLP+G+RLQRNFL++DPIQLLWSFC+S LEE + KPF+LTQ  PGA  +L
Sbjct  379  NPSVLCRVGIRLPNGKRLQRNFLKTDPIQLLWSFCNSQLEEPERKPFKLTQPFPGAAKTL  438

Query  185  DFESNLTFEESGLANSMISVTW  120
            D+ESNLTFE+SGLANSMISVTW
Sbjct  439  DYESNLTFEQSGLANSMISVTW  460



>ref|XP_008389122.1| PREDICTED: UBX domain-containing protein 2-like isoform X3 [Malus 
domestica]
Length=440

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 158/200 (79%), Gaps = 3/200 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            ++DPI GQKMRSW GMV P+  LEDLL F+D  P DH V+LS+KRPRE+   P   K++ 
Sbjct  242  LIDPITGQKMRSWNGMVHPDRFLEDLLLFLDSGPRDHHVTLSNKRPRETAH-PQKTKEET  300

Query  533  keedeellqalaASMEGMKDTNVDALKESSESDV-LGKETNVVKKPVYPPLPEEPKGDKN  357
             EEDEE+ +ALAASMEGMK+T+    K+  E      +ET+ +K P YPPLPEEPKGD+N
Sbjct  301  NEEDEEMQRALAASMEGMKETSGTISKDKDEIITDKEEETSSIKMPTYPPLPEEPKGDRN  360

Query  356  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  177
            L+CRVG+RLPDGRR+QRNFLR DPIQLLWSFC S L+E +A+PF+LTQAIPGA+ +LD++
Sbjct  361  LLCRVGVRLPDGRRVQRNFLRIDPIQLLWSFCYSQLKEAEARPFQLTQAIPGASKNLDYD  420

Query  176  SNLTFEESGLANSMISVTWD  117
               TFEESGLANSM+SVTW+
Sbjct  421  CQSTFEESGLANSMVSVTWE  440



>ref|XP_002315828.1| UBX domain-containing family protein [Populus trichocarpa]
 gb|EEF01999.1| UBX domain-containing family protein [Populus trichocarpa]
Length=444

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 142/207 (69%), Gaps = 14/207 (7%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            ++DPI GQKM SW GMVQPE+LLEDL+PFMDG P DH  +LSHKR R S   PP  K++ 
Sbjct  243  IIDPITGQKMHSWVGMVQPESLLEDLVPFMDGGPRDHHKTLSHKRQRGSSLTPPKSKEED  302

Query  533  keedeellqalaASMEGMKDTNVDALKESS--------ESDVLGKETNVVKKPVYPPLPE  378
            +E    L      SME MKD++V A  +           S   G+E    K   YPPLPE
Sbjct  303  EEVLRALAA----SMESMKDSSVIASNKKDIASNDKDDASTAKGEEKCSTKTLTYPPLPE  358

Query  377  EPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGA  198
            EP GDK+L+CRVGIRLPDGRR+QRNFL++DPI+LLWSFC S LEE   K F L +AIPGA
Sbjct  359  EPSGDKSLLCRVGIRLPDGRRVQRNFLKTDPIRLLWSFCYSQLEEAGTKLFCLKEAIPGA  418

Query  197  TSSLDFESNLTFEESGLANSMISVTWD  117
               LD++S +TF ESGLANSMISV W+
Sbjct  419  -KRLDYDSTMTFGESGLANSMISVAWE  444



>ref|XP_006378421.1| hypothetical protein POPTR_0010s10910g [Populus trichocarpa]
 gb|ERP56218.1| hypothetical protein POPTR_0010s10910g [Populus trichocarpa]
Length=451

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 142/207 (69%), Gaps = 14/207 (7%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            ++DPI GQKM SW GMVQPE+LLEDL+PFMDG P DH  +LSHKR R S   PP  K++ 
Sbjct  250  IIDPITGQKMHSWVGMVQPESLLEDLVPFMDGGPRDHHKTLSHKRQRGSSLTPPKSKEED  309

Query  533  keedeellqalaASMEGMKDTNVDALKESS--------ESDVLGKETNVVKKPVYPPLPE  378
            +E    L      SME MKD++V A  +           S   G+E    K   YPPLPE
Sbjct  310  EEVLRALAA----SMESMKDSSVIASNKKDIASNDKDDASTAKGEEKCSTKTLTYPPLPE  365

Query  377  EPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGA  198
            EP GDK+L+CRVGIRLPDGRR+QRNFL++DPI+LLWSFC S LEE   K F L +AIPGA
Sbjct  366  EPSGDKSLLCRVGIRLPDGRRVQRNFLKTDPIRLLWSFCYSQLEEAGTKLFCLKEAIPGA  425

Query  197  TSSLDFESNLTFEESGLANSMISVTWD  117
               LD++S +TF ESGLANSMISV W+
Sbjct  426  -KRLDYDSTMTFGESGLANSMISVAWE  451



>ref|XP_009351643.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Pyrus 
x bretschneideri]
Length=454

 Score =   218 bits (554),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 157/201 (78%), Gaps = 3/201 (1%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQ-APPlhkdd  537
            ++DPI GQKMRSW GMV P+ LLEDLL F+D  P DH V+LS+KRPRE+ Q       D 
Sbjct  254  LIDPITGQKMRSWNGMVHPDRLLEDLLLFLDSGPRDHHVTLSNKRPRETAQPQKTKVADG  313

Query  536  akeedeellqalaASMEGMKDTNVDALKESSESDVLGKE-TNVVKKPVYPPLPEEPKGDK  360
              EEDEE+ +ALAASMEGMK+T+    K+  ES    +E T+ +K P YPPLPEEPKGD+
Sbjct  314  TNEEDEEVQRALAASMEGMKETSRTTSKDKDESITEKEEGTSSIKMPTYPPLPEEPKGDR  373

Query  359  NLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDF  180
            +L+CRVG+RLPDGRR+QRNFLR DPIQLLWSFC S L+E +A+PF LTQAIPGA+ +LD+
Sbjct  374  SLLCRVGVRLPDGRRVQRNFLRVDPIQLLWSFCYSQLKEAEARPFHLTQAIPGASKNLDY  433

Query  179  ESNLTFEESGLANSMISVTWD  117
            +   TFEESGLANSM+SVTW+
Sbjct  434  DCQSTFEESGLANSMVSVTWE  454



>ref|XP_009351642.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Pyrus 
x bretschneideri]
Length=457

 Score =   217 bits (552),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 157/204 (77%), Gaps = 6/204 (3%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQ----APPlh  546
            ++DPI GQKMRSW GMV P+ LLEDLL F+D  P DH V+LS+KRPRE+ Q         
Sbjct  254  LIDPITGQKMRSWNGMVHPDRLLEDLLLFLDSGPRDHHVTLSNKRPRETAQPQKTKDASV  313

Query  545  kddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKE-TNVVKKPVYPPLPEEPK  369
             D   EEDEE+ +ALAASMEGMK+T+    K+  ES    +E T+ +K P YPPLPEEPK
Sbjct  314  ADGTNEEDEEVQRALAASMEGMKETSRTTSKDKDESITEKEEGTSSIKMPTYPPLPEEPK  373

Query  368  GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSS  189
            GD++L+CRVG+RLPDGRR+QRNFLR DPIQLLWSFC S L+E +A+PF LTQAIPGA+ +
Sbjct  374  GDRSLLCRVGVRLPDGRRVQRNFLRVDPIQLLWSFCYSQLKEAEARPFHLTQAIPGASKN  433

Query  188  LDFESNLTFEESGLANSMISVTWD  117
            LD++   TFEESGLANSM+SVTW+
Sbjct  434  LDYDCQSTFEESGLANSMVSVTWE  457



>ref|XP_007052064.1| UBX domain-containing protein [Theobroma cacao]
 gb|EOX96221.1| UBX domain-containing protein [Theobroma cacao]
Length=431

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 140/200 (70%), Gaps = 15/200 (8%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhkdda  534
            V+DPI G+KMRS  GMV+PE+LLEDL+ FMDG P D H +LS KRPR S   P       
Sbjct  245  VIDPITGEKMRSRCGMVEPESLLEDLVRFMDGGPRDYHATLSLKRPRGSSVTP-------  297

Query  533  keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNV-VKKPVYPPLPEEPKGDKN  357
                    +   ++ E M+D  +     +S  +V  KE     KKP YPPLPEEPKGD++
Sbjct  298  ------QQRVKMSTDETMEDEEMLRAVAASLENVKDKEEPCSTKKPTYPPLPEEPKGDRS  351

Query  356  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  177
            L+CRVG+RLP GRR+QRNFLR+D IQLLWSFC + L E ++KPFRLTQ IPGA+ SLD++
Sbjct  352  LLCRVGVRLPGGRRVQRNFLRTDSIQLLWSFCYAQLGEAESKPFRLTQPIPGASKSLDYD  411

Query  176  SNLTFEESGLANSMISVTWD  117
            S LTFEESGLANSMISV W+
Sbjct  412  SKLTFEESGLANSMISVAWE  431



>ref|XP_008389121.1| PREDICTED: UBX domain-containing protein 2-like isoform X2 [Malus 
domestica]
Length=442

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 156/201 (78%), Gaps = 3/201 (1%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQ-APPlhkdd  537
            ++DPI GQKMRSW GMV P+  LEDLL F+D  P DH V+LS+KRPRE+         ++
Sbjct  242  LIDPITGQKMRSWNGMVHPDRFLEDLLLFLDSGPRDHHVTLSNKRPRETAHPQKTKVAEE  301

Query  536  akeedeellqalaASMEGMKDTNVDALKESSESDV-LGKETNVVKKPVYPPLPEEPKGDK  360
              EEDEE+ +ALAASMEGMK+T+    K+  E      +ET+ +K P YPPLPEEPKGD+
Sbjct  302  TNEEDEEMQRALAASMEGMKETSGTISKDKDEIITDKEEETSSIKMPTYPPLPEEPKGDR  361

Query  359  NLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDF  180
            NL+CRVG+RLPDGRR+QRNFLR DPIQLLWSFC S L+E +A+PF+LTQAIPGA+ +LD+
Sbjct  362  NLLCRVGVRLPDGRRVQRNFLRIDPIQLLWSFCYSQLKEAEARPFQLTQAIPGASKNLDY  421

Query  179  ESNLTFEESGLANSMISVTWD  117
            +   TFEESGLANSM+SVTW+
Sbjct  422  DCQSTFEESGLANSMVSVTWE  442



>ref|XP_008389120.1| PREDICTED: UBX domain-containing protein 2-like isoform X1 [Malus 
domestica]
Length=445

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 158/204 (77%), Gaps = 6/204 (3%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES--PQAP--Plh  546
            ++DPI GQKMRSW GMV P+  LEDLL F+D  P DH V+LS+KRPRE+  PQ       
Sbjct  242  LIDPITGQKMRSWNGMVHPDRFLEDLLLFLDSGPRDHHVTLSNKRPRETAHPQKTKDASV  301

Query  545  kddakeedeellqalaASMEGMKDTNVDALKESSESDV-LGKETNVVKKPVYPPLPEEPK  369
             ++  EEDEE+ +ALAASMEGMK+T+    K+  E      +ET+ +K P YPPLPEEPK
Sbjct  302  AEETNEEDEEMQRALAASMEGMKETSGTISKDKDEIITDKEEETSSIKMPTYPPLPEEPK  361

Query  368  GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSS  189
            GD+NL+CRVG+RLPDGRR+QRNFLR DPIQLLWSFC S L+E +A+PF+LTQAIPGA+ +
Sbjct  362  GDRNLLCRVGVRLPDGRRVQRNFLRIDPIQLLWSFCYSQLKEAEARPFQLTQAIPGASKN  421

Query  188  LDFESNLTFEESGLANSMISVTWD  117
            LD++   TFEESGLANSM+SVTW+
Sbjct  422  LDYDCQSTFEESGLANSMVSVTWE  445



>ref|XP_010043889.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Eucalyptus 
grandis]
 gb|KCW85907.1| hypothetical protein EUGRSUZ_B02622 [Eucalyptus grandis]
Length=453

 Score =   214 bits (545),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 155/202 (77%), Gaps = 5/202 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            V+DPI GQKMRSW GM+QPE+LLE+LL F++G P DH VS SHKRPRE    PP    D 
Sbjct  253  VIDPITGQKMRSWTGMIQPESLLENLLLFLEGGPKDHHVSSSHKRPREKSATPPQKVKDE  312

Query  533  --keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKK-PVYPPLPEEPKGD  363
              KEEDEEL  AL AS+E +++  +    E  ++D   +E  +  K P YPPLPEEPKGD
Sbjct  313  MPKEEDEELQAALEASLENIEEP-IKTNGEDGKTDTSKEEETITGKIPAYPPLPEEPKGD  371

Query  362  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  183
            ++L+CRVG+RLPDGRR+QRNFLR+DPIQLLWSFC S LEE +++PFRL QAIPGA+ SLD
Sbjct  372  RSLLCRVGVRLPDGRRVQRNFLRTDPIQLLWSFCRSQLEEAESRPFRLAQAIPGASKSLD  431

Query  182  FESNLTFEESGLANSMISVTWD  117
            + S LTF+ESGLANSMIS+ W+
Sbjct  432  YNSKLTFQESGLANSMISLAWE  453



>ref|XP_010043888.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Eucalyptus 
grandis]
Length=459

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 152/207 (73%), Gaps = 9/207 (4%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            V+DPI GQKMRSW GM+QPE+LLE+LL F++G P DH VS SHKRPRE    PP    DA
Sbjct  253  VIDPITGQKMRSWTGMIQPESLLENLLLFLEGGPKDHHVSSSHKRPREKSATPPQKVKDA  312

Query  533  keedeellqalaASMEGMKDTNVDALKE-------SSESDVLGKETNVVKK-PVYPPLPE  378
              + +E+ +     ++   + +++ ++E         ++D   +E  +  K P YPPLPE
Sbjct  313  WIDADEMPKEEDEELQAALEASLENIEEPIKTNGEDGKTDTSKEEETITGKIPAYPPLPE  372

Query  377  EPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGA  198
            EPKGD++L+CRVG+RLPDGRR+QRNFLR+DPIQLLWSFC S LEE +++PFRL QAIPGA
Sbjct  373  EPKGDRSLLCRVGVRLPDGRRVQRNFLRTDPIQLLWSFCRSQLEEAESRPFRLAQAIPGA  432

Query  197  TSSLDFESNLTFEESGLANSMISVTWD  117
            + SLD+ S LTF+ESGLANSMIS+ W+
Sbjct  433  SKSLDYNSKLTFQESGLANSMISLAWE  459



>ref|XP_011021683.1| PREDICTED: UBX domain-containing protein 2-like [Populus euphratica]
Length=457

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 143/212 (67%), Gaps = 15/212 (7%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            ++DPI GQKM SW GMVQPE LLEDL+PFMDG P DH  +L HKR R S   PP  K   
Sbjct  247  IIDPITGQKMHSWVGMVQPENLLEDLVPFMDGGPRDHHKTLPHKRQRGSSPTPPKSKALV  306

Query  533  keedeell-----qalaASMEGMKDTNVDALKESS--------ESDVLGKETNVVKKPVY  393
               + +       +ALAASME MKD++V A  +           S   G+E  + + P Y
Sbjct  307  SAYETKEEDEEVLRALAASMESMKDSSVIASNKKDIASNDKDDASTAKGEEKCLTRTPTY  366

Query  392  PPLPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQ  213
            PPLPEEP GDK+L+CRVGIRLPDG R+QRNFL++DPIQLLWSFC S LEE   K F L +
Sbjct  367  PPLPEEPSGDKSLLCRVGIRLPDGLRVQRNFLKTDPIQLLWSFCYSLLEEAGTKLFFLKE  426

Query  212  AIPGATSSLDFESNLTFEESGLANSMISVTWD  117
            AIPGA   LD+++ +TF +SGLANSMISV W+
Sbjct  427  AIPGA-KRLDYDNTMTFGDSGLANSMISVAWE  457



>gb|AFK35082.1| unknown [Medicago truncatula]
Length=195

 Score =   203 bits (516),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 143/195 (73%), Gaps = 6/195 (3%)
 Frame = -1

Query  683  MRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQAPPlhkd----dakeede  519
            MR+W GMVQP++LLE LLPF D  P DH  +LSHKRPR S   P           KEEDE
Sbjct  1    MRAWGGMVQPDSLLEGLLPFFDAGPKDHHNTLSHKRPRGSSSPPKPKATLDSDANKEEDE  60

Query  518  ellqalaASMEGMKDTNVDALKESSESDVLGK-ETNVVKKPVYPPLPEEPKGDKNLVCRV  342
            E+ +ALAAS+E +K+++  A  +  E++V G  +   + +P YP LPEEPK ++NL+CRV
Sbjct  61   EVQRALAASLESVKESSEMAEGDDKEANVAGNVQETALPRPAYPTLPEEPKAERNLLCRV  120

Query  341  GIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLTF  162
            G+RLPDGRR+QRN LRS+PIQLLWSF +  L E + KPF+LT AIPGAT +LD+ESN TF
Sbjct  121  GVRLPDGRRVQRNSLRSEPIQLLWSFIAVQLGEDETKPFKLTHAIPGATKNLDYESNSTF  180

Query  161  EESGLANSMISVTWD  117
            EESGLA SMISVTWD
Sbjct  181  EESGLAYSMISVTWD  195



>ref|XP_008804300.1| PREDICTED: UBX domain-containing protein 7 [Phoenix dactylifera]
Length=443

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 139/222 (63%), Gaps = 42/222 (19%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS-LSHKRPRESPQAPPlhkdda  534
            V+DPI GQKMR+W GMVQPE LLEDLLP++D  P +H + L  KRPRE  +         
Sbjct  240  VIDPITGQKMRAWSGMVQPERLLEDLLPYLDKGPKEHHAILPQKRPREMAK---------  290

Query  533  keedeellqalaASMEGMKDTNV-----DALKESSES--DVLG----------------K  423
                        A   GM D  +     + L+++S S  D  G                 
Sbjct  291  ---------DSKAHTSGMPDKTLVPKYPETLQKTSASLEDTEGPIRSLATNDEPKHEKVA  341

Query  422  ETNVVKKPVYPPLPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEE  243
            ET+   KP+YPPLPEEPKG + L+CRVGIRLPDGRRLQRNFLR DP++ LWSFC S LE+
Sbjct  342  ETSSSGKPIYPPLPEEPKGSRELLCRVGIRLPDGRRLQRNFLRKDPVKFLWSFCCSKLED  401

Query  242  TDAKPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  117
               +PFR TQAIPGA+  L++ESNLTFEE+GL+NSMIS+ WD
Sbjct  402  GGTRPFRFTQAIPGASKVLNYESNLTFEEAGLSNSMISLAWD  443



>ref|XP_010935374.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Elaeis 
guineensis]
Length=444

 Score =   209 bits (532),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 142/222 (64%), Gaps = 42/222 (19%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS-LSHKRPRESPQAPPlhkdda  534
            V+DPI GQKMR+W GMVQPE LLEDLLP++D  P +H + L  KRPRE            
Sbjct  241  VIDPITGQKMRAWSGMVQPERLLEDLLPYLDKGPKEHHAILPQKRPRE------------  288

Query  533  keedeellqalaASMEGMKDTNV-----DALKESSES--DVLG----------------K  423
                  +++   A   GM D  +     DA++++S +  D  G                 
Sbjct  289  ------MVKDSTAHTSGMPDKTLVPKSADAVQKTSATLEDTGGPIRSHATNDVPKHDKVA  342

Query  422  ETNVVKKPVYPPLPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEE  243
            ET+   KP+YPPLPEEPKG + L+CRVGIRLPDGRRLQRNFLR DP++ LWSFC S LE+
Sbjct  343  ETSSSGKPIYPPLPEEPKGSRELLCRVGIRLPDGRRLQRNFLRKDPVKFLWSFCCSKLED  402

Query  242  TDAKPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  117
             + +PF  TQAIPGA+  L++ESNLTFE++GL+NSMIS+ WD
Sbjct  403  GETRPFHFTQAIPGASKVLNYESNLTFEDAGLSNSMISLAWD  444



>emb|CDY69105.1| BnaCnng61890D [Brassica napus]
Length=454

 Score =   209 bits (532),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 151/207 (73%), Gaps = 9/207 (4%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES----PQAPPlh  546
            V+DP  GQKMR W GMV+PETLLEDL+PFMDG P +H  SLS KRPR S    P + P  
Sbjct  248  VIDPTTGQKMRMWSGMVEPETLLEDLVPFMDGGPREHFASLSKKRPRGSFSLAPHSKPKE  307

Query  545  kddakeedeellqalaASMEG--MKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP  372
                 EE+EEL +ALAAS+E   MK+++ D    + E +V  +       P +PPLPEEP
Sbjct  308  VAAKDEEEEELQRALAASLEDNDMKESSDDKSAITPEEEVAVEAVTTTVLPTFPPLPEEP  367

Query  371  KG-DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGA  198
            KG D+++ CRVGIRLP+G+R+QRNFL++D IQLLWSFC S LEE++  KP +LTQAIPG 
Sbjct  368  KGGDRSVQCRVGIRLPNGQRVQRNFLKTDSIQLLWSFCYSQLEESERKKPLKLTQAIPGE  427

Query  197  TSSLDFESNLTFEESGLANSMISVTWD  117
            + +L++ESNLT E+SG+ANSMIS TW+
Sbjct  428  SKTLEYESNLTLEQSGVANSMISATWE  454



>emb|CDY45269.1| BnaA06g09390D [Brassica napus]
Length=467

 Score =   207 bits (526),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 150/207 (72%), Gaps = 9/207 (4%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES----PQAPPlh  546
            V+DP  GQKMR W GMV+PETLLEDL+PFMDG P +H  SLS KRPR S    P + P  
Sbjct  261  VIDPTTGQKMRMWSGMVEPETLLEDLVPFMDGGPREHFASLSKKRPRGSFSLAPHSKPKE  320

Query  545  kddakeedeellqalaASMEG--MKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP  372
                 EE+EEL +ALAAS+E   MK+++ D      E +V  +       P +PPLPEEP
Sbjct  321  VVAKDEEEEELQRALAASLEDNDMKESSDDKSAIIPEEEVAVEAVTTTVLPTFPPLPEEP  380

Query  371  KG-DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGA  198
            KG D+++ CRVGIRLP+G+R+QRNFL++D IQLLWSFC S LEE++  KP +LTQAIPG 
Sbjct  381  KGGDRSVQCRVGIRLPNGQRVQRNFLKTDSIQLLWSFCYSQLEESERKKPLKLTQAIPGE  440

Query  197  TSSLDFESNLTFEESGLANSMISVTWD  117
            + +L++ESNLT E+SG+ANSMIS TW+
Sbjct  441  SKTLEYESNLTLEQSGVANSMISATWE  467



>ref|XP_006307428.1| hypothetical protein CARUB_v10009052mg [Capsella rubella]
 gb|EOA40326.1| hypothetical protein CARUB_v10009052mg [Capsella rubella]
Length=468

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 152/207 (73%), Gaps = 10/207 (5%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES----PQAPPlh  546
            V+DP  GQ+MR W GMV+PE LLEDL+PFMDG P +H VSLS KRPR S    P + P  
Sbjct  263  VIDPTTGQRMRMWSGMVEPENLLEDLVPFMDGGPREHFVSLSKKRPRGSFSLTPHSKPKD  322

Query  545  kddakeedeellqalaASME--GMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP  372
                 EE+EEL +ALAAS+E   MKD++ D    + +   +   T+ V  P +PPLPEEP
Sbjct  323  DVAKDEEEEELQRALAASLEDNNMKDSSDDQSTITPDEVAVEAVTSAVL-PTFPPLPEEP  381

