BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF036G08

Length=703
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006355233.1|  PREDICTED: threonine--tRNA ligase, mitochond...    383   1e-125   Solanum tuberosum [potatoes]
ref|XP_004246064.1|  PREDICTED: threonine--tRNA ligase, mitochond...    379   5e-124   Solanum lycopersicum
ref|XP_009622103.1|  PREDICTED: threonine--tRNA ligase, mitochond...    376   2e-122   Nicotiana tomentosiformis
ref|XP_009794575.1|  PREDICTED: threonine--tRNA ligase, mitochond...    374   9e-122   Nicotiana sylvestris
ref|XP_004170956.1|  PREDICTED: threonine--tRNA ligase, mitochond...    352   2e-118   
ref|XP_006355966.1|  PREDICTED: threonine--tRNA ligase, mitochond...    365   2e-118   Solanum tuberosum [potatoes]
gb|KGN49712.1|  hypothetical protein Csa_5G080780                       351   6e-118   Cucumis sativus [cucumbers]
ref|XP_004238685.1|  PREDICTED: threonine--tRNA ligase, mitochond...    364   9e-118   Solanum lycopersicum
gb|KDO82534.1|  hypothetical protein CISIN_1g0066801mg                  350   1e-117   Citrus sinensis [apfelsine]
ref|XP_010274327.1|  PREDICTED: threonine--tRNA ligase, mitochond...    363   3e-117   Nelumbo nucifera [Indian lotus]
ref|XP_006438443.1|  hypothetical protein CICLE_v100308251mg            348   7e-117   
ref|XP_010272819.1|  PREDICTED: threonine--tRNA ligase, mitochond...    360   3e-116   Nelumbo nucifera [Indian lotus]
gb|EPS72288.1|  hypothetical protein M569_02470                         358   8e-116   Genlisea aurea
ref|XP_011076219.1|  PREDICTED: threonine--tRNA ligase, mitochond...    358   1e-115   Sesamum indicum [beniseed]
ref|XP_008460557.1|  PREDICTED: threonine--tRNA ligase, mitochond...    352   2e-113   Cucumis melo [Oriental melon]
gb|ADE77216.1|  unknown                                                 335   3e-113   Picea sitchensis
emb|CDP00192.1|  unnamed protein product                                352   6e-113   Coffea canephora [robusta coffee]
ref|XP_004142299.1|  PREDICTED: threonine--tRNA ligase, mitochond...    351   1e-112   Cucumis sativus [cucumbers]
gb|EYU25062.1|  hypothetical protein MIMGU_mgv1a002240mg                350   1e-112   Erythranthe guttata [common monkey flower]
ref|XP_010100498.1|  Threonine--tRNA ligase                             347   2e-112   
ref|XP_002265302.1|  PREDICTED: threonine--tRNA ligase, mitochond...    348   5e-112   Vitis vinifera
ref|XP_006483810.1|  PREDICTED: threonine--tRNA ligase, mitochond...    348   1e-111   Citrus sinensis [apfelsine]
ref|XP_010644571.1|  PREDICTED: threonine--tRNA ligase, mitochond...    346   3e-111   Vitis vinifera
ref|XP_003613276.1|  Threonyl-tRNA synthetase                           347   3e-111   Medicago truncatula
gb|KHN12091.1|  Threonine--tRNA ligase, mitochondrial                   343   6e-111   Glycine soja [wild soybean]
ref|XP_003519592.1|  PREDICTED: threonine--tRNA ligase, mitochond...    344   3e-110   Glycine max [soybeans]
ref|XP_006346202.1|  PREDICTED: threonine--tRNA ligase, mitochond...    335   3e-110   Solanum tuberosum [potatoes]
ref|XP_004489863.1|  PREDICTED: threonine--tRNA ligase, mitochond...    344   4e-110   Cicer arietinum [garbanzo]
ref|XP_010533069.1|  PREDICTED: threonine--tRNA ligase, mitochond...    344   5e-110   Tarenaya hassleriana [spider flower]
gb|KHN00337.1|  Threonine--tRNA ligase, mitochondrial                   344   6e-110   Glycine soja [wild soybean]
ref|XP_009360487.1|  PREDICTED: threonine--tRNA ligase, mitochond...    342   8e-110   Pyrus x bretschneideri [bai li]
gb|KDO82533.1|  hypothetical protein CISIN_1g0066801mg                  330   1e-109   Citrus sinensis [apfelsine]
ref|XP_003517788.1|  PREDICTED: threonine--tRNA ligase, mitochond...    343   1e-109   Glycine max [soybeans]
ref|XP_007157476.1|  hypothetical protein PHAVU_002G072800g             342   2e-109   Phaseolus vulgaris [French bean]
gb|KDP21323.1|  hypothetical protein JCGZ_21794                         340   5e-109   Jatropha curcas
ref|XP_008340003.1|  PREDICTED: threonine--tRNA ligase, mitochond...    340   7e-109   
ref|XP_009412586.1|  PREDICTED: threonine--tRNA ligase, mitochond...    341   7e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002311580.2|  Threonyl-tRNA synthetase family protein            341   7e-109   Populus trichocarpa [western balsam poplar]
ref|XP_004296467.2|  PREDICTED: threonine--tRNA ligase, mitochond...    340   1e-108   Fragaria vesca subsp. vesca
ref|XP_006836673.1|  hypothetical protein AMTR_s00088p00069780          340   1e-108   
ref|XP_008361801.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    340   2e-108   
ref|XP_011025470.1|  PREDICTED: threonine--tRNA ligase, mitochond...    339   3e-108   Populus euphratica
ref|XP_009599596.1|  PREDICTED: threonine--tRNA ligase, mitochond...    329   4e-108   Nicotiana tomentosiformis
ref|XP_010913364.1|  PREDICTED: threonine--tRNA ligase, mitochond...    338   7e-108   Elaeis guineensis
ref|XP_006378416.1|  Threonyl-tRNA synthetase family protein            337   1e-107   
ref|XP_010551550.1|  PREDICTED: threonine--tRNA ligase, mitochond...    337   2e-107   Tarenaya hassleriana [spider flower]
ref|XP_007225203.1|  hypothetical protein PRUPE_ppa002055mg             337   4e-107   Prunus persica
ref|XP_008221771.1|  PREDICTED: threonine--tRNA ligase, mitochond...    336   5e-107   Prunus mume [ume]
gb|KJB48103.1|  hypothetical protein B456_008G053600                    329   2e-106   Gossypium raimondii
gb|EEC83306.1|  hypothetical protein OsI_28675                          321   4e-106   Oryza sativa Indica Group [Indian rice]
ref|XP_008802022.1|  PREDICTED: threonine--tRNA ligase, mitochond...    333   7e-106   Phoenix dactylifera
ref|XP_007044584.1|  Threonyl-tRNA synthetase isoform 3                 329   1e-104   
ref|XP_010688668.1|  PREDICTED: threonine--tRNA ligase, mitochond...    329   1e-104   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB48102.1|  hypothetical protein B456_008G053600                    329   2e-104   Gossypium raimondii
ref|XP_007044582.1|  Threonyl-tRNA synthetase isoform 1                 329   3e-104   
ref|XP_004510448.1|  PREDICTED: threonine--tRNA ligase, mitochond...    320   8e-104   
ref|XP_011021655.1|  PREDICTED: threonine--tRNA ligase, mitochond...    324   1e-102   Populus euphratica
emb|CAC79651.1|  threonyl-tRNA synthetase                               319   2e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010044651.1|  PREDICTED: threonine--tRNA ligase, mitochond...    323   7e-102   Eucalyptus grandis [rose gum]
gb|EEE68426.1|  hypothetical protein OsJ_26793                          322   1e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004500860.1|  PREDICTED: threonine--tRNA ligase, mitochond...    316   2e-101   Cicer arietinum [garbanzo]
ref|XP_006659275.1|  PREDICTED: threonine--tRNA ligase, mitochond...    321   2e-101   Oryza brachyantha
ref|NP_001061475.1|  Os08g0295300                                       322   2e-101   
dbj|BAI39857.1|  putative threonyl-tRNA synthetase                      322   3e-101   Oryza sativa Indica Group [Indian rice]
ref|XP_004973168.1|  PREDICTED: threonine--tRNA ligase, mitochond...    317   1e-99    Setaria italica
ref|XP_006394912.1|  hypothetical protein EUTSA_v10003725mg             314   1e-98    Eutrema salsugineum [saltwater cress]
emb|CDX80596.1|  BnaC07g28480D                                          313   2e-98    
ref|XP_009151164.1|  PREDICTED: threonine--tRNA ligase, mitochond...    313   3e-98    Brassica rapa
gb|KFK26446.1|  hypothetical protein AALP_AA8G249500                    313   3e-98    Arabis alpina [alpine rockcress]
ref|XP_009111770.1|  PREDICTED: threonine--tRNA ligase, mitochond...    313   4e-98    Brassica rapa
dbj|BAJ93554.1|  predicted protein                                      312   7e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008664856.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    311   3e-97    Zea mays [maize]
ref|XP_004968434.1|  PREDICTED: threonine--tRNA ligase, mitochond...    311   3e-97    Setaria italica
emb|CDX87030.1|  BnaC09g03450D                                          310   3e-97    
ref|XP_002464119.1|  hypothetical protein SORBIDRAFT_01g012680          311   3e-97    Sorghum bicolor [broomcorn]
ref|XP_010027611.1|  PREDICTED: threonine--tRNA ligase, mitochond...    301   4e-97    
ref|XP_010027610.1|  PREDICTED: threonine--tRNA ligase, mitochond...    301   8e-97    Eucalyptus grandis [rose gum]
ref|XP_003573669.1|  PREDICTED: threonine--tRNA ligase, mitochond...    309   1e-96    Brachypodium distachyon [annual false brome]
gb|KCW54156.1|  hypothetical protein EUGRSUZ_I00127                     301   2e-96    Eucalyptus grandis [rose gum]
ref|XP_002521030.1|  threonyl-tRNA synthetase, putative                 307   3e-96    
emb|CDM81189.1|  unnamed protein product                                308   3e-96    Triticum aestivum [Canadian hard winter wheat]
ref|XP_008237148.1|  PREDICTED: threonine--tRNA ligase, mitochond...    306   3e-96    
ref|XP_006289423.1|  hypothetical protein CARUB_v10002922mg             308   4e-96    Capsella rubella
ref|XP_002872240.1|  AT5g26830/F2P16_90                                 307   4e-96    Arabidopsis lyrata subsp. lyrata
gb|AAK82468.1|  AT5g26830/F2P16_90                                      306   4e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008644625.1|  PREDICTED: threonine--tRNA ligase, mitochond...    308   5e-96    
ref|NP_198035.2|  threonyl-tRNA synthetase                              307   6e-96    Arabidopsis thaliana [mouse-ear cress]
emb|CAA74705.1|  threonyl-tRNA synthetase                               307   7e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010027608.1|  PREDICTED: threonine--tRNA ligase, mitochond...    301   8e-96    Eucalyptus grandis [rose gum]
ref|XP_007199721.1|  hypothetical protein PRUPE_ppa002288mg             306   1e-95    Prunus persica
ref|XP_010493938.1|  PREDICTED: threonine--tRNA ligase, mitochond...    306   2e-95    Camelina sativa [gold-of-pleasure]
ref|XP_007200687.1|  hypothetical protein PRUPE_ppa017189mg             303   9e-95    Prunus persica
ref|XP_010455043.1|  PREDICTED: threonine--tRNA ligase, mitochond...    303   2e-94    Camelina sativa [gold-of-pleasure]
ref|XP_001784310.1|  predicted protein                                  299   5e-93    
gb|AAB61048.1|  Similar to threonyl-tRNA synthetase; coded for by...    298   2e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010497266.1|  PREDICTED: probable threonine--tRNA ligase, ...    282   2e-91    Camelina sativa [gold-of-pleasure]
gb|EMT11254.1|  Threonyl-tRNA synthetase, mitochondrial                 299   2e-90    
gb|KDO82535.1|  hypothetical protein CISIN_1g0066801mg                  279   2e-90    Citrus sinensis [apfelsine]
emb|CDY19754.1|  BnaA09g04070D                                          287   2e-89    Brassica napus [oilseed rape]
ref|XP_010476961.1|  PREDICTED: LOW QUALITY PROTEIN: probable thr...    281   2e-88    Camelina sativa [gold-of-pleasure]
ref|XP_002989766.1|  hypothetical protein SELMODRAFT_447798             281   2e-87    
gb|EMS59266.1|  Threonyl-tRNA synthetase, mitochondrial                 285   1e-85    Triticum urartu
ref|XP_004304268.2|  PREDICTED: threonine--tRNA ligase, mitochond...    279   6e-85    Fragaria vesca subsp. vesca
ref|XP_002890262.1|  hypothetical protein ARALYDRAFT_889225             275   1e-84    
ref|XP_002892976.1|  hypothetical protein ARALYDRAFT_472010             270   1e-84    
ref|XP_006303967.1|  hypothetical protein CARUB_v10008857mg             267   2e-82    
ref|XP_010480524.1|  PREDICTED: probable threonine--tRNA ligase, ...    268   2e-81    
ref|XP_006303165.1|  hypothetical protein CARUB_v10008521mg             267   5e-81    Capsella rubella
emb|CDY21715.1|  BnaA09g44660D                                          264   4e-80    Brassica napus [oilseed rape]
ref|XP_009117622.1|  PREDICTED: threonine--tRNA ligase, mitochond...    263   7e-80    Brassica rapa
ref|XP_001696198.1|  hypothetical protein CHLREDRAFT_167047             262   7e-79    Chlamydomonas reinhardtii
ref|XP_002991732.1|  hypothetical protein SELMODRAFT_134156             260   1e-78    
ref|XP_002989765.1|  hypothetical protein SELMODRAFT_130418             260   1e-78    
dbj|BAN16553.1|  ADB6244                                                251   2e-78    Acytostelium subglobosum
ref|XP_002946221.1|  hypothetical protein VOLCADRAFT_102823             259   6e-78    Volvox carteri f. nagariensis
ref|XP_005844334.1|  hypothetical protein CHLNCDRAFT_49107              255   2e-77    Chlorella variabilis
ref|NP_173238.1|  threonyl-tRNA synthetase                              252   2e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007044585.1|  Threonyl-tRNA synthetase isoform 4                 253   2e-76    
ref|XP_007044583.1|  Threonyl-tRNA synthetase isoform 2                 253   4e-76    
ref|XP_007514880.1|  threonyl-tRNA synthetase                           253   2e-75    Bathycoccus prasinos
ref|XP_009117636.1|  PREDICTED: threonine--tRNA ligase, mitochond...    246   2e-75    Brassica rapa
ref|XP_011397153.1|  Threonine-tRNA ligase, mitochondrial               253   3e-75    Auxenochlorella protothecoides
ref|XP_003080220.1|  putative threonyl-tRNA synthetase (ISS)            252   3e-75    
ref|XP_636821.1|  threonyl-tRNA synthetase                              252   3e-75    Dictyostelium discoideum AX4
emb|CEF98631.1|  Anticodon-binding                                      251   5e-75    Ostreococcus tauri
ref|XP_005648591.1|  threonyl-tRNA synthetase                           253   6e-75    Coccomyxa subellipsoidea C-169
ref|XP_004351232.1|  threonyl-tRNA synthetase                           251   7e-75    Cavenderia fasciculata
ref|XP_003288175.1|  threonyl-tRNA synthetase                           251   8e-75    Dictyostelium purpureum
dbj|GAM29123.1|  hypothetical protein SAMD00019534_122990               251   8e-75    Acytostelium subglobosum LB1
ref|XP_002677200.1|  threonyl-tRNA synthetase                           250   2e-74    Naegleria gruberi strain NEG-M
gb|EFA77297.1|  threonyl-tRNA synthetase                                250   2e-74    Heterostelium album PN500
ref|XP_011499017.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    250   2e-74    Ceratosolen solmsi marchali
ref|XP_006071988.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     240   6e-74    
ref|XP_009117635.1|  PREDICTED: threonine--tRNA ligase, mitochond...    242   8e-74    Brassica rapa
ref|XP_004182642.1|  hypothetical protein TBLA_0J01260                  249   1e-73    Tetrapisispora blattae CBS 6284
ref|XP_004933460.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    248   1e-73    Bombyx mori [silk moth]
emb|CDJ83831.1|  Aminoacyl-tRNA synthetase and Anticodon-binding ...    240   1e-73    Haemonchus contortus [red stomach worm]
ref|XP_003058283.1|  predicted protein                                  248   1e-73    Micromonas pusilla CCMP1545
ref|XP_004933459.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    248   2e-73    Bombyx mori [silk moth]
ref|XP_002595927.1|  hypothetical protein BRAFLDRAFT_268618             246   5e-73    Branchiostoma floridae
ref|XP_005650255.1|  threonyl-tRNA synthetase                           250   5e-73    Coccomyxa subellipsoidea C-169
ref|XP_001418868.1|  predicted protein                                  246   6e-73    Ostreococcus lucimarinus CCE9901
ref|XP_005774035.1|  threonine-tRNA ligase                              246   7e-73    Emiliania huxleyi CCMP1516
ref|XP_001623293.1|  predicted protein                                  243   7e-73    Nematostella vectensis
emb|CDY21726.1|  BnaA09g44770D                                          239   9e-73    Brassica napus [oilseed rape]
ref|XP_005758375.1|  threonine-tRNA ligase                              246   9e-73    Emiliania huxleyi CCMP1516
pdb|4P3N|A  Chain A, Structural Basis For Full-spectrum Inhibitio...    239   9e-73    Homo sapiens [man]
ref|XP_004531261.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    245   1e-72    Ceratitis capitata [medfly]
pdb|4HWT|A  Chain A, Crystal Structure Of Human Threonyl-trna Syn...    238   1e-72    Homo sapiens [man]
ref|XP_001989177.1|  GH11579                                            241   1e-72    Drosophila grimshawi
gb|EDL82978.1|  threonyl-tRNA synthetase, isoform CRA_b                 239   1e-72    Rattus norvegicus [brown rat]
ref|NP_723726.1|  Threonyl-tRNA synthetase, isoform C                   245   1e-72    Drosophila melanogaster
ref|XP_008213480.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    246   1e-72    Nasonia vitripennis
gb|AAN71609.1|  RH56418p                                                245   1e-72    Drosophila melanogaster
ref|XP_011212426.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    245   2e-72    Bactrocera dorsalis [papaya fruit fly]
ref|XP_001603180.2|  PREDICTED: threonine--tRNA ligase, cytoplasm...    245   2e-72    Nasonia vitripennis
ref|XP_003397155.1|  PREDICTED: threonyl-tRNA synthetase, cytopla...    246   2e-72    
emb|CDF89359.1|  ZYBA0S04-02388g1_1                                     246   2e-72    Zygosaccharomyces bailii CLIB 213
gb|EFA05822.1|  hypothetical protein TcasGA2_TC008604                   244   2e-72    
ref|XP_003489967.1|  PREDICTED: threonyl-tRNA synthetase, cytopla...    244   2e-72    
ref|XP_008198247.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    245   3e-72    Tribolium castaneum [rust-red flour beetle]
ref|XP_967345.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic ...    244   3e-72    Tribolium castaneum [rust-red flour beetle]
ref|XP_004531260.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    246   3e-72    Ceratitis capitata [medfly]
ref|XP_319682.4|  AGAP008929-PA                                         245   3e-72    Anopheles gambiae str. PEST
ref|XP_002002014.1|  GI17149                                            244   3e-72    
ref|XP_004349538.1|  threonyl-tRNA synthetase                           245   3e-72    Capsaspora owczarzaki ATCC 30864
ref|NP_723725.1|  Threonyl-tRNA synthetase, isoform A                   245   3e-72    Drosophila melanogaster
ref|XP_001969762.1|  GG23767                                            245   3e-72    Drosophila erecta
gb|AAM50188.1|  GH20022p                                                245   3e-72    Drosophila melanogaster
gb|KGK38420.1|  hypothetical protein JL09_g2427                         244   4e-72    Pichia kudriavzevii
ref|XP_011342020.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    244   4e-72    Ooceraea biroi
ref|XP_011212417.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    245   4e-72    Bactrocera dorsalis [papaya fruit fly]
ref|XP_002079196.1|  GD23818                                            245   4e-72    Drosophila simulans
ref|XP_002042027.1|  GM26732                                            245   4e-72    Drosophila sechellia
gb|EPY73150.1|  threonine--tRNA ligase, cytoplasmic                     243   4e-72    Camelus ferus
ref|XP_001965104.1|  GF21565                                            244   5e-72    Drosophila ananassae
ref|XP_010208524.1|  PREDICTED: probable threonine--tRNA ligase 2...    232   5e-72    Colius striatus
emb|CDX81854.1|  BnaC08g37470D                                          237   6e-72    
ref|XP_002088448.1|  Aats-thr                                           244   6e-72    Drosophila yakuba
ref|XP_003729486.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    241   6e-72    Strongylocentrotus purpuratus [purple urchin]
ref|XP_011342019.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    244   6e-72    Ooceraea biroi
ref|XP_002052626.1|  GJ17652                                            244   7e-72    Drosophila virilis
gb|AAH04621.1|  Tars protein                                            238   7e-72    Mus musculus [mouse]
gb|ETN67379.1|  threonyl-tRNA synthetase                                243   9e-72    Anopheles darlingi [American malaria mosquito]
ref|XP_009238891.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    240   9e-72    
ref|XP_449908.1|  hypothetical protein                                  243   9e-72    [Candida] glabrata
emb|CCD74804.1|  unnamed protein product                                231   1e-71    Schistosoma mansoni
ref|XP_004088253.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     240   1e-71    
ref|XP_001658309.1|  AAEL001206-PA                                      243   1e-71    Aedes aegypti
ref|XP_003503703.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     243   1e-71    Cricetulus griseus [Chinese hamsters]
ref|XP_001642915.1|  hypothetical protein Kpol_411p2                    243   1e-71    Vanderwaltozyma polyspora DSM 70294
ref|XP_001950747.2|  PREDICTED: threonine--tRNA ligase, cytoplasm...    243   2e-71    
emb|CDW52205.1|  threonyl tRNA synthetase, cytoplasmic                  243   2e-71    Trichuris trichiura
ref|XP_003674309.1|  hypothetical protein NCAS_0A13710                  243   2e-71    Naumovozyma castellii CBS 4309
ref|XP_005556719.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    240   2e-71    
ref|XP_006194878.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     242   2e-71    Camelus ferus
ref|XP_004088252.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     240   2e-71    Nomascus leucogenys [White-cheeked Gibbon]
gb|EHJ63622.1|  hypothetical protein KGM_17077                          242   2e-71    
gb|KFB38665.1|  AGAP008929-PA-like protein                              243   2e-71    Anopheles sinensis
ref|XP_002942619.2|  PREDICTED: threonine--tRNA ligase, cytoplasm...    243   2e-71    Xenopus tropicalis [western clawed frog]
ref|XP_003955557.1|  hypothetical protein KAFR_0B01230                  242   3e-71    Kazachstania africana CBS 2517
ref|XP_004059038.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    239   3e-71    
ref|XP_005556718.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    240   3e-71    
ref|XP_005325709.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    242   3e-71    Ictidomys tridecemlineatus
ref|XP_004990683.1|  threonyl-tRNA synthetase isoform 2                 243   3e-71    Salpingoeca rosetta
gb|KHJ41146.1|  hypothetical protein D918_08732                         242   3e-71    Trichuris suis
ref|XP_005003846.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    242   4e-71    
gb|EDL03283.1|  threonyl-tRNA synthetase, isoform CRA_a                 238   4e-71    Mus musculus [mouse]
ref|NP_001125825.1|  threonine--tRNA ligase, cytoplasmic                238   4e-71    Pongo abelii [orang utan]
ref|XP_004059037.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    240   4e-71    
ref|XP_003475575.2|  PREDICTED: probable threonine--tRNA ligase 2...    242   4e-71    
ref|XP_004372697.1|  PREDICTED: probable threonine--tRNA ligase 2...    243   4e-71    Trichechus manatus latirostris
ref|XP_011264917.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    241   4e-71    Camponotus floridanus
ref|XP_003470228.2|  PREDICTED: threonine--tRNA ligase, cytoplasm...    241   5e-71    
gb|EWG95461.1|  Ths1p                                                   242   5e-71    Saccharomyces cerevisiae R103
gb|EDZ71519.1|  YIL078Wp-like protein                                   241   5e-71    Saccharomyces cerevisiae AWRI1631
ref|XP_002499537.1|  predicted protein                                  241   5e-71    Micromonas commoda
ref|XP_004088251.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     240   5e-71    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_011192188.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    241   5e-71    Zeugodacus cucurbitae [melon fruit fly]
gb|EDV09560.1|  threonyl-tRNA synthetase                                242   5e-71    Saccharomyces cerevisiae RM11-1a
ref|XP_006875438.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    241   5e-71    Chrysochloris asiatica
gb|AJR39322.1|  Ths1p                                                   242   5e-71    Saccharomyces cerevisiae YJM470
ref|XP_004085211.2|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   5e-71    
ref|XP_011264916.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    241   5e-71    Camponotus floridanus
ref|XP_002714160.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     241   5e-71    Oryctolagus cuniculus [domestic rabbit]
ref|XP_005325710.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    242   5e-71    
gb|EIW09934.1|  Ths1p                                                   241   5e-71    Saccharomyces cerevisiae CEN.PK113-7D
gb|EFB17446.1|  hypothetical protein PANDA_008118                       241   5e-71    Ailuropoda melanoleuca
gb|AJR45798.1|  Ths1p                                                   241   5e-71    Saccharomyces cerevisiae YJM1307