Query  371  KG-DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGA  198
            KG D+++ CRVGIRLP+G+RLQRNFL++D IQLLWSFC S LEE+D  KP +LTQAIPG 
Sbjct  382  KGGDRSVQCRVGIRLPNGQRLQRNFLKTDTIQLLWSFCYSQLEESDRKKPLKLTQAIPGE  441

Query  197  TSSLDFESNLTFEESGLANSMISVTWD  117
            + +L++ESNLT E+SG+ANSMIS TW+
Sbjct  442  SKTLEYESNLTLEQSGVANSMISATWE  468



>ref|XP_002890064.1| UBX domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66323.1| UBX domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 151/207 (73%), Gaps = 10/207 (5%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES----PQAPPlh  546
            V+DP  GQ+MR W GMV+PE LLEDL+PFMDG P +H  SLS KRPR S    P + P  
Sbjct  267  VIDPTTGQRMRIWSGMVEPENLLEDLVPFMDGGPREHFASLSKKRPRGSFSLAPHSKPKE  326

Query  545  kddakeedeellqalaASME--GMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP  372
                 EE+EEL +ALAAS+E   MK+++ D    + E   +   T+ V  P +PPLPEEP
Sbjct  327  DVAKDEEEEELQRALAASLEDNSMKESSDDQSTMTPEEVAVEAVTSAVL-PTFPPLPEEP  385

Query  371  KG-DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGA  198
            KG D++L CRVGIRLP+G+RLQRNFL++D IQLLWSFC S LEE++  KP +LTQAIPG 
Sbjct  386  KGGDRSLQCRVGIRLPNGQRLQRNFLKTDTIQLLWSFCYSQLEESERKKPLKLTQAIPGE  445

Query  197  TSSLDFESNLTFEESGLANSMISVTWD  117
            + +LD+ESNLT E+SG+ANSMIS TW+
Sbjct  446  SKTLDYESNLTLEQSGVANSMISATWE  472



>gb|EPS73806.1| hypothetical protein M569_00949, partial [Genlisea aurea]
Length=451

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 150/211 (71%), Gaps = 23/211 (11%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSL-SHKRPRESPQA----PPlh  546
            ++DP+ GQK+R+WRGMV+PE+LLEDLLPFMDGSPSD+ S+ S+KRPRES       P   
Sbjct  251  LLDPLTGQKLRTWRGMVEPESLLEDLLPFMDGSPSDNHSIASNKRPRESSDVQFLRPHRA  310

Query  545  kddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKP------VYPPL  384
             D   +ED+EL +ALAAS+E  +          S  D    E  V KKP       Y PL
Sbjct  311  SDKTTDEDDELRRALAASLENFE----------SPHDPKPDENIVEKKPDKSAAVAYLPL  360

Query  383  PEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD--AKPFRLTQA  210
            PEE KGDKNL+CR+G+RLP+GRR+QRNFLRSDP+QLLWSFC   + E D   +PFRLTQA
Sbjct  361  PEESKGDKNLLCRIGLRLPNGRRVQRNFLRSDPVQLLWSFCLQQITEIDNNNRPFRLTQA  420

Query  209  IPGATSSLDFESNLTFEESGLANSMISVTWD  117
            IPGA+ +LD++   TFEESGL N+M+SVTW+
Sbjct  421  IPGASRTLDYDVESTFEESGLDNTMVSVTWE  451



>emb|CDY68911.1| BnaAnng28760D [Brassica napus]
Length=385

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 139/201 (69%), Gaps = 7/201 (3%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            V+DP  GQKMR W GMV+PETLLE L+PF+DG P  H  SLS K PR S    P  K   
Sbjct  189  VIDPTTGQKMRMWSGMVEPETLLESLVPFLDGGPGTHFASLSKKHPRGSFSLAPHSKPKE  248

Query  533  keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKG-DKN  357
            +E    L   L  +  GMK+++ D     +  +    E  V+  P YPPLPEEPKG D++
Sbjct  249  EELQRALAATLENN--GMKESSSDDTSPITTPEEAAVEATVL--PTYPPLPEEPKGGDRS  304

Query  356  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDA-KPFRLTQAIPGATSSLDF  180
            + CRVGIRLP+G+RLQRNFL++D IQLLWSFC S LEE++  KP +LTQAIPG + +L++
Sbjct  305  VQCRVGIRLPNGQRLQRNFLKTDSIQLLWSFCYSQLEESEGEKPLKLTQAIPGESKTLEY  364

Query  179  ESNLTFEESGLANSMISVTWD  117
            ESNLT E+SG+ANSMIS TW+
Sbjct  365  ESNLTLEQSGVANSMISATWE  385



>ref|NP_001077535.1| UBX domain-containing protein [Arabidopsis thaliana]
 ref|NP_001077536.1| UBX domain-containing protein [Arabidopsis thaliana]
 gb|AEE29184.1| UBX domain-containing protein [Arabidopsis thaliana]
 gb|AEE29185.1| UBX domain-containing protein [Arabidopsis thaliana]
Length=447

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 152/212 (72%), Gaps = 20/212 (9%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES----PQAPPlh  546
            V+DP  GQ+MR W GMV PE LLEDL+PFMDG P +H  SLS KRPR S    P + P  
Sbjct  242  VIDPTTGQRMRMWTGMVDPENLLEDLVPFMDGGPREHFASLSKKRPRGSFSLTPHSKPKE  301

Query  545  kddakeedeellqalaASMEGMKDTNVDALKESS--ESDVLGKETNV-----VKKPVYPP  387
                 EE+EEL +ALAAS+E   D N   +KESS  +S ++ +E  V        P +PP
Sbjct  302  DVAKDEEEEELQRALAASLE---DNN---MKESSDDQSTIIPEEVAVEAVTSAVLPTFPP  355

Query  386  LPEEPKG-DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQ  213
            LPEEPKG D++L CRVGIRLP+G+RLQRNFL++D IQLLWSFC S LEE++  KP +LTQ
Sbjct  356  LPEEPKGGDRSLQCRVGIRLPNGQRLQRNFLKTDTIQLLWSFCYSQLEESERKKPLKLTQ  415

Query  212  AIPGATSSLDFESNLTFEESGLANSMISVTWD  117
            AIPG + +L++ESNLT E+SG+ANSMIS TW+
Sbjct  416  AIPGESKTLEYESNLTLEQSGVANSMISATWE  447



>ref|NP_563954.1| UBX domain-containing protein [Arabidopsis thaliana]
 ref|NP_973827.1| UBX domain-containing protein [Arabidopsis thaliana]
 gb|AAK43884.1|AF370507_1 Unknown protein [Arabidopsis thaliana]
 gb|AAL47388.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH19997.1| AT1G14570 [Arabidopsis thaliana]
 gb|AEE29182.1| UBX domain-containing protein [Arabidopsis thaliana]
 gb|AEE29183.1| UBX domain-containing protein [Arabidopsis thaliana]
Length=468

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 152/212 (72%), Gaps = 20/212 (9%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES----PQAPPlh  546
            V+DP  GQ+MR W GMV PE LLEDL+PFMDG P +H  SLS KRPR S    P + P  
Sbjct  263  VIDPTTGQRMRMWTGMVDPENLLEDLVPFMDGGPREHFASLSKKRPRGSFSLTPHSKPKE  322

Query  545  kddakeedeellqalaASMEGMKDTNVDALKESS--ESDVLGKETNV-----VKKPVYPP  387
                 EE+EEL +ALAAS+E   D N   +KESS  +S ++ +E  V        P +PP
Sbjct  323  DVAKDEEEEELQRALAASLE---DNN---MKESSDDQSTIIPEEVAVEAVTSAVLPTFPP  376

Query  386  LPEEPKG-DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQ  213
            LPEEPKG D++L CRVGIRLP+G+RLQRNFL++D IQLLWSFC S LEE++  KP +LTQ
Sbjct  377  LPEEPKGGDRSLQCRVGIRLPNGQRLQRNFLKTDTIQLLWSFCYSQLEESERKKPLKLTQ  436

Query  212  AIPGATSSLDFESNLTFEESGLANSMISVTWD  117
            AIPG + +L++ESNLT E+SG+ANSMIS TW+
Sbjct  437  AIPGESKTLEYESNLTLEQSGVANSMISATWE  468



>ref|XP_010496241.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
 ref|XP_010496249.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=463

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 149/207 (72%), Gaps = 10/207 (5%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES----PQAPPlh  546
            V+DP  GQ+MR W GMV+PE LLEDL+PFMDG P +H  SLS KRPR S    P + P  
Sbjct  258  VIDPTTGQRMRMWSGMVEPENLLEDLVPFMDGGPREHFASLSKKRPRGSFSLTPHSKPKE  317

Query  545  kddakeedeellqalaASME--GMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP  372
                 EE+EEL +ALAAS+E   MKD++ D    + E   +   T+ V  P +PPLPEEP
Sbjct  318  DVAKDEEEEELRRALAASLEDNNMKDSSDDQSTITPEEVAVEAVTSAVL-PTFPPLPEEP  376

Query  371  KG-DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGA  198
            KG D+N  CRVGIRLP+G+R QRNFL++D IQLLWSFC S LEE++  KP +LTQAIPG 
Sbjct  377  KGGDRNAQCRVGIRLPNGQRRQRNFLKTDTIQLLWSFCYSQLEESERKKPLKLTQAIPGE  436

Query  197  TSSLDFESNLTFEESGLANSMISVTWD  117
            + +L++ESNLT E+SG+ANSMIS TW+
Sbjct  437  SKTLEYESNLTLEQSGVANSMISATWE  463



>ref|XP_010458959.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
 ref|XP_010458960.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
 ref|XP_010458961.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=457

 Score =   202 bits (513),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 149/207 (72%), Gaps = 15/207 (7%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES----PQAPPlh  546
            V+DP  GQ+MR W GMV+PE LLEDL+PFMDG P +H  SLS KRPR S    P + P  
Sbjct  257  VIDPTTGQRMRMWSGMVEPENLLEDLVPFMDGGPREHFASLSKKRPRGSFSLTPHSKPKE  316

Query  545  kddakeedeellqalaASME--GMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP  372
                 EE+EEL +ALAAS+E   MKD++ D      +S +  +       P +PPLPEEP
Sbjct  317  DVAKDEEEEELRRALAASLEDNNMKDSSDD------QSTITPEAFTSAVLPAFPPLPEEP  370

Query  371  KG-DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGA  198
            KG D++L CRVGIRLP+G+RLQRNFL++D IQLLWSFC S LEE++  KP +LTQAIPG 
Sbjct  371  KGGDRSLQCRVGIRLPNGQRLQRNFLKTDTIQLLWSFCYSQLEESERKKPLKLTQAIPGE  430

Query  197  TSSLDFESNLTFEESGLANSMISVTWD  117
            + +L++ESNLT E+SG+ANSMIS TW+
Sbjct  431  SKTLEYESNLTLEQSGVANSMISATWE  457



>emb|CDX84023.1| BnaC08g16220D [Brassica napus]
Length=458

 Score =   201 bits (511),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 143/202 (71%), Gaps = 6/202 (3%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRES-PQAPPlhkdd  537
            V+DP  GQKMR W GMV+PETLL+ L+PF+DG P  H  SLS K PR S   AP     D
Sbjct  259  VIDPTSGQKMRMWCGMVEPETLLQYLVPFLDGGPGTHFDSLSKKHPRGSFSLAPHSKPKD  318

Query  536  akeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKG-DK  360
             +EE+ +   A +    GMK+++ D     +  +    E  V+  P YPPLPEEPKG D+
Sbjct  319  EEEEELQRALAASLENNGMKESSDDDTSPITTPEEAAVEATVL--PTYPPLPEEPKGGDR  376

Query  359  NLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGATSSLD  183
            ++ CRVGIRLP+G+RLQRNFLR+DPIQLLWSFC S LEE++  KP +LTQAIPG + +L+
Sbjct  377  SVQCRVGIRLPNGQRLQRNFLRTDPIQLLWSFCYSQLEESEREKPLKLTQAIPGESKTLE  436

Query  182  FESNLTFEESGLANSMISVTWD  117
            +ESNLT E+SG+ANSMIS TW+
Sbjct  437  YESNLTLEQSGVANSMISATWE  458



>ref|XP_009148836.1| PREDICTED: UBX domain-containing protein 2 [Brassica rapa]
Length=466

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 151/207 (73%), Gaps = 9/207 (4%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES----PQAPPlh  546
            V+DP  GQKMR W GMV+PETLLEDL+PFMDG P +H  SLS KRPR S    P + P  
Sbjct  260  VIDPTTGQKMRMWSGMVEPETLLEDLVPFMDGGPREHFASLSKKRPRGSFSLAPHSKPKE  319

Query  545  kddakeedeellqalaASMEG--MKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP  372
                 EE+EEL +ALAAS+E   MK+++ D      E +V+ +       P +PPLPEEP
Sbjct  320  VVAKDEEEEELQRALAASLEDNDMKESSDDKSAIIPEEEVVVEAVTTTVLPTFPPLPEEP  379

Query  371  KG-DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGA  198
            KG D+++ CRVGIRLP+G+R+QRNFL++D IQLLWSFC S LEE++  KP +LTQAIPG 
Sbjct  380  KGGDRSVQCRVGIRLPNGQRVQRNFLKTDSIQLLWSFCYSQLEESERKKPLKLTQAIPGE  439

Query  197  TSSLDFESNLTFEESGLANSMISVTWD  117
            + +L+FESNLT E+SG+ANSMIS TW+
Sbjct  440  SKTLEFESNLTLEQSGVANSMISATWE  466



>ref|XP_006416998.1| hypothetical protein EUTSA_v10007578mg [Eutrema salsugineum]
 gb|ESQ35351.1| hypothetical protein EUTSA_v10007578mg [Eutrema salsugineum]
Length=462

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 150/207 (72%), Gaps = 10/207 (5%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES----PQAPPlh  546
            V+DP  GQKMR W GMV+PETLLEDL+PFMDG P +H  SLS KRPR S    P +    
Sbjct  257  VIDPTTGQKMRMWCGMVEPETLLEDLVPFMDGGPREHFASLSKKRPRGSFSLTPHSKSKE  316

Query  545  kddakeedeellqalaASME--GMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP  372
                  E+EEL +ALAAS+E  GMK ++ D    + E+  +   T+ V  P +PPLPEEP
Sbjct  317  DAAKDGEEEELRRALAASLEDNGMKVSSDDKSPITPEAVAVEAVTSTVL-PTFPPLPEEP  375

Query  371  KG-DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGA  198
            KG D ++ CRVGIRLP+G+R+QRNFL++D IQLLWSFC S LEE++  KP +LTQAIPG 
Sbjct  376  KGGDPSVRCRVGIRLPNGQRIQRNFLKTDAIQLLWSFCYSQLEESERKKPLKLTQAIPGE  435

Query  197  TSSLDFESNLTFEESGLANSMISVTWD  117
            + +L++ESNLT E+SG+ANSMIS TW+
Sbjct  436  SKTLEYESNLTLEQSGVANSMISATWE  462



>ref|XP_009110537.1| PREDICTED: UBX domain-containing protein 2-like [Brassica rapa]
Length=443

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 141/202 (70%), Gaps = 6/202 (3%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES-PQAPPlhkdd  537
            V+DP  GQKMR W GMV+PETLLE L+PF+DG P  H  SLS K PR S   AP     D
Sbjct  244  VIDPTTGQKMRMWSGMVEPETLLESLVPFLDGGPGTHFASLSRKHPRGSFSLAPHSKPKD  303

Query  536  akeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKG-DK  360
             +EE+ +   A +    GMK+++ D     +  +    E  V+  P YPPLPEEPKG D+
Sbjct  304  EEEEETQQALAASLENNGMKESSSDDTSPITTPEEAAVEATVL--PTYPPLPEEPKGGDR  361

Query  359  NLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGATSSLD  183
            ++ CRVGIRLP+G+RLQRNFL++D IQLLWSFC S LEE++  KP +LTQAIPG + +L+
Sbjct  362  SVQCRVGIRLPNGQRLQRNFLKTDSIQLLWSFCYSQLEESEREKPLKLTQAIPGESKTLE  421

Query  182  FESNLTFEESGLANSMISVTWD  117
             ESNLT E+SG+ANSMIS TW+
Sbjct  422  DESNLTLEQSGVANSMISATWE  443



>gb|AAF63167.1|AC010657_3 T5E21.7 [Arabidopsis thaliana]
Length=514

 Score =   200 bits (509),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 145/208 (70%), Gaps = 17/208 (8%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            V+DP  GQ+MR W GMV PE LLEDL+PFMDG P +H  SLS KRPR S    P  K   
Sbjct  314  VIDPTTGQRMRMWTGMVDPENLLEDLVPFMDGGPREHFASLSKKRPRGSFSLTPHSKPKD  373

Query  533  keedeellqalaASMEGMKDTNVDALKESS--ESDVLGKETNV-----VKKPVYPPLPEE  375
            +EE+E      A     ++D N   +KESS  +S ++ +E  V        P +PPLPEE
Sbjct  374  EEEEELQRALAA----SLEDNN---MKESSDDQSTIIPEEVAVEAVTSAVLPTFPPLPEE  426

Query  374  PKG-DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPG  201
            PKG D++L CRVGIRLP+G+RLQRNFL++D IQLLWSFC S LEE++  KP +LTQAIPG
Sbjct  427  PKGGDRSLQCRVGIRLPNGQRLQRNFLKTDTIQLLWSFCYSQLEESERKKPLKLTQAIPG  486

Query  200  ATSSLDFESNLTFEESGLANSMISVTWD  117
             + +L++ESNLT E+SG+ANSMIS TW+
Sbjct  487  ESKTLEYESNLTLEQSGVANSMISATWE  514



>ref|XP_010476513.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=464

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 149/207 (72%), Gaps = 10/207 (5%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRES----PQAPPlh  546
            V+DP  GQ+MR W GMV+PE LLEDL+PFMDG P +H  SLS KRPR S    P + P  
Sbjct  259  VIDPTTGQRMRMWSGMVEPENLLEDLVPFMDGGPREHFASLSKKRPRGSFSLTPHSKPKE  318

Query  545  kddakeedeellqalaASME--GMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP  372
                 EE+EEL +ALAAS+E   MKD++ D    + E+  +         P +PPLPEEP
Sbjct  319  DVAKDEEEEELRRALAASLEDNNMKDSSGDQSTITPEAVAV-AAVTSAVLPTFPPLPEEP  377

Query  371  KG-DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGA  198
            KG D+++ CRVGIRLP+G+RLQRNFL++D IQLLWSFC S LEE++  KP +LTQAIPG 
Sbjct  378  KGGDRSVQCRVGIRLPNGQRLQRNFLKTDTIQLLWSFCYSQLEESERKKPLKLTQAIPGE  437

Query  197  TSSLDFESNLTFEESGLANSMISVTWD  117
            + +L++ESNLT E+SG+ANSMIS TW+
Sbjct  438  SKTLEYESNLTLEQSGVANSMISATWE  464



>ref|XP_009599661.1| PREDICTED: UBX domain-containing protein 7 homolog [Nicotiana 
tomentosiformis]
Length=367

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 124/199 (62%), Gaps = 34/199 (17%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS-LSHKRPRESPQAPPlhkdda  534
            V+DPI GQKMRSW GMVQPE LLED+  F+D SPS++ + L HKR R++P+         
Sbjct  202  VIDPITGQKMRSWNGMVQPENLLEDITSFIDLSPSEYYANLLHKRSRKNPRDEIKED---  258

Query  533  keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNL  354
                           EG++ +N               E   V K  YPPL EEPKGDKNL
Sbjct  259  ---------------EGIQQSN---------------EIKEVMKIFYPPLSEEPKGDKNL  288

Query  353  VCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFES  174
            +CRV IRL DGRR+QRNFL++D I+LLWS+C    EE + +PFR  Q  PG+   L+++S
Sbjct  289  ICRVAIRLFDGRRIQRNFLKTDSIKLLWSYCCVEFEEAETRPFRFRQVFPGSVKFLEYDS  348

Query  173  NLTFEESGLANSMISVTWD  117
            NLTFEES L NS++SVTW+
Sbjct  349  NLTFEESDLNNSIVSVTWE  367



>ref|XP_010253434.1| PREDICTED: UBX domain-containing protein 7-like [Nelumbo nucifera]
Length=361

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 130/198 (66%), Gaps = 24/198 (12%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQAPPlhkdda  534
            V+DPI GQ MRSW G+V+ ETLL DL+ FMD  P+++  SL +KR   S Q+        
Sbjct  184  VIDPITGQMMRSWSGVVEAETLLMDLVHFMDYGPNNYPPSLVYKRKARSHQS--------  235

Query  533  keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNL  354
                      L  S E     + + +  S+E+     ET++++K +YPPLP EPK +K+L
Sbjct  236  ----------LVYSQETEVAKHEEMMLASTET-----ETSLIEKTIYPPLPGEPKCEKSL  280

Query  353  VCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFES  174
            +CRV +R PDGRR+QRNFLR DPIQLLWSFC S LEET A+PFRL QAIPG +  LD+ +
Sbjct  281  LCRVAVRFPDGRRVQRNFLRKDPIQLLWSFCYSQLEETGARPFRLVQAIPGDSKQLDYAT  340

Query  173  NLTFEESGLANSMISVTW  120
             LTFEESG+ NSMI V W
Sbjct  341  ELTFEESGINNSMILVDW  358



>ref|XP_009401234.1| PREDICTED: UBX domain-containing protein 2 [Musa acuminata subsp. 
malaccensis]
Length=439

 Score =   193 bits (490),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 140/201 (70%), Gaps = 4/201 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS-LSHKRPRESPQAPPlhk--d  540
            V+DPI GQKMR+W GMV PE LLEDLLPF+D  P +H + L  KRPR +  + P +    
Sbjct  240  VIDPITGQKMRAWSGMVHPERLLEDLLPFLDKGPKEHHTFLPQKRPRVAHDSAPNNILDK  299

Query  539  dakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDK  360
            +A EED E+LQA+AASME  K      + +         ET+      YPPLPEEPKG K
Sbjct  300  EAVEEDVEVLQAIAASMEDAKSPPRPPVTDDDPKPEKDGETSSNGNLTYPPLPEEPKGSK  359

Query  359  NLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDF  180
             L CRVGIRLPDG R+QR FLR+DPI+LLWSFCSS LE+   +PF  TQAIPGA+ SL++
Sbjct  360  EL-CRVGIRLPDGCRIQRKFLRTDPIKLLWSFCSSKLEDGQRRPFHFTQAIPGASKSLEY  418

Query  179  ESNLTFEESGLANSMISVTWD  117
            ESN  FEE+GL+NSMI++ WD
Sbjct  419  ESNSNFEEAGLSNSMITLVWD  439



>ref|XP_009759130.1| PREDICTED: UBX domain-containing protein 7-like [Nicotiana sylvestris]
Length=377

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 123/199 (62%), Gaps = 34/199 (17%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAPPlhkdda  534
            V+DPI GQK+ SW GMVQPE LL+D+  F+D SPS+ H +L HKR R++P+         
Sbjct  212  VIDPITGQKVHSWNGMVQPEILLKDITSFIDLSPSEYHANLLHKRSRKNPRDEIKED---  268

Query  533  keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNL  354
                           EG++ TN               E   V K  YP LPEEP+GD+NL
Sbjct  269  ---------------EGVQQTN---------------EIKEVMKICYPTLPEEPEGDRNL  298

Query  353  VCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFES  174
            +CRV IRLPDGRR+QRNFL+ D I+LLWS+C    EE + +PFR  Q IPGA   L+++S
Sbjct  299  ICRVAIRLPDGRRIQRNFLKIDSIKLLWSYCCVEFEEAETRPFRFRQVIPGAVKFLEYDS  358