gb|AJR38945.1|  Ths1p                                                   241   5e-71    Saccharomyces cerevisiae YJM453
gb|EEU08659.1|  Ths1p                                                   241   5e-71    Saccharomyces cerevisiae JAY291
gb|EHN06623.1|  Ths1p                                                   241   6e-71    Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|AJR37072.1|  Ths1p                                                   241   6e-71    Saccharomyces cerevisiae YJM195
gb|AJR53093.1|  Ths1p                                                   241   6e-71    Saccharomyces cerevisiae YJM1549
ref|NP_116578.3|  threonine--tRNA ligase THS1                           241   6e-71    Saccharomyces cerevisiae S288C
emb|CAA26666.1|  unnamed protein product                                241   6e-71    Saccharomyces cerevisiae [brewer's yeast]
ref|XP_005320129.1|  PREDICTED: probable threonine--tRNA ligase 2...    241   6e-71    
ref|XP_001513531.2|  PREDICTED: probable threonine--tRNA ligase 2...    241   6e-71    
gb|EDN61420.1|  threonyl-tRNA synthetase                                241   6e-71    Saccharomyces cerevisiae YJM789
ref|XP_010168916.1|  PREDICTED: probable threonine--tRNA ligase 2...    233   6e-71    Antrostomus carolinensis
gb|AJR47138.1|  Ths1p                                                   241   6e-71    Saccharomyces cerevisiae YJM1342
dbj|BAG59361.1|  unnamed protein product                                239   6e-71    Homo sapiens [man]
ref|XP_004385288.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    239   6e-71    
gb|EGA78432.1|  Ths1p                                                   241   7e-71    Saccharomyces cerevisiae Vin13
ref|XP_004698143.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     240   7e-71    Echinops telfairi [lesser hedgehog tenrec]
emb|CDQ73765.1|  unnamed protein product                                228   7e-71    Oncorhynchus mykiss
gb|ELK31735.1|  Threonyl-tRNA synthetase, cytoplasmic                   239   8e-71    Myotis davidii
ref|XP_004059036.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    240   8e-71    
ref|XP_009163294.1|  hypothetical protein T265_01087                    241   8e-71    Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_006875437.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    241   8e-71    Chrysochloris asiatica
ref|XP_008690887.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     241   9e-71    Ursus maritimus [white bear]
ref|XP_011264915.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    241   9e-71    Camponotus floridanus
ref|XP_005694881.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     241   9e-71    
gb|EAX10803.1|  threonyl-tRNA synthetase, isoform CRA_a                 239   9e-71    Homo sapiens [man]
ref|XP_002919483.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     241   9e-71    Ailuropoda melanoleuca
ref|XP_004678135.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     241   9e-71    Condylura cristata
ref|XP_004325399.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    239   9e-71    
ref|XP_006148565.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     241   9e-71    Tupaia chinensis
gb|EHN01906.1|  Ths1p                                                   241   1e-70    Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|EDL07239.1|  threonyl-tRNA synthetase-like 2, isoform CRA_b          237   1e-70    Mus musculus [mouse]
ref|XP_004349666.1|  threonine-tRNA ligase                              240   1e-70    Acanthamoeba castellanii str. Neff
ref|XP_006996688.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     241   1e-70    Peromyscus maniculatus bairdii
ref|XP_004385287.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    238   1e-70    
ref|XP_006199708.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    240   1e-70    
ref|XP_002014541.1|  GL19239                                            241   1e-70    Drosophila persimilis
ref|XP_004412948.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     241   1e-70    Odobenus rosmarus divergens
ref|XP_008472446.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     237   1e-70    
ref|XP_004623299.1|  PREDICTED: LOW QUALITY PROTEIN: probable thr...    241   1e-70    
ref|XP_003703597.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    240   1e-70    
dbj|BAG53144.1|  unnamed protein product                                238   1e-70    Homo sapiens [man]
ref|XP_007959499.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    240   1e-70    Chlorocebus sabaeus
ref|XP_011192187.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    241   1e-70    
ref|XP_009812579.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    231   1e-70    Gavia stellata
ref|XP_009206493.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    239   1e-70    Papio anubis [baboon]
ref|XP_003274971.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    240   1e-70    
ref|XP_005556717.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    240   2e-70    Macaca fascicularis [crab eating macaque]
ref|XP_011290653.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    240   2e-70    Musca domestica
ref|XP_005983077.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    238   2e-70    Pantholops hodgsonii [Tibetan antelope]
gb|EHH61622.1|  Putative threonyl-tRNA synthetase 2, cytoplasmic        235   2e-70    Macaca fascicularis [crab eating macaque]
ref|XP_006761862.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     240   2e-70    
emb|CBK21096.2|  unnamed protein product                                241   2e-70    
ref|XP_009447608.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    239   2e-70    
ref|NP_001006977.1|  threonine--tRNA ligase, cytoplasmic                239   2e-70    
ref|XP_008046647.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     240   2e-70    
ref|XP_005320128.1|  PREDICTED: probable threonine--tRNA ligase 2...    241   2e-70    
ref|XP_004879581.1|  PREDICTED: probable threonine--tRNA ligase 2...    239   2e-70    
ref|XP_008833678.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     240   2e-70    
ref|XP_005178933.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    239   2e-70    
ref|XP_004059034.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    240   2e-70    
dbj|GAA47460.1|  threonyl-tRNA synthetase                               240   2e-70    
ref|NP_983365.1|  ACL039Wp                                              240   2e-70    
ref|XP_007959500.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    240   2e-70    
ref|XP_006090155.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     239   2e-70    
ref|XP_005872671.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     239   2e-70    
ref|XP_006232130.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    239   2e-70    
ref|XP_005556716.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    240   2e-70    
ref|XP_005320127.1|  PREDICTED: probable threonine--tRNA ligase 2...    241   2e-70    
gb|EHH54185.1|  hypothetical protein EGM_14968                          240   3e-70    
ref|XP_006003382.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    237   3e-70    
ref|XP_004088250.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     240   3e-70    
gb|EHH26432.1|  hypothetical protein EGK_16408                          240   3e-70    
ref|XP_008153034.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    239   3e-70    
ref|NP_001029542.1|  threonine--tRNA ligase, cytoplasmic                239   3e-70    
ref|XP_008990455.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    238   3e-70    
ref|XP_005178932.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    240   3e-70    
ref|XP_006612937.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    239   3e-70    
ref|XP_008153032.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    239   3e-70    
ref|XP_010586388.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    239   3e-70    
ref|XP_006612938.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    239   4e-70    
ref|XP_003688670.1|  hypothetical protein TPHA_0P00780                  239   4e-70    
ref|XP_004059035.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    239   4e-70    
ref|XP_003899597.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    239   4e-70    
ref|XP_007466902.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    237   4e-70    
gb|AAH10578.2|  Threonyl-tRNA synthetase                                239   4e-70    
ref|NP_689508.3|  threonine--tRNA ligase, cytoplasmic isoform 1         239   4e-70    
dbj|BAD96524.1|  threonyl-tRNA synthetase variant                       239   4e-70    
gb|AIC63184.1|  TARS                                                    239   4e-70    
gb|ABM82342.1|  threonyl-tRNA synthetase                                239   4e-70    
ref|XP_007097493.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     239   4e-70    
gb|EPQ11689.1|  Threonyl-tRNA synthetase, cytoplasmic                   239   4e-70    
ref|XP_010852134.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    239   5e-70    
ref|XP_005887778.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    239   5e-70    
ref|XP_001153971.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    239   5e-70    
ref|XP_007192302.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     239   5e-70    
ref|XP_008847768.1|  PREDICTED: probable threonine--tRNA ligase 2...    240   5e-70    
ref|XP_003936261.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     239   5e-70    
ref|XP_004017114.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     239   5e-70    
ref|XP_004583694.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     238   5e-70    
ref|XP_004385286.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    239   5e-70    
ref|XP_005983076.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    239   6e-70    
gb|EJW79603.1|  hypothetical protein WUBG_09488                         229   6e-70    
dbj|BAO41767.1|  threonyl-tRNA synthetase                               239   6e-70    
ref|XP_001498225.2|  PREDICTED: threonine--tRNA ligase, cytoplasmic     239   6e-70    
ref|XP_005356692.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     239   6e-70    
ref|XP_010354694.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     239   6e-70    
ref|XP_003691478.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    238   6e-70    
gb|KFQ16963.1|  putative threonine--tRNA ligase 2, cytoplasmic          238   6e-70    
ref|XP_003793022.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     238   7e-70    
ref|XP_002069231.1|  GK21088                                            238   7e-70    
ref|XP_009927442.1|  PREDICTED: LOW QUALITY PROTEIN: probable thr...    231   7e-70    
ref|XP_009206495.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    239   7e-70    
ref|XP_003667634.1|  hypothetical protein NDAI_0A02330                  238   8e-70    
ref|XP_009695024.1|  PREDICTED: probable threonine--tRNA ligase 2...    236   8e-70    
ref|XP_003683234.1|  hypothetical protein TDEL_0H01640                  238   8e-70    
ref|XP_006020081.1|  PREDICTED: probable threonine--tRNA ligase 2...    238   8e-70    
emb|CDK25861.1|  unnamed protein product                                238   8e-70    
ref|NP_001245367.1|  threonine--tRNA ligase, cytoplasmic isoform 2      239   8e-70    
ref|XP_006118795.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    237   8e-70    
gb|KFD69339.1|  hypothetical protein M514_10343                         245   8e-70    
gb|KFD48788.1|  hypothetical protein M513_10343                         245   8e-70    
ref|XP_008561545.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    234   9e-70    
gb|AAH55371.1|  Threonyl-tRNA synthetase                                238   9e-70    
gb|AGO11222.1|  AaceriACL039Wp                                          238   9e-70    
gb|EFA85860.1|  threonyl-tRNA synthetase                                238   9e-70    
dbj|BAB26799.1|  unnamed protein product                                238   9e-70    
ref|NP_149065.2|  threonine--tRNA ligase, cytoplasmic                   238   9e-70    
ref|XP_003760006.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     240   9e-70    
ref|XP_010166514.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     232   9e-70    
ref|XP_003981521.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     238   1e-69    
ref|XP_011158574.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    238   1e-69    
gb|AJR38174.1|  Ths1p                                                   238   1e-69    
ref|XP_005381767.1|  PREDICTED: probable threonine--tRNA ligase 2...    239   1e-69    
ref|XP_004266073.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     236   1e-69    
ref|XP_006268868.1|  PREDICTED: probable threonine--tRNA ligase 2...    238   1e-69    
ref|XP_002745122.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    238   1e-69    
ref|XP_007535845.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     238   1e-69    
ref|XP_004852723.1|  PREDICTED: probable threonine--tRNA ligase 2...    239   1e-69    
ref|XP_010598480.1|  PREDICTED: probable threonine--tRNA ligase 2...    238   1e-69    
ref|XP_004852724.1|  PREDICTED: probable threonine--tRNA ligase 2...    239   1e-69    
gb|EFZ18882.1|  hypothetical protein SINV_16250                         239   1e-69    
gb|KFV63505.1|  putative threonine--tRNA ligase 2, cytoplasmic          237   1e-69    
gb|KFP63323.1|  putative threonine--tRNA ligase 2, cytoplasmic          237   1e-69    
ref|XP_011158573.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    238   1e-69    
ref|XP_001845897.1|  threonyl-tRNA synthetase                           237   1e-69    
ref|XP_008685800.1|  PREDICTED: probable threonine--tRNA ligase 2...    236   1e-69    
ref|XP_008685799.1|  PREDICTED: probable threonine--tRNA ligase 2...    237   1e-69    
ref|XP_536509.3|  PREDICTED: threonine--tRNA ligase, cytoplasmic        238   1e-69    
ref|XP_002116349.1|  hypothetical protein TRIADDRAFT_50865              237   1e-69    
ref|XP_008561546.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    234   2e-69    
ref|XP_004431940.1|  PREDICTED: probable threonine--tRNA ligase 2...    237   2e-69    
gb|KFQ42737.1|  putative threonine--tRNA ligase 2, cytoplasmic          236   2e-69    
dbj|BAE31895.1|  unnamed protein product                                237   2e-69    
ref|XP_010014179.1|  PREDICTED: probable threonine--tRNA ligase 2...    237   2e-69    
gb|EKC29157.1|  Threonyl-tRNA synthetase, cytoplasmic                   227   2e-69    
ref|XP_007466903.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    237   2e-69    
ref|XP_007440622.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    235   2e-69    
gb|KFV55276.1|  Threonine--tRNA ligase, cytoplasmic                     229   2e-69    
ref|XP_006559720.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    237   2e-69    
ref|XP_006559719.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    237   2e-69    
dbj|BAG38072.1|  unnamed protein product                                237   2e-69    
gb|KFP03020.1|  putative threonine--tRNA ligase 2, cytoplasmic          236   2e-69    
ref|XP_005357852.1|  PREDICTED: probable threonine--tRNA ligase 2...    238   2e-69    
ref|XP_005357853.1|  PREDICTED: probable threonine--tRNA ligase 2...    238   2e-69    
ref|XP_008494852.1|  PREDICTED: probable threonine--tRNA ligase 2...    236   2e-69    
ref|XP_008942445.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    238   2e-69    
ref|XP_007872125.1|  hypothetical protein PNEG_00254                    236   2e-69    
gb|EDM08409.1|  threonyl-tRNA synthetase-like 2, isoform CRA_b          237   2e-69    
ref|XP_007855570.1|  threonyl-trna synthetase                           237   2e-69    
dbj|BAB71554.1|  unnamed protein product                                230   2e-69    
ref|XP_010636533.1|  PREDICTED: probable threonine--tRNA ligase 2...    238   3e-69    
ref|XP_007954753.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     237   3e-69    
ref|XP_010148223.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     232   3e-69    
ref|XP_006136948.1|  PREDICTED: probable threonine--tRNA ligase 2...    237   3e-69    
emb|CCK69517.1|  hypothetical protein KNAG_0C04150                      237   3e-69    
gb|AAH39225.1|  Threonyl-tRNA synthetase-like 2                         238   3e-69    
ref|XP_008685798.1|  PREDICTED: probable threonine--tRNA ligase 2...    236   3e-69    
ref|XP_008554535.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    236   3e-69    
ref|NP_758514.2|  probable threonine--tRNA ligase 2, cytoplasmic        238   3e-69    
gb|AAH74887.1|  TARSL2 protein                                          230   3e-69    
ref|XP_006162810.1|  PREDICTED: probable threonine--tRNA ligase 2...    238   3e-69    
ref|XP_003133916.3|  PREDICTED: threonine--tRNA ligase, cytoplasm...    236   3e-69    
ref|XP_002195014.2|  PREDICTED: probable threonine--tRNA ligase 2...    236   4e-69    
ref|XP_009044100.1|  hypothetical protein LOTGIDRAFT_103202             236   4e-69    
ref|XP_004738119.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     236   4e-69    
ref|XP_009291630.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    233   4e-69    
gb|EMP39003.1|  Putative threonyl-tRNA synthetase 2, cytoplasmic        230   4e-69    
gb|ELV13451.1|  putative threonyl-tRNA synthetase 2, cytoplasmic        238   4e-69    
ref|XP_009909554.1|  PREDICTED: probable threonine--tRNA ligase 2...    237   4e-69    
ref|XP_008554533.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    236   4e-69    
ref|XP_010141938.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     235   5e-69    
gb|KFQ99509.1|  putative threonine--tRNA ligase 2, cytoplasmic          235   5e-69    
ref|XP_003978376.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    236   5e-69    
ref|XP_002432585.1|  Threonyl-tRNA synthetase, cytoplasmic, putative    236   5e-69    
ref|XP_001491149.3|  PREDICTED: probable threonine--tRNA ligase 2...    237   5e-69    
ref|XP_004431939.1|  PREDICTED: probable threonine--tRNA ligase 2...    237   5e-69    
gb|AAH69346.1|  TARSL2 protein                                          230   5e-69    
ref|XP_007095949.1|  PREDICTED: probable threonine--tRNA ligase 2...    237   6e-69    
ref|XP_007638354.1|  PREDICTED: probable threonine--tRNA ligase 2...    236   6e-69    
ref|XP_008286368.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     236   6e-69    
ref|XP_005521510.1|  PREDICTED: probable threonine--tRNA ligase 2...    237   6e-69    
gb|EPQ10677.1|  Putative threonyl-tRNA synthetase 2, cytoplasmic        233   6e-69    
ref|XP_008120289.1|  PREDICTED: LOW QUALITY PROTEIN: probable thr...    237   6e-69    
gb|EHH27645.1|  Putative threonyl-tRNA synthetase 2, cytoplasmic        236   6e-69    
gb|KFO94418.1|  Threonine--tRNA ligase, cytoplasmic                     235   6e-69    
ref|XP_003648097.1|  hypothetical protein Ecym_7461                     236   6e-69    
gb|KFV92314.1|  putative threonine--tRNA ligase 2, cytoplasmic          235   6e-69    
ref|XP_011055937.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    236   6e-69    
ref|XP_004894553.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     236   6e-69    
ref|XP_007487558.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     236   6e-69    
ref|XP_007630822.1|  PREDICTED: probable threonine--tRNA ligase 2...    236   7e-69    
ref|XP_009576132.1|  PREDICTED: probable threonine--tRNA ligase 2...    236   7e-69    
ref|XP_007120316.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    236   7e-69    
ref|XP_004605618.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     236   7e-69    
gb|EDM08408.1|  threonyl-tRNA synthetase-like 2, isoform CRA_a          237   7e-69    
ref|XP_007056480.1|  PREDICTED: probable threonine--tRNA ligase 2...    236   7e-69    
ref|XP_009934283.1|  PREDICTED: probable threonine--tRNA ligase 2...    236   7e-69    
gb|KFP47497.1|  putative threonine--tRNA ligase 2, cytoplasmic          235   7e-69    
gb|KFP70847.1|  putative threonine--tRNA ligase 2, cytoplasmic          235   8e-69    
ref|XP_536172.2|  PREDICTED: probable threonine--tRNA ligase 2, c...    237   8e-69    
ref|XP_455348.1|  hypothetical protein                                  236   8e-69    
ref|XP_009076978.1|  PREDICTED: probable threonine--tRNA ligase 2...    235   8e-69    
ref|XP_007988793.1|  PREDICTED: probable threonine--tRNA ligase 2...    235   9e-69    
ref|XP_007375178.1|  hypothetical protein SPAPADRAFT_61003              235   9e-69    
gb|KFO53391.1|  putative threonine--tRNA ligase 2, cytoplasmic          234   9e-69    
ref|XP_010224537.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     236   9e-69    
ref|XP_003738717.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    235   9e-69    
ref|XP_004413033.1|  PREDICTED: probable threonine--tRNA ligase 2...    236   9e-69    
gb|KDR13507.1|  Threonyl-tRNA synthetase, cytoplasmic                   236   9e-69    
ref|XP_011055929.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    235   1e-68    
gb|KFZ50404.1|  Threonine--tRNA ligase, cytoplasmic                     229   1e-68    
emb|CEJ02300.1|  Putative Threonyl-tRNA synthetase                      223   1e-68    
ref|XP_004693013.1|  PREDICTED: probable threonine--tRNA ligase 2...    236   1e-68    
ref|XP_007557945.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    235   1e-68    
ref|XP_008051015.1|  PREDICTED: probable threonine--tRNA ligase 2...    232   1e-68    
ref|XP_006975908.1|  PREDICTED: probable threonine--tRNA ligase 2...    236   1e-68    
gb|KFV95622.1|  putative threonine--tRNA ligase 2, cytoplasmic          234   1e-68    
gb|AAH90718.1|  Zgc:92586 protein                                       227   1e-68    
ref|XP_010187513.1|  PREDICTED: probable threonine--tRNA ligase 2...    232   1e-68    
ref|XP_007557944.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    235   1e-68    
ref|XP_004413032.1|  PREDICTED: probable threonine--tRNA ligase 2...    236   1e-68    
ref|XP_004652577.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     235   1e-68    
ref|XP_006674966.1|  hypothetical protein BATDEDRAFT_8061               233   1e-68    
ref|XP_011230585.1|  PREDICTED: probable threonine--tRNA ligase 2...    236   1e-68    
emb|CDO95602.1|  unnamed protein product                                235   1e-68    
gb|KFU87220.1|  putative threonine--tRNA ligase 2, cytoplasmic          234   1e-68    
gb|KFM08256.1|  putative threonine--tRNA ligase 2, cytoplasmic          234   1e-68    
gb|KGL77238.1|  putative threonine--tRNA ligase 2, cytoplasmic          234   1e-68    
gb|KGL73538.1|  Threonine--tRNA ligase, cytoplasmic                     234   1e-68    
gb|EHB09296.1|  Threonyl-tRNA synthetase, cytoplasmic                   236   1e-68    
gb|KFO72069.1|  putative threonine--tRNA ligase 2, cytoplasmic          234   1e-68    
ref|XP_006790079.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    235   1e-68    
ref|XP_010007069.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     233   1e-68    
gb|ERE78099.1|  putative threonyl-tRNA synthetase 2, cytoplasmic        236   1e-68    
ref|XP_011281034.1|  PREDICTED: probable threonine--tRNA ligase 2...    236   1e-68    
ref|XP_005924563.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    235   1e-68    
ref|XP_008636148.1|  PREDICTED: probable threonine--tRNA ligase 2...    235   2e-68    
ref|XP_004546989.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    235   2e-68    
ref|XP_009679777.1|  PREDICTED: probable threonine--tRNA ligase 2...    231   2e-68    
ref|XP_005560684.1|  PREDICTED: probable threonine--tRNA ligase 2...    236   2e-68    
ref|XP_005285035.1|  PREDICTED: probable threonine--tRNA ligase 2...    236   2e-68    
ref|XP_005560685.1|  PREDICTED: probable threonine--tRNA ligase 2...    236   2e-68    
ref|XP_011281033.1|  PREDICTED: probable threonine--tRNA ligase 2...    236   2e-68    
gb|EJK67362.1|  hypothetical protein THAOC_11616                        234   2e-68    
ref|XP_010606023.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    234   2e-68    
ref|XP_005094375.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    234   2e-68    
ref|XP_005094376.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    234   2e-68    
dbj|BAC27235.1|  unnamed protein product                                234   2e-68    
ref|XP_008051014.1|  PREDICTED: probable threonine--tRNA ligase 2...    232   2e-68    
ref|XP_003976334.1|  PREDICTED: probable threonine--tRNA ligase 2...    236   2e-68    
ref|XP_005459862.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    234   2e-68    