Query  173  NLTFEESGLANSMISVTWD  117
            NL FEES L NS++SVTW+
Sbjct  359  NLNFEESDLNNSIVSVTWE  377



>ref|XP_008801336.1| PREDICTED: UBX domain-containing protein 2-like [Phoenix dactylifera]
Length=340

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 129/202 (64%), Gaps = 30/202 (15%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddak  531
            V+DPI GQKMRSW GM   + LLEDLLPF+DG P +H  +  ++  +S QA  L      
Sbjct  163  VIDPITGQKMRSWSGMRTADALLEDLLPFVDGGPKEHHDVLSRK--QSVQATEL------  214

Query  530  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPV-----YPPLPEEPKG  366
                           G+++    + + +S  D +G + ++++  +     Y  L EEPKG
Sbjct  215  ---------------GLREAA--STEGTSAGDRIGADIDIMEASMNAKLEYLHLLEEPKG  257

Query  365  DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSL  186
            +K + CRV IRLPDGRRLQRNFLRSDPI+LLWSFCSS +EE + + FR  Q  PG ++SL
Sbjct  258  EKGVTCRVAIRLPDGRRLQRNFLRSDPIKLLWSFCSSGMEEGNMRRFRFVQTTPGGSNSL  317

Query  185  DFESNLTFEESGLANSMISVTW  120
            ++ESNLTFEE+G +NSMIS+ W
Sbjct  318  EYESNLTFEEAGFSNSMISMVW  339



>ref|NP_001054216.1| Os04g0670800 [Oryza sativa Japonica Group]
 dbj|BAF16130.1| Os04g0670800, partial [Oryza sativa Japonica Group]
Length=331

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 141/207 (68%), Gaps = 12/207 (6%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLS-HKRPRESPQ--------A  558
            ++DPI GQKMR W GM+ P+ LLEDL+P++D  P +H +    KRPR+  Q         
Sbjct  128  LIDPITGQKMRGWNGMIHPDRLLEDLMPYLDKGPKEHHAAQPQKRPRKVDQETSIGKQGK  187

Query  557  PPlhkddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPE  378
             P+     ++EDEEL +A+AAS+E  K +  D  +E  E +V   E ++  K  YPPLPE
Sbjct  188  TPVPVVATEDEDEELARAVAASLEESKGS--DTSEEKIEPEV-ENEPSLSAKLNYPPLPE  244

Query  377  EPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGA  198
            EPKG + L+CRV IRLPDGRR+QRNFL +DPI+LLWSFC   +E+ D K F   Q IP A
Sbjct  245  EPKGSRELLCRVAIRLPDGRRIQRNFLHTDPIKLLWSFCYPQVEDGDKKAFHFVQPIPRA  304

Query  197  TSSLDFESNLTFEESGLANSMISVTWD  117
            +++L++ES+ TF+E+GLANSMI++ WD
Sbjct  305  STNLEYESDKTFKEAGLANSMINLLWD  331



>ref|XP_006653862.1| PREDICTED: UBX domain-containing protein 2-like [Oryza brachyantha]
Length=380

 Score =   181 bits (460),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 139/207 (67%), Gaps = 10/207 (5%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLS-HKRPRE-------SPQAP  555
            ++DPI GQKMR W GMV P+ LLEDL+P++D  P +H +    KRPR+         Q  
Sbjct  175  LIDPITGQKMRGWNGMVHPDRLLEDLMPYLDKGPKEHHAAQPQKRPRKVDHETSAGKQGK  234

Query  554  PlhkddakeedeellqalaASMEGMKDTN-VDALKESSESDVLGKETNVVKKPVYPPLPE  378
                   ++EDEEL +A+AAS+E  K  +  DA  E +E +V   E ++  K  YPPLPE
Sbjct  235  TPVPVAVEDEDEELARAVAASLEESKGVDGSDATDEKTEPEV-ENEPSLSVKLNYPPLPE  293

Query  377  EPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGA  198
            EPKG + L+CRV IRLPDGRR+QRNFL +DP++LLWSFC   +E+   K F   Q IPG+
Sbjct  294  EPKGSRELLCRVAIRLPDGRRIQRNFLHTDPVKLLWSFCYPQVEDGGKKAFHFVQFIPGS  353

Query  197  TSSLDFESNLTFEESGLANSMISVTWD  117
            + +LD+ES+ TF+E+GLANSMI++ WD
Sbjct  354  SKNLDYESDKTFKEAGLANSMINLLWD  380



>gb|AEV40978.1| putative UBX domain-containing protein [Oryza punctata]
Length=463

 Score =   182 bits (463),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 140/208 (67%), Gaps = 11/208 (5%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQ--------A  558
            ++DPI GQKMR W GMV P+ LLEDL+P++D  P +H  +   KRPR+  Q         
Sbjct  257  LIDPITGQKMRGWNGMVHPDRLLEDLMPYLDKGPKEHHAAQPQKRPRKVDQETSIGKQGK  316

Query  557  PPlhkddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPE  378
             P+     ++EDEEL +A+AAS+E  K        E  E +V   E ++  K  YPPLPE
Sbjct  317  TPVPPIATEDEDEELARAVAASLEESKGVGGSDTSEKIEPEV-ENEPSLSAKLNYPPLPE  375

Query  377  EPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGA  198
            EPKG++ L+CRV IRLPDGRR+QRNFL +DPI+LLWSFC   +E+ D K F   Q IPGA
Sbjct  376  EPKGNRELLCRVAIRLPDGRRIQRNFLHTDPIKLLWSFCCPQVEDGDKKAFHFVQPIPGA  435

Query  197  -TSSLDFESNLTFEESGLANSMISVTWD  117
             T++L++ES+ TF+E+GLANSMI++ WD
Sbjct  436  STTNLEYESDKTFKEAGLANSMINLLWD  463



>gb|AEV41122.1| putative UBX domain-containing protein [Oryza officinalis]
Length=464

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 140/207 (68%), Gaps = 10/207 (5%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLS-HKRPRE-------SPQAP  555
            ++DPI GQKMR W GMV P+ LLEDL+P++D  P +H +    KRPR+         Q  
Sbjct  259  LIDPITGQKMRGWNGMVHPDRLLEDLMPYLDKGPKEHHAAQPQKRPRKVDQETSIGKQGK  318

Query  554  PlhkddakeedeellqalaASMEGMKDTN-VDALKESSESDVLGKETNVVKKPVYPPLPE  378
                   ++EDEEL +A+AAS+E  K     DA +E  E +V   E ++  K  YPPLPE
Sbjct  319  TPVPVTTEDEDEELARAVAASLEESKGVGGSDASEEKIEPEV-EIEPSLSAKLNYPPLPE  377

Query  377  EPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGA  198
            EPKG + L+CRV IRLPDGRR+QRNFL +DPI+LLWSFC   +E+ D K F   Q IPGA
Sbjct  378  EPKGSRELLCRVAIRLPDGRRIQRNFLHTDPIKLLWSFCYPQVEDGDKKVFHFVQPIPGA  437

Query  197  TSSLDFESNLTFEESGLANSMISVTWD  117
            +++L++ES+ TF+E+GLANSMI++ WD
Sbjct  438  STNLEYESDKTFKEAGLANSMINLLWD  464



>gb|AIE88273.1| hypothetical protein OG_BBa0063K01.4 [Oryza glaberrima]
Length=540

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 142/207 (69%), Gaps = 12/207 (6%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQ--------A  558
            ++DPI GQKMR W GM+ P+ LLEDL+P++D  P +H  +   KRPR+  Q         
Sbjct  337  LIDPITGQKMRGWNGMIHPDRLLEDLMPYLDKGPKEHHAAQPQKRPRKVDQETSIGKQGK  396

Query  557  PPlhkddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPE  378
             P+     ++EDEEL +A+AAS+E  K +  D  +E  E +V   ET++  K  YPPLPE
Sbjct  397  TPVPVVATEDEDEELARAVAASLEESKGS--DTSEEKIEPEV-ENETSLSAKLNYPPLPE  453

Query  377  EPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGA  198
            EPKG + L+CRV IRLPDGRR+QRNFL +DPI+LLWSFC   +E+ D K F   Q IP A
Sbjct  454  EPKGSRELLCRVAIRLPDGRRIQRNFLHTDPIKLLWSFCYPQVEDGDKKAFHFVQPIPRA  513

Query  197  TSSLDFESNLTFEESGLANSMISVTWD  117
            +++L++ES+ TF+E+GLANSMI++ WD
Sbjct  514  STNLEYESDKTFKEAGLANSMINLLWD  540



>emb|CAE02831.2| OSJNBa0043A12.36 [Oryza sativa Japonica Group]
 emb|CAH67698.1| H0624F09.6 [Oryza sativa Indica Group]
 dbj|BAG93324.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78226.1| hypothetical protein OsI_17866 [Oryza sativa Indica Group]
Length=459

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 141/207 (68%), Gaps = 12/207 (6%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLS-HKRPRESPQ--------A  558
            ++DPI GQKMR W GM+ P+ LLEDL+P++D  P +H +    KRPR+  Q         
Sbjct  256  LIDPITGQKMRGWNGMIHPDRLLEDLMPYLDKGPKEHHAAQPQKRPRKVDQETSIGKQGK  315

Query  557  PPlhkddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPE  378
             P+     ++EDEEL +A+AAS+E  K +  D  +E  E +V   E ++  K  YPPLPE
Sbjct  316  TPVPVVATEDEDEELARAVAASLEESKGS--DTSEEKIEPEV-ENEPSLSAKLNYPPLPE  372

Query  377  EPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGA  198
            EPKG + L+CRV IRLPDGRR+QRNFL +DPI+LLWSFC   +E+ D K F   Q IP A
Sbjct  373  EPKGSRELLCRVAIRLPDGRRIQRNFLHTDPIKLLWSFCYPQVEDGDKKAFHFVQPIPRA  432

Query  197  TSSLDFESNLTFEESGLANSMISVTWD  117
            +++L++ES+ TF+E+GLANSMI++ WD
Sbjct  433  STNLEYESDKTFKEAGLANSMINLLWD  459



>gb|AEV41029.1| putative UBX domain-containing protein [Oryza minuta]
Length=463

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 139/208 (67%), Gaps = 11/208 (5%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQ--------A  558
            ++DPI GQKM  W GMV P+ LLEDL+P++D  P +H  +   KRPR+  Q         
Sbjct  257  LIDPITGQKMCGWNGMVHPDRLLEDLMPYLDKGPKEHHAAQPQKRPRKVDQETSIGKQGK  316

Query  557  PPlhkddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPE  378
             P+     ++EDEEL +A+AAS+E  K        E  E +V   E ++  K  YPPLPE
Sbjct  317  TPVPPIATEDEDEELARAVAASLEESKGVGGSDTSEKIEPEV-ENEPSLSAKLNYPPLPE  375

Query  377  EPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGA  198
            EPKG++ L+CRV IRLPDGRR+QRNFL +DPI+LLWSFC   +E+ D K F   Q IPGA
Sbjct  376  EPKGNRELLCRVAIRLPDGRRIQRNFLHTDPIKLLWSFCCPQVEDGDKKAFHFVQPIPGA  435

Query  197  -TSSLDFESNLTFEESGLANSMISVTWD  117
             T++L++ES+ TF+E+GLANSMI++ WD
Sbjct  436  STTNLEYESDKTFKEAGLANSMINLLWD  463



>gb|AEV41076.1| putative UBX domain-containing protein [Oryza minuta]
Length=402

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 139/207 (67%), Gaps = 10/207 (5%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRE-------SPQAP  555
            ++DPI GQKMR W GMV P+ LLEDL+P++D  P +H  +   KRPR+         Q  
Sbjct  197  LIDPITGQKMRGWNGMVHPDRLLEDLMPYLDKGPKEHHAAQPQKRPRKVDQETSIGKQGK  256

Query  554  PlhkddakeedeellqalaASMEGMKDTN-VDALKESSESDVLGKETNVVKKPVYPPLPE  378
                   ++EDEEL +A+AAS+E  K     DA +E  E +V   E ++  K  YPPLPE
Sbjct  257  TPVPVTTEDEDEELARAVAASLEESKGVGGSDASEEKIEPEV-EIEPSLSAKLNYPPLPE  315

Query  377  EPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGA  198
            EPKG + L+CRV IRLPDGRR+QRNFL +DPI+LLWSFC   +E+ D K F   Q IPGA
Sbjct  316  EPKGSRELLCRVAIRLPDGRRIQRNFLHTDPIKLLWSFCYPQVEDGDKKVFHFVQPIPGA  375

Query  197  TSSLDFESNLTFEESGLANSMISVTWD  117
            +++L++ES+ TF+E+GLANSMI++  D
Sbjct  376  STNLEYESDKTFKEAGLANSMINLLCD  402



>ref|XP_004960126.1| PREDICTED: UBX domain-containing protein 2-like [Setaria italica]
Length=456

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 141/209 (67%), Gaps = 15/209 (7%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLS-HKRPRESPQAPPlhkd--  540
            ++DPI GQKMR W GMV P+ LLEDLLP++D  P +H +    KRPR+  Q   + K   
Sbjct  252  LIDPITGQKMRGWNGMVHPDRLLEDLLPYLDKGPKEHHAAQPQKRPRKVDQESSMAKQGK  311

Query  539  -dakeedeellqalaASMEGMKDTNVDALKESSESDVLGK-------ETNVVKKPVYPPL  384
               ++EDEEL +A+AAS+EG K+      +ES  +D + +       E ++  K  YPPL
Sbjct  312  PTVEDEDEELARAVAASLEGSKEV----AEESGATDDMAEAEPEEDNEPSLNIKLDYPPL  367

Query  383  PEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIP  204
            PEEP G ++L+CRV IRLP+ RR+QRNFL +DPI+LLWSFC+  +EE + + F   Q IP
Sbjct  368  PEEPTGSRDLLCRVAIRLPNNRRIQRNFLHTDPIKLLWSFCAPEVEEGEKRAFHFVQPIP  427

Query  203  GATSSLDFESNLTFEESGLANSMISVTWD  117
            GA+  L+F S+LTF+E+ LANSMI++ WD
Sbjct  428  GASQKLEFASDLTFKEARLANSMINLLWD  456



>ref|XP_010325366.1| PREDICTED: LOW QUALITY PROTEIN: UBX domain-containing protein 
7-like [Solanum lycopersicum]
Length=375

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 125/200 (63%), Gaps = 36/200 (18%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddak  531
            V+DPI GQKMRSW GMVQPE LL D++ F+D +PS++ S   +   E             
Sbjct  206  VIDPITGQKMRSWNGMVQPERLLADVMTFIDRTPSEYHSDLIRNQLE-------------  252

Query  530  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKG----D  363
                             + T+ D  +ESS+++   KE  ++   +Y PLPEEP G    D
Sbjct  253  -----------------RLTHRDRTEESSDTNHEPKE--MIVSCIYLPLPEEPNGSLICD  293

Query  362  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  183
            KNLVCR+ IRLPDGRR+QRNF+++DPI+LLWSFCS+  EE   + FR  QA+PG T+  +
Sbjct  294  KNLVCRIAIRLPDGRRIQRNFMKTDPIKLLWSFCSTQFEEAKTRAFRFRQAMPGPTNFWN  353

Query  182  FESNLTFEESGLANSMISVT  123
            ++SNLTFEESGL NS+I++ 
Sbjct  354  YDSNLTFEESGLDNSIIALV  373



>ref|XP_002447303.1| hypothetical protein SORBIDRAFT_06g032400 [Sorghum bicolor]
 gb|EES11631.1| hypothetical protein SORBIDRAFT_06g032400 [Sorghum bicolor]
Length=463

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 138/205 (67%), Gaps = 7/205 (3%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLS-HKRPRESPQAPPlhkdda  534
            ++DP+ GQKM +W GMV P+ LLEDLLP++D  P +H +    KRPR+  Q     K   
Sbjct  259  LIDPVTGQKMHAWNGMVHPDRLLEDLLPYLDKGPKEHHAAQPQKRPRKVDQEASTGKQGK  318

Query  533  keed---eellqalaASMEGMKDT--NVDALKESSESD-VLGKETNVVKKPVYPPLPEEP  372
               +   EEL +A+AAS+E  K+     DA  + +E++  +  E ++  KP YPPLPEEP
Sbjct  319  IAVEDEDEELARAVAASLEEGKEIIEASDASDDMAEAEPQVDNEPSLNIKPDYPPLPEEP  378

Query  371  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  192
             G ++ +CRV IRLP+ RR+QRNFL +DPI+LLWSFC+  +E+ + + F   QAIPGA+ 
Sbjct  379  TGSRDRLCRVAIRLPNNRRIQRNFLHTDPIKLLWSFCAPQVEDGEKRAFHFVQAIPGASQ  438

Query  191  SLDFESNLTFEESGLANSMISVTWD  117
             L+F S+ TF+E+GLANSMI++ WD
Sbjct  439  KLEFRSDQTFKEAGLANSMINLLWD  463



>ref|XP_003580790.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Brachypodium 
distachyon]
Length=457

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/207 (45%), Positives = 132/207 (64%), Gaps = 14/207 (7%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLS-HKRPRESPQAPPlhkdda  534
            ++DPI GQKM +W GMV P+ LLEDL+P++D  P +H +    KRPR+  Q   + +   
Sbjct  256  LIDPITGQKMCAWTGMVYPDRLLEDLMPYLDKGPKEHHAAQPQKRPRKIDQETSMGRQGR  315

Query  533  keedeellqalaASMEGMKDTNVDALKESSESDVLGKETN--------VVKKPVYPPLPE  378
               ++E  +   A    +++      K   +SD    +TN        +  K  YPPLPE
Sbjct  316  TTVEDEDEELARAVAASLEEN-----KGFEQSDATNDKTNPEEENEPSLSVKLEYPPLPE  370

Query  377  EPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGA  198
            EPK  ++L+CRV IRLPDGRR+QRNFL +DPI+LLWSFCS  LE+ D + F   + IPGA
Sbjct  371  EPKVSRDLLCRVAIRLPDGRRIQRNFLHTDPIKLLWSFCSPQLEDGDKRAFHFVKPIPGA  430

Query  197  TSSLDFESNLTFEESGLANSMISVTWD  117
            +++L +ES+ TF+E+GLANSMI++ WD
Sbjct  431  SNNLGYESDQTFKEAGLANSMINLLWD  457



>gb|EMT10976.1| hypothetical protein F775_30110 [Aegilops tauschii]
Length=396

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 132/203 (65%), Gaps = 5/203 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLS-HKRPRESPQAPPlhkdda  534
            ++DPI GQKMR W GMV P++LLEDL+P+++  P +H +    KRPR+  Q   + +   
Sbjct  194  LIDPITGQKMRGWSGMVYPDSLLEDLMPYLEKGPKEHHAAQPQKRPRKVDQETSMVRQGK  253

Query  533  keedee---llqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD  363
               + E   L +A+AAS+E  K        +   + V   E ++  K  YPPLPEEPK  
Sbjct  254  TAVESEDEELARAVAASLEENKGAGGSGAADEKSNPVEETEPSLSVKIEYPPLPEEPKVS  313

Query  362  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGAT-SSL  186
            ++L+CRV +RLPDGRR+QRNFL +DPI+LLWSFCSS +++ + + F   Q IPGA  + L
Sbjct  314  RDLLCRVAVRLPDGRRIQRNFLHADPIKLLWSFCSSQVDDGEKRAFHFGQPIPGAAINKL  373

Query  185  DFESNLTFEESGLANSMISVTWD  117
             + S  TF+E+GLANSMI++ WD
Sbjct  374  QYSSEQTFKEAGLANSMINLLWD  396



>ref|NP_001170636.1| uncharacterized protein LOC100384688 [Zea mays]
 gb|ACR34298.1| unknown [Zea mays]
 gb|AFW59832.1| hypothetical protein ZEAMMB73_017157 [Zea mays]
Length=459

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 133/204 (65%), Gaps = 9/204 (4%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSP-SDHVSLSHKRPRESPQAPPlhkdda  534
            ++DP+ GQK+ +W GMV P+ LLEDLLP++D  P   H +   KRPR+  Q     K   
Sbjct  257  LIDPVTGQKVHAWNGMVHPDRLLEDLLPYLDKGPKGHHAAQPQKRPRKVDQEASTGKQGK  316

Query  533  keed---eellqalaASMEGM---KDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP  372
               +   EEL +A+AAS+E +    D + D + E+   +      N+  KP YPPLPEEP
Sbjct  317  IAVEDEDEELARAIAASLEVVIEASDASDDDMAEAEPEEENEPSLNI--KPDYPPLPEEP  374

Query  371  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  192
            KG + L+CRV IRLP+ +R+QRNFL +DPI+LLWSFC+  +E+ + + F   QAIPGA+ 
Sbjct  375  KGSRELLCRVAIRLPNNQRIQRNFLHTDPIKLLWSFCAPQVEDGEKRAFHFVQAIPGASQ  434

Query  191  SLDFESNLTFEESGLANSMISVTW  120
             L F S+LTF ++GLANSMI++ W
Sbjct  435  KLQFGSDLTFRKAGLANSMINLLW  458



>dbj|BAK05667.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=453

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 134/203 (66%), Gaps = 8/203 (4%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLS-HKRPRESPQAPPlhkdda  534
            ++DPI GQKMR W GMV P++LLEDL+P+++  P +H +    KRPR+  Q   + +   
Sbjct  254  LIDPITGQKMRGWNGMVYPDSLLEDLMPYLEKGPKEHHAAQPQKRPRKVDQETSVVRQGK  313

Query  533  k---eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD  363
                 EDEEL +A+AAS+E  K +  D      E +   KE ++  K  YPPLPEEPK  
Sbjct  314  TGIENEDEELARAVAASLEEKKGSGDDETNPKPEEE---KEPSLSAKMEYPPLPEEPKVS  370

Query  362  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGAT-SSL  186
            + LVCRV +RLP GRR+QRNFL +DPI+LLWS CSS +E+ + + F   Q IPGA  + L
Sbjct  371  RELVCRVAVRLPGGRRIQRNFLHTDPIKLLWSLCSSEVEDGEKRAFHFGQPIPGAAINKL  430

Query  185  DFESNLTFEESGLANSMISVTWD  117
             +ES  TF+E+GLANSMI++ WD
Sbjct  431  QYESEQTFKEAGLANSMINLLWD  453



>tpg|DAA35438.1| TPA: hypothetical protein ZEAMMB73_856149 [Zea mays]
Length=426

 Score =   169 bits (427),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 131/205 (64%), Gaps = 7/205 (3%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLS-HKRPRE-SPQAPPlhkdd  537
            ++DP+ GQKM +W GMV P+ LLEDLLP++D  P +H +    KRPR+  P+A    +  
Sbjct  222  LIDPVTGQKMHAWNGMVHPDRLLEDLLPYLDKGPKEHHAAQPQKRPRKVDPEASTGKQGK  281

Query  536  akeedeellqalaASMEGMKDTNVDALKESSESDVLGKET-----NVVKKPVYPPLPEEP  372
               EDE+   A A +    +   V    ++S+  V  +        +  KP YPPLPEEP
Sbjct  282  IAVEDEDEELARAVAASLEESKEVIEASDASDDMVEAEPEEENEPTLNTKPDYPPLPEEP  341

Query  371  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  192
             G ++L+CRV IRLP+ RR+QRNFL +DPI+LLWSFC+  +E+ + + F   QAIPGA+ 
Sbjct  342  TGSRDLLCRVAIRLPNNRRIQRNFLHTDPIKLLWSFCAPQVEDGERRAFHFVQAIPGASQ  401

Query  191  SLDFESNLTFEESGLANSMISVTWD  117
             L+  S+LTF+E+GLANSMI++  D
Sbjct  402  KLELGSDLTFKEAGLANSMINLLLD  426



>tpg|DAA35439.1| TPA: hypothetical protein ZEAMMB73_856149 [Zea mays]
Length=461

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 131/205 (64%), Gaps = 7/205 (3%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLS-HKRPRE-SPQAPPlhkdd  537
            ++DP+ GQKM +W GMV P+ LLEDLLP++D  P +H +    KRPR+  P+A    +  
Sbjct  257  LIDPVTGQKMHAWNGMVHPDRLLEDLLPYLDKGPKEHHAAQPQKRPRKVDPEASTGKQGK  316

Query  536  akeedeellqalaASMEGMKDTNVDALKESSESDVLGKET-----NVVKKPVYPPLPEEP  372
               EDE+   A A +    +   V    ++S+  V  +        +  KP YPPLPEEP
Sbjct  317  IAVEDEDEELARAVAASLEESKEVIEASDASDDMVEAEPEEENEPTLNTKPDYPPLPEEP  376

Query  371  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  192
             G ++L+CRV IRLP+ RR+QRNFL +DPI+LLWSFC+  +E+ + + F   QAIPGA+ 
Sbjct  377  TGSRDLLCRVAIRLPNNRRIQRNFLHTDPIKLLWSFCAPQVEDGERRAFHFVQAIPGASQ  436

Query  191  SLDFESNLTFEESGLANSMISVTWD  117
             L+  S+LTF+E+GLANSMI++  D
Sbjct  437  KLELGSDLTFKEAGLANSMINLLLD  461



>ref|XP_010935375.1| PREDICTED: UBX domain-containing protein 5 isoform X2 [Elaeis 
guineensis]
Length=413

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 121/198 (61%), Gaps = 42/198 (21%)
 Frame = -1

Query  638  DLLPFMDGSPSDHVS-LSHKRPRESPQAPPlhkddakeedeellqalaASMEGMKDTNV-  465
            DLLP++D  P +H + L  KRPRE                  +++   A   GM D  + 
Sbjct  234  DLLPYLDKGPKEHHAILPQKRPRE------------------MVKDSTAHTSGMPDKTLV  275

Query  464  ----DALKESSES--DVLG----------------KETNVVKKPVYPPLPEEPKGDKNLV  351
                DA++++S +  D  G                 ET+   KP+YPPLPEEPKG + L+
Sbjct  276  PKSADAVQKTSATLEDTGGPIRSHATNDVPKHDKVAETSSSGKPIYPPLPEEPKGSRELL  335

Query  350  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESN  171
            CRVGIRLPDGRRLQRNFLR DP++ LWSFC S LE+ + +PF  TQAIPGA+  L++ESN
Sbjct  336  CRVGIRLPDGRRLQRNFLRKDPVKFLWSFCCSKLEDGETRPFHFTQAIPGASKVLNYESN  395

Query  170  LTFEESGLANSMISVTWD  117
            LTFE++GL+NSMIS+ WD
Sbjct  396  LTFEDAGLSNSMISLAWD  413



>ref|XP_008668717.1| PREDICTED: UBX domain-containing protein 2-like [Zea mays]
Length=542

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 133/207 (64%), Gaps = 11/207 (5%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRE-SPQAPPlhkdd  537
            ++DP+ GQKM +W GMV P+ LLEDLLP++D  P +H  +   KRPR+  P+A       
Sbjct  338  LIDPVTGQKMHAWNGMVHPDRLLEDLLPYLDKGPKEHHAAQPQKRPRKVDPEA--STGKQ  395

Query  536  akeedeellqalaASMEGMKDTNVDALKESSESDVL-------GKETNVVKKPVYPPLPE  378
             K   E+  + LA ++    + + + ++ S  SD +         E  +  KP YPPLPE
Sbjct  396  GKIAVEDEDEELARAVAASLEESKEVIEASDASDDMVEAEPEEENEPTLNTKPDYPPLPE  455

Query  377  EPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGA  198
            EP G ++L+CRV IRLP+ RR+QRNFL +DPI+LLWSFC+  +E+ + + F   QAIPGA
Sbjct  456  EPTGSRDLLCRVAIRLPNNRRIQRNFLHTDPIKLLWSFCAPQVEDGERRAFHFVQAIPGA  515

Query  197  TSSLDFESNLTFEESGLANSMISVTWD  117
            +  L+  S+LTF+E+GLANSMI++  D
Sbjct  516  SQKLELGSDLTFKEAGLANSMINLLLD  542



>ref|XP_006343881.1| PREDICTED: UBX domain-containing protein 7-like [Solanum tuberosum]
Length=424

 Score =   166 bits (421),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 126/209 (60%), Gaps = 41/209 (20%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS--LSHKRPRESPQAPPlhkdd  537
            V+DPI GQ MRSW GMVQPETLLED + F+D +PS++ S  LS +  R +P+        
Sbjct  240  VIDPITGQNMRSWNGMVQPETLLEDAMTFIDRTPSEYHSDLLSKQFDRLTPRDRIE----  295

Query  536  akeedeellqalaASMEGMKDTNVDALKES-SESDVLGKETNVVKKPVYPPLPEEPK---  369
                               + TN +  KE  ++ + L   TN++    Y PLPEEP    
Sbjct  296  -------------------ESTNHEESKEEENDQNELSMNTNMI----YLPLPEEPNRSL  332

Query  368  ---GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPG-  201
                DKNLVCR+ IRLPDGRR+QRNF+++DPI+LLWSFCS+  EE   K FR  QA+PG 
Sbjct  333  ISNCDKNLVCRIAIRLPDGRRIQRNFMKTDPIKLLWSFCSTQFEEAKTKAFRFRQAMPGP  392

Query  200  ----ATSSLDFESNLTFEESGLANSMISV  126
                A++    +SNLTFEESGL NS+I++
Sbjct  393  TKFWASNFWTCDSNLTFEESGLDNSIIAL  421



>gb|EMS63720.1| UBX domain-containing protein 7 [Triticum urartu]
Length=454

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 134/203 (66%), Gaps = 5/203 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLS-HKRPRESPQAPP---lhk  543
            ++DPI GQKMR W GMV P++LLEDL+P+++  P +H +    KRPR+  Q        K
Sbjct  252  LIDPITGQKMRGWSGMVYPDSLLEDLMPYLEKGPKEHHAAQPQKRPRKVDQETSMDRQGK  311

Query  542  ddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD  363
               + EDEEL +A+AAS+E  K        +   + V   E ++  K  YPPLPEEPK  
Sbjct  312  TAVESEDEELARAVAASLEENKGAGGSDGADEKSNPVEETEPSLSVKMEYPPLPEEPKVS  371

Query  362  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGAT-SSL  186
            ++L+CRV +RLPDG+R+QRNFL +DPI+LLWSFCSS +E+ + + F   Q IPGA  + L
Sbjct  372  RDLLCRVAVRLPDGQRIQRNFLHTDPIKLLWSFCSSRVEDGEKRAFHFGQPIPGAAINKL  431

Query  185  DFESNLTFEESGLANSMISVTWD  117
             + S  TF+E+G+ANSMI++ WD
Sbjct  432  QYSSEQTFKEAGVANSMINLLWD  454



>ref|XP_010519525.1| PREDICTED: UBX domain-containing protein 2-like [Tarenaya hassleriana]
Length=324

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 116/203 (57%), Gaps = 43/203 (21%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD--HVSLSHKRPRESPQAPPlhkdd  537
            ++DP  GQ+M  W G + P   LEDL+PFMD  P +    S+S KRPR  P         
Sbjct  160  LIDPTTGQQMHLWSGKIDPRAFLEDLVPFMDHGPRECSSSSVSRKRPRMDPMVAKQV---  216

Query  536  akeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN  357
                                    D+L+            N+  + V+PPLPEEP+G  N
Sbjct  217  -----------------------TDSLR------------NMTLEAVFPPLPEEPQGSSN  241

Query  356  --LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  183
               +CRVG+RLPDGRRL R+F +SDPIQLLWSFC S LE  + KP +L  AIPGA+ +L+
Sbjct  242  GGFLCRVGVRLPDGRRLVRSFNKSDPIQLLWSFCYSELEGWEGKPLKLRLAIPGASKTLE  301

Query  182  FESNLTFEESGLANSMISV-TWD  117
            + SNLTFE+SGL NS+I+V TWD
Sbjct  302  YGSNLTFEQSGLENSLITVTTWD  324



>ref|XP_006414754.1| hypothetical protein EUTSA_v10027144mg, partial [Eutrema salsugineum]
 gb|ESQ56207.1| hypothetical protein EUTSA_v10027144mg, partial [Eutrema salsugineum]
Length=388

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 128/204 (63%), Gaps = 20/204 (10%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS--LSHKRPRESPQAPPlhkdd  537
            ++DPI GQKM SW G+++ ++ LEDL  +MD  P +HV+   S+KR +       +  + 
Sbjct  199  LIDPITGQKMHSWSGVIEAKSFLEDLAKYMDSGPHEHVASLTSNKRIK----TEKVCYES  254

Query  536  akeedeellqalaASMEGMKDTNVD-ALKESSESDV-LGKETNVVKKPVYPPLPEEPKGD  363
             +    + +     +       N+D  L ES E D  LG          +P L EEPKGD
Sbjct  255  DQTSTCQDMSTFWDNFFEESSNNIDHILFESVEDDTFLG----------FPVLTEEPKGD  304

Query  362  --KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSS  189
              +++VC + IR PDGRR QRNFL+++P+QLLWSFC S +EE++   F+L QAIPG++ +
Sbjct  305  CDRSVVCSLCIRFPDGRRKQRNFLKTEPVQLLWSFCYSQMEESEKNAFKLVQAIPGSSKT  364

Query  188  LDFESNLTFEESGLANSMISVTWD  117
            LD+ +N TF++SGLANS+ISVTW+
Sbjct  365  LDYGANATFDQSGLANSLISVTWE  388



>ref|XP_009398016.1| PREDICTED: UBX domain-containing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   161 bits (407),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 131/200 (66%), Gaps = 3/200 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS-LSHKRPRESPQ-APPlhkdd  537
            V+DPI GQKMR W  MV PE LLE+LLPF+D  P++H + L  KRPR +   A     D 
Sbjct  236  VIDPITGQKMRGWSNMVHPERLLEELLPFLDKGPNEHHAILPQKRPRVTHNSALNNILDK  295

Query  536  akeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKN  357
              E+DE L++A+AAS+E  K  +   + +         ET++  + +YPPLPEEPK  + 
Sbjct  296  EVEDDEVLMRAIAASLEDGKGASWPPVIDDEPKPEKDSETSLNGEMIYPPLPEEPKSSRE  355

Query  356  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  177
            L C++ IRLPDGRR++RNFL +D  +LLWS CSS L +   +PF   +AIPG   SL++ 
Sbjct  356  L-CKIAIRLPDGRRIRRNFLPTDSTKLLWSLCSSQLADGQKRPFHFAEAIPGTLKSLEYA  414

Query  176  SNLTFEESGLANSMISVTWD  117
            +NLTFEE+GL+N MI++  D
Sbjct  415  NNLTFEEAGLSNKMITLILD  434



>gb|KJB30688.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
Length=408

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 113/153 (74%), Gaps = 7/153 (5%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRES---PQAPPlhk  543
            V+DPI GQKMRSW GMVQPE+LLEDL+ FMDG P D H +LSHKRPR S   PQ      
Sbjct  253  VIDPITGQKMRSWFGMVQPESLLEDLVQFMDGGPRDYHATLSHKRPRGSSVTPQQKIKVS  312

Query  542  ddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD  363
             D   ED+E+L+A+AASME  K++ +   ++   S    +E  + KKP YPPLPEEPKGD
Sbjct  313  TDETNEDKEMLRAIAASMENAKES-IKTTEDDKVSSTTEEEPCLTKKPAYPPLPEEPKGD  371

Query  362  KNLVCRVGIRLPDGRRLQRNFLRSDPIQ--LLW  270
            +NL+CRVG+RLPDGRR+QRNFLR+DPIQ  +LW
Sbjct  372  RNLLCRVGVRLPDGRRVQRNFLRTDPIQVSILW  404



>ref|XP_002868299.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44558.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=694

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 131/215 (61%), Gaps = 27/215 (13%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQAPPlhkdda  534
            ++DP+ GQKMR W GM++P+  LEDL+ +MD  P +HV SLS+KR +    + P +  D 
Sbjct  158  LIDPVTGQKMRMWSGMIEPQGFLEDLMKYMDAGPHEHVASLSNKRIKTEKISFPSNNADD  217

Query  533  keedeellqalaASMEGMKDTNVDALKESSESDVL----GKETNVVKKPV----------  396
            + +            + +++    A  E  E+ V+    G+E   +K             
Sbjct  218  QVDMATFWG------DDIEEEKTVAKDEKEENLVVAPSWGQEFEDIKTLSDHEEETCLSS  271

Query  395  ----YPPLPEEPK--GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDA  234
                +P L EEPK   D+++VC + +R PDGRR QR FL+S+PIQLLWSFC SH+EE++ 
Sbjct  272  DLFEFPVLTEEPKEDCDRSIVCSLCVRFPDGRRKQRKFLKSEPIQLLWSFCYSHMEESEK  331

Query  233  KPFRLTQAIPGATSSLDFESNLTFEESGLANSMIS  129
            K FRL QAIPGA+ +LD+ +N+TF+ SGLANSMIS
Sbjct  332  KAFRLVQAIPGASKTLDYGANVTFDHSGLANSMIS  366


 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 77/96 (80%), Gaps = 2/96 (2%)
 Frame = -1

Query  398  VYPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPF  225
            V+P L EEP GD  ++ VC + +R PDGRR QR FL+S+ IQLLWSFC S ++E++ + F
Sbjct  599  VFPVLAEEPNGDCDRSFVCSLCVRFPDGRRKQRRFLKSERIQLLWSFCYSLMDESEKRSF  658

Query  224  RLTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  117
            +L QAIPGA+ +LD+E++ TF++SGLANSMISVTW+
Sbjct  659  KLVQAIPGASKTLDYEADTTFDQSGLANSMISVTWE  694


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQA  558
            V++PI GQKMR W G+++P++ +EDL+ F D  P +++ SL+  R  E+ + 
Sbjct  463  VINPITGQKMRMWSGVIEPDSFVEDLMMFRDAGPHENIASLTRNRRTETTET  514



>ref|XP_010450084.1| PREDICTED: UBX domain-containing protein 7-like [Camelina sativa]
Length=373

 Score =   157 bits (396),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 121/220 (55%), Gaps = 49/220 (22%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS--LSHKRPRESPQAPPlhkdd  537
            ++DPI GQKMR+W GM++    LEDL+ + D  P +HV+   S+KR +            
Sbjct  181  LIDPITGQKMRTWSGMIEAHDFLEDLMKYRDVGPHEHVASLTSNKRIK------------  228

Query  536  akeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKP--------------  399
                            E +   +  A  +  +      +  VV  P              
Sbjct  229  ---------------TEKIWFVSSQAYDDHHDMSTFWDDDRVVTTPPSWGIEFEETCLSS  273

Query  398  ----VYPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD  237
                 +P L EEPKGD  ++L+C + IR PDGRR+QR FL+S+PIQLLWSFC SH+EE++
Sbjct  274  DDMFEFPVLTEEPKGDCDRSLLCSLCIRFPDGRRMQRKFLKSEPIQLLWSFCYSHMEESE  333

Query  236  AKPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  117
             + F+L QAIPGAT +LD+ +  TF++SG+ NSM+SVTW+
Sbjct  334  KRAFKLVQAIPGATKTLDYGAKATFDQSGIDNSMVSVTWE  373



>ref|XP_010519462.1| PREDICTED: UBX domain-containing protein 2-like [Tarenaya hassleriana]
Length=357

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 129/200 (65%), Gaps = 22/200 (11%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddak  531
            ++DPI GQKMR W GMV+ E LLE+L+PFMD  P   +     R ++ P +    +  + 
Sbjct  176  LIDPITGQKMRLWYGMVEGEILLEELVPFMDDGPKQQL----LRKKQHPTSTTEEQKPSL  231

Query  530  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP-KGDKNL  354
            E ++ L +   AS+E +       L E  +++ +         P++PPLP+EP  GD  +
Sbjct  232  ETEKPLSETATASLETL------TLSEKDQANAM---------PMFPPLPQEPITGDPRV  276

Query  353  VCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAK-PFRLTQA-IPGATSSLDF  180
            +CRVG R PDGRRL R FL+++PIQLLWSFC + ++E++ K PF+L +   PG+++++D+
Sbjct  277  LCRVGFRFPDGRRLMRTFLKTEPIQLLWSFCYAQIQESEMKQPFKLVETRTPGSSNAIDY  336

Query  179  ESNLTFEESGLANSMISVTW  120
             SN TFE+SGLANS+I ++W
Sbjct  337  GSNQTFEQSGLANSIIFLSW  356



>ref|NP_001190727.1| UBX domain-containing pseudogene [Arabidopsis thaliana]
 gb|AEE83402.1| structural constituent of ribosome [Arabidopsis thaliana]
Length=815

 Score =   159 bits (402),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 91/224 (41%), Positives = 132/224 (59%), Gaps = 33/224 (15%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS--LSHKRPR------ESPQAP  555
            ++DPI GQKMR W G+++P+  LEDL+ +MD  P +HV+   S+KR +       S  A 
Sbjct  157  LIDPITGQKMRMWSGVIEPQGFLEDLMKYMDSGPHEHVASLTSNKRMKTEKISCSSNNAD  216

Query  554  PlhkddakeedeellqalaASMEGMKDT----------------NVDALKESSESDVLGK  423
                        E  + +  S  G ++T                ++  L E  E   L  
Sbjct  217  DQDMATFWGNAIEEEKTVIKS--GKEETFTSDRVVAPSWGPEFEDIMTLSEHEEETCLS-  273

Query  422  ETNVVKKPVYPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHL  249
              ++++   +P L EEPK D  +++VC + +R PDGRR QR FL+S+PIQLLWSFC SH+
Sbjct  274  -CDLLE---FPVLTEEPKADCDRSVVCSICVRFPDGRRKQRKFLKSEPIQLLWSFCYSHM  329

Query  248  EETDAKPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  117
            EE++ K F+L QAIPGA+ +LD+ +  TF++SG+ANSMISVTWD
Sbjct  330  EESEKKEFKLVQAIPGASKTLDYGAKATFDQSGIANSMISVTWD  373


 Score =   153 bits (387),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 138/231 (60%), Gaps = 33/231 (14%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQA--------  558
            V++PI GQKM  W G+++ E+++EDL+ F D  P +++ SL+  R  E+ +         
Sbjct  585  VINPITGQKMHMWSGVIEAESIVEDLMMFWDAGPHENIASLTRNRRTETAETCLSSYNFY  644

Query  557  -PPlhkddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNV----------  411
              P      + E+E+   + + + + +  T    L+E  E ++    ++           
Sbjct  645  ETPAPSWGEEFEEEDNWSSRSNNNQVVAPTWEKELEEQDEWEIWSSRSDTDDFVPPFMGD  704

Query  410  -------VKKP----VYPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLW  270
                   VK+     V+P L EEPKGD  +++VC + +R PDGRR QR FL+S+PIQLLW
Sbjct  705  EYEDPDEVKEEEICLVFPVLTEEPKGDCDRSVVCSLCVRFPDGRRKQRKFLKSEPIQLLW  764

Query  269  SFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  117
            SFC SH++E++ K F+L QAIPGA+ +LD E++ TF++SGLANS+ISVTW+
Sbjct  765  SFCYSHIDESEKKAFKLVQAIPGASKTLDCEADATFDQSGLANSLISVTWE  815



>emb|CAB10204.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78467.1| hypothetical protein [Arabidopsis thaliana]
Length=724

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/224 (41%), Positives = 131/224 (58%), Gaps = 33/224 (15%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS--LSHKRPR------ESPQAP  555
            ++DPI GQKMR W G+++P+  LEDL+ +MD  P +HV+   S+KR +       S  A 
Sbjct  165  LIDPITGQKMRMWSGVIEPQGFLEDLMKYMDSGPHEHVASLTSNKRMKTEKISCSSNNAD  224

Query  554  PlhkddakeedeellqalaASMEGMKDT----------------NVDALKESSESDVLGK  423
                        E  + +  S  G ++T                ++  L E  E   L  
Sbjct  225  DQDMATFWGNAIEEEKTVIKS--GKEETFTSDRVVAPSWGPEFEDIMTLSEHEEETCLS-  281

Query  422  ETNVVKKPVYPPLPEEPKG--DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHL  249
              ++++ PV   L EEPK   D+++VC + +R PDGRR QR FL+S+PIQLLWSFC SH+
Sbjct  282  -CDLLEFPV---LTEEPKADCDRSVVCSICVRFPDGRRKQRKFLKSEPIQLLWSFCYSHM  337

Query  248  EETDAKPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  117
            EE++ K F+L QAIPGA+ +LD+ +  TF +SG+ANSMISVTWD
Sbjct  338  EESEKKEFKLVQAIPGASKTLDYGAKATFVQSGIANSMISVTWD  381


 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 138/231 (60%), Gaps = 33/231 (14%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQA--------  558
            V++PI GQKM  W G+++ E+++EDL+ F D  P +++ SL+  R  E+ +         
Sbjct  494  VINPITGQKMHMWSGVIEAESIVEDLMMFWDAGPHENIASLTRNRRTETAETCLSSYNFY  553

Query  557  -PPlhkddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNV----------  411
              P      + E+E+   + + + + +  T    L+E  E ++    ++           
Sbjct  554  ETPAPSWGEEFEEEDNWSSRSNNNQVVAPTWEKELEEQDEWEIWSSRSDTDDFVPPFMGD  613

Query  410  -------VKKP----VYPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLW  270
                   VK+     V+P L EEPKGD  +++VC + +R PDGRR QR FL+S+PIQLLW
Sbjct  614  EYEDPDEVKEEEICLVFPVLTEEPKGDCDRSVVCSLCVRFPDGRRKQRKFLKSEPIQLLW  673

Query  269  SFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  117
            SFC SH++E++ K F+L QAIPGA+ +LD E++ TF++SGLANS+ISVTW+
Sbjct  674  SFCYSHIDESEKKAFKLVQAIPGASKTLDCEADATFDQSGLANSLISVTWE  724



>gb|EYU24728.1| hypothetical protein MIMGU_mgv1a025994mg, partial [Erythranthe 
guttata]
Length=320

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 111/151 (74%), Gaps = 10/151 (7%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSLSHKRPRESPQAPPlhkdda  534
            ++DPI GQK+ +WRGMVQPE LLEDL+PFMDGSPSDH VSLSHKRPR   +AP  H   A
Sbjct  173  LIDPITGQKLHAWRGMVQPENLLEDLVPFMDGSPSDHHVSLSHKRPRVHTEAPVHHIQSA  232

Query  533  keedeel------lqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP  372
              E+ +        +ALAASM   K+ +    KE +E++   +ET   KKP Y PLPEEP
Sbjct  233  AAENHDEDEEEELQRALAASMVDTKEIDEGDSKEVTEANN-AEETE--KKPSYLPLPEEP  289

Query  371  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQ  279
            KGD++L+CRVG+RLPDGRR+QRNFLR+DP+Q
Sbjct  290  KGDRSLLCRVGVRLPDGRRVQRNFLRTDPVQ  320



>ref|XP_001758899.1| predicted protein [Physcomitrella patens]
 gb|EDQ76405.1| predicted protein [Physcomitrella patens]
Length=450