>ref|XP_006355233.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Solanum 
tuberosum]
Length=676

 Score =   383 bits (983),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W KAEAAL++ALNE GKPWEINEGDGAFYGPKIDISV DAMKRKFQCATLQLDFQLPQR
Sbjct  472  TWVKAEAALSEALNEHGKPWEINEGDGAFYGPKIDISVSDAMKRKFQCATLQLDFQLPQR  531

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS
Sbjct  532  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  591

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q+Y ++LR++IH+AG++VDVDTSDRTIQKKVREAQVAQYNYILVVGE EAT+G+VSVRVR
Sbjct  592  QSYALKLREQIHDAGYYVDVDTSDRTIQKKVREAQVAQYNYILVVGEAEATSGQVSVRVR  651

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D PDH+VMTVD LLAHFKD++AS++
Sbjct  652  DKPDHQVMTVDVLLAHFKDMVASFQ  676



>ref|XP_004246064.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Solanum 
lycopersicum]
Length=676

 Score =   379 bits (973),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W KAEAAL++ALNE GKPWEINEGDGAFYGPKIDISV DAMKRKFQCATLQLDFQLPQR
Sbjct  472  TWVKAEAALSEALNEHGKPWEINEGDGAFYGPKIDISVSDAMKRKFQCATLQLDFQLPQR  531

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS
Sbjct  532  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  591

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q+Y ++LR++IH+AG++VDVDTSDRTIQKKVREAQVAQYNYILVVGE EA++G+VSVRVR
Sbjct  592  QSYALKLREQIHDAGYYVDVDTSDRTIQKKVREAQVAQYNYILVVGEAEASSGQVSVRVR  651

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D PDH+VMTVD LLA FKD++AS++
Sbjct  652  DKPDHQVMTVDVLLAQFKDMVASFQ  676



>ref|XP_009622103.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Nicotiana tomentosiformis]
Length=721

 Score =   376 bits (965),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/205 (85%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            SW KAE +L +AL+EFGKPWE NEGDGAFYGPKIDISV DAM+RKFQCATLQLDFQLPQR
Sbjct  517  SWNKAEDSLAEALDEFGKPWEKNEGDGAFYGPKIDISVSDAMRRKFQCATLQLDFQLPQR  576

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNLSYSAEDE+KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS
Sbjct  577  FNLSYSAEDENKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  636

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q+Y +ELR+RIH+AG++VDVDTSDRTIQKKVREAQVAQYNYILVVGE EA++ +VSVRVR
Sbjct  637  QSYALELRERIHDAGYYVDVDTSDRTIQKKVREAQVAQYNYILVVGEAEASSRQVSVRVR  696

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D PDH+VMTVD+LL HFKD++AS++
Sbjct  697  DKPDHQVMTVDDLLGHFKDMVASFQ  721



>ref|XP_009794575.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Nicotiana sylvestris]
Length=725

 Score =   374 bits (961),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 175/205 (85%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            SW KAE AL +AL+EFGKPWE NEGDGAFYGPKIDISV DAM+RKFQCATLQLDFQLPQR
Sbjct  521  SWNKAEDALAEALDEFGKPWEKNEGDGAFYGPKIDISVSDAMRRKFQCATLQLDFQLPQR  580

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNL+YSAEDE+KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS
Sbjct  581  FNLAYSAEDENKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  640

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q+Y +ELR+RIH+AG++VDVDTSDRTIQKKVREAQVAQYNYILVVGE EA++ +VSVRVR
Sbjct  641  QSYALELRERIHDAGYYVDVDTSDRTIQKKVREAQVAQYNYILVVGEAEASSRQVSVRVR  700

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D PDH+VMTV +LLAHFKD++AS++
Sbjct  701  DKPDHQVMTVGDLLAHFKDMVASFQ  725



>ref|XP_004170956.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Cucumis 
sativus]
Length=305

 Score =   352 bits (903),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAEAALT+ALNEFGKPW+I+EGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP R
Sbjct  101  TWEKAEAALTEALNEFGKPWQIDEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPAR  160

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L YSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  161  FELYYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  220

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q+Y +++RD IH AG+ VDVD +DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVR
Sbjct  221  QSYALKVRDLIHHAGYFVDVDVTDRKIQKKVREAQLAQYNYILVVGEEEANTGQVSVRVR  280

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  DH VM+++ LL HFK+ +A++
Sbjct  281  DKADHSVMSIESLLNHFKEEVAAF  304



>ref|XP_006355966.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Solanum 
tuberosum]
Length=725

 Score =   365 bits (938),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            SWEKAEAAL +ALNEFGKPWEINEGDGAFYGPKIDI+V DAMKRKFQCATLQLDFQLPQR
Sbjct  521  SWEKAEAALAEALNEFGKPWEINEGDGAFYGPKIDITVSDAMKRKFQCATLQLDFQLPQR  580

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS
Sbjct  581  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  640

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             +Y  ELR+RIH+AG++VDVDTSDRTIQKKVREAQ+AQYNYILVVGE E ++G+VSVRVR
Sbjct  641  LSYAFELRERIHDAGYYVDVDTSDRTIQKKVREAQMAQYNYILVVGEAEVSSGQVSVRVR  700

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
              PDH+VMTVD LL HFKDL+AS++
Sbjct  701  SKPDHEVMTVDGLLTHFKDLVASFQ  725



>gb|KGN49712.1| hypothetical protein Csa_5G080780 [Cucumis sativus]
Length=321

 Score =   351 bits (901),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAEAALT+ALNEFGKPW+I+EGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP R
Sbjct  117  TWEKAEAALTEALNEFGKPWQIDEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPAR  176

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L YSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  177  FELYYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  236

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q+Y +++RD IH AG+ VDVD +DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVR
Sbjct  237  QSYALKVRDLIHHAGYFVDVDVTDRKIQKKVREAQLAQYNYILVVGEEEANTGQVSVRVR  296

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  DH VM+++ LL HFK+ +A++
Sbjct  297  DKADHSVMSIESLLNHFKEEVAAF  320



>ref|XP_004238685.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Solanum 
lycopersicum]
Length=725

 Score =   364 bits (934),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            SWEKAEAAL +ALNEFGKPWEINEGDGAFYGPKIDI+V DAMKRKFQCATLQLDFQLPQR
Sbjct  521  SWEKAEAALAEALNEFGKPWEINEGDGAFYGPKIDITVSDAMKRKFQCATLQLDFQLPQR  580

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS
Sbjct  581  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  640

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             +Y  ELR+RIH+AG++VDVDTSDRTIQKKVREAQ+AQYNYILVVGE EA++G+VSVRVR
Sbjct  641  LSYAFELRERIHDAGYYVDVDTSDRTIQKKVREAQMAQYNYILVVGEAEASSGQVSVRVR  700

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
               DH+VMTVD LL HFKDL+AS++
Sbjct  701  SKSDHEVMTVDGLLTHFKDLVASFQ  725



>gb|KDO82534.1| hypothetical protein CISIN_1g0066801mg, partial [Citrus sinensis]
Length=291

 Score =   350 bits (897),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAEAALT+ALNEFGKPW+INEGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP R
Sbjct  87   TWEKAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPDR  146

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNL YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  147  FNLGYSAEDEAKTERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  206

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q Y +++RD I+ AG++VDVDT+DR IQKKVREAQ+AQYN+ILVVGE+EA +G+VSVRVR
Sbjct  207  QPYALQVRDHIYRAGYYVDVDTTDRKIQKKVREAQLAQYNFILVVGEEEAKSGQVSVRVR  266

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  DH  M++++LL HFK+ + +++
Sbjct  267  DQGDHSNMSIEDLLKHFKEKLEAFQ  291



>ref|XP_010274327.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X1 [Nelumbo nucifera]
Length=729

 Score =   363 bits (931),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAEAALT+ALNEFGKPW+INEGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP R
Sbjct  525  TWEKAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVFDALKRKFQCATLQLDFQLPSR  584

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNLSYSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  585  FNLSYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAVVCPVSEKS  644

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q Y +++RD+IH+AG++VDVDT+DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVR
Sbjct  645  QPYALQVRDQIHQAGYYVDVDTTDRKIQKKVREAQLAQYNYILVVGEEEANTGQVSVRVR  704

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  DH V +++ELL HFK+ +A++
Sbjct  705  DKSDHSVKSIEELLTHFKEEVAAF  728



>ref|XP_006438443.1| hypothetical protein CICLE_v100308251mg, partial [Citrus clementina]
 gb|ESR51683.1| hypothetical protein CICLE_v100308251mg, partial [Citrus clementina]
Length=315

 Score =   348 bits (894),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAEAALT+ALNEFGKPW+INEGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP R
Sbjct  111  TWEKAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPDR  170

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNL YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  171  FNLGYSAEDEAKTERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  230

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q Y +++RD I+ AG++VDVDT+DR IQKKVREAQ+AQYN+ILVVGE+EA +G+VSVRVR
Sbjct  231  QPYALQVRDHIYRAGYYVDVDTTDRKIQKKVREAQLAQYNFILVVGEEEAKSGQVSVRVR  290

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  DH  M++++LL HFK+ + +++
Sbjct  291  DQGDHSNMSIEDLLKHFKEKLEAFQ  315



>ref|XP_010272819.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Nelumbo 
nucifera]
Length=726

 Score =   360 bits (924),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAEAALT+ALNEFGKPW+INEGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP R
Sbjct  522  TWEKAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVFDALKRKFQCATLQLDFQLPSR  581

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNLSYSAEDE+KRE+PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  582  FNLSYSAEDEAKREKPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  641

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q Y +++RD+IH+AG++VDVDT+DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVR
Sbjct  642  QPYALQVRDQIHQAGYYVDVDTTDRKIQKKVREAQLAQYNYILVVGEEEANTGQVSVRVR  701

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  DH V ++ +LL HFK+ +A+++
Sbjct  702  DKADHSVKSIQDLLTHFKEEVAAFR  726



>gb|EPS72288.1| hypothetical protein M569_02470 [Genlisea aurea]
Length=690

 Score =   358 bits (919),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 189/205 (92%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAEAAL DALNEFGKPWEINE DGAFYGPKIDISV DAMKRKFQCATLQLDFQLP R
Sbjct  486  TWEKAEAALADALNEFGKPWEINEADGAFYGPKIDISVSDAMKRKFQCATLQLDFQLPAR  545

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNLSYSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVSDKS
Sbjct  546  FNLSYSAEDETKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSDKS  605

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q+Y +E+++RIH+AG++VDVDT+DRTI KKVREAQVAQYNYILVVGEKE  TG+V+VRVR
Sbjct  606  QSYALEVKNRIHDAGYYVDVDTTDRTINKKVREAQVAQYNYILVVGEKEVGTGQVAVRVR  665

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  D  +M++D+LL  FK  +A+++
Sbjct  666  DNSDTNLMSIDDLLNRFKSEVAAHR  690



>ref|XP_011076219.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Sesamum indicum]
Length=722

 Score =   358 bits (920),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            SWE+AEAAL DALNEFGKPWEINEGDGAFYGPKIDISV DAM+RKFQCATLQLDFQLP R
Sbjct  518  SWERAEAALADALNEFGKPWEINEGDGAFYGPKIDISVSDAMRRKFQCATLQLDFQLPAR  577

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNLSYSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVSDKS
Sbjct  578  FNLSYSAEDETKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSDKS  637

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             +Y +++RDRIH+AGF+VDVDT+DRTI KKVREAQ+AQYNYILVVGEKE  TG+V+VRVR
Sbjct  638  HSYALQVRDRIHDAGFYVDVDTTDRTINKKVREAQLAQYNYILVVGEKEVGTGQVAVRVR  697

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  D  + ++D+LL +FKD +A+++
Sbjct  698  DNFDANLKSIDDLLNYFKDEVAAFR  722



>ref|XP_008460557.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Cucumis melo]
Length=724

 Score =   352 bits (904),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAEAALT+ALNEFGKPW+I+EGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP R
Sbjct  520  TWEKAEAALTEALNEFGKPWQIDEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPTR  579

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L YSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  580  FELYYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  639

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q+Y M++RD IH AG+ VDVD +DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVR
Sbjct  640  QSYAMKVRDLIHHAGYFVDVDVTDRKIQKKVREAQLAQYNYILVVGEEEANTGQVSVRVR  699

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  DH VM+V+ LL HFK+ +A++
Sbjct  700  DKADHSVMSVESLLNHFKEEVAAF  723



>gb|ADE77216.1| unknown [Picea sitchensis]
Length=215

 Score =   335 bits (860),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W++AEAALT+ALN FGKPW+INEGDGAFYGPKIDI+V DA+KRKFQCAT+QLDFQLP R
Sbjct  11   TWQRAEAALTEALNAFGKPWQINEGDGAFYGPKIDITVFDALKRKFQCATIQLDFQLPIR  70

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F+LSYS EDE+KRERPVMIHRAILGSVERM AILLEH+ GKWPFWLSPRQA+VCPVS+KS
Sbjct  71   FDLSYSTEDEAKRERPVMIHRAILGSVERMLAILLEHYAGKWPFWLSPRQAIVCPVSEKS  130

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              Y + +RD+IH+AG++VDVDTSDR IQKK+REAQ+AQYNYILVVGE+EA TG+VSVR+R
Sbjct  131  SDYALRVRDQIHQAGYYVDVDTSDRKIQKKIREAQLAQYNYILVVGEEEANTGQVSVRIR  190

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D   H+V ++DELL  F++ + ++
Sbjct  191  DKSAHEVRSMDELLKLFREEIEAF  214



>emb|CDP00192.1| unnamed protein product [Coffea canephora]
Length=727

 Score =   352 bits (902),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAEAAL +ALNEFGKPW+INEGDGAFYGPKIDISV DAM+R+FQCATLQLDFQLP R
Sbjct  523  TWEKAEAALKEALNEFGKPWQINEGDGAFYGPKIDISVNDAMRRQFQCATLQLDFQLPSR  582

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNLSY+AEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  583  FNLSYTAEDENKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  642

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q Y ++LRD+IH+AG++VDVD +DRTIQKKVREAQVAQYNYILVVGE+EA TG+VSVRVR
Sbjct  643  QPYALKLRDQIHDAGYYVDVDATDRTIQKKVREAQVAQYNYILVVGEEEAKTGQVSVRVR  702

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D   H V +V+ELL+  K+ +A+++
Sbjct  703  DKASHSVKSVEELLSDLKNEVAAFR  727



>ref|XP_004142299.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Cucumis 
sativus]
Length=724

 Score =   351 bits (900),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAEAALT+ALNEFGKPW+I+EGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP R
Sbjct  520  TWEKAEAALTEALNEFGKPWQIDEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPAR  579

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L YSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  580  FELYYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  639

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q+Y +++RD IH AG+ VDVD +DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVR
Sbjct  640  QSYALKVRDLIHHAGYFVDVDVTDRKIQKKVREAQLAQYNYILVVGEEEANTGQVSVRVR  699

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  DH VM+++ LL HFK+ +A++
Sbjct  700  DKADHSVMSIESLLNHFKEEVAAF  723



>gb|EYU25062.1| hypothetical protein MIMGU_mgv1a002240mg [Erythranthe guttata]
Length=696

 Score =   350 bits (897),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/205 (79%), Positives = 186/205 (91%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAEAAL +ALNEFGKPW+INE DGAFYGPKIDI+V DAM R FQCATLQLDFQLP R
Sbjct  492  TWDKAEAALEEALNEFGKPWKINEADGAFYGPKIDITVFDAMGRDFQCATLQLDFQLPAR  551

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNLSYSAEDE+KRERPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  552  FNLSYSAEDETKRERPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  611

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q Y +E+RDRIH+AGF+VDVDT+DRTI KKVREAQ+AQYNYILVVGEKE  TG+V+VRVR
Sbjct  612  QQYALEVRDRIHDAGFYVDVDTTDRTINKKVREAQMAQYNYILVVGEKEVGTGQVAVRVR  671

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            DI D  + ++D++L  FKD  AS+K
Sbjct  672  DINDANLQSIDDVLNRFKDETASFK  696



>ref|XP_010100498.1| Threonine--tRNA ligase [Morus notabilis]
 gb|EXB82632.1| Threonine--tRNA ligase [Morus notabilis]
Length=625

 Score =   347 bits (890),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAEAALT+ALNEFGKPW+INEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP R
Sbjct  421  TWEKAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATLQLDFQLPAR  480

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L YSAEDE+KRE PVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  481  FELYYSAEDEAKREAPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  540

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q+Y +++RD+IH+AG++VDVDT+DR IQKKVREAQ+AQYN+ILVVGE+EA TG+VSVR+R
Sbjct  541  QSYALKVRDQIHDAGYYVDVDTTDRKIQKKVREAQLAQYNFILVVGEEEANTGQVSVRLR  600

Query  163  DIPDHKVMTVDELLAHFK  110
            +  DH VM+++ELL HFK
Sbjct  601  NSYDHSVMSMEELLQHFK  618



>ref|XP_002265302.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Vitis vinifera]
 emb|CBI32119.3| unnamed protein product [Vitis vinifera]
Length=686

 Score =   348 bits (893),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAEAALT+AL++ GKPWEINEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP R
Sbjct  482  TWEKAEAALTEALDQSGKPWEINEGDGAFYGPKIDISVSDALSRKFQCATLQLDFQLPSR  541

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F+LSYSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  542  FDLSYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  601

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q Y +++RD+IH+AG++VDVDT+DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVR
Sbjct  602  QPYALKVRDQIHQAGYYVDVDTTDRKIQKKVREAQLAQYNYILVVGEEEANTGQVSVRVR  661

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  DH VM+++ LL+ FK  +A++
Sbjct  662  DKGDHSVMSMENLLSFFKSEIAAF  685



>ref|XP_006483810.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Citrus 
sinensis]
Length=718

 Score =   348 bits (892),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAEAALT+ALNEFGKPW+INEGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP R
Sbjct  514  TWEKAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPDR  573

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNL YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  574  FNLGYSAEDEAKTERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  633

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q Y +++RD I+ AG++VDVDT+DR IQKKVREAQ+AQYN+ILVVGE+EA +G+VSVRVR
Sbjct  634  QPYALQVRDHIYRAGYYVDVDTTDRKIQKKVREAQLAQYNFILVVGEEEAKSGQVSVRVR  693

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  DH  M++++LL HFK+ + +++
Sbjct  694  DQGDHSNMSIEDLLKHFKEKLEAFQ  718



>ref|XP_010644571.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Vitis 
vinifera]
 emb|CBI39735.3| unnamed protein product [Vitis vinifera]
Length=686

 Score =   346 bits (888),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAEAALT+ALN+ GKPWEINEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP R
Sbjct  482  TWEKAEAALTEALNQSGKPWEINEGDGAFYGPKIDISVSDALNRKFQCATLQLDFQLPSR  541

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F+LSYSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  542  FDLSYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  601

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q Y +++RD+IH+AG++VDVDT+DR IQKKVREAQ+AQYN+ILVVGE+EA T +VSVRVR
Sbjct  602  QPYALQVRDQIHQAGYYVDVDTTDRKIQKKVREAQLAQYNFILVVGEEEANTRQVSVRVR  661

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  DH VM+++ LL++FK   A++
Sbjct  662  DKGDHSVMSMENLLSYFKSETAAF  685



>ref|XP_003613276.1| Threonyl-tRNA synthetase [Medicago truncatula]
 gb|AES96234.1| threonyl-tRNA synthetase/threonine-tRNA ligase, putative [Medicago 
truncatula]
Length=711

 Score =   347 bits (889),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 184/199 (92%), Gaps = 0/199 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAEA+L +AL+EFGKPW++NEGDGAFYGPKIDISV DA++RKFQCATLQLDFQLP R
Sbjct  507  TWEKAEASLKEALDEFGKPWQLNEGDGAFYGPKIDISVSDALRRKFQCATLQLDFQLPDR  566

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L +SAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA++CPVS+KS
Sbjct  567  FKLEFSAEDEAKIERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAILCPVSEKS  626

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            QAY +++RD+IH+AG+HVD DT+DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVR
Sbjct  627  QAYALQVRDQIHQAGYHVDADTTDRKIQKKVREAQLAQYNYILVVGEEEAKTGQVSVRVR  686

Query  163  DIPDHKVMTVDELLAHFKD  107
            D  DH VMT++ LL HFKD
Sbjct  687  DKADHSVMTIENLLEHFKD  705



>gb|KHN12091.1| Threonine--tRNA ligase, mitochondrial [Glycine soja]
Length=599

 Score =   343 bits (879),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAE+AL +AL++FGKPW++NEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP R
Sbjct  395  TWDKAESALKEALDDFGKPWQLNEGDGAFYGPKIDISVSDALSRKFQCATLQLDFQLPDR  454

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L +SAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  455  FKLEFSAEDEAKIERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  514

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q+Y +++RD+IH+AG+HVD DT+DR IQKKVREAQ+AQYN+ILVVGE+EA +G+VSVRVR
Sbjct  515  QSYALQVRDQIHQAGYHVDADTTDRKIQKKVREAQLAQYNFILVVGEEEANSGQVSVRVR  574

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D+ +HKVM++++LL HF+D  A+++
Sbjct  575  DLAEHKVMSIEKLLEHFRDKTAAFE  599



>ref|XP_003519592.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Glycine 
max]
Length=710

 Score =   344 bits (883),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAE+AL +AL++FGKPW++NEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP R
Sbjct  506  TWDKAESALKEALDDFGKPWQLNEGDGAFYGPKIDISVSDALGRKFQCATLQLDFQLPDR  565

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L +SAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  566  FKLEFSAEDEAKIERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  625

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            QAY +++RD+IH+AG++VD DT+DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVR
Sbjct  626  QAYALQVRDQIHQAGYYVDADTTDRKIQKKVREAQLAQYNYILVVGEEEANTGQVSVRVR  685

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D+ +HKVM++++LL HF+D  A+++
Sbjct  686  DLAEHKVMSIEKLLEHFRDKAAAFE  710



>ref|XP_006346202.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Solanum 
tuberosum]
Length=413

 Score =   335 bits (859),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            SW+KAE AL +ALNEFGKPWEIN+GDGAFYGPKIDISV DAMKR  QCATLQLDFQLP+R
Sbjct  209  SWKKAEDALAEALNEFGKPWEINKGDGAFYGPKIDISVSDAMKRNLQCATLQLDFQLPER  268

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNL Y AE +  RERPVMIHRAILGSVERMFAIL EH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  269  FNLLYVAEYDQIRERPVMIHRAILGSVERMFAILFEHYKGKWPFWLSPRQAIVCPVSNKS  328

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q+Y  E+  R+H+A +HVD+D SD+T+ KKVREAQ+ QYNYILVVGE+EA  G+VSVRVR
Sbjct  329  QSYAFEIWKRLHDARYHVDIDVSDKTVGKKVREAQLVQYNYILVVGEEEAKNGQVSVRVR  388

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  DH+VMTVDELL  FKD++AS++
Sbjct  389  DKRDHQVMTVDELLDQFKDMVASFQ  413



>ref|XP_004489863.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Cicer 
arietinum]
Length=719

 Score =   344 bits (882),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAE +L +AL+EFGKPW++NEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP R
Sbjct  515  TWEKAENSLKEALDEFGKPWQLNEGDGAFYGPKIDISVSDALSRKFQCATLQLDFQLPDR  574

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L +SAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA++CPVS+KS
Sbjct  575  FKLEFSAEDEAKIERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAILCPVSEKS  634

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            QAY +++RD+IH+AG+HVD DT+DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVR
Sbjct  635  QAYALKVRDQIHQAGYHVDADTTDRKIQKKVREAQLAQYNYILVVGEEEANTGQVSVRVR  694

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  DH VM+++ LL HF+D +A++
Sbjct  695  DKADHSVMSIENLLKHFEDEVAAF  718



>ref|XP_010533069.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Tarenaya 
hassleriana]
Length=714

 Score =   344 bits (882),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W++AE AL +ALN FGKPW++NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP R
Sbjct  510  TWDRAENALKEALNAFGKPWQLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPDR  569

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L YSAEDE+KRERPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  570  FKLEYSAEDEAKRERPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  629

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              Y +++++++H AG++VDVDTSDR IQKKVREAQ+AQYN+ILVVGE+EA TG+VSVRVR
Sbjct  630  SPYALKVKEQVHNAGYYVDVDTSDRKIQKKVREAQLAQYNFILVVGEEEAATGQVSVRVR  689

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  DHKVM++++LL HFKD +A+Y
Sbjct  690  DKSDHKVMSIEDLLNHFKDEVAAY  713