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/202 (42%), Positives = 115/202 (57%), Gaps = 13/202 (6%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLS---HKRPRESPQAPPlhkd  540
            V+DPI GQKMRSW GM+  E LLEDL+ +MD  P D   +    HKRPRE+ +       
Sbjct  258  VIDPITGQKMRSWEGMISAERLLEDLVRYMDMGPLDKQPIGFPPHKRPREAAKDANQPFK  317

Query  539  dakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDK  360
                     +++       +    VDA       DV+    + V++ VYP L EEP+   
Sbjct  318  GHSLSGSRHMESSMEPSGALSGEKVDA-------DVVA--ASAVQQIVYPSLSEEPENKA  368

Query  359  NLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEET-DAKPFRLTQAIPGATSSLD  183
               CRVG+R PDG R  R FL SD ++ LWSFCSS ++E  D +PF L Q IPGA  +L 
Sbjct  369  PGTCRVGVRFPDGSRSNRRFLMSDSVKQLWSFCSSKVKEAEDGRPFHLNQMIPGANRTLV  428

Query  182  FESNLTFEESGLANSMISVTWD  117
            + S+ + EE+G+AN+M+S+ WD
Sbjct  429  YSSDASMEEAGVANAMLSMVWD  450



>emb|CDY12748.1| BnaC04g28930D [Brassica napus]
Length=351

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/228 (36%), Positives = 128/228 (56%), Gaps = 32/228 (14%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddak  531
            ++DPI GQ MRSW G ++    +EDL+ +MD  P  +++ S +  R              
Sbjct  135  LIDPITGQNMRSWSGAIEAHGFVEDLMKYMDDGPHQYMASSTRNKR--------------  180

Query  530  eedeellqalaASMEGMKDTNVD-----------ALKESSESDVLGKETNVVKKPVYPPL  384
               +    +  +S  GM +   +            L+    ++V  +E   ++   YP L
Sbjct  181  --MKTDKISSESSQTGMPELARNQTISHIVVPSWGLEFEKSAEVKQEEETCLR---YPDL  235

Query  383  PEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQA  210
             EEP GD  ++LVC + +R PDGRR QR FL+++PIQLLWSFC S + E++ K F+L QA
Sbjct  236  TEEPNGDCDRSLVCSLCVRFPDGRRKQRKFLKTEPIQLLWSFCYSQMVESEKKAFKLVQA  295

Query  209  IPGATSSLDFESNLTFEESGLANSMISVTWD*SKMITVCFSSM*NARI  66
            IPGA+ +L++  N TF++SGLANSMIS+TW+    I +  + + + +I
Sbjct  296  IPGASKTLEYGPNATFDQSGLANSMISITWELYIYIYIFHNYLGSTKI  343



>ref|XP_009139539.1| PREDICTED: UBX domain-containing protein 2-like [Brassica rapa]
Length=387

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 78/202 (39%), Positives = 120/202 (59%), Gaps = 14/202 (7%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQAPPlhkdda  534
            ++DPI G KMRSW G+++ ++ ++DL+ +    P +H+ SL+ K P              
Sbjct  196  LIDPITGFKMRSWSGVIEAQSFIDDLMNYTKSGPHEHIASLTRKEP----------VLCN  245

Query  533  keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPV-YPPLPEEPKGD--  363
            +           +  E    TN D + E+ E+  L       +  + +P L EEP+GD  
Sbjct  246  ETNQTSDDVVTPSGAETCSSTNCDDVVETIETKTLPTHDEEEETCLEFPVLTEEPRGDCD  305

Query  362  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  183
            ++LVC + +R PDGRR QR FL+++PIQLLWSFC S + E++ K F+L QAIPGA+ +LD
Sbjct  306  RSLVCSLCVRFPDGRRKQRKFLKTEPIQLLWSFCYSQMVESEKKAFKLVQAIPGASKTLD  365

Query  182  FESNLTFEESGLANSMISVTWD  117
            + ++ TF +SGLANSM+ V W+
Sbjct  366  YGADATFGQSGLANSMVLVAWE  387



>ref|XP_006285858.1| hypothetical protein CARUB_v10007353mg, partial [Capsella rubella]
 gb|EOA18756.1| hypothetical protein CARUB_v10007353mg, partial [Capsella rubella]
Length=348

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 124/204 (61%), Gaps = 16/204 (8%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS--LSHKRPRESPQAPPlhkdd  537
            ++DPI GQKM +W GM++ +  L++L+ ++D  P +HV+   S+KR +  P         
Sbjct  154  LIDPITGQKMHTWAGMIEAQAFLQELMTYLDVGPHEHVASLTSNKRIKTEP---------  204

Query  536  akeedeellqalaASMEGMKDTNV-DALKESSESDV-LGKETNVVKKPV-YPPLPEEPKG  366
                  +        M    D  + D+++E+  S   L +E  ++     +P L EEPK 
Sbjct  205  IWFSSSQAYNGGDQDMSTFADPPLPDSIEETLMSLTELDEEARLLSDLFEFPALTEEPKE  264

Query  365  DKN--LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATS  192
            D +  L+C + +R PDGRR QR FL+S+P+QLLWSFC S +EE++ K F+L QAIPGAT 
Sbjct  265  DCDPSLLCSLCVRFPDGRRKQRKFLKSEPVQLLWSFCFSLMEESEEKAFKLVQAIPGATK  324

Query  191  SLDFESNLTFEESGLANSMISVTW  120
            +LD+ +  TF +SG+ANSM+SVTW
Sbjct  325  TLDYGAEATFGQSGIANSMVSVTW  348



>ref|XP_006470475.1| PREDICTED: UBX domain-containing protein 7-like [Citrus sinensis]
Length=397

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 112/199 (56%), Gaps = 49/199 (25%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddak  531
            V+DPI G+KMR W GMV P +LLEDLL FM+  P D +  + K   + P  PP+H+    
Sbjct  218  VIDPITGEKMRKWCGMVDPVSLLEDLLSFMESGPRDQLERATKT--QLPPYPPVHE----  271

Query  530  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP-KGDKNL  354
                                                     + P YP +PEEP +  +NL
Sbjct  272  -----------------------------------------QMPAYPAVPEEPLQVARNL  290

Query  353  VCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGATSSLDFE  177
            VCR+G+RLPDGR ++RNFL +DP+QLLWSFC S LEE +  + FRLT+  PGA   LD+ 
Sbjct  291  VCRIGVRLPDGRMIRRNFLLTDPVQLLWSFCFSQLEEANQTRQFRLTRPDPGAPKPLDYN  350

Query  176  SNLTFEESGLANSMISVTW  120
            S +TF+ESGL NS+I VTW
Sbjct  351  SKMTFQESGLNNSVILVTW  369



>ref|NP_193161.3| UBX domain-containing pseudogene [Arabidopsis thaliana]
 gb|AEE83401.1| structural constituent of ribosome [Arabidopsis thaliana]
Length=821

 Score =   153 bits (387),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 138/231 (60%), Gaps = 33/231 (14%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQA--------  558
            V++PI GQKM  W G+++ E+++EDL+ F D  P +++ SL+  R  E+ +         
Sbjct  591  VINPITGQKMHMWSGVIEAESIVEDLMMFWDAGPHENIASLTRNRRTETAETCLSSYNFY  650

Query  557  -PPlhkddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNV----------  411
              P      + E+E+   + + + + +  T    L+E  E ++    ++           
Sbjct  651  ETPAPSWGEEFEEEDNWSSRSNNNQVVAPTWEKELEEQDEWEIWSSRSDTDDFVPPFMGD  710

Query  410  -------VKKP----VYPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLW  270
                   VK+     V+P L EEPKGD  +++VC + +R PDGRR QR FL+S+PIQLLW
Sbjct  711  EYEDPDEVKEEEICLVFPVLTEEPKGDCDRSVVCSLCVRFPDGRRKQRKFLKSEPIQLLW  770

Query  269  SFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  117
            SFC SH++E++ K F+L QAIPGA+ +LD E++ TF++SGLANS+ISVTW+
Sbjct  771  SFCYSHIDESEKKAFKLVQAIPGASKTLDCEADATFDQSGLANSLISVTWE  821


 Score =   153 bits (387),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 128/219 (58%), Gaps = 23/219 (11%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddak  531
            ++DPI GQKMR W G+++P+  LEDL+ +MD  P  H  ++     +  +   +      
Sbjct  163  LIDPITGQKMRMWSGVIEPQGFLEDLMKYMDSGP--HEHVASLTSNKRMKTEKISCSSNN  220

Query  530  eedeellqalaASMEGMKDTNVDALKESSESDVL-----------------GKETNVVKK  402
             +D+++      ++E  K       +E+  SD +                  +E   +  
Sbjct  221  ADDQDMATFWGNAIEEEKTVIKSGKEETFTSDRVVAPSWGPEFEDIMTLSEHEEETCLSC  280

Query  401  PV--YPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDA  234
             +  +P L EEPK D  +++VC + +R PDGRR QR FL+S+PIQLLWSFC SH+EE++ 
Sbjct  281  DLLEFPVLTEEPKADCDRSVVCSICVRFPDGRRKQRKFLKSEPIQLLWSFCYSHMEESEK  340

Query  233  KPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  117
            K F+L QAIPGA+ +LD+ +  TF++SG+ANSMISVTWD
Sbjct  341  KEFKLVQAIPGASKTLDYGAKATFDQSGIANSMISVTWD  379



>emb|CDY01207.1| BnaA04g06120D [Brassica napus]
Length=789

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 123/207 (59%), Gaps = 9/207 (4%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRP----RESPQAPPlh  546
            ++DPI G KMRSW G+++ ++ ++DL+ +    P +H+ SL+ K P    + +  +  + 
Sbjct  583  LIDPITGFKMRSWSGVIEAQSFIDDLMNYTKSGPHEHIASLTRKEPVLCNKTNQTSDDVV  642

Query  545  kddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVY--PPLPEEP  372
                 E             E    TN + + E+ E+  L       ++  +  P L EEP
Sbjct  643  TPSGAETCSSSNHIDHVVAETCSSTNCNDVVETIETKTLPTHEEKEEETCFEFPVLTEEP  702

Query  371  KGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGA  198
            KGD  ++LVC + +R PDGRR QR FL+++PIQLLWSFC S + E++ K F+L QAIPGA
Sbjct  703  KGDCDRSLVCSLCVRFPDGRRKQRKFLKTEPIQLLWSFCHSQMVESEKKAFKLVQAIPGA  762

Query  197  TSSLDFESNLTFEESGLANSMISVTWD  117
            + +LD+ ++ TF +SGLANSM+ V W+
Sbjct  763  SKTLDYGADATFGQSGLANSMVLVAWE  789


 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 91/251 (36%), Positives = 141/251 (56%), Gaps = 22/251 (9%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLS--HKRPRESPQAPPlhkdd  537
            ++DPI GQ MRSW G ++    +EDL+ +MD  P  +++ S  +KR +    +    +  
Sbjct  169  LIDPITGQNMRSWSGAIEAHGFVEDLMKYMDDGPHQYMASSTRNKRMKTEKISSESSQTG  228

Query  536  akeedeellqalaASMEGMKDTNVDALK-------ESSESDVLGKETNVVKKPVYPPLPE  378
              E  E L           ++  +  +        E  +S  + +E   V+   +P L E
Sbjct  229  MPELAESLETKEEEETCSSRNQTISHIGLPLPWGPEFEKSAEVKQEETCVE---FPDLTE  285

Query  377  EPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIP  204
            EPKGD  K+LVC + +R PDGRR QR FL+++PIQLLWSFC S +  ++ K F+L QAIP
Sbjct  286  EPKGDCDKSLVCSLCVRFPDGRRKQRKFLKTEPIQLLWSFCHSQIVGSEKKAFKLVQAIP  345

Query  203  GATSSLDFESNLTFEESGLANSMISVTWD*SKMITVCFSSM*NARIFIFVSAASCH----  36
            GA+ +L++ ++ TF++SGLANSMISVTWD   ++ +  +   N   ++F S  S H    
Sbjct  346  GASKTLEYGASATFDQSGLANSMISVTWD-YNVLLIQATLFDNDGYYLFSSRLSNHQHDK  404

Query  35   ---IMCIIQIV  12
               +  ++QIV
Sbjct  405  LILVHSLLQIV  415



>ref|XP_009139538.1| PREDICTED: UBX domain-containing protein 2 [Brassica rapa]
Length=427

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/209 (41%), Positives = 126/209 (60%), Gaps = 14/209 (7%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPR--------ESPQAP  555
            ++DPI GQ MRSW G ++    +EDL+ +MD  P  +++ S +  R        ES Q  
Sbjct  222  LIDPITGQNMRSWSGAIEAHGFVEDLMKYMDDGPHQYMASSTRNKRMKTDKISSESSQTG  281

Query  554  -PlhkddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPE  378
             P   +  + ++EE   +      G     +    E  +S  + +E   V+   +P L E
Sbjct  282  MPELAESLETKEEEETCSSRNQTIGHIGLPLSWGPEFEKSAEVKQEEICVE---FPDLTE  338

Query  377  EPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIP  204
            EPKGD  K+LVC + +R PDGRR QR FL+++PIQLLWSFC S +  ++ K F+L QAIP
Sbjct  339  EPKGDCDKSLVCSLCVRFPDGRRKQRKFLKTEPIQLLWSFCHSQIVGSEKKAFKLVQAIP  398

Query  203  GATSSLDFESNLTFEESGLANSMISVTWD  117
            GA+ +L++ ++ TF++SGLANSMISVTW+
Sbjct  399  GASKTLEYGASATFDQSGLANSMISVTWE  427



>ref|XP_010436606.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=358

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 124/200 (62%), Gaps = 8/200 (4%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQAPPlhkdda  534
            V+DPI GQKM  W G+++ ++L E+L+ F D  P +++ SL   R  E+ +        +
Sbjct  161  VIDPITGQKMGMWSGVIEYDSLYEELMKFTDAGPHEYIASLIRDRRTETTET----CLSS  216

Query  533  keedeellqalaASMEGMKDTNVDALKESSESD-VLGKETNVVKKPVYPPLPEEPKGDKN  357
                E    +     +G +DT   +   +  +D  L +E +      +P L EE KGD +
Sbjct  217  NIAYEIPAPSWGEEFDGKEDTWSSSNNNNQVADPSLEQEESDEACLEFPVLTEELKGDCD  276

Query  356  --LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  183
              ++C + IR PDGRR  R FL+S+PIQLLWSFC SH++E++ K F+L QAIPGA+ +LD
Sbjct  277  PSVLCSLCIRFPDGRRKPRKFLKSEPIQLLWSFCYSHMDESEKKAFKLVQAIPGASKTLD  336

Query  182  FESNLTFEESGLANSMISVT  123
            + +++TF++SGLANSMISVT
Sbjct  337  YGADITFDQSGLANSMISVT  356



>ref|XP_010490003.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=320

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 120/204 (59%), Gaps = 18/204 (9%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS--LSHKRPRESPQAPPlhkdd  537
            ++DPI GQKMR W GM++    LEDL+ + D  P +HV+   S+KR +           +
Sbjct  129  LIDPITGQKMRKWSGMIEAHGFLEDLMKYKDVGPHEHVASLTSNKRIK----------TE  178

Query  536  akeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVY--PPLPEEPKGD  363
                    +      M    D +      S   +   +ET +    V+  P L EEPKGD
Sbjct  179  KICFLSSQVDDDHQDMSTFWDNDRVVTPPSWGKEF--EETCLSSDDVFEFPVLTEEPKGD  236

Query  362  --KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSS  189
              ++L+C + IR PDGRR QR FL+S+P+QLLWSFC  ++E+++ + F+L QAIPGAT +
Sbjct  237  CDRSLLCSLCIRFPDGRRKQRKFLKSEPVQLLWSFCYFNMEDSEKRAFKLVQAIPGATKT  296

Query  188  LDFESNLTFEESGLANSMISVTWD  117
            LD+ +  TF++SG+ NS++SVTW+
Sbjct  297  LDYGAKATFDQSGIDNSIVSVTWE  320



>gb|KFK22408.1| hypothetical protein AALP_AAs65522U000100 [Arabis alpina]
Length=377

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 84/205 (41%), Positives = 124/205 (60%), Gaps = 7/205 (3%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS--LSHKRPR-ESPQAPPlhkd  540
            ++DP  GQKMR W GM+Q  + +EDL  +M+  P+ +++   S KR R E     P +K 
Sbjct  173  LIDPFTGQKMRMWSGMIQAHSFVEDLKKYMESGPNQYIASLTSKKRTRTEMVNCLPSNKR  232

Query  539  dakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPV-YPPLPEEPKGD  363
               E+               ++++ DAL    E +   ++T +      +  L EEPKGD
Sbjct  233  LKTEKTSCSPSNYTVQDMYTEESSEDALFVEEEEEEEEEDTCLSSDMFEFLVLTEEPKGD  292

Query  362  --KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGATS  192
              ++LVC + +R PDGRR  R FL+S+PIQLLWSFC +H+EE++  K F+L QAIPGA+ 
Sbjct  293  CDRSLVCSLCVRFPDGRRKPRKFLKSEPIQLLWSFCYAHMEESERNKAFKLVQAIPGASK  352

Query  191  SLDFESNLTFEESGLANSMISVTWD  117
            +L++ +N TFEESGL  +MISV W+
Sbjct  353  TLEYGTNATFEESGLDKAMISVIWE  377



>emb|CDY12747.1| BnaC04g28940D [Brassica napus]
Length=385

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/202 (39%), Positives = 121/202 (60%), Gaps = 13/202 (6%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQAPPlhkdda  534
            ++DPI G K+RSW G+++ ++ ++DL+ +    P +H+ SL  K P       P    + 
Sbjct  193  LIDPITGFKIRSWSGVIEAQSFIDDLMNYTKSGPHEHIASLRRKEP-----IKPDILCNE  247

Query  533  keedeellqalaASMEGMKDTN-VDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD--  363
              +    +   ++ +E    +N +D +   +      +ET       +P L E P+GD  
Sbjct  248  TNQTSHRIVTPSSGVETCSSSNHIDHVVAKTLPTHEEEETCFE----FPALTEVPRGDCD  303

Query  362  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  183
            ++LVC V +R PDG R QR FL+S+PIQLLWSFC S + E++ K F+L QAIPGA+ +LD
Sbjct  304  RSLVCSVCVRFPDGTRKQRRFLKSEPIQLLWSFCHSQIVESEKKAFKLVQAIPGASKTLD  363

Query  182  FESNLTFEESGLANSMISVTWD  117
            + +N TFE+SGLANSM+ V W+
Sbjct  364  YGANATFEQSGLANSMVLVAWE  385



>gb|EEE61882.1| hypothetical protein OsJ_16574 [Oryza sativa Japonica Group]
Length=421

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 123/184 (67%), Gaps = 12/184 (7%)
 Frame = -1

Query  641  EDLLPFMDGSPSDHVSLS-HKRPRESPQ--------APPlhkddakeedeellqalaASM  489
            +DL+P++D  P +H +    KRPR+  Q          P+     ++EDEEL +A+AAS+
Sbjct  241  KDLMPYLDKGPKEHHAAQPQKRPRKVDQETSIGKQGKTPVPVVATEDEDEELARAVAASL  300

Query  488  EGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLVCRVGIRLPDGRRLQ  309
            E  K +  D  +E  E +V   E ++  K  YPPLPEEPKG + L+CRV IRLPDGRR+Q
Sbjct  301  EESKGS--DTSEEKIEPEV-ENEPSLSAKLNYPPLPEEPKGSRELLCRVAIRLPDGRRIQ  357

Query  308  RNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLTFEESGLANSMIS  129
            RNFL +DPI+LLWSFC   +E+ D K F   Q IP A+++L++ES+ TF+E+GLANSMI+
Sbjct  358  RNFLHTDPIKLLWSFCYPQVEDGDKKAFHFVQPIPRASTNLEYESDKTFKEAGLANSMIN  417

Query  128  VTWD  117
            + WD
Sbjct  418  LLWD  421



>gb|AGH62811.1| UBX1 [Brassica napus]
Length=386

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/202 (39%), Positives = 121/202 (60%), Gaps = 13/202 (6%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQAPPlhkdda  534
            ++DPI G K+RSW G+++ ++ ++DL+ +    P +H+ SL  K P       P    + 
Sbjct  194  LIDPITGFKIRSWGGVIEAQSFIDDLMNYTKSGPHEHIASLRRKEP-----IKPDILCNE  248

Query  533  keedeellqalaASMEGMKDTN-VDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD--  363
              +    +   ++ +E    +N +D +   +      +ET       +P L E P+GD  
Sbjct  249  TNQTSHRIVTPSSGVETCSSSNHIDHVVAKTLPTHEEEETCFE----FPALTEVPRGDCD  304

Query  362  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  183
            ++LVC V +R PDG R QR FL+S+PIQLLWSFC S + E++ K F+L QAIPGA+ +LD
Sbjct  305  RSLVCSVCVRFPDGTRKQRRFLKSEPIQLLWSFCHSQIVESEKKAFKLVQAIPGASKTLD  364

Query  182  FESNLTFEESGLANSMISVTWD  117
            + +N TFE+SGLANSM+ V W+
Sbjct  365  YGANATFEQSGLANSMVLVAWE  386



>ref|XP_006446591.1| hypothetical protein CICLE_v10017670mg [Citrus clementina]
 gb|ESR59831.1| hypothetical protein CICLE_v10017670mg [Citrus clementina]
Length=369

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 110/198 (56%), Gaps = 49/198 (25%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddak  531
            V+DPI G+KMR W GMV P +LLEDLL FM+  P D +  + K   + P  PP+H+    
Sbjct  217  VIDPITGEKMRKWCGMVDPVSLLEDLLSFMESGPRDQLERATKT--QLPPYPPVHE----  270

Query  530  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP-KGDKNL  354
                                                     + P YP +PEEP +  +NL
Sbjct  271  -----------------------------------------QMPAYPAVPEEPLQVARNL  289

Query  353  VCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRLTQAIPGATSSLDFE  177
            VCR+GIRLPDGR ++RNFL +DP+QLLWSFC S LEE +  + FRLT+  PGA   LD+ 
Sbjct  290  VCRIGIRLPDGRMIRRNFLLTDPVQLLWSFCFSQLEEANQTRQFRLTRPDPGAPKPLDYN  349

Query  176  SNLTFEESGLANSMISVT  123
            S +TF+ES L NS+I VT
Sbjct  350  SKMTFQESELNNSVILVT  367



>ref|XP_009139540.1| PREDICTED: UBX domain-containing protein 7-like [Brassica rapa]
Length=412

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 121/212 (57%), Gaps = 22/212 (10%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQAPPlhkdda  534
            V+DP+ GQKM  W G+V  ++ +EDL  F++  P +HV SL   R  E+ +       + 
Sbjct  209  VIDPVTGQKMGMWSGVVDAQSFVEDLSRFLEAGPHEHVASLIRDRYPETEEDQTCSASNN  268

Query  533  keedeellqalaASME-----------GMKDTNVDALKESSESDVLGKETNVVKKPVYPP  387
             ++            E           G +  NV     SS +D       +V+   +P 
Sbjct  269  NDQVPVPSWGEEFEKEDDWSSSKGPSWGEEFENVVETCSSSNND-----DGIVE---FPD  320

Query  386  LPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQ  213
            L EEPKGD  K+LVC + +R PDGRR QR FL+++PIQLLWSFC S + +++ K F+L Q
Sbjct  321  LTEEPKGDCDKSLVCSLCVRFPDGRRKQRKFLKTEPIQLLWSFCYSQMVDSEKKTFKLVQ  380

Query  212  AIPGATSSLDFESNLTFEESGLANSMISVTWD  117
            AIPGA+ +LD+    TFEESGLANSMISV ++
Sbjct  381  AIPGASKTLDYGLYATFEESGLANSMISVLYN  412



>ref|XP_006414812.1| hypothetical protein EUTSA_v10027208mg, partial [Eutrema salsugineum]
 gb|ESQ56265.1| hypothetical protein EUTSA_v10027208mg, partial [Eutrema salsugineum]
Length=394

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 119/202 (59%), Gaps = 32/202 (16%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDH-VSL-SHKRPRESPQAPPlhkdd  537
            ++DPI GQKMRSW G+++ ++ LEDL+ +MD  P +H  SL S+KR +       +  + 
Sbjct  221  LIDPITGQKMRSWSGVIEAKSFLEDLVKYMDSGPHEHNASLTSNKRIK----TEKVCYES  276

Query  536  akeedeellqalaASMEGMKDTNVD-ALKESSESDV-LGKETNVVKKPVYPPLPEEPKGD  363
             +    + +     +       N+D  L ES E D  LG          +P L EEPK  
Sbjct  277  DQTSTCQDMSTFWDNFFEESSNNIDHILFESVEDDTFLG----------FPVLTEEPK--  324

Query  362  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  183
                        DGRR QRNFL+++P+QLLWSFC S + E++ K F+L QAIPGA+ +LD
Sbjct  325  ------------DGRRKQRNFLKTEPVQLLWSFCYSQMGESEKKAFKLVQAIPGASKTLD  372

Query  182  FESNLTFEESGLANSMISVTWD  117
            + +N TF++SGLANS+ISVTW+
Sbjct  373  YGANATFDQSGLANSLISVTWE  394



>ref|NP_176165.1| pseudo [Arabidopsis thaliana]
 gb|AAK62798.1|AC027036_19 hypothetical protein [Arabidopsis thaliana]
 gb|AEE33588.1| UBX domain-containing protein [Arabidopsis thaliana]
Length=307

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 117/188 (62%), Gaps = 9/188 (5%)
 Frame = -1

Query  674  WRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakeedeellqalaA  495
            +RG ++ +  L+DL  ++D SP +H++ + +  R   +A  +   D ++       ++  
Sbjct  127  FRGEIKAKGFLKDLKKYIDASPHEHIASTARNMR--VKAEKICHSDQQDMGNLSSDSVVV  184

Query  494  SMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD--KNLVCRVGIRLPDG  321
            S  G +  +V  L E  E   L  +        +P L +EPKGD  +++VC + +R P+G
Sbjct  185  SSCGREFDDVVTLSEDEEETCLSSDL-----FEFPVLTKEPKGDCDRSVVCSISVRFPNG  239

Query  320  RRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLTFEESGLAN  141
            RR QR FL+S+P+QLLWSFC SH++E+D K F+L QAIPGA+ +LD+ +  +F++ G+AN
Sbjct  240  RRKQRKFLKSEPVQLLWSFCYSHMDESDNKAFKLVQAIPGASKTLDYGAEASFDQYGIAN  299

Query  140  SMISVTWD  117
            S+ISVTW+
Sbjct  300  SIISVTWE  307



>ref|XP_002886675.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62934.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=305

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 115/188 (61%), Gaps = 9/188 (5%)
 Frame = -1

Query  674  WRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddakeedeellqalaA  495
            + G ++ ++ LEDL  ++D +P ++ + S  R          H D            +++
Sbjct  125  FSGEIKAQSFLEDLKKYIDATPHEYFA-SMARNMRVKTKKICHLDRDMVNSPSDRVVVSS  183

Query  494  SMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD--KNLVCRVGIRLPDG  321
            S +  +D  +  L E  E   L   +N+ K   +P L EEPKGD  +++VC + ++ P+G
Sbjct  184  SGQEFEDV-IMTLSEHEEETCLS--SNMFK---FPVLTEEPKGDCDRSVVCSISVQFPNG  237

Query  320  RRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLTFEESGLAN  141
            RR QR FL+S+PIQLLWSFC SH+EE++ K F+L QAIPGA+ +L + +  TF++SG+AN
Sbjct  238  RRKQRKFLKSEPIQLLWSFCYSHMEESEKKAFKLVQAIPGASKTLHYGAKATFDQSGIAN  297

Query  140  SMISVTWD  117
            S+ISVTW+
Sbjct  298  SIISVTWE  305



>emb|CDY01206.1| BnaA04g06130D [Brassica napus]
Length=412

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 118/211 (56%), Gaps = 20/211 (9%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddak  531
            V+DP+ GQKM  W G+V  ++ +EDL  F++  P +HV+ S  R R            + 
Sbjct  209  VIDPVTGQKMGMWSGVVDAQSFVEDLSRFLEAGPHEHVA-SLIRDRYPETEDDQTCSASN  267

Query  530  eedeellqalaASMEGMKDTNVDALKESSESDVLGKE-TNVVKKPV----------YPPL  384
              D+  + +     E   D +      SS+    G+E  NVV+              P L
Sbjct  268  NNDQVPVPSWGEEFEKEDDWS------SSKGPSWGEEFENVVETCSSSNNDDGIFELPDL  321

Query  383  PEEPK--GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQA  210
             EEP    DK+LVC + +R PDGRR QR FL+++ IQLLWSFC S + +++ K F+L QA
Sbjct  322  TEEPTVDCDKSLVCSLCVRFPDGRRKQRKFLKTEHIQLLWSFCHSQMVDSEKKTFKLVQA  381

Query  209  IPGATSSLDFESNLTFEESGLANSMISVTWD  117
            IPGA+ +LD+    TFEESGLANSMISV ++
Sbjct  382  IPGASKTLDYGLYATFEESGLANSMISVLYN  412



>ref|XP_002883438.1| hypothetical protein ARALYDRAFT_898874 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59697.1| hypothetical protein ARALYDRAFT_898874 [Arabidopsis lyrata subsp. 
lyrata]
Length=139

 Score =   125 bits (314),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 82/115 (71%), Gaps = 5/115 (4%)
 Frame = -1

Query  458  LKESSESDVLGKETNVVKKPVYPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDP  285
              E SE++ +     V     +P LPEEP  D  ++++CR+ +RLPDGRR+QR+FL+S+ 
Sbjct  27   FSEESETETMTSSNAVFG---FPHLPEEPNRDLDQSVLCRIRVRLPDGRRIQRSFLKSES  83

Query  284  IQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
            +QLLWSFC S ++E++ K F+L QA PG   +L F SN TFEESGLANS++SVTW
Sbjct  84   VQLLWSFCYSQIDESERKRFKLIQAFPGEYKNLYFGSNTTFEESGLANSLVSVTW  138



>gb|KFK22146.1| hypothetical protein AALP_AAs62910U000300 [Arabis alpina]
Length=408

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 77/95 (81%), Gaps = 2/95 (2%)
 Frame = -1

Query  395  YPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFR  222
            +P L EEPK D  ++ +C + +R PDGRR QR FL+S+PIQLLWSFC SH+E ++ K F+
Sbjct  314  FPDLTEEPKSDCDRSELCNICVRFPDGRRKQRKFLKSEPIQLLWSFCYSHMEGSERKVFK  373

Query  221  LTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  117
            L QAIPGA+ +LD+E+N TF++SGLANSMISVTW+
Sbjct  374  LVQAIPGASKTLDYEANETFDQSGLANSMISVTWE  408



>ref|XP_006414811.1| hypothetical protein EUTSA_v10027532mg [Eutrema salsugineum]
 gb|ESQ56264.1| hypothetical protein EUTSA_v10027532mg [Eutrema salsugineum]
Length=448

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 78/95 (82%), Gaps = 2/95 (2%)
 Frame = -1

Query  395  YPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFR  222
            +P L EEPKGD  +++VC + +R PDGRR QR FL+S+P+QLLWSFC S +E ++ K F+
Sbjct  354  FPDLTEEPKGDCDRSIVCSLCVRFPDGRRKQRRFLKSEPVQLLWSFCYSLMETSEKKVFK  413

Query  221  LTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  117
            L QAIPGA+ +LD+ +N+TF++SGLANSMISVTW+
Sbjct  414  LVQAIPGASKTLDYGANMTFDQSGLANSMISVTWE  448



>ref|XP_010436605.1| PREDICTED: uncharacterized protein LOC104720396 [Camelina sativa]
Length=327

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 114/206 (55%), Gaps = 49/206 (24%)
 Frame = -1

Query  668  GMVQPETLLEDLLPFMDGSPSDHVS--LSHKRPR------ESPQAPPlhkddakeedeel  513
            GM++    LEDL+ + D  P +HV+   S+KR +      ES QA               
Sbjct  149  GMIEAHGFLEDLMKYRDVGPHEHVASLTSNKRIKTEKICFESSQA---------------  193

Query  512  lqalaASMEGMKDTNVDALKESSESD----------VLGKETNVVKKPVY--PPLPEEPK  369
                        D +   +    E D          +  +ET +    ++  P L EEPK
Sbjct  194  ------------DDDHHGMSTFWEDDRFVTPPPSWGIEFEETCLSSDDMFEFPVLTEEPK  241

Query  368  GD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGAT  195
            GD  ++L+C + IR PDGRR+QR FL+S+PIQLLWSFC S++EE++ + F+L QAIPGAT
Sbjct  242  GDCDRSLLCSLCIRFPDGRRMQRKFLKSEPIQLLWSFCYSNMEESEKRAFKLVQAIPGAT  301

Query  194  SSLDFESNLTFEESGLANSMISVTWD  117
             +LD+ +  TF++SG+ NS++SVTW+
Sbjct  302  KTLDYGAKATFDQSGIDNSIVSVTWE  327



>gb|AAF79774.1|AC009317_33 T30E16.10 [Arabidopsis thaliana]
Length=268

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 77/95 (81%), Gaps = 2/95 (2%)
 Frame = -1

Query  395  YPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFR  222
            +P L +EPKGD  +++VC + +R P+GRR QR FL+S+P+QLLWSFC SH++E+D K F+
Sbjct  174  FPVLTKEPKGDCDRSVVCSISVRFPNGRRKQRKFLKSEPVQLLWSFCYSHMDESDNKAFK  233

Query  221  LTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  117
            L QAIPGA+ +LD+ +  +F++ G+ANS+ISVTW+
Sbjct  234  LVQAIPGASKTLDYGAEASFDQYGIANSIISVTWE  268



>ref|XP_010445452.1| PREDICTED: UBX domain-containing protein 7 [Camelina sativa]
Length=430

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 87/114 (76%), Gaps = 5/114 (4%)
 Frame = -1

Query  455  KESSESDVLGKETNVVKKPVYPPLPEEPKGDKN--LVCRVGIRLPDGRRLQRNFLRSDPI  282
            +E +ESD + ++   ++ PV   L EEPKGD +  +VC + +R PDGRR  R FL+S+PI
Sbjct  319  EEYAESDEVKEDEACLEFPV---LTEEPKGDCDPIVVCSLCLRFPDGRRKPRKFLKSEPI  375

Query  281  QLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
            QLLWSFC SH++E++ K F+L Q IPGA+ +LD+ +++TF++SGLANSMISVTW
Sbjct  376  QLLWSFCYSHMDESEKKAFKLVQTIPGASKTLDYGADITFDQSGLANSMISVTW  429



>emb|CDY12746.1| BnaC04g28950D [Brassica napus]
Length=421

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 84/216 (39%), Positives = 119/216 (55%), Gaps = 21/216 (10%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRPRESPQ---------  561
            V+DP+ GQKM  W G++  ++ +EDL  F++  P +H+ SL   R  E+ +         
Sbjct  203  VIDPVTGQKMGMWSGVIDAQSFVEDLSWFLEAGPHEHIASLIRNRYPEAEEDQTCSTSNN  262

Query  560  -----APPlhkddakeedeellqalaASMEGMKDTNVDALKESS---ESDVLGKETNVVK  405
                  P   ++  K+ED      +     G +  NV+    SS   + D++   +   +
Sbjct  263  NDQVPVPSWGEEFEKKEDWSSSNNVEGPSWGEEFENVEETCSSSNNDDDDIVDPSSGPGE  322

Query  404  KPV-YPPLPEEPK--GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDA  234
              V  P L EEPK   DK+LVC + +R PDG R QR FL+S+P  LLWSFC S LEE++ 
Sbjct  323  HWVELPDLTEEPKVDCDKSLVCSLSVRFPDGTRKQRRFLKSEPYLLLWSFCDSLLEESEI  382

Query  233  KPFRLTQAIPGATSSLDFESNLTFEESGLANSMISV  126
              F+L  AIPG + +LD+    TFEESGLANSMISV
Sbjct  383  NAFKLVHAIPGDSKTLDYRLYATFEESGLANSMISV  418



>gb|KFK39659.1| hypothetical protein AALP_AA3G272700 [Arabis alpina]
Length=144

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 75/94 (80%), Gaps = 4/94 (4%)
 Frame = -1

Query  395  YPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFR  222
            +P LPEEP  D  K+++CR+ +RLPDGRR++RNFL+++ +QLLWSFC S +++   KPF+
Sbjct  50   FPQLPEEPNRDLDKSVLCRICVRLPDGRRVERNFLKTESVQLLWSFCYSQIDQ--KKPFK  107

Query  221  LTQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
            L QA PG+  +L + SN TFE+SGLANS++SVTW
Sbjct  108  LIQAFPGSYKTLHYGSNTTFEQSGLANSVVSVTW  141



>ref|XP_010450078.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=432

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 77/95 (81%), Gaps = 2/95 (2%)
 Frame = -1

Query  395  YPPLPEEPKGDKN--LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFR  222
            +P L EEPKGD +  ++C + IR PDGRR  R FL+S+PIQLLWSFC S+++E++ K F+
Sbjct  338  FPVLTEEPKGDCDPSVLCSLCIRFPDGRRKPRKFLKSEPIQLLWSFCYSNMDESEKKAFK  397

Query  221  LTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  117
            L QAIPGA+ +LD+ ++ TF++SGLANSMISVTW+
Sbjct  398  LVQAIPGASKTLDYGADTTFDQSGLANSMISVTWE  432



>ref|XP_006406007.1| hypothetical protein EUTSA_v10021701mg [Eutrema salsugineum]
 gb|ESQ47460.1| hypothetical protein EUTSA_v10021701mg [Eutrema salsugineum]
Length=150

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 76/96 (79%), Gaps = 4/96 (4%)
 Frame = -1

Query  395  YPPLPEEPKG---DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKP  228
            +P LPEEP     D++++CR+ +RLPDGRR+QR+FL+S+ +QLLWSFC S +++++  KP
Sbjct  54   FPELPEEPNNSDSDRSVLCRLCVRLPDGRRVQRSFLKSESVQLLWSFCYSQIDQSERIKP  113

Query  227  FRLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
            F+L QA PG   +L + SN TFE+SGLANS+ISVTW
Sbjct  114  FKLIQAFPGEYKTLCYGSNTTFEQSGLANSLISVTW  149



>ref|XP_006285935.1| hypothetical protein CARUB_v10007447mg, partial [Capsella rubella]
 gb|EOA18833.1| hypothetical protein CARUB_v10007447mg, partial [Capsella rubella]
Length=436

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 72/94 (77%), Gaps = 2/94 (2%)
 Frame = -1

Query  395  YPPLPEEPKGDKN--LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFR  222
            +P L EEPKGD +  LVC + +R PDGRR QR FL S+P+QLLWSFC S ++E++ K F 
Sbjct  342  FPVLTEEPKGDIDPSLVCNLCVRFPDGRRKQRKFLESEPVQLLWSFCYSQMDESEKKAFS  401

Query  221  LTQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
            L QAIPGA+ +LD+  + TFE+S LANSMISVTW
Sbjct  402  LVQAIPGASKTLDYGDDATFEQSRLANSMISVTW  435



>ref|XP_006296631.1| hypothetical protein CARUB_v10014834mg [Capsella rubella]
 gb|EOA29529.1| hypothetical protein CARUB_v10014834mg [Capsella rubella]
Length=152

 Score =   117 bits (294),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 73/95 (77%), Gaps = 3/95 (3%)
 Frame = -1

Query  395  YPPLPEEPKG---DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPF  225
            +P LPEEP     D++++CR+ +RLPDGR +QR+FL+S+ +QLLWSFC S ++E++ K F
Sbjct  57   FPNLPEEPSNRDCDRSVLCRIRVRLPDGRIIQRSFLKSESVQLLWSFCYSQIDESERKLF  116

Query  224  RLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
            +L  A PG   +L + SN TFE+SGLANS++SVTW
Sbjct  117  KLIHAFPGECKTLHYGSNTTFEQSGLANSVVSVTW  151



>ref|XP_010514980.1| PREDICTED: uncharacterized protein LOC104790878 [Camelina sativa]
Length=155

 Score =   117 bits (292),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 74/95 (78%), Gaps = 3/95 (3%)
 Frame = -1

Query  395  YPPLPEEPKG---DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPF  225
            +P LPEEP     D++++CR+ +RLPDGR  QR+FL+S+ +QLLWS+C+S ++E++ K F
Sbjct  60   FPHLPEEPTNHDFDQSVLCRIRVRLPDGRITQRSFLKSESVQLLWSYCNSQIDESERKLF  119

Query  224  RLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
            +L QA PG   +L + SN TFE+SGLANS++SVTW
Sbjct  120  KLIQAFPGDYKTLHYGSNTTFEQSGLANSVVSVTW  154



>ref|XP_010488437.1| PREDICTED: uncharacterized protein LOC104766276 isoform X3 [Camelina 
sativa]
Length=155

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 74/95 (78%), Gaps = 3/95 (3%)
 Frame = -1

Query  395  YPPLPEEPKG---DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPF  225
            +P LPEEP     D++++CR+ +RLPDGR  QR+FL+S+ +QLLWS+C+S ++E++ K F
Sbjct  60   FPHLPEEPTNRDFDQSVLCRIRVRLPDGRITQRSFLKSESVQLLWSYCNSQIDESERKLF  119

Query  224  RLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
            +L QA PG   +L + SN TFE+SGLANS++SVTW
Sbjct  120  KLIQAFPGDYKTLHYGSNTTFEQSGLANSVVSVTW  154



>ref|XP_010466708.1| PREDICTED: uncharacterized protein LOC104746864 [Camelina sativa]
Length=156

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 74/95 (78%), Gaps = 3/95 (3%)
 Frame = -1

Query  395  YPPLPEEPKG---DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPF  225
            +P LPEEP     D++++CR+ +RLPDGR  QR+FL+S+ +QLLWS+C+S ++E++ K F
Sbjct  61   FPNLPEEPTNRDFDQSVLCRIRVRLPDGRITQRSFLKSESVQLLWSYCNSQIDESERKLF  120

Query  224  RLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
            +L QA PG   +L + SN TFE+SGLANS++SVTW
Sbjct  121  KLIQAFPGDYKTLHYGSNTTFEQSGLANSVVSVTW  155



>ref|XP_010488435.1| PREDICTED: uncharacterized protein LOC104766276 isoform X1 [Camelina 
sativa]
Length=157

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 74/95 (78%), Gaps = 3/95 (3%)
 Frame = -1

Query  395  YPPLPEEPKG---DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPF  225
            +P LPEEP     D++++CR+ +RLPDGR  QR+FL+S+ +QLLWS+C+S ++E++ K F
Sbjct  62   FPHLPEEPTNRDFDQSVLCRIRVRLPDGRITQRSFLKSESVQLLWSYCNSQIDESERKLF  121

Query  224  RLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
            +L QA PG   +L + SN TFE+SGLANS++SVTW
Sbjct  122  KLIQAFPGDYKTLHYGSNTTFEQSGLANSVVSVTW  156



>ref|XP_010488436.1| PREDICTED: uncharacterized protein LOC104766276 isoform X2 [Camelina 
sativa]
Length=157

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 74/95 (78%), Gaps = 3/95 (3%)
 Frame = -1

Query  395  YPPLPEEPKG---DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPF  225
            +P LPEEP     D++++CR+ +RLPDGR  QR+FL+S+ +QLLWS+C+S ++E++ K F
Sbjct  62   FPHLPEEPTNRDFDQSVLCRIRVRLPDGRITQRSFLKSESVQLLWSYCNSQIDESERKLF  121

Query  224  RLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
            +L QA PG   +L + SN TFE+SGLANS++SV+W
Sbjct  122  KLIQAFPGDYKTLHYGSNTTFEQSGLANSVVSVSW  156



>ref|XP_009136068.1| PREDICTED: uncharacterized protein LOC103860231 [Brassica rapa]
Length=148

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 74/95 (78%), Gaps = 3/95 (3%)
 Frame = -1

Query  395  YPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDA-KPF  225
            YP L EEP  D  ++++CR+ +RLPDGRR+QRNFL+S+ +QLLWSFC S +++++  KPF
Sbjct  53   YPELSEEPSSDWDRSVLCRICVRLPDGRRVQRNFLKSESVQLLWSFCYSQMDQSERNKPF  112

Query  224  RLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
            +L QAIPG   +L +    +FE+SGLANS+ISVTW
Sbjct  113  KLFQAIPGYYKNLYYGYYTSFEQSGLANSLISVTW  147



>ref|XP_006414759.1| hypothetical protein EUTSA_v10027233mg [Eutrema salsugineum]
 gb|ESQ56212.1| hypothetical protein EUTSA_v10027233mg [Eutrema salsugineum]
Length=418

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 112/221 (51%), Gaps = 45/221 (20%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddak  531
            V+DPI GQKMR W G ++ ++ +EDL  FM+     ++  S  +  ++P   P   ++ +
Sbjct  211  VIDPITGQKMRMWSGEIEAQSFVEDLSRFMEA----NIGFSSNKNDQAP--APSWVEEFE  264

Query  530  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEE-----PKG  366
            +ED          + G       +  E  + D     +N++++ V     EE     P  
Sbjct  265  KEDTCSSSNHINQVAG-------SSGEDFQKDNTWSSSNIIQQTVASSCVEEFENMEPWS  317

Query  365  DKN---------------------------LVCRVGIRLPDGRRLQRNFLRSDPIQLLWS  267
              N                           L+C + +R PDGRR QR FL+S+P+QLLWS
Sbjct  318  SNNNYDHIVTPSWEPEFEDSSEVEEEESRILLCSLCVRFPDGRRKQRRFLKSEPVQLLWS  377

Query  266  FCSSHLEETDAKPFRLTQAIPGATSSLDFESNLTFEESGLA  144
            FC S +EE++ K F+L QAIPGA+ +LD+ +N TF++SGL+
Sbjct  378  FCYSQMEESEKKAFKLVQAIPGASKTLDYGANTTFDQSGLS  418



>ref|XP_009106587.1| PREDICTED: uncharacterized protein LOC103832346 [Brassica rapa]
Length=143

 Score =   112 bits (279),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 74/96 (77%), Gaps = 4/96 (4%)
 Frame = -1

Query  395  YPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD--AKP  228
            +P L EEPK D  ++++CR+ +RLPDGR++QRNFLRS+ +QLLWSFC S ++E++   + 
Sbjct  47   FPELTEEPKSDSDRSVLCRLCVRLPDGRKVQRNFLRSESVQLLWSFCYSLMDESERRERS  106

Query  227  FRLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
            F+L QA+PG   SL + S  +FE+SGLANS+ISV W
Sbjct  107  FKLIQAVPGEYRSLYYGSETSFEDSGLANSLISVIW  142



>emb|CDY50464.1| BnaCnng19430D [Brassica napus]
Length=143

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 74/96 (77%), Gaps = 4/96 (4%)
 Frame = -1

Query  395  YPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD--AKP  228
            +P L EEPK D  ++++CR+ +RLPDGR++QRNFLRS+ +QLLWSFC S ++E++   + 
Sbjct  47   FPELTEEPKSDSDRSVLCRLCVRLPDGRKVQRNFLRSESVQLLWSFCYSLMDESERRERS  106