>gb|KHN00337.1| Threonine--tRNA ligase, mitochondrial [Glycine soja]
Length=725

 Score =   344 bits (882),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAE+AL +AL++FGKPW++NEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP R
Sbjct  521  TWDKAESALKEALDDFGKPWQLNEGDGAFYGPKIDISVSDALGRKFQCATLQLDFQLPDR  580

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L +SAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  581  FKLEFSAEDEAKIERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  640

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            QAY +++RD+IH+AG++VD DT+DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVR
Sbjct  641  QAYALQVRDQIHQAGYYVDADTTDRKIQKKVREAQLAQYNYILVVGEEEANTGQVSVRVR  700

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D+ +HKVM++++LL HF+D  A+++
Sbjct  701  DLAEHKVMSIEKLLEHFRDKAAAFE  725



>ref|XP_009360487.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Pyrus 
x bretschneideri]
 ref|XP_009363511.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Pyrus 
x bretschneideri]
Length=676

 Score =   342 bits (877),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 182/199 (91%), Gaps = 1/199 (1%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAEAAL DALNEFGKPW+INEGDGAFYGPKIDISV DA+ RK+QCATLQLDFQLPQ+
Sbjct  471  TWEKAEAALADALNEFGKPWQINEGDGAFYGPKIDISVSDALNRKYQCATLQLDFQLPQK  530

Query  523  FNLSYSAE-DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDK  347
            F L+YSAE +E K ERPVMIHRA+LGSVERMFAILLE++KGKWPFWLSPRQA+VCPVSDK
Sbjct  531  FELNYSAEGEEGKLERPVMIHRAVLGSVERMFAILLENYKGKWPFWLSPRQAIVCPVSDK  590

Query  346  SQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
            SQ Y +E+RDRIH+AG++VDVDT+DRTIQKKVREAQ+AQYNYILVVGE+E  TG+VS+RV
Sbjct  591  SQPYALEVRDRIHQAGYYVDVDTTDRTIQKKVREAQIAQYNYILVVGEEEVKTGQVSLRV  650

Query  166  RDIPDHKVMTVDELLAHFK  110
            RD  D  VMT+D LL HFK
Sbjct  651  RDKGDVSVMTMDNLLQHFK  669



>gb|KDO82533.1| hypothetical protein CISIN_1g0066801mg, partial [Citrus sinensis]
Length=325

 Score =   330 bits (847),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/239 (67%), Positives = 188/239 (79%), Gaps = 34/239 (14%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAEAALT+ALNEFGKPW+INEGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP R
Sbjct  87   TWEKAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPDR  146

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNL YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  147  FNLGYSAEDEAKTERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  206

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKK------------------------------  254
            Q Y +++RD I+ AG++VDVDT+DR IQKK                              
Sbjct  207  QPYALQVRDHIYRAGYYVDVDTTDRKIQKKPNSFVHARSTYIEVVFSCWEELVAGINIYP  266

Query  253  ----VREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  89
                VREAQ+AQYN+ILVVGE+EA +G+VSVRVRD  DH  M++++LL HFK+ + +++
Sbjct  267  IRVSVREAQLAQYNFILVVGEEEAKSGQVSVRVRDQGDHSNMSIEDLLKHFKEKLEAFQ  325



>ref|XP_003517788.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Glycine 
max]
Length=717

 Score =   343 bits (880),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAE+AL +AL++FGKPW++NEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP R
Sbjct  513  TWDKAESALKEALDDFGKPWQLNEGDGAFYGPKIDISVSDALSRKFQCATLQLDFQLPDR  572

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L +SAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  573  FKLEFSAEDEAKIERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  632

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q+Y +++RD+IH+AG+HVD DT+DR IQKKVREAQ+AQYN+ILVVGE+EA +G+VSVRVR
Sbjct  633  QSYALQVRDQIHQAGYHVDADTTDRKIQKKVREAQLAQYNFILVVGEEEANSGQVSVRVR  692

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D+ +HKVM++++LL HF+D  A+++
Sbjct  693  DLAEHKVMSIEKLLEHFRDKTAAFE  717



>ref|XP_007157476.1| hypothetical protein PHAVU_002G072800g [Phaseolus vulgaris]
 gb|ESW29470.1| hypothetical protein PHAVU_002G072800g [Phaseolus vulgaris]
Length=707

 Score =   342 bits (878),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAE+AL +AL++FGKPW++NEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP R
Sbjct  503  TWDKAESALKEALDDFGKPWQLNEGDGAFYGPKIDISVSDALSRKFQCATLQLDFQLPDR  562

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L +SAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  563  FKLEFSAEDEAKIERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  622

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            QAY +++RD+IH+AG+ VD DT+DR IQKKVREAQ+AQ+NYILVVGE+EA TG+VSVRVR
Sbjct  623  QAYALQVRDQIHQAGYQVDADTTDRKIQKKVREAQLAQFNYILVVGEEEANTGQVSVRVR  682

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  DHKVM++++LL HF+D  A++
Sbjct  683  DKGDHKVMSIEDLLKHFRDEAAAF  706



>gb|KDP21323.1| hypothetical protein JCGZ_21794 [Jatropha curcas]
Length=676

 Score =   340 bits (872),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAE AL  AL+EFGKPW+INEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP R
Sbjct  472  TWEKAEDALKLALDEFGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATLQLDFQLPDR  531

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L YSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  532  FELEYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  591

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q Y  +++ +IH+AG+HVDVDT+DR IQKKVREAQ+AQYN+ILVVGE+EA TG+VSVRVR
Sbjct  592  QPYAEQVQAQIHKAGYHVDVDTTDRKIQKKVREAQLAQYNFILVVGEEEAKTGQVSVRVR  651

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  DH VM+++ LL HF+D +A++
Sbjct  652  DKGDHSVMSMESLLKHFEDEVAAF  675



>ref|XP_008340003.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Malus 
domestica]
Length=676

 Score =   340 bits (871),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 180/199 (90%), Gaps = 1/199 (1%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAEAAL DALNEFGKPW+INEGDGAFYGPKIDISV DA+ RK+QCATLQLDFQLPQ+
Sbjct  471  TWEKAEAALADALNEFGKPWQINEGDGAFYGPKIDISVSDALNRKYQCATLQLDFQLPQK  530

Query  523  FNLSYSAE-DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDK  347
            F L YSAE +E K ERPVMIHRA+LGSVERMFAILLE++KGKWPFWLSPRQA+VCPVSDK
Sbjct  531  FELYYSAEGEEGKLERPVMIHRAVLGSVERMFAILLENYKGKWPFWLSPRQAIVCPVSDK  590

Query  346  SQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
            SQ Y  E+RDRIHEAG++VDVDTSDRTIQKKVREAQ+AQYNYILVVGE+E  TG+VS+RV
Sbjct  591  SQPYAQEVRDRIHEAGYYVDVDTSDRTIQKKVREAQIAQYNYILVVGEEEVKTGQVSLRV  650

Query  166  RDIPDHKVMTVDELLAHFK  110
            RD  D  VMT++ LL HFK
Sbjct  651  RDHGDVTVMTMENLLQHFK  669



>ref|XP_009412586.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=731

 Score =   341 bits (875),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAEAAL++ALNEFG+PW+INEGDGAFYGPKIDI V DA+ RKFQCATLQLDFQLP R
Sbjct  527  TWDKAEAALSEALNEFGRPWQINEGDGAFYGPKIDIGVFDALNRKFQCATLQLDFQLPLR  586

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F LSYSAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  587  FKLSYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  646

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q+Y  ++ D+IH+AG++VD D +DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVR
Sbjct  647  QSYAQQVHDKIHQAGYYVDADLTDRKIQKKVREAQLAQYNYILVVGEEEAKTGQVSVRVR  706

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  DH VM+++ LL HFK+ +A++
Sbjct  707  DGSDHSVMSLEALLEHFKEEVAAF  730



>ref|XP_002311580.2| Threonyl-tRNA synthetase family protein [Populus trichocarpa]
 gb|EEE88947.2| Threonyl-tRNA synthetase family protein [Populus trichocarpa]
Length=715

 Score =   341 bits (874),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 187/205 (91%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W++AE ALT+AL+EFGKPW+I+EGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP R
Sbjct  511  TWDEAEKALTEALDEFGKPWKIDEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPDR  570

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L YSAEDE++ E PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  571  FKLEYSAEDEARSEAPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  630

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q+Y +++RD+IHEAG++VDVD +DR IQKKVREAQ+AQYNYILVVGE+E+ TG+VSVRVR
Sbjct  631  QSYALQVRDQIHEAGYYVDVDATDRKIQKKVREAQLAQYNYILVVGEEESKTGQVSVRVR  690

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  DH VM+++ LL  FK+L+A ++
Sbjct  691  DNADHSVMSIESLLGLFKELVADFR  715



>ref|XP_004296467.2| PREDICTED: threonine--tRNA ligase, mitochondrial [Fragaria vesca 
subsp. vesca]
Length=732

 Score =   340 bits (873),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/205 (79%), Positives = 183/205 (89%), Gaps = 1/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAEAALT+ALNEFGKPW+INEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP R
Sbjct  527  TWEKAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATLQLDFQLPAR  586

Query  523  FNLSYSAE-DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDK  347
            F L YSAE +E KRE PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVSDK
Sbjct  587  FELYYSAEGEEGKREAPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSDK  646

Query  346  SQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
            SQ Y  ++RDRI +AG++VDVDTSDRTIQKKVREAQ+AQYNYILVVGE+E  TG+VSVRV
Sbjct  647  SQPYAQQVRDRIFQAGYYVDVDTSDRTIQKKVREAQMAQYNYILVVGEEEVKTGQVSVRV  706

Query  166  RDIPDHKVMTVDELLAHFKDLMASY  92
            RD  D  VM++D LL HFK+ + ++
Sbjct  707  RDKGDSNVMSMDGLLEHFKNEVEAF  731



>ref|XP_006836673.1| hypothetical protein AMTR_s00088p00069780 [Amborella trichopoda]
 gb|ERM99526.1| hypothetical protein AMTR_s00088p00069780 [Amborella trichopoda]
Length=723

 Score =   340 bits (873),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 186/205 (91%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAE AL +AL+EFG+ WEIN GDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP R
Sbjct  519  TWDKAEGALKEALDEFGRDWEINTGDGAFYGPKIDISVFDALKRKFQCATLQLDFQLPAR  578

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNL+YSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  579  FNLTYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  638

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            QAY +++RD+IH+AG++VDVDT+DR IQKKVREAQ+AQYNYILVVGE+EA T +VSVRVR
Sbjct  639  QAYALKVRDQIHQAGYYVDVDTTDRKIQKKVREAQLAQYNYILVVGEEEANTNQVSVRVR  698

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  DH V  +++LL  F++  A+++
Sbjct  699  DKSDHSVKFMEDLLTQFREDTAAFR  723



>ref|XP_008361801.1| PREDICTED: LOW QUALITY PROTEIN: threonine--tRNA ligase, mitochondrial-like 
[Malus domestica]
Length=731

 Score =   340 bits (872),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 180/199 (90%), Gaps = 1/199 (1%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAEAAL DALNEFGKPW+INEGDGAFYGPKIDISV DA+ RK+QCATLQLDFQLPQ+
Sbjct  526  TWEKAEAALADALNEFGKPWQINEGDGAFYGPKIDISVSDALNRKYQCATLQLDFQLPQK  585

Query  523  FNLSYSAE-DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDK  347
            F L YSAE +E K ERPVMIHRA+LGSVERMFAILLE++KGKWPFWLSPRQA+VCPVSDK
Sbjct  586  FELYYSAEGEEGKLERPVMIHRAVLGSVERMFAILLENYKGKWPFWLSPRQAIVCPVSDK  645

Query  346  SQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
            SQ Y  E+RDRIHEAG++VDVDTSDRTIQKKVREAQ+AQYNYILVVGE+E  TG+VS+RV
Sbjct  646  SQPYAQEVRDRIHEAGYYVDVDTSDRTIQKKVREAQIAQYNYILVVGEEEVKTGQVSLRV  705

Query  166  RDIPDHKVMTVDELLAHFK  110
            RD  D  VMT++ LL HFK
Sbjct  706  RDHGDVTVMTMENLLQHFK  724



>ref|XP_011025470.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Populus 
euphratica]
Length=715

 Score =   339 bits (870),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 186/205 (91%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W++AE ALT+AL+EFGKPW+I+EGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP R
Sbjct  511  TWDEAEKALTEALDEFGKPWKIDEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPDR  570

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F + YSAEDE+K E PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  571  FKVEYSAEDEAKSEAPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  630

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q+Y +++RD+IHEAG+ VDVD +DR IQKKVREAQ+AQYNYILVVGE+E+ TG+VSVRVR
Sbjct  631  QSYALQVRDQIHEAGYFVDVDATDRKIQKKVREAQLAQYNYILVVGEEESKTGQVSVRVR  690

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  DH VM+++ LL  FK+L+A ++
Sbjct  691  DNADHSVMSIESLLGLFKELVADFR  715



>ref|XP_009599596.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=405

 Score =   329 bits (844),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 182/205 (89%), Gaps = 1/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAE AL +AL EFGKPW   EGDGAFYGPKIDI+V DAM R+FQCATLQLDFQLP+R
Sbjct  202  TWEKAEGALVEALEEFGKPWGRKEGDGAFYGPKIDITVSDAMNREFQCATLQLDFQLPER  261

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L+Y AED S  ERPVMIHRAILGSVERMFAIL EHF+GKWPFWLSPRQAMVCPVS+KS
Sbjct  262  FELTYKAEDGSD-ERPVMIHRAILGSVERMFAILCEHFEGKWPFWLSPRQAMVCPVSNKS  320

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q+Y +ELR +IH+AG++VDV+TSD+T+QKKVREAQ A+YNYILVVGE EA +G+VSVRVR
Sbjct  321  QSYALELRKQIHDAGYYVDVETSDKTLQKKVREAQEAKYNYILVVGEAEAKSGQVSVRVR  380

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  D +VMTVD+LL HFKD++AS++
Sbjct  381  DNRDIQVMTVDDLLHHFKDIVASFQ  405



>ref|XP_010913364.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Elaeis guineensis]
Length=727

 Score =   338 bits (868),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W++AEAALTDALNEFG+PW+INEGDGAFYGPKIDI V DA+KRKFQC TLQLDFQLP R
Sbjct  523  TWDQAEAALTDALNEFGRPWQINEGDGAFYGPKIDIGVFDALKRKFQCGTLQLDFQLPLR  582

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F LSYSAEDE K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VC VS+KS
Sbjct  583  FKLSYSAEDEKKMERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCNVSEKS  642

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            + Y  ++RD+IH+AG++VD D +DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVR
Sbjct  643  EDYAKQVRDQIHQAGYYVDADITDRKIQKKVREAQLAQYNYILVVGEEEAKTGQVSVRVR  702

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  DH  M+++ LL HFK+  A+Y
Sbjct  703  DGSDHSTMSMEALLTHFKEEAAAY  726



>ref|XP_006378416.1| Threonyl-tRNA synthetase family protein [Populus trichocarpa]
 gb|ERP56213.1| Threonyl-tRNA synthetase family protein [Populus trichocarpa]
Length=696

 Score =   337 bits (865),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WE+AE  L +ALNEFGKPW+ NEGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP R
Sbjct  492  TWEEAEKDLAEALNEFGKPWKFNEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPDR  551

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L YSAEDE+K E PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  552  FKLEYSAEDEAKSETPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  611

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q+Y ++++D+IHEAG+ VD DT+DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVR+R
Sbjct  612  QSYALQVQDQIHEAGYFVDADTTDRKIQKKVREAQLAQYNYILVVGEEEAKTGQVSVRMR  671

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  DH VM+++ LL  FKD +A ++
Sbjct  672  DNADHSVMSIESLLKLFKDAVADFR  696



>ref|XP_010551550.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Tarenaya 
hassleriana]
Length=717

 Score =   337 bits (864),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W++AE AL +ALN FGKPW++NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP R
Sbjct  513  TWDRAENALKEALNAFGKPWQLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPDR  572

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L YSAEDE+KRERPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  573  FKLEYSAEDEAKRERPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  632

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              Y +++RD+IH+AG++VDVD SDR IQKKVREAQ+AQYNYILVVGE EA TG+VSVRVR
Sbjct  633  SPYALKVRDQIHDAGYYVDVDLSDRKIQKKVREAQLAQYNYILVVGEDEAKTGQVSVRVR  692

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  DH V +++ LL  FKD  A+Y
Sbjct  693  DKSDHSVKSIEGLLQQFKDEAAAY  716



>ref|XP_007225203.1| hypothetical protein PRUPE_ppa002055mg [Prunus persica]
 gb|EMJ26402.1| hypothetical protein PRUPE_ppa002055mg [Prunus persica]
Length=724

 Score =   337 bits (863),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 180/199 (90%), Gaps = 1/199 (1%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAEAALT+ALNE GKPW++NEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP R
Sbjct  519  TWEKAEAALTEALNESGKPWQLNEGDGAFYGPKIDISVSDALNRKFQCATLQLDFQLPTR  578

Query  523  FNLSYSAE-DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDK  347
            F L YSAE +E KRE PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVSDK
Sbjct  579  FELYYSAEGEEGKRETPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSDK  638

Query  346  SQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
            SQ Y +E+R+RIH+AG++VDVDTSDRTIQKKVREAQ+AQYNYILVVGE+E  TG+VS+RV
Sbjct  639  SQPYALEVRNRIHQAGYYVDVDTSDRTIQKKVREAQMAQYNYILVVGEEEVKTGQVSLRV  698

Query  166  RDIPDHKVMTVDELLAHFK  110
            RD  D  VM+++ LL HFK
Sbjct  699  RDKGDVTVMSMENLLQHFK  717



>ref|XP_008221771.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Prunus 
mume]
Length=721

 Score =   336 bits (862),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 180/199 (90%), Gaps = 1/199 (1%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAEAALT+ALNE GKPW++NEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP R
Sbjct  516  TWEKAEAALTEALNESGKPWQLNEGDGAFYGPKIDISVSDALNRKFQCATLQLDFQLPAR  575

Query  523  FNLSYSAE-DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDK  347
            F L YSAE +E KRE PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVSDK
Sbjct  576  FELYYSAEGEEGKRETPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSDK  635

Query  346  SQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
            SQ Y +E+R+RIH+AG++VDVDTSDRTIQKKVREAQ+AQYNYILVVGE+E  TG+VS+RV
Sbjct  636  SQPYALEVRNRIHQAGYYVDVDTSDRTIQKKVREAQMAQYNYILVVGEEEVKTGQVSLRV  695

Query  166  RDIPDHKVMTVDELLAHFK  110
            RD  D  VM+++ LL HFK
Sbjct  696  RDKGDVTVMSMENLLQHFK  714



>gb|KJB48103.1| hypothetical protein B456_008G053600 [Gossypium raimondii]
Length=533

 Score =   329 bits (844),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W +AEAALT+ALN+ GKPW+INEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP+R
Sbjct  329  TWNRAEAALTEALNQSGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATLQLDFQLPER  388

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L YSAEDE+KRE+PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  389  FKLEYSAEDEAKREKPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  448

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q Y M++RD IHEAG++VDVD +DR IQKK+REAQ+AQYN+ILVVGE+E  T +VSVRVR
Sbjct  449  QQYAMQVRDWIHEAGYYVDVDMTDRKIQKKIREAQLAQYNFILVVGEEEMNTKKVSVRVR  508

Query  163  DIPDHKVMTVDELLAHFK  110
            D  D   M++++LL HF+
Sbjct  509  DSGDFSGMSIEDLLNHFQ  526



>gb|EEC83306.1| hypothetical protein OsI_28675 [Oryza sativa Indica Group]
Length=306

 Score =   321 bits (822),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W KAE  LT+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP R
Sbjct  102  TWNKAEQQLTEALNEFGKPWQINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLR  161

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC +S  S
Sbjct  162  FKLTYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCSISSNS  221

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              Y  ++R RIHEAGFHV +D +DRTIQKKVREAQ+AQ+NYILVVG +EA TG+VSVRVR
Sbjct  222  VEYAKQVRARIHEAGFHVAIDETDRTIQKKVREAQLAQFNYILVVGAQEAETGQVSVRVR  281

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  +   +++D+++  FK+ +A+YK
Sbjct  282  DKAELATVSIDDIITRFKEEVAAYK  306



>ref|XP_008802022.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Phoenix dactylifera]
Length=727

 Score =   333 bits (854),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAEAAL+DALNEFG+PW INEGDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP R
Sbjct  523  TWDKAEAALSDALNEFGRPWLINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLR  582

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F LSYSAEDE K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VC VS+KS
Sbjct  583  FKLSYSAEDEKKMERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCNVSEKS  642

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            + Y  ++RD+IH+AG++VD D +DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVR
Sbjct  643  EDYAKQVRDQIHQAGYYVDADITDRKIQKKVREAQLAQYNYILVVGEEEAKTGQVSVRVR  702

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  DH   +++ LL H K+ +A+Y
Sbjct  703  DGSDHSTKSMEALLTHLKEEVAAY  726



>ref|XP_007044584.1| Threonyl-tRNA synthetase isoform 3 [Theobroma cacao]
 gb|EOY00416.1| Threonyl-tRNA synthetase isoform 3 [Theobroma cacao]
Length=686

 Score =   329 bits (843),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WE+AEAALT+ALNE GKPW+INEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP R
Sbjct  482  TWERAEAALTEALNESGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATLQLDFQLPDR  541

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L YSAEDE+KRE+PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS KS
Sbjct  542  FKLEYSAEDEAKREKPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSAKS  601

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q Y  E++++IH AG++VDVD +DR IQKKVREAQ+AQYNYILVVGE+E  T +VSVRVR
Sbjct  602  QDYAREVQEQIHGAGYYVDVDLTDRKIQKKVREAQLAQYNYILVVGEEEMNTKQVSVRVR  661

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  D   M+++ LL H KD +A++
Sbjct  662  DKGDLTSMSIEGLLQHLKDEIAAF  685



>ref|XP_010688668.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=688

 Score =   329 bits (843),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAEAALT+ALNE GKPW++NEGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP R
Sbjct  484  TWDKAEAALTEALNESGKPWQLNEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPLR  543

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNLSYSAEDE+KRERPV+IHRAILGSVERMFAILLEH+KGKWP WLSPRQA+VC VS+KS
Sbjct  544  FNLSYSAEDEAKRERPVIIHRAILGSVERMFAILLEHYKGKWPLWLSPRQAIVCNVSEKS  603

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             AY  E+ D+IH+AG+ VDVDTSDRTI KKVREAQ++QYNYILVVGEK+A    V+VRVR
Sbjct  604  SAYAHEVCDQIHKAGYFVDVDTSDRTINKKVREAQLSQYNYILVVGEKDAENRVVTVRVR  663

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  +H  M+V+ LL HF + + +Y
Sbjct  664  DKNEHSPMSVENLLKHFGEEVKAY  687



>gb|KJB48102.1| hypothetical protein B456_008G053600 [Gossypium raimondii]
Length=714

 Score =   329 bits (844),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W +AEAALT+ALN+ GKPW+INEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP+R
Sbjct  510  TWNRAEAALTEALNQSGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATLQLDFQLPER  569

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L YSAEDE+KRE+PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  570  FKLEYSAEDEAKREKPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  629

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q Y M++RD IHEAG++VDVD +DR IQKK+REAQ+AQYN+ILVVGE+E  T +VSVRVR
Sbjct  630  QQYAMQVRDWIHEAGYYVDVDMTDRKIQKKIREAQLAQYNFILVVGEEEMNTKKVSVRVR  689

Query  163  DIPDHKVMTVDELLAHFK  110
            D  D   M++++LL HF+
Sbjct  690  DSGDFSGMSIEDLLNHFQ  707



>ref|XP_007044582.1| Threonyl-tRNA synthetase isoform 1 [Theobroma cacao]
 gb|EOY00414.1| Threonyl-tRNA synthetase isoform 1 [Theobroma cacao]
Length=715

 Score =   329 bits (843),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WE+AEAALT+ALNE GKPW+INEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP R
Sbjct  511  TWERAEAALTEALNESGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATLQLDFQLPDR  570

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L YSAEDE+KRE+PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS KS
Sbjct  571  FKLEYSAEDEAKREKPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSAKS  630

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q Y  E++++IH AG++VDVD +DR IQKKVREAQ+AQYNYILVVGE+E  T +VSVRVR
Sbjct  631  QDYAREVQEQIHGAGYYVDVDLTDRKIQKKVREAQLAQYNYILVVGEEEMNTKQVSVRVR  690

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  D   M+++ LL H KD +A++
Sbjct  691  DKGDLTSMSIEGLLQHLKDEIAAF  714



>ref|XP_004510448.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Cicer 
arietinum]
Length=458

 Score =   320 bits (820),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            WEKAE  L +AL+EFGKPW++NEGDGAFYGPKIDISV DA+ RKFQC TLQLDFQLP  F
Sbjct  254  WEKAENELREALDEFGKPWQLNEGDGAFYGPKIDISVSDALSRKFQCGTLQLDFQLPDSF  313

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
             L +S EDE+K ERPVMIHR+ILGSVE MFAILLEH+KGKWPFWLSPRQA++CPVS+KSQ
Sbjct  314  KLEFSTEDEAKIERPVMIHRSILGSVESMFAILLEHYKGKWPFWLSPRQAILCPVSEKSQ  373

Query  340  AYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRD  161
            AY +++RD+IHE G+HVD DT+D  IQKKV EA++AQYNYILVVGE EA TG+VSV+VRD
Sbjct  374  AYALQVRDQIHEEGYHVDADTTDMEIQKKVEEARLAQYNYILVVGEDEANTGQVSVQVRD  433

Query  160  IPDHK-VMTVDELLAHFKDLMASY  92
              DH  +M+++ LL HFKD +A++
Sbjct  434  NEDHSIIMSIENLLKHFKDEVAAF  457



>ref|XP_011021655.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Populus 
euphratica]
Length=678

 Score =   324 bits (830),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WE+AE AL +ALNEFGKPW+ NEGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP R
Sbjct  474  TWEEAEKALAEALNEFGKPWKFNEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPDR  533

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L YSAEDE+K E PVMIHRAILGSVERMFA+LLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  534  FKLEYSAEDEAKSETPVMIHRAILGSVERMFAVLLEHYKGKWPFWLSPRQAIVCPVSEKS  593

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q+Y ++++D+IHEAG+ VD DT+DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVR
Sbjct  594  QSYALQVQDQIHEAGYFVDADTTDRKIQKKVREAQLAQYNYILVVGEEEAKTGQVSVRVR  653

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  DH VM+++ LL  FKD ++ ++
Sbjct  654  DNADHSVMSIESLLKLFKDAVSDFR  678



>emb|CAC79651.1| threonyl-tRNA synthetase [Oryza sativa Japonica Group]
Length=531

 Score =   319 bits (817),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W KAE  LT+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP R
Sbjct  327  TWNKAEQQLTEALNEFGKPWQINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLR  386

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC +S  S
Sbjct  387  FKLTYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCSISSNS  446

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              Y  ++R RIHEAGFHV +D +DRTIQKKVREAQ+AQ+ YILVVG +EA TG+VSVRVR
Sbjct  447  VEYAKQVRVRIHEAGFHVAIDETDRTIQKKVREAQLAQFKYILVVGAQEAETGQVSVRVR  506

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  +   +++D+++  FK+ +A+YK
Sbjct  507  DKAELATVSIDDIITRFKEEVAAYK  531



>ref|XP_010044651.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Eucalyptus 
grandis]
 gb|KCW86747.1| hypothetical protein EUGRSUZ_B03357 [Eucalyptus grandis]
Length=737

 Score =   323 bits (828),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAEAAL +ALNE GKPW+INEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP R
Sbjct  533  TWEKAEAALAEALNESGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATLQLDFQLPAR  592

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F LSYSAEDE K E PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  593  FELSYSAEDEGKTETPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  652

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q+Y +++RD+IH+AG++VDVD +DR IQKKVREAQ+AQYN+ILVVGE+EA TG+VSVRVR
Sbjct  653  QSYALKVRDQIHDAGYYVDVDETDRKIQKKVREAQLAQYNFILVVGEEEANTGQVSVRVR  712

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  DH VM V++LL  F++ +A++
Sbjct  713  DKSDHSVMRVEDLLKFFQEEVAAF  736



>gb|EEE68426.1| hypothetical protein OsJ_26793 [Oryza sativa Japonica Group]
Length=701

 Score =   322 bits (824),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W KAE  LT+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP R
Sbjct  497  TWNKAEQQLTEALNEFGKPWQINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLR  556

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC +S  S
Sbjct  557  FKLTYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCSISSNS  616

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              Y  ++R RIHEAGFHV +D +DRTIQKKVREAQ+AQ+NYILVVG +EA TG+VSVRVR
Sbjct  617  VEYAKQVRARIHEAGFHVAIDETDRTIQKKVREAQLAQFNYILVVGAQEAETGQVSVRVR  676

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  +   +++D+++  FK+ +A+YK
Sbjct  677  DKAELATVSIDDIITRFKEEVAAYK  701



>ref|XP_004500860.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Cicer 
arietinum]
Length=508

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 173/198 (87%), Gaps = 0/198 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            WEK E AL +AL+EFGKPW++ EG+GAFYGPKIDISV DA  RKFQC TLQLDFQLP  F
Sbjct  305  WEKTENALREALDEFGKPWQLIEGEGAFYGPKIDISVSDAFSRKFQCGTLQLDFQLPDSF  364

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
             L +S EDE+K ERPVMIHR+ILGSVE MFAILLEH+KGKWPFWLSPRQA++CPVS+KSQ
Sbjct  365  KLEFSTEDEAKTERPVMIHRSILGSVEHMFAILLEHYKGKWPFWLSPRQAILCPVSEKSQ  424

Query  340  AYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRD  161
            AY +++RD+IH+AG++VDVDT+D  IQKKV EA+V QYNYILVVGE+EA TG+VSV++RD
Sbjct  425  AYALQVRDQIHQAGYYVDVDTTDSKIQKKVHEARVTQYNYILVVGEEEANTGQVSVQLRD  484

Query  160  IPDHKVMTVDELLAHFKD  107
              DH V+++++LL HFKD
Sbjct  485  KEDHCVLSIEDLLKHFKD  502



>ref|XP_006659275.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Oryza 
brachyantha]
Length=696

 Score =   321 bits (822),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W KAE  LT+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP R
Sbjct  492  TWNKAEQQLTEALNEFGKPWQINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLR  551

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC +S  S
Sbjct  552  FKLTYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCSISSNS  611

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              Y  ++R RIHEAGFHV +D +DRTIQKKVREAQ+AQ+NYILVVG +EA TG+VSVRVR
Sbjct  612  VEYAKQVRARIHEAGFHVAIDETDRTIQKKVREAQLAQFNYILVVGAQEAETGQVSVRVR  671

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  +   +++D+++  FK+ +A+YK
Sbjct  672  DKAELATVSIDDIITRFKEEVAAYK  696



>ref|NP_001061475.1| Os08g0295300 [Oryza sativa Japonica Group]
 dbj|BAD01219.1| putative threonyl-tRNA synthetase [Oryza sativa Japonica Group]
 dbj|BAD01414.1| putative threonyl-tRNA synthetase [Oryza sativa Japonica Group]
 dbj|BAF23389.1| Os08g0295300 [Oryza sativa Japonica Group]
 dbj|BAG91912.1| unnamed protein product [Oryza sativa Japonica Group]
Length=745

 Score =   322 bits (825),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W KAE  LT+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP R
Sbjct  541  TWNKAEQQLTEALNEFGKPWQINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLR  600

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC +S  S
Sbjct  601  FKLTYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCSISSNS  660

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              Y  ++R RIHEAGFHV +D +DRTIQKKVREAQ+AQ+NYILVVG +EA TG+VSVRVR
Sbjct  661  VEYAKQVRARIHEAGFHVAIDETDRTIQKKVREAQLAQFNYILVVGAQEAETGQVSVRVR  720

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  +   +++D+++  FK+ +A+YK
Sbjct  721  DKAELATVSIDDIITRFKEEVAAYK  745



>dbj|BAI39857.1| putative threonyl-tRNA synthetase [Oryza sativa Indica Group]
Length=749

 Score =   322 bits (824),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W KAE  LT+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP R
Sbjct  545  TWNKAEQQLTEALNEFGKPWQINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLR  604

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC +S  S
Sbjct  605  FKLTYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCSISSNS  664

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              Y  ++R RIHEAGFHV +D +DRTIQKKVREAQ+AQ+NYILVVG +EA TG+VSVRVR
Sbjct  665  VEYAKQVRARIHEAGFHVAIDETDRTIQKKVREAQLAQFNYILVVGAQEAETGQVSVRVR  724

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  +   +++D+++  FK+ +A+YK
Sbjct  725  DKAELATVSIDDIITRFKEEVAAYK  749



>ref|XP_004973168.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Setaria 
italica]
Length=739

 Score =   317 bits (813),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W KAE  LT+ALNEFGKPW+IN+GDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP R
Sbjct  535  TWNKAEQQLTEALNEFGKPWQINKGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLR  594

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC VS  S
Sbjct  595  FKLTYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCSVSSGS  654

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              Y  ++  R+HEAGFHVD+D SDRTIQKKVREAQ+AQ+NYILVVG +EA TG V VRVR
Sbjct  655  VEYAKQVLARLHEAGFHVDIDMSDRTIQKKVREAQMAQFNYILVVGAQEAETGNVCVRVR  714

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  D   M VD L+  F++  A++K
Sbjct  715  DSADLATMNVDGLITRFREETAAFK  739



>ref|XP_006394912.1| hypothetical protein EUTSA_v10003725mg [Eutrema salsugineum]
 gb|ESQ32198.1| hypothetical protein EUTSA_v10003725mg [Eutrema salsugineum]
Length=712

 Score =   314 bits (805),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAE  L  AL+ FGK W++NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP R
Sbjct  508  TWDKAEKDLKVALDAFGKKWQLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPDR  567

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L YSA+DE+KR+RPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA+VCP+S KS
Sbjct  568  FKLEYSADDEAKRQRPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQAIVCPISKKS  627

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            + Y +E+  +IHEAG++VD D +DR I KKVREAQ+AQYNYILVVGE EA TG+VSVR+R
Sbjct  628  EEYALEVEKKIHEAGYYVDADITDRKIDKKVREAQLAQYNYILVVGETEAKTGQVSVRLR  687

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D   H V ++++LL  FK   A Y+
Sbjct  688  DSAAHSVKSIEDLLEEFKTKTAEYQ  712



>emb|CDX80596.1| BnaC07g28480D [Brassica napus]
Length=714

 Score =   313 bits (803),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAE  L  AL+ FGK W++NEGDGAFYGPKIDI+V DA+ RKFQCATLQLDFQLP R
Sbjct  510  TWDKAENDLKVALDAFGKTWQLNEGDGAFYGPKIDITVSDALNRKFQCATLQLDFQLPDR  569

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L YS +DE+KR RPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA+VCP+S KS
Sbjct  570  FKLEYSGDDEAKRNRPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQAIVCPISKKS  629

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            + Y ++++++IHEAG++VD D +DR I KKVREAQ+AQYNYILVVGE EA TG+VSVR+R
Sbjct  630  EEYALKVKEQIHEAGYYVDADITDRKIDKKVREAQLAQYNYILVVGETEAATGQVSVRIR  689

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D   H V ++D+LL  FK   A Y+
Sbjct  690  DSAAHSVKSIDDLLEEFKTKTAEYQ  714



>ref|XP_009151164.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Brassica 
rapa]
 emb|CDX88245.1| BnaA06g28360D [Brassica napus]
Length=718

 Score =   313 bits (803),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAE  L  AL+ FGK W++NEGDGAFYGPKIDI+V DA+ RKFQCATLQLDFQLP R
Sbjct  514  TWDKAENDLKVALDAFGKTWQLNEGDGAFYGPKIDITVSDALNRKFQCATLQLDFQLPDR  573

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L YS +DE+KR RPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA+VCP+S KS
Sbjct  574  FKLEYSGDDEAKRNRPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQAIVCPISKKS  633

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            + Y ++++++IHEAG++VD D +DR I KKVREAQ+AQYNYILVVGE EA TG+VSVR+R
Sbjct  634  EEYALKVKEQIHEAGYYVDADITDRKIDKKVREAQLAQYNYILVVGETEAATGQVSVRIR  693

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D   H V ++D+LL  FK   A Y+
Sbjct  694  DSAAHSVKSIDDLLEEFKTKTAEYQ  718



>gb|KFK26446.1| hypothetical protein AALP_AA8G249500 [Arabis alpina]
Length=714

 Score =   313 bits (802),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAE  L  AL+ FGKPW +N GDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP R
Sbjct  510  TWDKAEKDLKVALDAFGKPWLLNPGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPDR  569

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L Y+AEDE+K ERPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA+VCP+S KS
Sbjct  570  FKLEYAAEDEAKIERPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQAIVCPISKKS  629

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            + Y +++++RIH+AG++VD D SDR I KKVREAQ+AQYNYILVVGE EA TG+VSVR+R
Sbjct  630  EIYALQVKERIHQAGYYVDADISDRKIDKKVREAQLAQYNYILVVGETEAATGQVSVRLR  689

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D   H V ++D+LL  FK   A Y+
Sbjct  690  DSAAHLVKSIDDLLEDFKAKTAEYQ  714



>ref|XP_009111770.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Brassica rapa]
Length=707

 Score =   313 bits (801),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAE  L  AL+ FGK W +NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP R
Sbjct  503  AWDKAENDLKIALDAFGKTWVLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPDR  562

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L YSA+DE+KR+RPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA+VCP+S KS
Sbjct  563  FKLEYSADDEAKRQRPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQAIVCPISKKS  622

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            + Y ++++ +IHEAG++VD D +DR I KKVREAQ+AQYNYILVVGE EA TG+VSVR+R
Sbjct  623  EEYALQVKKQIHEAGYYVDADITDRKIDKKVREAQLAQYNYILVVGETEAATGQVSVRIR  682

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D   H V +++ LL  FK   A Y+
Sbjct  683  DSAAHSVKSIENLLEEFKTKTAEYQ  707



>dbj|BAJ93554.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=711

 Score =   312 bits (799),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W KAE  LT+ALNEFGKPW+INE DGAFYGPKIDI V DA+KRKFQCATLQLDFQLP R
Sbjct  507  TWNKAEQQLTEALNEFGKPWKINEADGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLR  566

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC VS  S
Sbjct  567  FKLTYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCCVSSNS  626

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             AY  E+  +IH AGFHVD+D +DRTIQKKVREAQ+AQ+NYILVVG KEA +G+V +RVR
Sbjct  627  LAYAKEVHAQIHAAGFHVDIDMTDRTIQKKVREAQLAQFNYILVVGAKEAESGKVVLRVR  686

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  D    ++ +++A F D +AS+K
Sbjct  687  DKADLSTESIADVIARFSDEVASFK  711



>ref|XP_008664856.1| PREDICTED: LOW QUALITY PROTEIN: threonine--tRNA ligase, mitochondrial-like 
[Zea mays]
Length=737

 Score =   311 bits (797),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W KAE  LT+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP R
Sbjct  533  TWNKAEQQLTEALNEFGKPWKINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPIR  592

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC VS  S
Sbjct  593  FKLTYSAEDEAKIERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCSVSSGS  652

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              Y  ++   +HEA FHVD+D SDRTIQKKVREAQVAQ+NYILVVG +EA TG V VRVR
Sbjct  653  VEYAKQVLAMLHEADFHVDIDVSDRTIQKKVREAQVAQFNYILVVGAQEAETGNVCVRVR  712

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  D   M+VD L+   ++ + ++K
Sbjct  713  DNADLATMSVDGLITRLREEIVAFK  737



>ref|XP_004968434.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Setaria 
italica]
Length=741

 Score =   311 bits (797),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W K E  LT+ALNEFG PW+INEGDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP R
Sbjct  537  TWNKPEQQLTEALNEFGMPWQINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLR  596

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F LSYSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC VS  S
Sbjct  597  FKLSYSAEDEAKIERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCSVSSGS  656

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              Y  ++  R+HEAGFHVD+D SDRTIQKKVREAQVAQ+NY LVVG +EA TG VSVRVR
Sbjct  657  VEYAKQVLARLHEAGFHVDIDMSDRTIQKKVREAQVAQFNYTLVVGAQEAETGNVSVRVR  716

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
                   M++D L+  F++ +A++K
Sbjct  717  GSDGLATMSLDGLITRFREEIAAFK  741



>emb|CDX87030.1| BnaC09g03450D [Brassica napus]
Length=719

 Score =   310 bits (795),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAE  L  AL+ FGK W +NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP R
Sbjct  515  TWDKAENDLKIALDAFGKKWVLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPDR  574

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L YSA+DE+KR+RPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA+VCP+S KS
Sbjct  575  FKLEYSADDEAKRQRPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQAIVCPISKKS  634

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            + Y ++++ +IHEAG++VD D +DR I KKVREAQ+AQYNYILVVGE EA TG+VSVR+R
Sbjct  635  EEYALQVKKQIHEAGYYVDADITDRKIDKKVREAQLAQYNYILVVGETEAATGQVSVRIR  694

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D   H V +++ LL  FK   + Y+
Sbjct  695  DSAAHSVKSIENLLEEFKTKTSEYQ  719



>ref|XP_002464119.1| hypothetical protein SORBIDRAFT_01g012680 [Sorghum bicolor]
 gb|EER91117.1| hypothetical protein SORBIDRAFT_01g012680 [Sorghum bicolor]
Length=739

 Score =   311 bits (796),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W KAE  LT+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP R
Sbjct  535  TWNKAEQQLTEALNEFGKPWKINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPIR  594

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC VS  S
Sbjct  595  FKLAYSAEDEAKIERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCSVSSGS  654

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              Y  ++   +HEAGFH D+D SDRTIQKKVREAQ+AQ+NYILVVG +EA TG + VRVR
Sbjct  655  VEYAKQVLATLHEAGFHADIDASDRTIQKKVREAQLAQFNYILVVGAQEAETGNICVRVR  714

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  D   M+VD  +   K+ +A+++
Sbjct  715  DNADLATMSVDGFVTRLKEEIAAFR  739



>ref|XP_010027611.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X3 [Eucalyptus grandis]
Length=418

 Score =   301 bits (772),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAE+ALT+ALNEFGK W+ +EG+GAFYGPKIDI+V DA  RKFQCATLQLDFQLP R
Sbjct  214  TWEKAESALTEALNEFGKRWQKDEGEGAFYGPKIDITVFDAFNRKFQCATLQLDFQLPVR  273

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F LSY+AE ESK E PVMIHRA+LGSVERMFAILLEH++GKWPFWLSPRQA+V PVS+KS
Sbjct  274  FGLSYTAEYESKSETPVMIHRAVLGSVERMFAILLEHYQGKWPFWLSPRQAIVFPVSEKS  333

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            ++Y +++RD+IH+AGF+VD D +DR IQ+KV EA++ QYNYILVVGE+ A TG+V+V  R
Sbjct  334  RSYSLKVRDQIHDAGFYVDFDETDRKIQEKVSEARLVQYNYILVVGEEAAGTGQVTVHAR  393

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  D  VMT+ +LL  FK+  A++
Sbjct  394  DEADKIVMTIADLLKVFKEKSAAF  417



>ref|XP_010027610.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X2 [Eucalyptus grandis]
Length=432

 Score =   301 bits (771),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAE+ALT+ALNEFGK W+ +EG+GAFYGPKIDI+V DA  RKFQCATLQLDFQLP R
Sbjct  228  TWEKAESALTEALNEFGKRWQKDEGEGAFYGPKIDITVFDAFNRKFQCATLQLDFQLPVR  287

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F LSY+AE ESK E PVMIHRA+LGSVERMFAILLEH++GKWPFWLSPRQA+V PVS+KS
Sbjct  288  FGLSYTAEYESKSETPVMIHRAVLGSVERMFAILLEHYQGKWPFWLSPRQAIVFPVSEKS  347

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            ++Y +++RD+IH+AGF+VD D +DR IQ+KV EA++ QYNYILVVGE+ A TG+V+V  R
Sbjct  348  RSYSLKVRDQIHDAGFYVDFDETDRKIQEKVSEARLVQYNYILVVGEEAAGTGQVTVHAR  407

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  D  VMT+ +LL  FK+  A++
Sbjct  408  DEADKIVMTIADLLKVFKEKSAAF  431



>ref|XP_003573669.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Brachypodium 
distachyon]
Length=736

 Score =   309 bits (792),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W KAE  LT+AL+EFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP R
Sbjct  532  TWNKAEQQLTEALDEFGKPWKINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLR  591

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F LSYSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC VS  S
Sbjct  592  FKLSYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCCVSSNS  651

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              Y  E+  +IH AGFHVD+D +DRTIQKKVREAQ+AQ+NYILVVG KEA TG+V +RVR
Sbjct  652  LEYAKEVHAKIHAAGFHVDIDMTDRTIQKKVREAQLAQFNYILVVGAKEAETGKVVLRVR  711

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  +    ++ +++  F D +AS++
Sbjct  712  DKAELSTESIADVITRFSDEIASFQ  736



>gb|KCW54156.1| hypothetical protein EUGRSUZ_I00127 [Eucalyptus grandis]
Length=448

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAE+ALT+ALNEFGK W+ +EG+GAFYGPKIDI+V DA  RKFQCATLQLDFQLP R
Sbjct  244  TWEKAESALTEALNEFGKRWQKDEGEGAFYGPKIDITVFDAFNRKFQCATLQLDFQLPVR  303

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F LSY+AE ESK E PVMIHRA+LGSVERMFAILLEH++GKWPFWLSPRQA+V PVS+KS
Sbjct  304  FGLSYTAEYESKSETPVMIHRAVLGSVERMFAILLEHYQGKWPFWLSPRQAIVFPVSEKS  363

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            ++Y +++RD+IH+AGF+VD D +DR IQ+KV EA++ QYNYILVVGE+ A TG+V+V  R
Sbjct  364  RSYSLKVRDQIHDAGFYVDFDETDRKIQEKVSEARLVQYNYILVVGEEAAGTGQVTVHAR  423

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  D  VMT+ +LL  FK+  A++
Sbjct  424  DEADKIVMTIADLLKVFKEKSAAF  447



>ref|XP_002521030.1| threonyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF41447.1| threonyl-tRNA synthetase, putative [Ricinus communis]
Length=691

 Score =   307 bits (787),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAE++L  AL++FGKPW+INEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP R
Sbjct  510  TWEKAESSLKSALDDFGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATLQLDFQLPDR  569

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L YSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  570  FELEYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  629

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVS  176
            Q Y ++++D+IH+AG+++DVD +DR IQKKVREAQ+AQYNYILVVGE+EA TG+V+
Sbjct  630  QEYAVQVQDQIHKAGYYIDVDLTDRKIQKKVREAQLAQYNYILVVGEEEAKTGQVA  685



>emb|CDM81189.1| unnamed protein product [Triticum aestivum]
Length=706

 Score =   308 bits (788),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W KAE  LT+ALNEFGKPW+INE DGAFYGPKIDI V DA+KRKFQCATLQLDFQLP R
Sbjct  502  TWNKAEQQLTEALNEFGKPWKINEADGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLR  561

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC VS  S
Sbjct  562  FKLTYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCCVSANS  621

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              Y  E+  +I  AGFHVD+D +DRTIQKKVREAQ+AQ+NYILVVG KEA +G+VS+RVR
Sbjct  622  LTYAKEVHAQIRAAGFHVDIDMTDRTIQKKVREAQLAQFNYILVVGAKEAESGKVSLRVR  681

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  D    ++ +++A F D +AS++
Sbjct  682  DRADLSTESIADVIARFNDEVASFQ  706



>ref|XP_008237148.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like, partial 
[Prunus mume]
Length=648

 Score =   306 bits (784),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 173/205 (84%), Gaps = 1/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAEAAL +AL EFGKPWE+NEGDGAFYGPKIDI+V DA+ R  Q ATLQLDFQLP R
Sbjct  443  TWKKAEAALKEALIEFGKPWEVNEGDGAFYGPKIDITVSDALSRDHQLATLQLDFQLPDR  502