Query  227  FRLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
            F+L QA+PG   SL + S  +FE+SGLANS+ISV W
Sbjct  107  FKLIQAVPGEYKSLYYGSETSFEDSGLANSLISVIW  142



>ref|XP_010512639.1| PREDICTED: UBX domain-containing protein 1-like [Camelina sativa]
Length=159

 Score =   112 bits (280),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 73/95 (77%), Gaps = 3/95 (3%)
 Frame = -1

Query  395  YPPLPEEPKG---DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPF  225
            +P LP+EP     D++++CR+ +RLPDGR  QR+FL+S+ +QLLWS+C+S ++E++   F
Sbjct  64   FPNLPKEPTNRDFDQSVLCRIRVRLPDGRITQRSFLKSESVQLLWSYCNSQIDESERNLF  123

Query  224  RLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
            +L QA PG   +L + SN TFE+SGLANS++SV+W
Sbjct  124  KLIQAFPGDYKTLHYGSNTTFEQSGLANSVVSVSW  158



>emb|CDY18108.1| BnaA01g23690D [Brassica napus]
Length=143

 Score =   111 bits (278),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 74/96 (77%), Gaps = 4/96 (4%)
 Frame = -1

Query  395  YPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD--AKP  228
            +P L EEPK D  ++++CR+ +RLPDGR++QRNFLRS+ +QLLWSFC S ++E++   + 
Sbjct  47   FPELTEEPKSDSDRSVLCRLCVRLPDGRKVQRNFLRSESVQLLWSFCYSLMDESERRERS  106

Query  227  FRLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
            F+L QA+PG   SL + S  +FE+SGLANS+ISV W
Sbjct  107  FKLIQAVPGDYRSLYYGSETSFEDSGLANSLISVIW  142



>ref|NP_566733.1| UBX domain-containing protein [Arabidopsis thaliana]
 dbj|BAB02779.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD95135.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABF59029.1| At3g23605 [Arabidopsis thaliana]
 gb|AEE76783.1| UBX domain-containing protein [Arabidopsis thaliana]
Length=152

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 72/97 (74%), Gaps = 5/97 (5%)
 Frame = -1

Query  395  YPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDA---K  231
            +P LPEEP  D  ++++CR+ +RLPDGRR+QR+FL+S+ +QLLWSFC S + +  +   +
Sbjct  55   FPNLPEEPNRDMDQSVLCRICVRLPDGRRIQRSFLKSESVQLLWSFCYSQIGDESSERKR  114

Query  230  PFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
             F+L Q  PG   +L F SN TFE+SGLANS++SVTW
Sbjct  115  RFKLIQGFPGDYKNLYFGSNTTFEQSGLANSLVSVTW  151



>gb|AAM66019.1| unknown [Arabidopsis thaliana]
Length=145

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 72/97 (74%), Gaps = 5/97 (5%)
 Frame = -1

Query  395  YPPLPEEPKGD--KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDA---K  231
            +P LPEEP  D  ++++CR+ +RLPDGRR+QR+FL+S+ +QLLWSFC S + +  +   +
Sbjct  48   FPNLPEEPNRDMDQSVLCRICVRLPDGRRIQRSFLKSESVQLLWSFCYSQIGDESSERKR  107

Query  230  PFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
             F+L Q  PG   +L F SN TFE+SGLANS++SVTW
Sbjct  108  RFKLIQGFPGDYKNLYFGSNTTFEQSGLANSLVSVTW  144



>gb|KDO55137.1| hypothetical protein CISIN_1g036413mg [Citrus sinensis]
Length=346

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 90/197 (46%), Gaps = 71/197 (36%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddak  531
            V+DPI G+KMR W GMV P +LLEDLL FM+  P D +  + K   + P  PP+H+    
Sbjct  218  VIDPITGEKMRKWCGMVDPVSLLEDLLSFMESGPRDQLERATKT--QLPPYPPVHE----  271

Query  530  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEP-KGDKNL  354
                                                     + P YP +PEEP +  +NL
Sbjct  272  -----------------------------------------QMPAYPAVPEEPLQVARNL  290

Query  353  VCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFES  174
            VCR+G+RLPDG+                       E    + FRLT+  PGA   LD+ S
Sbjct  291  VCRIGVRLPDGQ-----------------------EANQTRQFRLTRPDPGAPKPLDYNS  327

Query  173  NLTFEESGLANSMISVT  123
             +TF+ESGL NS+I VT
Sbjct  328  KMTFQESGLNNSVILVT  344



>emb|CDX92988.1| BnaA03g37100D [Brassica napus]
Length=137

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 61/93 (66%), Gaps = 11/93 (12%)
 Frame = -1

Query  395  YPPLPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRL  219
            YP L EEP  D +              LQRNFL+S+ +QLLWSFC S +++++  KPF+L
Sbjct  54   YPELSEEPNSDWD----------RSVLLQRNFLKSESVQLLWSFCYSQMDQSERNKPFKL  103

Query  218  TQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
             QAIPG   +L + S  +FE+SGLANS+ISVTW
Sbjct  104  FQAIPGYYKNLYYGSYTSFEQSGLANSLISVTW  136



>emb|CDX94853.1| BnaC03g43350D [Brassica napus]
Length=140

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 60/93 (65%), Gaps = 11/93 (12%)
 Frame = -1

Query  395  YPPLPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETD-AKPFRL  219
            YP L  EP  D +              LQRNFL+S+ +QLLWSFC S +++++  KPF+L
Sbjct  57   YPELSAEPNSDWD----------RSVLLQRNFLKSESVQLLWSFCYSQMDQSERNKPFKL  106

Query  218  TQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
             QAIPG   +L + S  +FE+SGLANS+ISVTW
Sbjct  107  FQAIPGYYKNLYYGSYTSFEQSGLANSLISVTW  139



>ref|XP_005643712.1| hypothetical protein COCSUDRAFT_59648 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19168.1| hypothetical protein COCSUDRAFT_59648 [Coccomyxa subellipsoidea 
C-169]
Length=440

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 103/219 (47%), Gaps = 24/219 (11%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSL---SHKRPRESPQAPPlhkd  540
            V+DP+ G   ++W G ++P+ L+E+L+PF+D    D  +L   SH + ++    PP    
Sbjct  222  VIDPVTGASPKAWTGAIEPQRLIEELVPFLDHDIHDPAALQLGSHLKRKKRSSPPPKGLT  281

Query  539  dakeedeellqalaAS-----MEGMKDTNVDA-------LKESSESDVL------GKETN  414
            + +E    L  +   +      E     + DA       + E ++ D+        K   
Sbjct  282  EDEELAMALAMSAEDAHGSGPAEDAPSYSADASLSKAEPVTEDADDDIPEEAPMPSKSAA  341

Query  413  VVKKPVYPPLPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDA  234
             V K     LP EP       C V +R PDG+R QR F RS  + ++ +FC  H EE  A
Sbjct  342  DVAKEAEEQLPPEPGAGDAAGCGVLVRFPDGQRRQRRFPRSASLDVVRAFCLVHSEEAAA  401

Query  233  -KPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
             +PF + +++PG+    D     T EE+ LA +M+ + W
Sbjct  402  GRPFAIVESMPGSNPLEDMTK--TIEEANLAGAMLVMRW  438



>ref|XP_010274053.1| PREDICTED: homeobox-leucine zipper protein HOX7-like [Nelumbo 
nucifera]
Length=264

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -1

Query  335  RLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLTFEE  156
            + PDGRR+QRNFL  DPIQL WSF  SHLEET A+ FRL QAIPG +  LD+ + LTF E
Sbjct  160  QFPDGRRIQRNFLCKDPIQL-WSFYYSHLEETGARQFRLVQAIPGDSKQLDYVTKLTFVE  218

Query  155  SG  150
             G
Sbjct  219  FG  220



>gb|KDO53547.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=320

 Score = 81.3 bits (199),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAP  555
            VVDPI GQKMRSW GMVQPE+LLEDL+PFMDG P + H  +SHKRPR S   P
Sbjct  245  VVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTP  297



>ref|XP_006420698.1| hypothetical protein CICLE_v10005240mg [Citrus clementina]
 gb|ESR33938.1| hypothetical protein CICLE_v10005240mg [Citrus clementina]
Length=361

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPRESPQAP  555
            VVDPI GQKMRSW GMVQPE+LLEDL+PFMDG P + H  +SHKRPR S   P
Sbjct  245  VVDPITGQKMRSWCGMVQPESLLEDLVPFMDGGPREQHAKVSHKRPRGSSTTP  297



>gb|KEH28763.1| structural constituent of ribosome protein [Medicago truncatula]
Length=321

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -1

Query  281  QLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTWD  117
            QLLWSF +  L+E + KPF+LT  I GA+ +LD+ SN TFEESGLA SMISVTWD
Sbjct  267  QLLWSFIAVQLKEDETKPFKLTHEIHGASKNLDYRSNATFEESGLAGSMISVTWD  321


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHV-SLSHKRP  576
            ++ PI GQ M SW G+VQP+TLLE LL F+D +P DH  +LSHK P
Sbjct  198  IIHPITGQNMHSWEGLVQPQTLLEGLLTFLDATPKDHHNTLSHKSP  243



>ref|XP_010270205.1| PREDICTED: uncharacterized protein LOC104606607 [Nelumbo nucifera]
Length=176

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -1

Query  335  RLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAI  207
            R PDGRR+QRNFL  DPIQLLWSFC S LEET A+ FRL Q+ 
Sbjct  94   RFPDGRRIQRNFLHKDPIQLLWSFCYSQLEETGARSFRLVQSY  136



>ref|XP_002874517.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50776.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=333

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 75/165 (45%), Gaps = 47/165 (28%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMV------------------QPETLLEDLLPFMDGSPSDH-VSLS  588
            V++P  GQ M+ W GMV                   PE LL    PFMD  P +H  SL+
Sbjct  193  VINPTTGQAMKKWFGMVPPEWFGMVPPEALLREALLPEALLVFFYPFMDSGPREHFTSLA  252

Query  587  HKRPRESPQAPPlhkddakeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVV  408
             K+PR S  A                           D N   ++E+S+   +     VV
Sbjct  253  KKQPRRSLAA------------------------SFDDYN---MEETSDDQSMISTEEVV  285

Query  407  KKPVYPPLPEEP-KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQL  276
              P +PPL EEP +G+ +  C VGI LP+G+R+ R FL++D IQ+
Sbjct  286  LLPKFPPLLEEPERGNFSSNCGVGIDLPNGQRIMRYFLKTDTIQV  330



>ref|XP_002891290.1| hypothetical protein ARALYDRAFT_891395 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67549.1| hypothetical protein ARALYDRAFT_891395 [Arabidopsis lyrata subsp. 
lyrata]
Length=134

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 50/80 (63%), Gaps = 14/80 (18%)
 Frame = -1

Query  350  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPG--ATSSLDFE  177
            C VGI LP+G R+ R FL++D IQ                P +LT+ IPG   T +L++E
Sbjct  67   CGVGIDLPNGERIMRYFLKTDTIQ------------RGRTPLKLTRVIPGQSKTITLEYE  114

Query  176  SNLTFEESGLANSMISVTWD  117
            SNLTFE+SG+ANS++  TW+
Sbjct  115  SNLTFEQSGVANSLVFATWE  134



>ref|XP_002900938.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY59328.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=455

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 55/197 (28%), Positives = 89/197 (45%), Gaps = 12/197 (6%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddak  531
            ++DP  G+  + W G  +P+ + E L  F      D  S   K+  E    P +      
Sbjct  270  IIDPRTGETRQRWTGFHEPQDMTEKLSDFCCMHTLDTPSTEQKKEAE----PSIMDASED  325

Query  530  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLV  351
            ++    + A   + EG    N D +++  E      +  VV+      L  EP      V
Sbjct  326  DQLAAAIAASLQNGEGETKRNEDDMEQEEEGQEEKTQEPVVE------LTPEPDASAPGV  379

Query  350  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESN  171
             RV IR+PDG RL R FL++DP+ ++W+F    + E  A+ F L  A P   S++ +   
Sbjct  380  TRVQIRVPDGSRLTRRFLKNDPLAMVWAFVKDQIPEARARAFELRTAFP--PSAVAYNDT  437

Query  170  LTFEESGLANSMISVTW  120
            ++ EE  L N+ + V W
Sbjct  438  ISIEEGKLENASLMVKW  454



>gb|ETI31731.1| hypothetical protein F443_21327 [Phytophthora parasitica P1569]
 gb|ETK72108.1| hypothetical protein L915_20730 [Phytophthora parasitica]
 gb|ETL25538.1| hypothetical protein L916_20613 [Phytophthora parasitica]
 gb|ETL78752.1| hypothetical protein L917_20475 [Phytophthora parasitica]
 gb|ETM32024.1| hypothetical protein L914_20483 [Phytophthora parasitica]
 gb|ETO60443.1| hypothetical protein F444_21350 [Phytophthora parasitica P1976]
 gb|ETP01531.1| hypothetical protein F441_21225 [Phytophthora parasitica CJ01A1]
 gb|ETP29704.1| hypothetical protein F442_21166 [Phytophthora parasitica P10297]
Length=455

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/197 (27%), Positives = 90/197 (46%), Gaps = 12/197 (6%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddak  531
            ++DP  G+  + W G  +P+ + E L  F      D  S   K+  E    P +      
Sbjct  270  IIDPRTGEIRQRWTGFYEPQDMTEKLSDFCCMHTFDTPSTEIKKEAE----PDIMDASED  325

Query  530  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLV  351
            ++    + A   +  G    + +A+++  ++D         ++PV    PE P      V
Sbjct  326  DQLAAAIAASMQNGGGETKQDGNAMEQEEKND-----EEKAQEPVVDLTPE-PDAGAPGV  379

Query  350  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESN  171
             RV IR+PDG RL R FL+SDP+ ++W+F    + E   + F L  + P   S++ +   
Sbjct  380  TRVQIRVPDGSRLTRRFLKSDPLAMVWTFVKDQVSEARTRAFELRTSFP--PSAVAYNDT  437

Query  170  LTFEESGLANSMISVTW  120
            L+ EE  L N+ + V W
Sbjct  438  LSIEEGKLENASLMVKW  454



>ref|XP_008915021.1| hypothetical protein PPTG_18885 [Phytophthora parasitica INRA-310]
 gb|ETM99642.1| hypothetical protein PPTG_18885 [Phytophthora parasitica INRA-310]
Length=441

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/197 (27%), Positives = 90/197 (46%), Gaps = 12/197 (6%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddak  531
            ++DP  G+  + W G  +P+ + E L  F      D  S   K+  E    P +      
Sbjct  256  IIDPRTGEIRQRWTGFYEPQDMTEKLSDFCCMHTFDTPSTEIKKEAE----PDIMDASED  311

Query  530  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLV  351
            ++    + A   +  G    + +A+++  ++D         ++PV    PE P      V
Sbjct  312  DQLAAAIAASMQNGGGETKQDGNAMEQEEKND-----EEKAQEPVVDLTPE-PDAGAPGV  365

Query  350  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESN  171
             RV IR+PDG RL R FL+SDP+ ++W+F    + E   + F L  + P   S++ +   
Sbjct  366  TRVQIRVPDGSRLTRRFLKSDPLAMVWTFVKDQVSEARTRAFELRTSFP--PSAVAYNDT  423

Query  170  LTFEESGLANSMISVTW  120
            L+ EE  L N+ + V W
Sbjct  424  LSIEEGKLENASLMVKW  440



>gb|ETI31732.1| hypothetical protein, variant 1 [Phytophthora parasitica P1569]
 gb|ETK72109.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETL25539.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETL78753.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETM32025.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETO60444.1| hypothetical protein, variant 1 [Phytophthora parasitica P1976]
 gb|ETP01532.1| hypothetical protein, variant 1 [Phytophthora parasitica CJ01A1]
 gb|ETP29705.1| hypothetical protein, variant 1 [Phytophthora parasitica P10297]
Length=454

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 89/197 (45%), Gaps = 13/197 (7%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddak  531
            ++DP  G+  + W G  +P+ + E L  F      D  S   K+       P +      
Sbjct  270  IIDPRTGEIRQRWTGFYEPQDMTEKLSDFCCMHTFDTPSTEIKKAE-----PDIMDASED  324

Query  530  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLV  351
            ++    + A   +  G    + +A+++  ++D         ++PV    PE P      V
Sbjct  325  DQLAAAIAASMQNGGGETKQDGNAMEQEEKND-----EEKAQEPVVDLTPE-PDAGAPGV  378

Query  350  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESN  171
             RV IR+PDG RL R FL+SDP+ ++W+F    + E   + F L  + P   S++ +   
Sbjct  379  TRVQIRVPDGSRLTRRFLKSDPLAMVWTFVKDQVSEARTRAFELRTSFP--PSAVAYNDT  436

Query  170  LTFEESGLANSMISVTW  120
            L+ EE  L N+ + V W
Sbjct  437  LSIEEGKLENASLMVKW  453



>ref|XP_008915022.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETM99643.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
Length=440

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 89/197 (45%), Gaps = 13/197 (7%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddak  531
            ++DP  G+  + W G  +P+ + E L  F      D  S   K+       P +      
Sbjct  256  IIDPRTGEIRQRWTGFYEPQDMTEKLSDFCCMHTFDTPSTEIKKAE-----PDIMDASED  310

Query  530  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLV  351
            ++    + A   +  G    + +A+++  ++D         ++PV    PE P      V
Sbjct  311  DQLAAAIAASMQNGGGETKQDGNAMEQEEKND-----EEKAQEPVVDLTPE-PDAGAPGV  364

Query  350  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESN  171
             RV IR+PDG RL R FL+SDP+ ++W+F    + E   + F L  + P   S++ +   
Sbjct  365  TRVQIRVPDGSRLTRRFLKSDPLAMVWTFVKDQVSEARTRAFELRTSFP--PSAVAYNDT  422

Query  170  LTFEESGLANSMISVTW  120
            L+ EE  L N+ + V W
Sbjct  423  LSIEEGKLENASLMVKW  439



>ref|XP_008383892.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103446532 
[Malus domestica]
Length=64

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 2/48 (4%)
 Frame = -1

Query  368  GDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPF  225
             D+NL+CRV IRL D RR+QRNFL +  +QLLWSFC S L+E  A+PF
Sbjct  10   NDRNLLCRVRIRLLDDRRVQRNFLXA--LQLLWSFCYSQLKEAKARPF  55



>ref|XP_010497037.1| PREDICTED: UBX domain-containing protein 7-like, partial [Camelina 
sativa]
Length=310

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 68/157 (43%), Gaps = 49/157 (31%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS--LSHKRPRESPQAPPlhkdd  537
            ++DPI GQKMR+W GM++    LEDL+ + D  P +HV+   S+KR +            
Sbjct  181  LIDPITGQKMRTWSGMIEAHDFLEDLMKYRDVGPHEHVASLTSNKRIK------------  228

Query  536  akeedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKP--------------  399
                            E +   +  A  +  +      +  VV  P              
Sbjct  229  ---------------TEKIWFVSSQAYDDHHDMSTFWDDDRVVTTPPSWGIEFEETCLSS  273

Query  398  ----VYPPLPEEPKG--DKNLVCRVGIRLPDGRRLQR  306
                 +P L EEPKG  D++L+C + IR PDGRR+QR
Sbjct  274  DDMFEFPVLTEEPKGDCDRSLLCSLCIRFPDGRRMQR  310



>ref|XP_002872422.1| hypothetical protein ARALYDRAFT_911175 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48681.1| hypothetical protein ARALYDRAFT_911175 [Arabidopsis lyrata subsp. 
lyrata]
Length=63

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 3/57 (5%)
 Frame = -1

Query  278  LLWSFCSSHLEETD-AKPFRLTQAIPG--ATSSLDFESNLTFEESGLANSMISVTWD  117
            +LWSFC S L +++  KP +LT+ IPG   T +L++ESNLTFE+SG+ANS++  TW+
Sbjct  7    ILWSFCYSRLTKSERKKPLKLTRLIPGQSKTITLEYESNLTFEQSGVANSLVFATWE  63



>gb|KDO48110.1| hypothetical protein CISIN_1g021440mg [Citrus sinensis]
Length=312

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 64/119 (54%), Gaps = 7/119 (6%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddak  531
            V+DPI GQK+ SW GM+ P+ L E LLPFMD SP    ++  +R R S   P       +
Sbjct  201  VIDPITGQKICSWCGMINPQPLGEMLLPFMDRSPRKCATIIIERQRASSTTP-------Q  253

Query  530  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNL  354
               ++   ALAASME +KDT   +  ++  +    + T+  +   YP LPEEP  D  L
Sbjct  254  RNIKDCCSALAASMETIKDTIGVSPSDADVTSADKEATSTTQGTAYPALPEEPNVDGKL  312



>ref|XP_009533837.1| hypothetical protein PHYSODRAFT_352438 [Phytophthora sojae]
 gb|EGZ11092.1| hypothetical protein PHYSODRAFT_352438 [Phytophthora sojae]
Length=459

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 52/97 (54%), Gaps = 3/97 (3%)
 Frame = -1

Query  410  VKKPVYPPLPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAK  231
             + PV    PE   G  + V RV IR+PDG RL R FL++DP+ ++W+F    + E   +
Sbjct  365  AQDPVVALTPEPDAGAPD-VTRVQIRVPDGTRLTRRFLKTDPLAMVWTFVKDQVPEARGR  423

Query  230  PFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
             F L  A P   S++ +   L+ EE  L N+ + V W
Sbjct  424  AFELRTAFP--PSAVAYNDTLSIEEGKLENASLMVKW  458



>gb|KDO48111.1| hypothetical protein CISIN_1g021440mg [Citrus sinensis]
Length=305

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 60/119 (50%), Gaps = 14/119 (12%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddak  531
            V+DPI GQK+ SW GM+ P+ L E LLPFMD SP    ++  +R R S   P        
Sbjct  201  VIDPITGQKICSWCGMINPQPLGEMLLPFMDRSPRKCATIIIERQRASSTTP--------  252

Query  530  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNL  354
                   + + ASME +KDT   +  ++  +    + T+  +   YP LPEEP  D  L
Sbjct  253  ------QRNIKASMETIKDTIGVSPSDADVTSADKEATSTTQGTAYPALPEEPNVDGKL  305



>emb|CCI43060.1| unnamed protein product [Albugo candida]
Length=410

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 91/208 (44%), Gaps = 39/208 (19%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFM------DGSPSDHVSLSHKRPRESPQAPPl  549
            ++ P  G+ +  W G V+P  L+E +  F       +    + ++L  +  RES      
Sbjct  230  IIHPRTGEILAQWNGFVEPTILVEKISDFCCQNILENTVEKETINLVEEESRES------  283

Query  548  hkddakeedeellqalaASMEGMKDTNVDA-----LKESSESDVLGKETNVVKKPVYPPL  384
                               ++  +D N+ A     L+E S+S +   +  +        L
Sbjct  284  -------------------LDENEDPNLAAAIAASLEEKSKS-MHDVDEEMKDDQSIDML  323

Query  383  PEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIP  204
            P EP      V R+ IR PDG R+ R F +SDPI +L +F   +++E  A+PF L +A P
Sbjct  324  PTEPSATDPNVTRIQIRCPDGTRMIRRFYKSDPISILRTFVKENVQEARARPFALRRAYP  383

Query  203  GATSSLDFESNLTFEESGLANSMISVTW  120
             A  ++D   +    +  L N+++ V W
Sbjct  384  PA--AIDCNGSEALSDRNLENAVLHVDW  409



>emb|CDY51383.1| BnaC02g46180D [Brassica napus]
Length=150

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 39/50 (78%), Gaps = 2/50 (4%)
 Frame = -1