Query  523  FNLSYSAEDE-SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDK  347
            F L YSAE E  K ERPVMIHRA+LGSVERM A+LLEH+KGKWPFWLSPRQA+VCPVS  
Sbjct  503  FKLYYSAEGEDGKMERPVMIHRAVLGSVERMLAVLLEHYKGKWPFWLSPRQAIVCPVSHT  562

Query  346  SQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
            +  Y +++RD+IH+AG++VDVDTSD+TIQKKVR+AQ+AQYNYILVVG +E   G+VSVRV
Sbjct  563  ALPYALQVRDQIHQAGYYVDVDTSDKTIQKKVRQAQIAQYNYILVVGGEEVQNGQVSVRV  622

Query  166  RDIPDHKVMTVDELLAHFKDLMASY  92
            RD  D  VM+++ LL HFKD + ++
Sbjct  623  RDKGDVTVMSMESLLQHFKDQVEAF  647



>ref|XP_006289423.1| hypothetical protein CARUB_v10002922mg [Capsella rubella]
 gb|EOA22321.1| hypothetical protein CARUB_v10002922mg [Capsella rubella]
Length=713

 Score =   308 bits (788),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAE  L +A+  FGKP  +NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP+R
Sbjct  509  TWDKAEEDLKEAIEAFGKPLVLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPER  568

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L Y+AEDE+KR RPVMIHRA+LGSVERMFAILLEH+KGKWPFW+SPRQA+VCP+S+KS
Sbjct  569  FKLEYAAEDEAKRGRPVMIHRAVLGSVERMFAILLEHYKGKWPFWISPRQAIVCPISEKS  628

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q Y  +++ +IH+AGF+VD D +DR I KKVREAQ+AQYNYILVVGE EA TG+VSVR+R
Sbjct  629  QKYAEKVQKQIHDAGFYVDADLTDRKIDKKVREAQLAQYNYILVVGETEAATGQVSVRLR  688

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D   H V ++++LL  FK   A +
Sbjct  689  DSAAHSVKSIEDLLEEFKSKTAEF  712



>ref|XP_002872240.1| AT5g26830/F2P16_90 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48499.1| AT5g26830/F2P16_90 [Arabidopsis lyrata subsp. lyrata]
Length=713

 Score =   307 bits (787),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAEA L +A+  FGKP  +NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP R
Sbjct  509  TWDKAEADLKEAIEAFGKPLVLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPIR  568

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNL Y+AEDE+K+ +PVMIHRA+LGSVERMFAILLEH+KGKWPFW+SPRQA+VCP+S+KS
Sbjct  569  FNLEYAAEDEAKKAKPVMIHRAVLGSVERMFAILLEHYKGKWPFWISPRQAIVCPISEKS  628

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q Y  +++  IH+AGF++D D +DR I KKVREAQ+AQYNYILVVGE EA TG+VSVR+R
Sbjct  629  QKYAEKVQKEIHDAGFYIDADLTDRKIDKKVREAQLAQYNYILVVGETEAATGQVSVRLR  688

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D   H V ++++LL  FK  +A +
Sbjct  689  DSAAHSVKSIEDLLEEFKAKIAEF  712



>gb|AAK82468.1| AT5g26830/F2P16_90 [Arabidopsis thaliana]
 gb|AAO64760.1| At5g26830/F2P16_90 [Arabidopsis thaliana]
Length=676

 Score =   306 bits (785),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAEA L +A+  FGKP  +NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP R
Sbjct  472  TWDKAEADLKEAIEAFGKPLVLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPIR  531

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNL Y+AEDE+K+ RPVMIHRA+LGSVERMFAILLEH+KGKWPFW+SPRQA+VCP+S+KS
Sbjct  532  FNLEYAAEDEAKKSRPVMIHRAVLGSVERMFAILLEHYKGKWPFWISPRQAIVCPISEKS  591

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q Y  +++ +I +AGF+VD D +DR I KKVREAQ+AQYNYILVVGE EA TG+VSVRVR
Sbjct  592  QQYAEKVQKQIKDAGFYVDADLTDRKIDKKVREAQLAQYNYILVVGETEAATGQVSVRVR  651

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D   H V ++++LL  FK   A +
Sbjct  652  DNAAHSVKSIEDLLEEFKAKTAEF  675



>ref|XP_008644625.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Zea mays]
 gb|AFW68051.1| hypothetical protein ZEAMMB73_499676 [Zea mays]
Length=739

 Score =   308 bits (788),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W KAE  LT+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP R
Sbjct  535  TWNKAEQQLTEALNEFGKPWKINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPIR  594

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L+YSAEDE+K ERPVMIHRAILGSVERM AILLEH+ GKWP WLSPRQA+VC VS  S
Sbjct  595  FKLAYSAEDEAKIERPVMIHRAILGSVERMLAILLEHYNGKWPLWLSPRQAIVCSVSSGS  654

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              Y  ++   +HEAGFHVD+D SDRTIQKKVREAQ+AQ+NYILVVG +EA TG + VRVR
Sbjct  655  VEYAKQVLATLHEAGFHVDIDASDRTIQKKVREAQLAQFNYILVVGAQEAETGNICVRVR  714

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D  D    +VD  +   ++ +A++K
Sbjct  715  DNADLVTTSVDGFITRLREEIAAFK  739



>ref|NP_198035.2| threonyl-tRNA synthetase [Arabidopsis thaliana]
 sp|O04630.3|SYTM_ARATH RecName: Full=Threonine--tRNA ligase, mitochondrial; AltName: 
Full=Threonyl-tRNA synthetase; Short=ThrRS; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AED93610.1| threonyl-tRNA synthetase [Arabidopsis thaliana]
Length=709

 Score =   307 bits (786),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAEA L +A+  FGKP  +NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP R
Sbjct  505  TWDKAEADLKEAIEAFGKPLVLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPIR  564

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNL Y+AEDE+K+ RPVMIHRA+LGSVERMFAILLEH+KGKWPFW+SPRQA+VCP+S+KS
Sbjct  565  FNLEYAAEDEAKKSRPVMIHRAVLGSVERMFAILLEHYKGKWPFWISPRQAIVCPISEKS  624

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q Y  +++ +I +AGF+VD D +DR I KKVREAQ+AQYNYILVVGE EA TG+VSVRVR
Sbjct  625  QQYAEKVQKQIKDAGFYVDADLTDRKIDKKVREAQLAQYNYILVVGETEAATGQVSVRVR  684

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D   H V ++++LL  FK   A +
Sbjct  685  DNAAHSVKSIEDLLEEFKAKTAEF  708



>emb|CAA74705.1| threonyl-tRNA synthetase [Arabidopsis thaliana]
Length=709

 Score =   307 bits (786),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAEA L +A+  FGKP  +NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP R
Sbjct  505  TWDKAEADLKEAIEAFGKPLVLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPIR  564

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNL Y+AEDE+K+ RPVMIHRA+LGSVERMFAILLEH+KGKWPFW+SPRQA+VCP+S+KS
Sbjct  565  FNLEYAAEDEAKKSRPVMIHRAVLGSVERMFAILLEHYKGKWPFWISPRQAIVCPISEKS  624

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q Y  +++ +I +AGF+VD D +DR I KKVREAQ+AQYNYILVVGE EA TG+VSVRVR
Sbjct  625  QQYAEKVQKQIKDAGFYVDADLTDRKIDKKVREAQLAQYNYILVVGETEAATGQVSVRVR  684

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D   H V ++++LL  FK   A +
Sbjct  685  DNAAHSVKSIEDLLEEFKAKTAEF  708



>ref|XP_010027608.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X1 [Eucalyptus grandis]
 ref|XP_010027609.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X1 [Eucalyptus grandis]
Length=505

 Score =   301 bits (771),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAE+ALT+ALNEFGK W+ +EG+GAFYGPKIDI+V DA  RKFQCATLQLDFQLP R
Sbjct  301  TWEKAESALTEALNEFGKRWQKDEGEGAFYGPKIDITVFDAFNRKFQCATLQLDFQLPVR  360

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F LSY+AE ESK E PVMIHRA+LGSVERMFAILLEH++GKWPFWLSPRQA+V PVS+KS
Sbjct  361  FGLSYTAEYESKSETPVMIHRAVLGSVERMFAILLEHYQGKWPFWLSPRQAIVFPVSEKS  420

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            ++Y +++RD+IH+AGF+VD D +DR IQ+KV EA++ QYNYILVVGE+ A TG+V+V  R
Sbjct  421  RSYSLKVRDQIHDAGFYVDFDETDRKIQEKVSEARLVQYNYILVVGEEAAGTGQVTVHAR  480

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  D  VMT+ +LL  FK+  A++
Sbjct  481  DEADKIVMTIADLLKVFKEKSAAF  504



>ref|XP_007199721.1| hypothetical protein PRUPE_ppa002288mg [Prunus persica]
 gb|EMJ00920.1| hypothetical protein PRUPE_ppa002288mg [Prunus persica]
Length=691

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 172/205 (84%), Gaps = 1/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAEAAL +AL EFGKPWE+NEGDGAFYGPKIDI+V DA+ R  Q ATLQLDFQLP R
Sbjct  486  TWKKAEAALKEALIEFGKPWEVNEGDGAFYGPKIDITVSDALSRDHQLATLQLDFQLPDR  545

Query  523  FNLSYSAEDE-SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDK  347
            F L YSAE E  K ERPVMIHRA+LGSVERM A+LLEH+KGKWPFWLSPRQA+VCPVS  
Sbjct  546  FKLYYSAEGEDGKMERPVMIHRAVLGSVERMLAVLLEHYKGKWPFWLSPRQAIVCPVSHT  605

Query  346  SQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
            +  Y +++RD IH+AG++VDVDTSD+TIQKKVR+AQ+AQYNYILVVG +E   G+VSVRV
Sbjct  606  ALPYALQVRDCIHQAGYYVDVDTSDKTIQKKVRQAQIAQYNYILVVGGEEVQNGQVSVRV  665

Query  166  RDIPDHKVMTVDELLAHFKDLMASY  92
            RD  D  VM+++ LL HFKD + ++
Sbjct  666  RDKGDVTVMSMESLLQHFKDQVEAF  690



>ref|XP_010493938.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Camelina 
sativa]
Length=712

 Score =   306 bits (783),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAEA L +A+  FGKP  +NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP R
Sbjct  508  TWDKAEADLKEAIEAFGKPLVLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPDR  567

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L Y+AEDE+KR +PVMIHRA+LGSVERMFAILLEH+KGKWPFW+SPRQA+VCP+S+KS
Sbjct  568  FKLEYAAEDEAKRVKPVMIHRAVLGSVERMFAILLEHYKGKWPFWISPRQAIVCPISEKS  627

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q Y  +++  IH+AGF+VD D +DR I KKVREAQ+AQYNYILVVGE EA TG+VSVR+R
Sbjct  628  QKYAEKVQKEIHDAGFYVDADLTDRKIDKKVREAQLAQYNYILVVGETEAATGQVSVRLR  687

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D   H V ++++LL  FK   A +
Sbjct  688  DSAAHSVKSIEDLLEEFKAKTAEF  711



>ref|XP_007200687.1| hypothetical protein PRUPE_ppa017189mg [Prunus persica]
 gb|EMJ01886.1| hypothetical protein PRUPE_ppa017189mg [Prunus persica]
Length=689

 Score =   303 bits (777),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 173/205 (84%), Gaps = 1/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAEAAL +AL EFGKPWE+NEGDGAFYGPKIDI+V DA+ R  Q ATLQLDFQLP R
Sbjct  484  TWKKAEAALKEALIEFGKPWEVNEGDGAFYGPKIDITVSDALNRDHQLATLQLDFQLPDR  543

Query  523  FNLSYSAEDE-SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDK  347
            F L YSAE E  K ERPVMIHRA+LGSVERM A+LLEH+KGKWPFWLSPRQA+VCPVS  
Sbjct  544  FKLYYSAEGEDGKMERPVMIHRAVLGSVERMLAVLLEHYKGKWPFWLSPRQAIVCPVSHT  603

Query  346  SQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
            +  Y +++RD++H+AG++VDVDTSD+TIQKKVR+AQ+AQYNYILVVG +E   G+VSVRV
Sbjct  604  ALPYALQVRDQLHQAGYYVDVDTSDKTIQKKVRQAQMAQYNYILVVGAEEVQNGQVSVRV  663

Query  166  RDIPDHKVMTVDELLAHFKDLMASY  92
            RD  D  VM+++ LL HF+D + ++
Sbjct  664  RDKGDVTVMSMEGLLQHFEDQVEAF  688



>ref|XP_010455043.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Camelina sativa]
Length=716

 Score =   303 bits (777),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAEA L +A+  FGKP  +N+GDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP R
Sbjct  512  TWDKAEADLKEAIEAFGKPLVLNKGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPAR  571

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L Y+AEDE++R +PVMIHRA+LGSVERMFAILLEH+KGKWPFW+SPRQA+VCP+S+KS
Sbjct  572  FKLEYAAEDEAQRGKPVMIHRAVLGSVERMFAILLEHYKGKWPFWISPRQAIVCPISEKS  631

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q Y  +++  IH+AGF+VD D +DR I KKVREAQ+AQYNYILVVGE EA TG+VSVR+R
Sbjct  632  QKYAEKVQKEIHDAGFYVDADLTDRKIDKKVREAQLAQYNYILVVGETEAATGQVSVRLR  691

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D   H V ++++LL  FK   A +
Sbjct  692  DSAAHSVKSIEDLLEEFKAKTAEF  715



>ref|XP_001784310.1| predicted protein [Physcomitrella patens]
 gb|EDQ50872.1| predicted protein [Physcomitrella patens]
Length=685

 Score =   299 bits (765),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W +AE AL  ALN FGKPW+INE DGAFYGPKIDI+V DA+KRKFQCAT+QLDFQLP R
Sbjct  481  TWNRAEKALEAALNAFGKPWQINEADGAFYGPKIDITVFDALKRKFQCATIQLDFQLPIR  540

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNLSYS EDE+KRE+PV+IHRAILGSVERMFAILLEH+ GKWPFWLSPRQ +VCPVS+K 
Sbjct  541  FNLSYSTEDEAKREKPVIIHRAILGSVERMFAILLEHYAGKWPFWLSPRQCIVCPVSEKF  600

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              Y +E+RD I+ AG+  + D +DR +QKK+REAQ+AQ+NYILVVGE+E +  +V++R R
Sbjct  601  THYAVEVRDAINAAGYFCEADVTDRKLQKKIREAQLAQFNYILVVGEEETSKKQVNIRTR  660

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D   H   +V ELLA F+   A Y+
Sbjct  661  DNVVHGTKSVTELLADFQKETAEYR  685



>gb|AAB61048.1| Similar to threonyl-tRNA synthetase; coded for by A. thaliana 
cDNA R65376 [Arabidopsis thaliana]
Length=702

 Score =   298 bits (762),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/217 (65%), Positives = 171/217 (79%), Gaps = 13/217 (6%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAEA L +A+  FGKP  +NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP R
Sbjct  485  TWDKAEADLKEAIEAFGKPLVLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPIR  544

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNL Y+AEDE+K+ RPVMIHRA+LGSVERMFAILLEH+KGKWPFW+SPRQA+VCP+S+KS
Sbjct  545  FNLEYAAEDEAKKSRPVMIHRAVLGSVERMFAILLEHYKGKWPFWISPRQAIVCPISEKS  604

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKK-------------VREAQVAQYNYILVVGE  203
            Q Y  +++ +I +AGF+VD D +DR I KK             VREAQ+AQYNYILVVGE
Sbjct  605  QQYAEKVQKQIKDAGFYVDADLTDRKIDKKVNDFGSCSKFCSVVREAQLAQYNYILVVGE  664

Query  202  KEATTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  92
             EA TG+VSVRVRD   H V ++++LL  FK   A +
Sbjct  665  TEAATGQVSVRVRDNAAHSVKSIEDLLEEFKAKTAEF  701



>ref|XP_010497266.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic, partial 
[Camelina sativa]
Length=260

 Score =   282 bits (721),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 165/208 (79%), Gaps = 5/208 (2%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W+ AE  L  AL++FGKPW IN+GDGAFYGPKIDI+V DAMKRKFQCATLQLDFQLP+RF
Sbjct  52   WDMAEKDLKKALDDFGKPWVINKGDGAFYGPKIDITVSDAMKRKFQCATLQLDFQLPERF  111

Query  520  NLSYSAE-DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
             L Y  +  + K  RPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA+VC +S+  
Sbjct  112  KLKYKTKVKQDKPVRPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQAIVCSLSENY  171

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             +Y  E++ +IH+AG++VD+D SDR+I KKV EA+ A YNYILVVG+KEATTG+V+VR+R
Sbjct  172  SSYAKEVQKQIHDAGYYVDIDESDRSISKKVAEARAAPYNYILVVGQKEATTGQVTVRLR  231

Query  163  DIP----DHKVMTVDELLAHFKDLMASY  92
            + P    D   M++D LL  FK    +Y
Sbjct  232  EDPAGRKDLPEMSIDSLLDEFKYKTVNY  259



>gb|EMT11254.1| Threonyl-tRNA synthetase, mitochondrial [Aegilops tauschii]
Length=1098

 Score =   299 bits (766),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 163/195 (84%), Gaps = 0/195 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W KAE  LT+ALNEFGKPW+INE DGAFYGPKIDI V DA+KRKFQCATLQLDFQLP R
Sbjct  437  TWNKAEQQLTEALNEFGKPWKINEADGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLR  496

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC VS  S
Sbjct  497  FKLTYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCCVSANS  556

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              Y  E+  +I  AGFHVD+D +DRTIQKKVREAQ+AQ+NYILVVG KEA +G+VS+RVR
Sbjct  557  LTYAKEVHAQIRAAGFHVDIDMTDRTIQKKVREAQLAQFNYILVVGAKEAESGKVSLRVR  616

Query  163  DIPDHKVMTVDELLA  119
            D  D    ++ +++A
Sbjct  617  DRADLSTESIADVIA  631



>gb|KDO82535.1| hypothetical protein CISIN_1g0066801mg, partial [Citrus sinensis]
Length=266

 Score =   279 bits (714),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WEKAEAALT+ALNEFGKPW+INEGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP R
Sbjct  87   TWEKAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPDR  146

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNL YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS
Sbjct  147  FNLGYSAEDEAKTERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKS  206

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKV  251
            Q Y +++RD I+ AG++VDVDT+DR IQKKV
Sbjct  207  QPYALQVRDHIYRAGYYVDVDTTDRKIQKKV  237



>emb|CDY19754.1| BnaA09g04070D [Brassica napus]
Length=609

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 164/205 (80%), Gaps = 6/205 (3%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAE  L  AL+ FGK W +NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP R
Sbjct  411  TWDKAENDLKIALDAFGKKWVLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPDR  470

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L YSA+DE+KR+RPVMIHRA+LGSVERMFAI+LEH+KGKWPFWLSPRQA+VCP+S KS
Sbjct  471  FKLEYSADDEAKRQRPVMIHRAVLGSVERMFAIVLEHYKGKWPFWLSPRQAIVCPISKKS  530

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            + Y ++++ +IHEAG++      +  +   VREAQ+AQYNYILVVGE EA TG+VSVR+R
Sbjct  531  EEYALQVKKQIHEAGYY------ETILGLGVREAQLAQYNYILVVGETEAATGQVSVRIR  584

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D   H V +++ LL  FK   A Y+
Sbjct  585  DSAAHSVKSIENLLEEFKTKTAEYQ  609



>ref|XP_010476961.1| PREDICTED: LOW QUALITY PROTEIN: probable threonine--tRNA ligase, 
cytoplasmic [Camelina sativa]
Length=453

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 165/208 (79%), Gaps = 5/208 (2%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W+ AE  L  AL++FGKPW IN+GDGAFYGPKIDI+V DAMKRKFQCATLQLDFQLP+RF
Sbjct  245  WDMAEKDLKKALDDFGKPWVINKGDGAFYGPKIDITVSDAMKRKFQCATLQLDFQLPERF  304

Query  520  NLSYSAE-DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
             L Y  +  + K  RPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA+VC +S+  
Sbjct  305  KLKYKTKVKQDKPVRPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQAIVCSLSENY  364

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             +Y  E++ +IH+AG++VD+D SDR+I KKV EA+ A YNYILVVG+KEATTG+V+VR+R
Sbjct  365  SSYAKEVQKQIHDAGYYVDIDESDRSISKKVAEARAAPYNYILVVGQKEATTGQVTVRLR  424

Query  163  DIP----DHKVMTVDELLAHFKDLMASY  92
            + P    D   M++D LL  FK    +Y
Sbjct  425  EDPAGRKDLPEMSIDSLLDEFKYKTVNY  452



>ref|XP_002989766.1| hypothetical protein SELMODRAFT_447798 [Selaginella moellendorffii]
 gb|EFJ09243.1| hypothetical protein SELMODRAFT_447798 [Selaginella moellendorffii]
Length=564

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 162/204 (79%), Gaps = 1/204 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE AL DALN   KPW++NEGDGAFYGPKIDI V DA+ RKFQCAT+QLDFQ P RF
Sbjct  359  WDRAEGALADALNAHAKPWQMNEGDGAFYGPKIDIQVSDALNRKFQCATIQLDFQSPIRF  418

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
             LSYSAEDE+K ERPV+IHRAILGS+ERMFAILLE   GKWPFWLSPRQA+V  +S+K +
Sbjct  419  KLSYSAEDEAKIERPVIIHRAILGSIERMFAILLEDNAGKWPFWLSPRQAIVLTISEKFK  478

Query  340  AYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRD  161
             Y  E+R ++H AGF VDVD SDR + KKVREAQ+A YNY+LVVG  E   GEV+VR R 
Sbjct  479  DYAEEVRAKLHAAGFEVDVDVSDRKVDKKVREAQMAHYNYLLVVGAMEQEKGEVNVRTRG  538

Query  160  IPDHK-VMTVDELLAHFKDLMASY  92
                +  +T+++L+A F+DL+A+Y
Sbjct  539  SKGQRGCITIEKLIAEFQDLVANY  562



>gb|EMS59266.1| Threonyl-tRNA synthetase, mitochondrial [Triticum urartu]
Length=1047

 Score =   285 bits (730),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 150/175 (86%), Gaps = 0/175 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W KAE  LT+ALNEFGKPW+INE DGAFYGPKIDI V DA+KRKFQCATLQLDFQLP R
Sbjct  458  TWNKAEQQLTEALNEFGKPWKINEADGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLR  517

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC VS  S
Sbjct  518  FKLTYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCCVSANS  577

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEV  179
              Y  E+  +I  AGFHVD+D +DRTIQKKVREAQ+AQ+NYILVVG KEA +G++
Sbjct  578  LTYAKEVHAQIRAAGFHVDIDMTDRTIQKKVREAQLAQFNYILVVGAKEAESGKI  632



>ref|XP_004304268.2| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011467923.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011467924.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=746

 Score =   279 bits (713),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 168/208 (81%), Gaps = 4/208 (2%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQ-  527
            +W+KAEA LT+ALN+FG PW+INEGDGAFYGPKID  VC+A+K+KFQCAT+QLDFQLP  
Sbjct  538  TWDKAEAILTEALNDFGMPWQINEGDGAFYGPKIDFGVCNALKKKFQCATIQLDFQLPDC  597

Query  526  -RFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSD  350
             +F+L Y+++ + K E+PVMIHRA+ GS ER   ILLEH+KGKWPFWLSPRQ +VC V+ 
Sbjct  598  AQFDLHYTSDKQGKGEKPVMIHRAVFGSFERFIGILLEHYKGKWPFWLSPRQLIVCSVTQ  657

Query  349  KSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  170
            + +AY +++++RI   G+HVDVD SDR++ KK+REAQVAQYNY+LVVG+KEA + +VSVR
Sbjct  658  EFEAYAVQVQERIRRDGYHVDVDISDRSMSKKIREAQVAQYNYVLVVGDKEAKSDQVSVR  717

Query  169  VRDIPDH--KVMTVDELLAHFKDLMASY  92
             RD  D    VM++D+LL   K+ + ++
Sbjct  718  ARDKQDELMGVMSIDDLLRELKNKVEAF  745