Query  395  YPPLPEEPKG--DKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSH  252
            YP   +EP    DK+++CR+ +RLPDGRR+Q++FL+S+ +QLL SFC+S 
Sbjct  46   YPEFSDEPNSHLDKSVLCRICVRLPDGRRVQKSFLKSESVQLLLSFCNSQ  95



>ref|XP_003604169.1| UBX domain-containing protein [Medicago truncatula]
 gb|AES86366.1| UBX domain protein [Medicago truncatula]
Length=320

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 37/47 (79%), Gaps = 1/47 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPR  573
            V+DPI G+KM SW GMV+P++LLE LL F+D  P+D H +LSHK PR
Sbjct  196  VIDPITGKKMCSWDGMVEPQSLLEGLLTFLDAGPTDHHNTLSHKLPR  242



>gb|KEH28537.1| UBX domain protein [Medicago truncatula]
Length=259

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 37/47 (79%), Gaps = 1/47 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPR  573
            V+DPI G+KM SW GMV+P++LLE LL F+D  P+D H +LSHK PR
Sbjct  196  VIDPITGKKMCSWDGMVEPQSLLEGLLTFLDAGPTDHHNTLSHKLPR  242



>gb|KEH28538.1| UBX domain protein [Medicago truncatula]
Length=305

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 37/47 (79%), Gaps = 1/47 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSD-HVSLSHKRPR  573
            V+DPI G+KM SW GMV+P++LLE LL F+D  P+D H +LSHK PR
Sbjct  196  VIDPITGKKMCSWDGMVEPQSLLEGLLTFLDAGPTDHHNTLSHKLPR  242



>ref|XP_008864408.1| hypothetical protein H310_02617 [Aphanomyces invadans]
 gb|ETW06333.1| hypothetical protein H310_02617 [Aphanomyces invadans]
Length=435

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 88/198 (44%), Gaps = 22/198 (11%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSL-SHKRPRESPQAPPlhkdda  534
            ++DP+ GQK+  W   ++P+T+ E L        SD   L S   P   P  P   +   
Sbjct  255  ILDPVTGQKVVEWHDYIEPQTMAEKL--------SDFACLNSPGAPVARPAEPSPPRSRE  306

Query  533  keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNL  354
              ED+EL  A+AAS+E   D   D +K  +           V      PLP+EP  D   
Sbjct  307  WTEDDELAAAIAASLEQPSD---DGMKSEAAQAAPPPPPAFV------PLPDEPV-DGPT  356

Query  353  VCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFES  174
            V RV IR   G RL R F ++ P+  LW F    L E   + F L    P AT +    S
Sbjct  357  VTRVQIRTTAGSRLMRRFEKTAPVSDLWRFVQQELPEARTRRFELRTTYPPATLT---SS  413

Query  173  NLTFEESGLANSMISVTW  120
            + T  E+ L N+ + + W
Sbjct  414  DTTLAEANLVNASLMMQW  431



>ref|XP_005843123.1| hypothetical protein CHLNCDRAFT_55386 [Chlorella variabilis]
 gb|EFN51021.1| hypothetical protein CHLNCDRAFT_55386 [Chlorella variabilis]
Length=324

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 49/90 (54%), Gaps = 5/90 (6%)
 Frame = -1

Query  386  LPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEET-DAKPFRLTQA  210
            LP+EP       CR+ +RLPDGRR QR F     +  ++ FC S  EE    + F L+Q 
Sbjct  237  LPQEPSDGSG--CRIAVRLPDGRRAQRRFPAGTALAAVYDFCLSQSEEAGGGRRFSLSQG  294

Query  209  IPGATSSLDFESNLTFEESGLANSMISVTW  120
             PGA  +LD +   T E +GL  +M+ + W
Sbjct  295  FPGAP-ALD-DQQQTVEAAGLNGAMLVLKW  322



>gb|KDO22673.1| hypothetical protein SPRG_10988 [Saprolegnia parasitica CBS 223.65]
Length=426

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 51/102 (50%), Gaps = 3/102 (3%)
 Frame = -1

Query  425  KETNVVKKPVYPPLPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLE  246
            K + V   PV  P+PEEP  D   V R+ IR   G RL R F ++DP++LLW F    + 
Sbjct  324  KPSVVAAPPVLAPMPEEP-ADGPSVTRIQIRTATGGRLLRRFQKTDPLELLWRFVRHEIP  382

Query  245  ETDAKPFRLTQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
            E   + F L  A P    + D  + L   ++ L N+ + + W
Sbjct  383  EAQTREFELRSAYPPKAVAFDTTTRLC--DAQLENASLMMNW  422



>gb|AFW86620.1| hypothetical protein ZEAMMB73_563531 [Zea mays]
Length=286

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMD-GSPSDHVSLSHKRPRESPQ  561
            ++DP+ GQK+ +W GMV P+ LLEDLLP++D G    H S   KRPR+  Q
Sbjct  188  LIDPVTGQKVHAWNGMVHPDRLLEDLLPYLDKGLKGHHASQPQKRPRKVDQ  238



>ref|XP_002957220.1| hypothetical protein VOLCADRAFT_98325 [Volvox carteri f. nagariensis]
 gb|EFJ41718.1| hypothetical protein VOLCADRAFT_98325 [Volvox carteri f. nagariensis]
Length=516

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 50/87 (57%), Gaps = 4/87 (5%)
 Frame = -1

Query  383  PEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDA-KPFRLTQAI  207
            PE P GD    CRV +R+PDG R+ R+F R+D ++ L+  C +H+ E  A +   +T A 
Sbjct  429  PEPPAGDSE-ACRVALRMPDGSRVTRSFRRTDTVRALFDLCVAHVPEAAAGRSLVITLAA  487

Query  206  PGATSSLDFESNLTFEESGLANSMISV  126
            P     LD E   T   +G+A +M++V
Sbjct  488  PPGQPPLDPEQ--TIGAAGVAGAMLAV  512



>ref|XP_011463688.1| PREDICTED: uncharacterized protein LOC105351367 [Fragaria vesca 
subsp. vesca]
Length=775

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 35/54 (65%), Gaps = 5/54 (9%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLL-PFMDGSPSDHVSLSHKRPRESPQAPP  552
            ++DPI G+ MRSW GMVQPE LL+DLL PFM+  P DH    H    ES Q  P
Sbjct  690  IIDPINGENMRSWYGMVQPECLLKDLLVPFMENRPKDH----HHPGEESSQPQP  739



>ref|XP_010240593.1| PREDICTED: UBX domain-containing protein 7 isoform X2 [Brachypodium 
distachyon]
Length=318

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLS-HKRPRESPQ  561
            ++DPI GQKM +W GMV P+ LLEDL+P++D  P +H +    KRPR+  Q
Sbjct  256  LIDPITGQKMCAWTGMVYPDRLLEDLMPYLDKGPKEHHAAQPQKRPRKIDQ  306



>ref|XP_008617322.1| hypothetical protein SDRG_13017 [Saprolegnia diclina VS20]
 ref|XP_008617323.1| hypothetical protein, variant [Saprolegnia diclina VS20]
 gb|EQC29144.1| hypothetical protein SDRG_13017 [Saprolegnia diclina VS20]
 gb|EQC29145.1| hypothetical protein, variant [Saprolegnia diclina VS20]
Length=437

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 55/199 (28%), Positives = 91/199 (46%), Gaps = 8/199 (4%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMD-GSPSDHVSLSHKRPRESPQAPPlhkdda  534
            ++DP  GQK+  W   ++P T+ E L  F    S         +                
Sbjct  242  ILDPRTGQKLVEWHNFIEPGTMTEKLSDFCCLNSMETTPPARPQAQAAPAPPARATSLYD  301

Query  533  keedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKP-VYPPLPEEPKGDKN  357
              E+E+L  A+AAS+EG  + + D   +     V+ ++ +VV  P V   +P+EP  D  
Sbjct  302  ASEEEQLAAAIAASLEGGDNEDSDDDDDDM---VIEEKPSVVAAPPVLASMPDEP-ADGP  357

Query  356  LVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFE  177
             V R+ IR   G RL R F ++DP++LLW F    + E   + F L  A P    ++ F+
Sbjct  358  SVTRIQIRTATGGRLLRRFQKTDPLELLWRFVRHEIPEAQTREFELRSAYP--PKAVAFD  415

Query  176  SNLTFEESGLANSMISVTW  120
            +     ++ L N+ + + W
Sbjct  416  TTTRICDAQLENASLMMNW  434



>emb|CCA23196.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=443

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = -1

Query  386  LPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAI  207
            LP EP   ++ V R+ IR PDG ++ R F +S+ I +L +F   ++ E   +PF L  A 
Sbjct  356  LPCEPSASESNVTRIQIRCPDGTKIIRRFYKSESISILRTFVRENVHEARTRPFNLRTAY  415

Query  206  PGATSSLDFESNLTFEESGLANSMISVTW  120
            P    ++D  S+    +  L N+++ V W
Sbjct  416  PPV--AIDCNSSALLGDQNLENAVMHVHW  442



>ref|XP_003604178.1| UBX domain-containing protein [Medicago truncatula]
 gb|ACJ84042.1| unknown [Medicago truncatula]
 gb|AES86375.1| UBX domain protein [Medicago truncatula]
Length=286

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSP  609
            ++DPI GQK+RSW GM+QPE+L+E LL F+D  P
Sbjct  184  IIDPITGQKIRSWGGMIQPESLIEGLLTFLDAGP  217



>ref|NP_594518.1| UBX domain protein Ubx2 [Schizosaccharomyces pombe 972h-]
 sp|O14048.1|UBX2_SCHPO RecName: Full=UBX domain-containing protein 2 [Schizosaccharomyces 
pombe 972h-]
 emb|CAB16375.1| UBX domain protein Ubx2 [Schizosaccharomyces pombe]
Length=427

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 87/193 (45%), Gaps = 7/193 (4%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddak  531
            ++DP  G++++ W     P   +  L  F++G   D  S   K P  +    P+      
Sbjct  237  ILDPRTGERVKEWSKSFTPADFVIALNDFLEGCTLDETS-GRKNPLGAKSQKPVEAMSED  295

Query  530  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNLV  351
            E+  + + A   +     ++  ++  + +ES  +  +T V K        EEP    N V
Sbjct  296  EQMHKAIAASLGNGNSTTESQGESSSQQAESHGVADDT-VHKIDSAECDAEEPSPGPN-V  353

Query  350  CRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLDFESN  171
             R+ IR+P+G R  R F  +DP+  ++++     E  D +PF LT       +SLD    
Sbjct  354  TRIQIRMPNGARFIRRFSLTDPVSKVYAYVKGVAEGADKQPFSLTFQRKSLWTSLD----  409

Query  170  LTFEESGLANSMI  132
             T +E+G+ N+ +
Sbjct  410  STIKEAGIQNTAL  422



>gb|EPY51977.1| UB Xdomain protein Ubx2 [Schizosaccharomyces cryophilus OY26]
Length=440

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 91/197 (46%), Gaps = 14/197 (7%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddak  531
            ++DP  G++++ W G + P   + +L  F+     +  +L   + R++P  P   K    
Sbjct  249  ILDPRTGERVKQWNGGITPTEFVIELNDFL-----ERCTLDETKDRKNPLGPKSQKPAEA  303

Query  530  eedeellqalaASMEGMKDTNVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGDKNL-  354
              +EE +    A+  G++    ++  ESS+  +   E       V+    EE K ++   
Sbjct  304  MTEEEQMSKAIAASLGVEQERTESTGESSQP-IQEDEEEEQDNTVHKIKSEEGKDEEPSP  362

Query  353  ---VCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  183
               V R+ IR+P G R  R F  SD ++ ++++     E  D++ F LT       +SLD
Sbjct  363  GPGVTRIQIRMPTGARFIRRFYESDLVRKVYAYVKGVAEGADSQAFSLTFQRTSLWNSLD  422

Query  182  FESNLTFEESGLANSMI  132
                 T +E+G+ N+ +
Sbjct  423  ----KTIKEAGIQNTAL  435



>ref|XP_006480636.1| PREDICTED: UBX domain-containing protein 7-like isoform X2 [Citrus 
sinensis]
Length=278

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAP  555
            V+DPI GQK+ SW GM+ P+ L E LLPFMD SP    ++  +R R S   P
Sbjct  220  VIDPITGQKICSWCGMINPQPLGEMLLPFMDRSPRKCATIIIERQRASSTTP  271



>ref|XP_006480635.1| PREDICTED: UBX domain-containing protein 7-like isoform X1 [Citrus 
sinensis]
Length=294

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAP  555
            V+DPI GQK+ SW GM+ P+ L E LLPFMD SP    ++  +R R S   P
Sbjct  220  VIDPITGQKICSWCGMINPQPLGEMLLPFMDRSPRKCATIIIERQRASSTTP  271



>ref|XP_006480637.1| PREDICTED: UBX domain-containing protein 7-like isoform X3 [Citrus 
sinensis]
Length=275

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAP  555
            V+DPI GQK+ SW GM+ P+ L E LLPFMD SP    ++  +R R S   P
Sbjct  201  VIDPITGQKICSWCGMINPQPLGEMLLPFMDRSPRKCATIIIERQRASSTTP  252



>ref|XP_009844374.1| hypothetical protein H257_17329 [Aphanomyces astaci]
 ref|XP_009844375.1| hypothetical protein, variant [Aphanomyces astaci]
 gb|ETV66185.1| hypothetical protein H257_17329 [Aphanomyces astaci]
 gb|ETV66186.1| hypothetical protein, variant [Aphanomyces astaci]
Length=446

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 90/202 (45%), Gaps = 17/202 (8%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddak  531
            V+DP+ GQK+  W   ++P  + E L        SD   L+       P AP        
Sbjct  255  VLDPLTGQKVVEWPDYIEPHAMAEKL--------SDFACLNPPGAAVRPVAPKPPPSREL  306

Query  530  eedeellqalaASMEGMKDT----NVDALKESSESDVLGKETNVVKKPVYPPLPEEPKGD  363
             EDEEL  A+AASME   D     +V  L + + +               P LP+EP  D
Sbjct  307  TEDEELAAAIAASMEQQTDDDMGHDVKVLPQGAPTVHDDLPPPPSPVAAVPRLPDEP-AD  365

Query  362  KNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGATSSLD  183
               V RV IR   G RL R F +++P+ +L+ F    + E   + F L  + P AT    
Sbjct  366  GPTVTRVQIRTTTGSRLMRRFDKAEPVAVLFQFVQQEIPEARTRGFELRTSYPPATL---  422

Query  182  FESNLT-FEESGLANSMISVTW  120
              S+LT   ++ L N+ +++ W
Sbjct  423  VSSDLTPLADANLVNASLNMQW  444



>ref|XP_001691879.1| hypothetical protein CHLREDRAFT_145485 [Chlamydomonas reinhardtii]
 gb|EDP04369.1| predicted protein [Chlamydomonas reinhardtii]
Length=523

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 48/88 (55%), Gaps = 3/88 (3%)
 Frame = -1

Query  386  LPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDA-KPFRLTQA  210
            +PEEP        RV +RLPDG RL R F +S+ ++ L+    + + E  A +   ++ A
Sbjct  434  VPEEPAEGDPAALRVALRLPDGGRLMRRFRKSEHVRCLYDLALAKVPEAAAGRSVTISHA  493

Query  209  IPGATSSLDFESNLTFEESGLANSMISV  126
             PG  +  D   + T E +G+A +M++V
Sbjct  494  TPGGAALTD--QDQTLEAAGVAGAMLAV  519



>emb|CDH49981.1| ubx domain protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=480

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 51/93 (55%), Gaps = 5/93 (5%)
 Frame = -1

Query  398  VYPPLPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRL  219
            + P   +EP    N   R+ +R PDG+R+ R F ++DP++ L+ F  + L E+  +PF L
Sbjct  390  IQPIKRDEPTDPAN-TTRIQLRTPDGKRIVRKFSKTDPVRYLFEFVKAELPESQDRPFEL  448

Query  218  TQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
                      LD E     +E+GLAN+ +++++
Sbjct  449  VFNRQQLIELLDKE----IQEAGLANAAVNLSF  477



>ref|XP_008812862.1| PREDICTED: uncharacterized protein LOC103723650 isoform X2 [Phoenix 
dactylifera]
Length=99

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -1

Query  404  KPVYPPLPEEPKGDKNLVCRVGIRLPD  324
            KPVYP LPEEPKG + L+C VGIRLPD
Sbjct  73   KPVYPALPEEPKGSRELLCTVGIRLPD  99



>ref|XP_011399212.1| UBX domain-containing protein 7 [Auxenochlorella protothecoides]
 gb|KFM26316.1| UBX domain-containing protein 7 [Auxenochlorella protothecoides]
Length=338

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 47/93 (51%), Gaps = 10/93 (11%)
 Frame = -1

Query  374  PKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDA-KPFRLTQAIP--  204
            PK +  L     +R PDG RLQR F ++ P++ L   C +   E  A +PF L  + P  
Sbjct  246  PKAESGLTSAGPVRCPDGSRLQRRFEQTAPLETLRDLCIASCPEAAAGRPFFLAPSFPGT  305

Query  203  -----GATSSLDFESNLTFEESGLANSMISVTW  120
                 GA   LD  ++LT   SG A+SM+ + W
Sbjct  306  LRLPGGAQPLLDMAADLT--TSGAADSMLVMKW  336



>ref|XP_006677415.1| hypothetical protein BATDEDRAFT_34588 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF82120.1| hypothetical protein BATDEDRAFT_34588 [Batrachochytrium dendrobatidis 
JAM81]
Length=468

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 95/210 (45%), Gaps = 21/210 (10%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMD-------GSPSDHVSLSHKRPRESPQAPP  552
            ++DP+ G++++ WR  + P   + +++ FMD         P+   ++S      +P    
Sbjct  261  IIDPLTGERIKLWRVQIDPSAFMVEVVEFMDRYQTHLSNEPTSSAAISGLNSASNPTTKQ  320

Query  551  lhkddakeedeellqalaASMEGMKDTNVDALKESSESDVL-------GKETNVVKKPVY  393
              K     E+E+L  A++AS+   K  N D    +S  +V+        K    V K + 
Sbjct  321  SSKIIDLTEEEQLNLAISASLGEAKTGNRDMANTTSNLNVMPLPSKDDPKYALAVFKQID  380

Query  392  PPLPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLW-SFCSSHLEETDAKPFRLT  216
                 EP G  + + R+  RLP+G++    FL+SD ++ L+ S  ++H E T  + F L 
Sbjct  381  AVPYVEPTGSPDTITRIQFRLPNGQKSVYRFLKSDLVRRLFESIKAAHPEIT--QSFELL  438

Query  215  QAIPGATSSLDFESNLTFEESGLANSMISV  126
                     +D     T E++GL N  + V
Sbjct  439  HFRDTLLRKMD----QTIEQAGLVNVALVV  464



>emb|CDS04684.1| hypothetical protein LRAMOSA07234 [Absidia idahoensis var. thermophila]
Length=474

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 51/93 (55%), Gaps = 5/93 (5%)
 Frame = -1

Query  398  VYPPLPEEPKGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRL  219
            + P   +EP    N   R+ +R PDG+R+ R FL++DP++ L+ F  + + E+  + F L
Sbjct  384  IQPIKRDEPTDPAN-TTRIQLRTPDGKRIVRRFLKTDPVRHLFEFVKAEIPESQDRQFEL  442

Query  218  TQAIPGATSSLDFESNLTFEESGLANSMISVTW  120
                      LD E     +E+GLAN+ +++++
Sbjct  443  VFNRQQLIELLDQE----IQEAGLANAAVNLSF  471



>gb|EPX70813.1| UB Xdomain protein Ubx2 [Schizosaccharomyces octosporus yFS286]
Length=437

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 94/202 (47%), Gaps = 18/202 (9%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddak  531
            ++DP  G++++ W   + P   + +L  F++       +L   + R++P  P  HK    
Sbjct  240  ILDPRTGERVKQWNSGITPTDFIIELNDFLE-----RCTLDETKGRKNPLGPKSHKPAEA  294

Query  530  eedeellqalaASMEGMKDTNVDALKESSE-----SDVLGKETNVVKKPVYPPLPEEPKG  366
              +EE +    A+  G++    + + ESS+      D   +E       +Y    EE K 
Sbjct  295  MTEEEQMSKAIAASLGVEQEKNEDMGESSQPIQANEDEEEEEVETQDNTIYKINSEEAKD  354

Query  365  DK----NLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLTQAIPGA  198
            ++      V R+ IRLP+G R  R F  +D ++ ++++   + E  +++PF LT      
Sbjct  355  EEPSPGAGVTRIQIRLPNGARFIRRFYETDLVRKVYAYVKGNAEGAESQPFSLTFQRTSL  414

Query  197  TSSLDFESNLTFEESGLANSMI  132
             + LD     T +++G+ N+ +
Sbjct  415  WNLLD----KTIKDAGIQNTAL  432



>ref|XP_010440502.1| PREDICTED: UBX domain-containing protein 7-like [Camelina sativa]
Length=300

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 8/59 (14%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVS--LSHKRPR------ESPQA  558
            ++DPI GQKM +W GM++    LEDL+ + D  P +HV+   S+KR +      ES QA
Sbjct  220  LIDPITGQKMHTWSGMIEAHGFLEDLMKYRDVGPHEHVASLTSNKRIKTEKIYFESSQA  278



>ref|XP_002173242.1| UB Xdomain protein Ubx2 [Schizosaccharomyces japonicus yFS275]
 gb|EEB06949.1| UB Xdomain protein Ubx2 [Schizosaccharomyces japonicus yFS275]
Length=440

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 76/172 (44%), Gaps = 8/172 (5%)
 Frame = -1

Query  710  VVDPIPGQKMRSWRGMVQPETLLEDLLPFMDGSPSDHVSLSHKRPRESPQAPPlhkddak  531
            ++DP  G+++++W     P  L+  L  F++    D  S  HK P       P+     +
Sbjct  241  ILDPRTGERLKAWNKGFTPAELVVALNDFLEQCSFDE-SNGHKNPLGPKAKKPVEAMSEE  299

Query  530  eedeellqalaASMEG-----MKDTNVDALKESSESDVLGKET--NVVKKPVYPPLPEEP  372
            E+  + + A   +  G     MKD N D ++   E +    E   N V       LP + 
Sbjct  300  EQLHKAIAASLGASAGSEDAVMKDNNEDEIEGDEEEEEDVVEQVPNTVNSINVSDLPTDE  359

Query  371  KGDKNLVCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDAKPFRLT  216
                    R+ +R+ +G R  R FL++DP++ +++F       ++ KPF LT
Sbjct  360  PAAGPATTRIQVRMANGSRFIRRFLKADPVRYVYAFAKQMAPGSEGKPFTLT  411



>ref|XP_002461860.1| hypothetical protein SORBIDRAFT_02g009430 [Sorghum bicolor]
 gb|EER98381.1| hypothetical protein SORBIDRAFT_02g009430 [Sorghum bicolor]
Length=598

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 43/81 (53%), Gaps = 5/81 (6%)
 Frame = -1

Query  353  VCRVGIRLPDGRRLQRNFLRSDPIQLLWSFCSSHLEETDA----KPFRLTQAIPGATSSL  186
            VC+V +RL DGR + + F     +  L+++C S L    A    KPFRL + +  AT  +
Sbjct  515  VCKVRVRLADGRVVTKEFGSQCAVAALFAYCRSMLGAGGAPPPEKPFRLMRFVGRATEEI  574

Query  185  -DFESNLTFEESGLANSMISV  126
             D   N +FE  GL  + +SV
Sbjct  575  GDHNQNASFESLGLHLTTVSV  595



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1219970116365