>ref|XP_002890262.1| hypothetical protein ARALYDRAFT_889225 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66521.1| hypothetical protein ARALYDRAFT_889225 [Arabidopsis lyrata subsp. 
lyrata]
Length=620

 Score =   275 bits (703),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 167/203 (82%), Gaps = 4/203 (2%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W+KAE  L +ALN+FGK W  N+GDG FYGPKIDI+V DAMKRKFQCAT+QLDF LP RF
Sbjct  421  WDKAEKDLEEALNDFGKTWVKNKGDGEFYGPKIDITVYDAMKRKFQCATIQLDFHLPDRF  480

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
             L YSAEDE++ E  V+IHRA+LGSVER+FAILLE +KGK PFWLSPRQA+VC VS+ S+
Sbjct  481  KLEYSAEDETEIESSVLIHRAVLGSVERLFAILLEQYKGKLPFWLSPRQAIVCSVSEDSR  540

Query  340  AYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRD  161
            +Y  ++RD+IHEAG++VDVDT+DRT+ +KV+EAQVAQYNYIL VG++EA TG+V+V +RD
Sbjct  541  SYANKVRDQIHEAGYYVDVDTTDRTVSEKVQEAQVAQYNYILAVGDEEARTGQVTVWLRD  600

Query  160  IPDHKVMTVDELLAHFKDLMASY  92
                ++M+ + LL  FK   A++
Sbjct  601  ----EMMSFETLLDEFKLKTANF  619



>ref|XP_002892976.1| hypothetical protein ARALYDRAFT_472010 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69235.1| hypothetical protein ARALYDRAFT_472010 [Arabidopsis lyrata subsp. 
lyrata]
Length=458

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 163/202 (81%), Gaps = 5/202 (2%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+KAE  L  AL+ FGKPW IN+GDGAFYGPKIDI+V DAMKRKFQCATLQLDFQLP  
Sbjct  251  TWDKAEKDLEKALDNFGKPWVINKGDGAFYGPKIDITVSDAMKRKFQCATLQLDFQLPAC  310

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L Y  + ++++ERPVMIHRA+LGS+ERMFAILLEH+KG WPFWLSPRQA+VC +S+  
Sbjct  311  FKLKYITK-KNEKERPVMIHRAVLGSIERMFAILLEHYKGIWPFWLSPRQAIVCSLSEDY  369

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             +Y  +++ +I EAG++VD+D SDR+I KKV +A+ A YNYILVVG+KEATTG+V+VR+R
Sbjct  370  SSYAKQVQKQIQEAGYYVDIDESDRSICKKVADARAAPYNYILVVGQKEATTGQVTVRLR  429

Query  163  DIP----DHKVMTVDELLAHFK  110
            + P    D   M++D LL  FK
Sbjct  430  EDPAGRKDLPEMSIDSLLDEFK  451



>ref|XP_006303967.1| hypothetical protein CARUB_v10008857mg [Capsella rubella]
 gb|EOA36865.1| hypothetical protein CARUB_v10008857mg [Capsella rubella]
Length=521

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 163/208 (78%), Gaps = 4/208 (2%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W + E  L  AL EFGKP+ +N+GDG F GPKIDI++ DAMK+  QC TLQLDFQLP  
Sbjct  313  TWVRVEEDLKKALEEFGKPFLLNKGDGEFCGPKIDITIFDAMKKNIQCGTLQLDFQLPDS  372

Query  523  FNLSYSA--EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSD  350
            F L YS+  EDE KRERPVMIHRA+LGSVE M AILLEH++GKWPFWLSPRQA+VC  S 
Sbjct  373  FKLEYSSSTEDEVKRERPVMIHRAVLGSVEHMIAILLEHYEGKWPFWLSPRQAIVCSSSK  432

Query  349  KSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  170
            K  +Y  ++RD+IHEAG++VDVD SDR I++KVREAQVAQYN++LVVG++EATTG+V+V+
Sbjct  433  KHHSYAEKVRDQIHEAGYYVDVDVSDRDIREKVREAQVAQYNFVLVVGDEEATTGQVTVQ  492

Query  169  VR--DIPDHKVMTVDELLAHFKDLMASY  92
            +R  D     VM+++ LL  FK   A+Y
Sbjct  493  LREEDGSYFPVMSIETLLDVFKLKSANY  520



>ref|XP_010480524.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Camelina 
sativa]
Length=668

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 165/205 (80%), Gaps = 6/205 (3%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W+KAE AL  AL +FGKP+ IN+GDG  YGPKIDI++ DAMKR FQCATLQLDFQLP+ F
Sbjct  467  WDKAEVALEKALKDFGKPFLINKGDGEIYGPKIDITLSDAMKRNFQCATLQLDFQLPESF  526

Query  520  NLSYS--AEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDK  347
             L YS  AEDE+K E+PV+IHRA+LGSVERMF+ILLE  KGKWPFWLSPRQA+VC  S  
Sbjct  527  TLEYSSSAEDETKSEQPVLIHRAVLGSVERMFSILLEQCKGKWPFWLSPRQAIVCSSSKD  586

Query  346  SQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
             ++Y  ++RD+IH+AG++VD DT+DR + +KV+EAQVA+YNYILVVGE++A  G+V+V +
Sbjct  587  DRSYADKVRDQIHKAGYYVDADTTDRNVSEKVKEAQVARYNYILVVGEEDARRGQVTVWL  646

Query  166  RDIPDHKVMTVDELLAHFKDLMASY  92
            RD    +VM+++ LL  FK   A++
Sbjct  647  RD----EVMSIEALLDEFKLKTANF  667



>ref|XP_006303165.1| hypothetical protein CARUB_v10008521mg [Capsella rubella]
 gb|EOA36063.1| hypothetical protein CARUB_v10008521mg [Capsella rubella]
Length=664

 Score =   267 bits (682),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 165/205 (80%), Gaps = 6/205 (3%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE AL  AL +FGKP+ +N+GDGAF+GPK+DI+V DAMKR FQCATLQLDFQLP  F
Sbjct  463  WDRAEGALEKALKDFGKPFFVNKGDGAFHGPKVDITVSDAMKRNFQCATLQLDFQLPDCF  522

Query  520  NLSYS--AEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDK  347
             L YS  AEDE+KRE+PV+IHRA+LGSVERMFAILLE  KGKWPFWLSPRQ +VC +   
Sbjct  523  KLEYSSLAEDETKREKPVLIHRAVLGSVERMFAILLEQNKGKWPFWLSPRQVIVCSLLKD  582

Query  346  SQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
             ++Y  ++RD+IH+AG++ DVDT+DR I +KV EAQVA+YNYILVVG++EA  G+V+V +
Sbjct  583  DRSYAEKVRDQIHQAGYYDDVDTTDRNISEKVEEAQVARYNYILVVGDEEARRGQVTVWL  642

Query  166  RDIPDHKVMTVDELLAHFKDLMASY  92
            RD    +VM+++ LL  FK   A++
Sbjct  643  RD----EVMSIETLLDEFKLKTANF  663



>emb|CDY21715.1| BnaA09g44660D [Brassica napus]
Length=628

 Score =   264 bits (674),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 157/206 (76%), Gaps = 2/206 (1%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W++AE  L +AL +FGKP+ +N G G FYGPKIDI+V DAMK   QCATLQLDFQLP  
Sbjct  422  TWDRAERDLEEALEDFGKPFLVNRGAGEFYGPKIDITVSDAMKSYVQCATLQLDFQLPAL  481

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L Y+A  E   + PVMIHRA+LGSVERMF  L+EH+KGKWPFWLSPRQA+VC +S  S
Sbjct  482  FELEYTAMAEGSSDTPVMIHRAVLGSVERMFTTLVEHYKGKWPFWLSPRQAIVCSLSKDS  541

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              Y  ++R++IHEAG++VDVD +DR I KKVREAQVAQYNYILVVG +E TTG V+VR R
Sbjct  542  HEYAEKVREQIHEAGYYVDVDITDRNISKKVREAQVAQYNYILVVGAEETTTGHVTVRRR  601

Query  163  --DIPDHKVMTVDELLAHFKDLMASY  92
              D+ +  V++V+ LL  FK   A++
Sbjct  602  NEDLSEFPVLSVENLLDEFKLKTANF  627



>ref|XP_009117622.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Brassica 
rapa]
Length=628

 Score =   263 bits (672),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 157/206 (76%), Gaps = 2/206 (1%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W++AE  L +AL +FGKP+ +N G G FYGPKIDI+V DAMK   QCATLQLDFQLP  
Sbjct  422  TWDRAERDLEEALEDFGKPFLVNRGAGEFYGPKIDITVSDAMKSYVQCATLQLDFQLPAL  481

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L Y+A  E   + PVMIHRA+LGSVERMF  L+EH+KGKWPFWLSPRQA+VC +S  S
Sbjct  482  FELEYTAMAEGSSDTPVMIHRAVLGSVERMFTTLVEHYKGKWPFWLSPRQAIVCSLSKDS  541

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              Y  ++R++IHEAG++VDVD +DR I KKVREAQVAQYNYIL+VG +E TTG V+VR R
Sbjct  542  HEYAEKVREQIHEAGYYVDVDITDRNISKKVREAQVAQYNYILLVGAEETTTGHVTVRRR  601

Query  163  --DIPDHKVMTVDELLAHFKDLMASY  92
              D+ +  V++V+ LL  FK   A++
Sbjct  602  NEDLSEFPVLSVENLLDEFKLKTANF  627



>ref|XP_001696198.1| hypothetical protein CHLREDRAFT_167047 [Chlamydomonas reinhardtii]
 gb|EDP08175.1| predicted protein [Chlamydomonas reinhardtii]
Length=688

 Score =   262 bits (669),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 148/196 (76%), Gaps = 4/196 (2%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W KAE ALTDALN  GK W +N GDGAFYGPKIDI+V DA++RKFQCAT+QLDFQLP RF
Sbjct  463  WNKAEQALTDALNSTGKAWVLNPGDGAFYGPKIDITVYDALRRKFQCATVQLDFQLPIRF  522

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
             L Y++E     ERPV++HRA+LGSVERMFAIL EHF GKWPFWL+PRQ MV P+S+ S 
Sbjct  523  GLEYASE-AGTLERPVIVHRAVLGSVERMFAILTEHFAGKWPFWLNPRQVMVVPISENSV  581

Query  340  AYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRD  161
             Y   +R  +  AG H DVD++DR +QKKVREAQ+AQYNYILVVGE E T   V+VR RD
Sbjct  582  EYAFTVRKELRSAGLHCDVDSTDRKMQKKVREAQLAQYNYILVVGEAEKTAQTVNVRTRD  641

Query  160  IPDH---KVMTVDELL  122
               H   K+  V EL+
Sbjct  642  NVVHGMFKLSDVRELM  657



>ref|XP_002991732.1| hypothetical protein SELMODRAFT_134156 [Selaginella moellendorffii]
 gb|EFJ07136.1| hypothetical protein SELMODRAFT_134156 [Selaginella moellendorffii]
Length=647

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE AL DALN   KPW++NEGDGAFYGPKIDI V DA+ RKFQCAT+QLDFQ P RF
Sbjct  467  WDRAEGALADALNAHAKPWQMNEGDGAFYGPKIDIQVSDALNRKFQCATIQLDFQSPIRF  526

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
             LSYSAEDE+K ERPV+IHRAILGSVERMFAILLE   GKWPFWLSPRQA+V  +S+K +
Sbjct  527  KLSYSAEDEAKIERPVIIHRAILGSVERMFAILLEDNVGKWPFWLSPRQAIVLTISEKFK  586

Query  340  AYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  170
             Y  E+R ++H AGF VDVD SDR + KKVREAQ+A YNY+LVVG  E   GEV  +
Sbjct  587  DYAEEVRAKLHAAGFEVDVDVSDRKVDKKVREAQMAHYNYLLVVGAMEQEKGEVRTK  643



>ref|XP_002989765.1| hypothetical protein SELMODRAFT_130418 [Selaginella moellendorffii]
 gb|EFJ09242.1| hypothetical protein SELMODRAFT_130418 [Selaginella moellendorffii]
Length=647

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE AL DALN   KPW++NEGDGAFYGPKIDI V DA+ RKFQCAT+QLDFQ P RF
Sbjct  467  WDRAEGALADALNAHAKPWQMNEGDGAFYGPKIDIQVSDALNRKFQCATIQLDFQSPIRF  526

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
             LSYSAEDE+K ERPV+IHRAILGS+ERMFAILLE   GKWPFWLSPRQA+V  +S+K +
Sbjct  527  KLSYSAEDEAKIERPVIIHRAILGSIERMFAILLEDNAGKWPFWLSPRQAIVLTISEKFK  586

Query  340  AYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  170
             Y  E+R ++H AGF VDVD SDR + KKVREAQ+A YNY+LVVG  E   GEV  +
Sbjct  587  DYAEEVRAKLHAAGFEVDVDVSDRKVDKKVREAQMAHYNYLLVVGAMEQEKGEVRTK  643



>dbj|BAN16553.1| ADB6244 [Acytostelium subglobosum]
Length=339

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 146/204 (72%), Gaps = 0/204 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W+ AE  L DALN+FGKPW++N GDGAFYGPKIDI + D +KR  QCAT+QLDFQLP RF
Sbjct  136  WDMAENQLRDALNKFGKPWKLNPGDGAFYGPKIDIHITDVLKRSHQCATIQLDFQLPIRF  195

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
             L Y      +R RPV+IHRAILGSVERM AIL+EH  GKWPFWLSPRQ +V  VS+K  
Sbjct  196  ELEYMGSGPEERHRPVIIHRAILGSVERMMAILIEHTGGKWPFWLSPRQVLVATVSEKYI  255

Query  340  AYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRD  161
             YG ++   + +AGF  +VD SD+T+ KK+REAQ+AQYNYILVVGE+E T   V+VR RD
Sbjct  256  EYGQQVAASLTDAGFFCEVDVSDKTLPKKIREAQLAQYNYILVVGEEETTNKTVNVRTRD  315

Query  160  IPDHKVMTVDELLAHFKDLMASYK  89
                  ++V  L+   K +   +K
Sbjct  316  NAVRGSISVQALIDELKQVSKEFK  339



>ref|XP_002946221.1| hypothetical protein VOLCADRAFT_102823 [Volvox carteri f. nagariensis]
 gb|EFJ53216.1| hypothetical protein VOLCADRAFT_102823 [Volvox carteri f. nagariensis]
Length=691

 Score =   259 bits (663),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 148/192 (77%), Gaps = 1/192 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE ALT+ALN  G+ W +N GDGAFYGPKIDI+V DA++RKFQCAT+QLDFQLP RF
Sbjct  466  WNRAETALTEALNSTGREWVLNPGDGAFYGPKIDITVYDALRRKFQCATVQLDFQLPIRF  525

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
             L Y++E  +  ERPV++HRA+LGSVERMFAIL EHF GKWPFWL+PRQ MV P+S+ S 
Sbjct  526  GLEYASESGT-LERPVIVHRAVLGSVERMFAILTEHFAGKWPFWLNPRQVMVVPISENSS  584

Query  340  AYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRD  161
             Y  ++R  +  AG HVDVD SDR +QKKVREAQ+AQYNYILVVGE E     V+VR RD
Sbjct  585  QYAFDVRRELRAAGLHVDVDASDRKMQKKVREAQLAQYNYILVVGEAEKAEQTVNVRTRD  644

Query  160  IPDHKVMTVDEL  125
               H +  ++++
Sbjct  645  NVVHGMFKLEDV  656



>ref|XP_005844334.1| hypothetical protein CHLNCDRAFT_49107 [Chlorella variabilis]
 gb|EFN52232.1| hypothetical protein CHLNCDRAFT_49107 [Chlorella variabilis]
Length=570

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 152/201 (76%), Gaps = 5/201 (2%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AEAAL +ALN  G+ WE+N GDGAFYGPKIDI+V DA++RK+QCAT+QLDFQ P RF
Sbjct  346  WNQAEAALEEALNATGREWEMNPGDGAFYGPKIDITVFDALRRKYQCATVQLDFQFPIRF  405

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL Y AED S R+RPV++HRAILGS ERMFAIL EH+ GKWP W+SPRQ M+ P+S+   
Sbjct  406  NLEYVAEDGS-RQRPVIVHRAILGSAERMFAILTEHWGGKWPLWISPRQVMIVPISEAVY  464

Query  340  AYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRD  161
             Y   +R ++  AGFHVD D +DR +QKKVREAQ++QYNYILVVGE+E   G V+VR RD
Sbjct  465  DYASAVRRQLRSAGFHVDADMADRKMQKKVREAQLSQYNYILVVGEEERVAGTVNVRTRD  524

Query  160  IPDHKVMTVDELLAHFKDLMA  98
               H + +    LA   D+M+
Sbjct  525  NQVHGMHS----LAGVIDVMS  541



>ref|NP_173238.1| threonyl-tRNA synthetase [Arabidopsis thaliana]
 sp|Q8GZ45.2|SYTC_ARATH RecName: Full=Probable threonine--tRNA ligase, cytoplasmic; AltName: 
Full=Threonyl-tRNA synthetase; Short=ThrRS [Arabidopsis 
thaliana]
 gb|AAF97275.1|AC034106_18 Strong similarity to threonyl-tRNA synthetase from Arabidopsis 
thaliana gb|Y14329 and is a member of the tRNA synthetase 
PF|00587 class II [Arabidopsis thaliana]
 gb|AEE29656.1| threonyl-tRNA synthetase [Arabidopsis thaliana]
Length=458

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 157/202 (78%), Gaps = 5/202 (2%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W KAE  L  AL++FGKPW I EGDGAFYGPKIDI+V DA  RKFQCAT+QLDFQLP  
Sbjct  251  TWAKAENDLEKALDDFGKPWVIKEGDGAFYGPKIDITVSDARNRKFQCATIQLDFQLPAC  310

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L Y +E +++ E PVMIH A+LGS+ERMFAILLEH+KG WPFWLSPRQA+VC +S+  
Sbjct  311  FKLKYLSE-KNEMEAPVMIHSAVLGSIERMFAILLEHYKGIWPFWLSPRQAIVCSLSEDC  369

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             +Y  +++ +I+E G++VD+D SDR+++KKV +A+ A YNYILVVG+KE  TG+V+VR+R
Sbjct  370  SSYAKQVQKQINEVGYYVDIDESDRSLRKKVADARDAPYNYILVVGQKEVATGQVTVRLR  429

Query  163  DIP----DHKVMTVDELLAHFK  110
            + P    D   M+++ LL  FK
Sbjct  430  EDPEGRKDLPEMSIESLLDEFK  451



>ref|XP_007044585.1| Threonyl-tRNA synthetase isoform 4 [Theobroma cacao]
 gb|EOY00417.1| Threonyl-tRNA synthetase isoform 4 [Theobroma cacao]
Length=616

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 150/204 (74%), Gaps = 31/204 (15%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WE+AEAALT+ALNE GKPW                               QLDFQLP R
Sbjct  443  TWERAEAALTEALNESGKPW-------------------------------QLDFQLPDR  471

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L YSAEDE+KRE+PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS KS
Sbjct  472  FKLEYSAEDEAKREKPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSAKS  531

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q Y  E++++IH AG++VDVD +DR IQKKVREAQ+AQYNYILVVGE+E  T +VSVRVR
Sbjct  532  QDYAREVQEQIHGAGYYVDVDLTDRKIQKKVREAQLAQYNYILVVGEEEMNTKQVSVRVR  591

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  D   M+++ LL H KD +A++
Sbjct  592  DKGDLTSMSIEGLLQHLKDEIAAF  615



>ref|XP_007044583.1| Threonyl-tRNA synthetase isoform 2 [Theobroma cacao]
 gb|EOY00415.1| Threonyl-tRNA synthetase isoform 2 [Theobroma cacao]
Length=645

 Score =   253 bits (647),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 150/204 (74%), Gaps = 31/204 (15%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +WE+AEAALT+ALNE GKPW                               QLDFQLP R
Sbjct  472  TWERAEAALTEALNESGKPW-------------------------------QLDFQLPDR  500

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L YSAEDE+KRE+PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS KS
Sbjct  501  FKLEYSAEDEAKREKPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSAKS  560

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            Q Y  E++++IH AG++VDVD +DR IQKKVREAQ+AQYNYILVVGE+E  T +VSVRVR
Sbjct  561  QDYAREVQEQIHGAGYYVDVDLTDRKIQKKVREAQLAQYNYILVVGEEEMNTKQVSVRVR  620

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D  D   M+++ LL H KD +A++
Sbjct  621  DKGDLTSMSIEGLLQHLKDEIAAF  644



>ref|XP_007514880.1| threonyl-tRNA synthetase [Bathycoccus prasinos]
 emb|CCO15120.1| threonyl-tRNA synthetase [Bathycoccus prasinos]
Length=715

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 151/194 (78%), Gaps = 1/194 (1%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W KAE AL  AL   GK WE+N GDGAFYGPKIDI+V DA++R+FQCAT+QLDFQLP R
Sbjct  486  TWNKAEMALEGALKASGKEWELNPGDGAFYGPKIDIAVFDALRRRFQCATVQLDFQLPIR  545

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F+L+Y  E  ++ ERP++IHRA+LGSVERMFAIL EH+ GKWP+WLSPRQ M+ P+S+ S
Sbjct  546  FDLAYQNE-HNEDERPIIIHRAVLGSVERMFAILTEHYAGKWPYWLSPRQVMIVPISELS  604

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              Y  ++R RI +AG HV+VD SDR +QKKVREAQ+ Q+NYILVVGE+E T   V+VR R
Sbjct  605  LEYAKDVRRRIRKAGHHVEVDASDRKMQKKVREAQLEQFNYILVVGEQEKTNDTVNVRTR  664

Query  163  DIPDHKVMTVDELL  122
            D   H    +++L+
Sbjct  665  DNQVHGERKLEDLI  678



>ref|XP_009117636.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X2 [Brassica rapa]
Length=435

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/225 (55%), Positives = 156/225 (69%), Gaps = 31/225 (14%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            WE++E  L +AL EFGKP+ +N G+GAF GPKIDI++ DAMKRKFQCA++QLDFQLP  F
Sbjct  207  WEESENDLVEALQEFGKPFIVNRGEGAFCGPKIDITLSDAMKRKFQCASIQLDFQLPDHF  266

Query  520  NLSYSAEDESKRE------------------RPVMIHRAILGSVERMFAILLEHFKGKWP  395
             L YS  DE K+E                  RPVMIHR +LGS ERM AILL H+KGKWP
Sbjct  267  KLRYSPSDEEKKENVMIHSKVLGTEDKEKGVRPVMIHRTVLGSFERMLAILLNHYKGKWP  326

Query  394  FWLSPRQAMVCPVSDKS--QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNY  221
            FW+SPRQ +VC  S+    ++Y  E+R +IHEAG+HVDVDT+DR I +KV EA++AQYNY
Sbjct  327  FWISPRQVIVCSSSNNENHRSYAEEVRRQIHEAGYHVDVDTTDRNISEKVGEAEIAQYNY  386

Query  220  ILVVGEKEATTGEVSVRVRD--------IPDHKVMTVDELLAHFK  110
            ILVVG++E  T +V+  +RD        +P   +M+VD LL  FK
Sbjct  387  ILVVGDEEVATRQVTALLRDSSCSDRSKVP---MMSVDALLDVFK  428



>ref|XP_011397153.1| Threonine-tRNA ligase, mitochondrial [Auxenochlorella protothecoides]
 gb|KFM24266.1| Threonine-tRNA ligase, mitochondrial [Auxenochlorella protothecoides]
Length=727

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 147/193 (76%), Gaps = 1/193 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W+ AE AL +AL+  G  WE+NEGDGAFYGPKIDI+V DA++RKFQCAT+QLDFQLP RF
Sbjct  511  WDAAEGALRNALDASGHAWELNEGDGAFYGPKIDITVHDALRRKFQCATVQLDFQLPLRF  570

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
             L Y AED    + PV+IHRA+LGSVERMFAIL E+F G+WP WLSPRQ MV P+SD S 
Sbjct  571  GLQYVAED-GGFQVPVIIHRAVLGSVERMFAILTENFAGRWPLWLSPRQVMVVPISDSSY  629

Query  340  AYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRD  161
             Y +E+RD +  AGFHV+VD +DR +QKKVREAQVAQ+NYILVVG  E     V+VR RD
Sbjct  630  DYALEVRDAVRGAGFHVEVDLADRKMQKKVREAQVAQFNYILVVGAAEREQRTVNVRTRD  689

Query  160  IPDHKVMTVDELL  122
               H    +D++L
Sbjct  690  NQVHGQRQLDDVL  702



>ref|XP_003080220.1| putative threonyl-tRNA synthetase (ISS) [Ostreococcus tauri]
Length=673

 Score =   252 bits (643),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 150/195 (77%), Gaps = 2/195 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W+KAEAALT ALN  G+ W++N GDGAFYGPKIDI+V DA+KR+FQCAT+QLDFQLP RF
Sbjct  461  WDKAEAALTAALNRSGRDWKLNPGDGAFYGPKIDITVFDALKRRFQCATVQLDFQLPIRF  520

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            +LSY  E+ ++  RP++IHRAILGSVERMF IL EHF GKWPFWLSP+Q M+ P+SD + 
Sbjct  521  DLSYVDEN-NEPTRPIIIHRAILGSVERMFGILTEHFAGKWPFWLSPKQVMIVPISDSAS  579

Query  340  A-YGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              Y ME++  + + GFHV+VD SDR +QKKVREAQ+ Q+NYILV GE E     V+VR R
Sbjct  580  GEYCMEVKRMLRKEGFHVEVDNSDRKMQKKVREAQLEQFNYILVCGESEKVNRTVNVRTR  639

Query  163  DIPDHKVMTVDELLA  119
            D   H    V++L+ 
Sbjct  640  DNKVHGEHKVEDLIT  654



>ref|XP_636821.1| threonyl-tRNA synthetase [Dictyostelium discoideum AX4]
 sp|Q54J66.1|SYTC1_DICDI RecName: Full=Probable threonine--tRNA ligase 1, cytoplasmic; 
AltName: Full=Threonyl-tRNA synthetase; Short=ThrRS [Dictyostelium 
discoideum]
 gb|EAL63315.1| threonyl-tRNA synthetase [Dictyostelium discoideum AX4]
Length=710

 Score =   252 bits (644),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 155/205 (76%), Gaps = 1/205 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W+ AEA+L  ALN+FGKPW++N  DGAFYGPKIDI + D +KR  QCAT+QLDFQLP RF
Sbjct  506  WDIAEASLEKALNKFGKPWKLNPKDGAFYGPKIDIHITDCLKRSHQCATIQLDFQLPIRF  565

Query  520  NLSYSAEDESK-RERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            +L Y ++D ++ ++RPV+IHRAILGSVERM AIL+EH  GKWP W+SPRQA+V  V+   
Sbjct  566  DLEYQSDDAAELKKRPVIIHRAILGSVERMMAILIEHTGGKWPLWVSPRQAIVVTVNKTH  625

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              YG ++   I +AGF+ D+D SD+TI KKVREAQ+AQYNYILVVG++E     V+VR R
Sbjct  626  NEYGQKVCKEISDAGFYCDIDDSDKTISKKVREAQLAQYNYILVVGQEEINGNTVNVRTR  685

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D      +TV++L++ FK L+  +K
Sbjct  686  DNVVRGSLTVNDLISEFKQLVKEFK  710



>emb|CEF98631.1| Anticodon-binding [Ostreococcus tauri]
Length=693

 Score =   251 bits (642),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 150/195 (77%), Gaps = 2/195 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W+KAEAALT ALN  G+ W++N GDGAFYGPKIDI+V DA+KR+FQCAT+QLDFQLP RF
Sbjct  481  WDKAEAALTAALNRSGRDWKLNPGDGAFYGPKIDITVFDALKRRFQCATVQLDFQLPIRF  540

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            +LSY  E+ ++  RP++IHRAILGSVERMF IL EHF GKWPFWLSP+Q M+ P+SD + 
Sbjct  541  DLSYVDEN-NEPTRPIIIHRAILGSVERMFGILTEHFAGKWPFWLSPKQVMIVPISDSAS  599

Query  340  A-YGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              Y ME++  + + GFHV+VD SDR +QKKVREAQ+ Q+NYILV GE E     V+VR R
Sbjct  600  GEYCMEVKRMLRKEGFHVEVDNSDRKMQKKVREAQLEQFNYILVCGESEKVNRTVNVRTR  659

Query  163  DIPDHKVMTVDELLA  119
            D   H    V++L+ 
Sbjct  660  DNKVHGEHKVEDLIT  674



>ref|XP_005648591.1| threonyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
 gb|EIE24047.1| threonyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
Length=765

 Score =   253 bits (645),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 146/193 (76%), Gaps = 0/193 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W+ AEA+L  AL+  G+PWE+N  DGAFYGPKIDI+V DA++RKFQCAT+QLDFQLP RF
Sbjct  540  WDAAEASLKQALDSTGQPWELNPADGAFYGPKIDITVFDALRRKFQCATVQLDFQLPIRF  599

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
             L Y+ +  ++ ERPV++HRAILGSVERMFAIL EH+ GKWPFWLSPRQ MV P+S+ S 
Sbjct  600  GLQYATDKLNEFERPVIVHRAILGSVERMFAILTEHYAGKWPFWLSPRQVMVVPISEASA  659

Query  340  AYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRD  161
             Y  E+R  +  A F VDVD +D  +QKKVREAQ+AQYNYILVVGEKE     V+VR RD
Sbjct  660  EYAQEVRRTLRNARFFVDVDLADNKMQKKVREAQLAQYNYILVVGEKEREQKTVNVRTRD  719

Query  160  IPDHKVMTVDELL  122
               H    + E++
Sbjct  720  NVVHGEHALSEVV  732



>ref|XP_004351232.1| threonyl-tRNA synthetase [Dictyostelium fasciculatum]
 gb|EGG14724.1| threonyl-tRNA synthetase [Dictyostelium fasciculatum]
Length=706

 Score =   251 bits (642),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 145/196 (74%), Gaps = 0/196 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W+KAE +L  AL  FGKPW++N GDGAFYGPKIDI + D +KR  QCAT+QLDFQLP RF
Sbjct  503  WDKAEKSLEVALTNFGKPWKLNPGDGAFYGPKIDIHITDVLKRSHQCATIQLDFQLPIRF  562

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
             L Y  +     +RPV+IHRAILGSVERM AIL+EH  GKWPFW+SPRQA++ PVS +  
Sbjct  563  ELEYMTDKAEDLQRPVIIHRAILGSVERMMAILIEHTGGKWPFWVSPRQAIIVPVSQQFN  622

Query  340  AYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRD  161
             Y  +L+ +I +AGF+ DVD SD+T+ KKVREAQ+AQYNYILVVG+KE     V VR RD
Sbjct  623  EYADQLQKKIVDAGFYCDVDGSDKTLPKKVREAQLAQYNYILVVGQKEKDENTVGVRTRD  682

Query  160  IPDHKVMTVDELLAHF  113
                  +++D LLA F
Sbjct  683  NVVRDAISLDALLAEF  698



>ref|XP_003288175.1| threonyl-tRNA synthetase [Dictyostelium purpureum]
 gb|EGC35308.1| threonyl-tRNA synthetase [Dictyostelium purpureum]
Length=713

 Score =   251 bits (642),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 154/205 (75%), Gaps = 1/205 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE +L  ALN FGKPW++N GDGAFYGPKIDI + D +KR  QCAT+QLDFQLP RF
Sbjct  509  WNEAEKSLEKALNRFGKPWQLNPGDGAFYGPKIDIQIYDCLKRAHQCATIQLDFQLPIRF  568

Query  520  NLSYSAEDESK-RERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            +L Y ++D +  ++RPV+IHRAILGSVERM AIL+EH  GKWPFW+SPRQA+V  V+ + 
Sbjct  569  DLEYQSDDATDVKKRPVIIHRAILGSVERMMAILMEHTAGKWPFWVSPRQAIVVTVAKQH  628

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              YG ++  +I E G++ D+D SD+TI KKVREAQ+AQYNYILVVG++E    +V+VR R
Sbjct  629  NEYGHKVAKQISELGYYCDIDESDKTIGKKVREAQLAQYNYILVVGQEEIDNNKVNVRTR  688

Query  163  DIPDHKVMTVDELLAHFKDLMASYK  89
            D      ++V+EL+A F  L   +K
Sbjct  689  DNVVRGSISVEELVAEFAVLSKEFK  713



>dbj|GAM29123.1| hypothetical protein SAMD00019534_122990 [Acytostelium subglobosum 
LB1]
Length=708

 Score =   251 bits (642),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 146/204 (72%), Gaps = 0/204 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W+ AE  L DALN+FGKPW++N GDGAFYGPKIDI + D +KR  QCAT+QLDFQLP RF
Sbjct  505  WDMAENQLRDALNKFGKPWKLNPGDGAFYGPKIDIHITDVLKRSHQCATIQLDFQLPIRF  564

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
             L Y      +R RPV+IHRAILGSVERM AIL+EH  GKWPFWLSPRQ +V  VS+K  
Sbjct  565  ELEYMGSGPEERHRPVIIHRAILGSVERMMAILIEHTGGKWPFWLSPRQVLVATVSEKYI  624

Query  340  AYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRD  161
             YG ++   + +AGF  +VD SD+T+ KK+REAQ+AQYNYILVVGE+E T   V+VR RD
Sbjct  625  EYGQQVAASLTDAGFFCEVDVSDKTLPKKIREAQLAQYNYILVVGEEETTNKTVNVRTRD  684

Query  160  IPDHKVMTVDELLAHFKDLMASYK  89
                  ++V  L+   K +   +K
Sbjct  685  NAVRGSISVQALIDELKQVSKEFK  708



>ref|XP_002677200.1| threonyl-tRNA synthetase [Naegleria gruberi]
 gb|EFC44456.1| threonyl-tRNA synthetase [Naegleria gruberi]
Length=672

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 154/205 (75%), Gaps = 2/205 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE  L  ALNEFG  W+ NEGDGAFYGPKIDI + DA+KR+ QCAT+QLDFQLP RF
Sbjct  469  WDEAEGQLEAALNEFGHSWQKNEGDGAFYGPKIDILISDALKREHQCATVQLDFQLPIRF  528

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            +L+Y+AED+++  RPV++HRAI GS+ER  AI  EHF GKWPFWLSPRQA+V PVS+K  
Sbjct  529  DLTYAAEDKTE-SRPVIVHRAIFGSLERFLAIATEHFGGKWPFWLSPRQAIVVPVSNKCN  587

Query  340  AYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRD  161
             Y  +++ R+HEA ++VDVD S   I KK+R AQ++QYNYILVVG KE  +  V++R+RD
Sbjct  588  EYAEKVQKRLHEAKYYVDVDLSSNRIDKKIRNAQLSQYNYILVVGPKEMESDSVNIRIRD  647

Query  160  I-PDHKVMTVDELLAHFKDLMASYK  89
               +  V T++ELL  F+     +K
Sbjct  648  SDKEQGVKTIEELLIEFEGNKVQFK  672



>gb|EFA77297.1| threonyl-tRNA synthetase [Polysphondylium pallidum PN500]
Length=716

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 144/197 (73%), Gaps = 0/197 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W+ AE +L DALN+FGKPW++N GDGAFYGPKIDI + D +KR  QCAT+QLDFQLP RF
Sbjct  513  WDVAENSLRDALNKFGKPWKLNPGDGAFYGPKIDIQIFDVLKRAHQCATIQLDFQLPIRF  572

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
             L Y      +R RPV+IHRAILGSVERM AIL+EH  GKWPFW+SPRQ +V  VS+K  
Sbjct  573  ELEYMGSGPEERHRPVIIHRAILGSVERMMAILIEHTAGKWPFWVSPRQVLVATVSEKFA  632

Query  340  AYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRD  161
             Y   +   + +AGF+ DVD SD+T+ KKVREAQ++QYNYILVVGE+E     V+VR RD
Sbjct  633  DYAKSVTKTLTDAGFYADVDLSDKTLPKKVREAQLSQYNYILVVGEEELNNNTVNVRTRD  692

Query  160  IPDHKVMTVDELLAHFK  110
                  +TVD L+  FK
Sbjct  693  NVVRGSITVDALIEEFK  709



>ref|XP_011499017.1| PREDICTED: LOW QUALITY PROTEIN: threonine--tRNA ligase, cytoplasmic 
[Ceratosolen solmsi marchali]
Length=700

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 153/204 (75%), Gaps = 2/204 (1%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            SW+ AE AL+++L+ FG+PW +N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP R
Sbjct  489  SWDAAEKALSESLDTFGQPWTLNPGDGAFYGPKIDITIMDALKRPHQCATIQLDFQLPIR  548

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNLSY  E   ++ RPV+IHRAILGSVERM AILLE + GKWPFWLSPRQA+V PV    
Sbjct  549  FNLSYVNE-AGEKTRPVIIHRAILGSVERMIAILLESYAGKWPFWLSPRQAIVIPVGPSV  607

Query  343  QAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
              Y +E+RDRI + GF  +V+     T+ KK+R AQ+ Q+NYILVVGEKE ++  V+VR 
Sbjct  608  DDYALEVRDRIFKCGFMTEVNVDHSVTLNKKIRNAQLDQFNYILVVGEKEKSSSTVNVRT  667

Query  166  RDIPDHKVMTVDELLAHFKDLMAS  95
            RD   H  + +DEL+  F++L+ +
Sbjct  668  RDNKVHGQIEIDELMKKFENLIET  691



>ref|XP_006071988.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Bubalus bubalis]
Length=367

 Score =   240 bits (613),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 145/203 (71%), Gaps = 1/203 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  156  WNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  215

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL++ + D   +++PV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  216  NLTFVSHDGDDKKKPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCD  275

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE T+G V++R R
Sbjct  276  EYAQKVRQQFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKTSGTVNIRTR  335

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H   T+ E +   + L  S
Sbjct  336  DNKVHGERTISETIERLQQLKHS  358



>ref|XP_009117635.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X1 [Brassica rapa]
Length=436

 Score =   242 bits (618),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 123/226 (54%), Positives = 156/226 (69%), Gaps = 32/226 (14%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPW-EINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            WE++E  L +AL EFGKP+  +N G+GAF GPKIDI++ DAMKRKFQCA++QLDFQLP  
Sbjct  207  WEESENDLVEALQEFGKPFIVVNRGEGAFCGPKIDITLSDAMKRKFQCASIQLDFQLPDH  266

Query  523  FNLSYSAEDESKRE------------------RPVMIHRAILGSVERMFAILLEHFKGKW  398
            F L YS  DE K+E                  RPVMIHR +LGS ERM AILL H+KGKW
Sbjct  267  FKLRYSPSDEEKKENVMIHSKVLGTEDKEKGVRPVMIHRTVLGSFERMLAILLNHYKGKW  326

Query  397  PFWLSPRQAMVCPVSDKS--QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYN  224
            PFW+SPRQ +VC  S+    ++Y  E+R +IHEAG+HVDVDT+DR I +KV EA++AQYN
Sbjct  327  PFWISPRQVIVCSSSNNENHRSYAEEVRRQIHEAGYHVDVDTTDRNISEKVGEAEIAQYN  386

Query  223  YILVVGEKEATTGEVSVRVRD--------IPDHKVMTVDELLAHFK  110
            YILVVG++E  T +V+  +RD        +P   +M+VD LL  FK
Sbjct  387  YILVVGDEEVATRQVTALLRDSSCSDRSKVP---MMSVDALLDVFK  429



>ref|XP_004182642.1| hypothetical protein TBLA_0J01260 [Tetrapisispora blattae CBS 
6284]
 emb|CCH63123.1| hypothetical protein TBLA_0J01260 [Tetrapisispora blattae CBS 
6284]
Length=741

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 146/208 (70%), Gaps = 7/208 (3%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W  AE  L  AL  +G  WEINEGDGAFYGPKIDI + DA++R  QCAT+QLDFQLP R
Sbjct  524  TWNAAETKLASALKSWGGKWEINEGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNR  583

Query  523  FNLSYSAED---ESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVS  353
            F L + A+D   E   ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV 
Sbjct  584  FELEFKAQDNKSEEAYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQILVVPVG  643

Query  352  DKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSV  173
             K Q+Y  E+RD+ H AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++
Sbjct  644  VKYQSYAQEIRDKFHNAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNENSVNI  703

Query  172  RVRDIPDHK----VMTVDELLAHFKDLM  101
            R RDI + +     + VD +L   K+L+
Sbjct  704  RNRDIMEQQGKNATVNVDVVLKQMKNLL  731



>ref|XP_004933460.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like isoform X2 
[Bombyx mori]
Length=713

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 153/206 (74%), Gaps = 2/206 (1%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W +AE AL D+LN+FGKPW++N GDGAFYGPKIDI++ DA++R  QCAT+QLDFQLP+R
Sbjct  500  TWNQAEKALEDSLNKFGKPWQLNPGDGAFYGPKIDITIQDALRRSHQCATIQLDFQLPER  559

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNL+Y +E   K+ RPV+IHRA+LGSVERM AIL E + GKWP WLSPRQ  V PV    
Sbjct  560  FNLTYVSETGDKK-RPVIIHRAVLGSVERMVAILSESYAGKWPLWLSPRQLRVVPVGPAF  618

Query  343  QAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
              Y +++ D++  AGF  +VDT +  T+ KKVR AQ+AQ+NYILVVGE+E  +G V+VR 
Sbjct  619  DDYAVQVNDKLFAAGFMSEVDTDAGDTLNKKVRNAQLAQFNYILVVGEREKNSGTVNVRT  678

Query  166  RDIPDHKVMTVDELLAHFKDLMASYK  89
            RD   H  M+V+ L+ H  +L+   K
Sbjct  679  RDNKVHGEMSVEALIEHLNNLVREKK  704



>emb|CDJ83831.1| Aminoacyl-tRNA synthetase and Anticodon-binding domain containing 
protein, partial [Haemonchus contortus]
Length=390

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/206 (56%), Positives = 156/206 (76%), Gaps = 4/206 (2%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W++AE+ L  ALNE G+PW++NEGDGAFYGPKIDIS+ DA++R  QCAT+QLDFQLPQR
Sbjct  167  TWDEAESDLKAALNESGRPWKLNEGDGAFYGPKIDISIQDALRRNHQCATIQLDFQLPQR  226

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F+LSY  E + +++RPVMIHRA+LGSVERM AIL E++ GKWPFWLSPRQA V  V +  
Sbjct  227  FDLSYFDE-KGEKQRPVMIHRAVLGSVERMAAILTENYGGKWPFWLSPRQAKVITVHESV  285

Query  343  QAYGMELRDRIHEAGFHVDVD--TSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  170
              Y  +++++++ AGF V+ D   SD T+ K++R AQ+AQ+N+ILVVG+KE   G V+VR
Sbjct  286  NPYARQVKEKLYNAGFEVEFDEGCSD-TLNKQIRNAQLAQFNFILVVGQKEVEHGTVNVR  344

Query  169  VRDIPDHKVMTVDELLAHFKDLMASY  92
             RD      +++D+LLA F+     Y
Sbjct  345  TRDNAVRGEVSIDDLLAKFRRFADEY  370



>ref|XP_003058283.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58234.1| predicted protein [Micromonas pusilla CCMP1545]
Length=725

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 152/194 (78%), Gaps = 1/194 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE AL +ALN+ GK W++N GDGAFYGPKIDI+V DA+KR+FQCAT+QLDFQLP RF
Sbjct  487  WNQAEDALRNALNKSGKEWKLNPGDGAFYGPKIDITVFDALKRRFQCATVQLDFQLPIRF  546

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NLSY  E+ ++  RP++IHRAILGSVERMFAIL EHF GK+P+WLSP+Q M+ P+S+ S+
Sbjct  547  NLSYVTEN-NEPARPIIIHRAILGSVERMFAILTEHFAGKYPYWLSPKQVMLVPISEASR  605

Query  340  AYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRD  161
             Y +E++ ++ +AG H  VD +DR +QKKVREAQ+  +NYILVVGE E T   V+VR RD
Sbjct  606  EYALEVKKQLRKAGHHAQVDETDRKMQKKVREAQLEHWNYILVVGEGEKTNRTVNVRTRD  665

Query  160  IPDHKVMTVDELLA  119
               H  + ++EL+ 
Sbjct  666  NVVHGEVKLEELMT  679



>ref|XP_004933459.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like isoform X1 
[Bombyx mori]
Length=720

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 153/206 (74%), Gaps = 2/206 (1%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W +AE AL D+LN+FGKPW++N GDGAFYGPKIDI++ DA++R  QCAT+QLDFQLP+R
Sbjct  507  TWNQAEKALEDSLNKFGKPWQLNPGDGAFYGPKIDITIQDALRRSHQCATIQLDFQLPER  566

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNL+Y +E   K+ RPV+IHRA+LGSVERM AIL E + GKWP WLSPRQ  V PV    
Sbjct  567  FNLTYVSETGDKK-RPVIIHRAVLGSVERMVAILSESYAGKWPLWLSPRQLRVVPVGPAF  625

Query  343  QAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
              Y +++ D++  AGF  +VDT +  T+ KKVR AQ+AQ+NYILVVGE+E  +G V+VR 
Sbjct  626  DDYAVQVNDKLFAAGFMSEVDTDAGDTLNKKVRNAQLAQFNYILVVGEREKNSGTVNVRT  685

Query  166  RDIPDHKVMTVDELLAHFKDLMASYK  89
            RD   H  M+V+ L+ H  +L+   K
Sbjct  686  RDNKVHGEMSVEALIEHLNNLVREKK  711



>ref|XP_002595927.1| hypothetical protein BRAFLDRAFT_268618 [Branchiostoma floridae]
 gb|EEN51939.1| hypothetical protein BRAFLDRAFT_268618 [Branchiostoma floridae]
Length=681

 Score =   246 bits (628),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 150/202 (74%), Gaps = 3/202 (1%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W++AE  L  AL++FG PW++N GDGAFYGPKIDI V DA++R  QCAT+QLDF  P+R
Sbjct  466  TWDRAEKHLASALDKFGMPWKLNPGDGAFYGPKIDIQVFDALRRAHQCATIQLDFNNPER  525

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNL+Y + D  +++RPVMIHRAILGSVER  AIL E+F GKWPFWLSPRQAM+ PVS   
Sbjct  526  FNLTYVSGDGDEKKRPVMIHRAILGSVERFIAILCENFGGKWPFWLSPRQAMIVPVSPDQ  585

Query  343  QAYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  170
              Y  ++R+ IHEAGF    D D  D T+ KK+R AQ+AQYN+I+VVG+KE  +G V+VR
Sbjct  586  NEYAQKVRNSIHEAGFMCEADCDPGD-TMNKKIRNAQLAQYNFIMVVGKKEVESGTVNVR  644

Query  169  VRDIPDHKVMTVDELLAHFKDL  104
             RD   H   +V++++  FK L
Sbjct  645  TRDNKVHGERSVEDVILRFKKL  666



>ref|XP_005650255.1| threonyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
 gb|EIE25711.1| threonyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
Length=1049

 Score =   250 bits (639),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 145/190 (76%), Gaps = 1/190 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W+ AEAALT AL+  GK WE+NE DGAFYGPKIDI+V DA++RKFQCAT+QLDFQLP RF
Sbjct  505  WDAAEAALTQALDATGKAWELNEADGAFYGPKIDITVFDALRRKFQCATIQLDFQLPVRF  564

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            +L Y    E+  ERPV++HRAILGSVERM AIL E+F GKWP WLSPRQ +V P+S+ S 
Sbjct  565  DLQYKGASEA-FERPVIVHRAILGSVERMLAILTENFAGKWPLWLSPRQVIVVPISEASV  623

Query  340  AYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRD  161
             Y   +R ++  A  HV+VD SDR +QKKVREAQ+AQ+NYILVVGEKE   G V+VR RD
Sbjct  624  GYARRVRAQLRAAKLHVEVDDSDRKMQKKVREAQLAQFNYILVVGEKEEAEGTVNVRTRD  683

Query  160  IPDHKVMTVD  131
               H +  +D
Sbjct  684  NIVHGMHALD  693



>ref|XP_001418868.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97161.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=674

 Score =   246 bits (627),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 150/197 (76%), Gaps = 1/197 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W+KAEAAL  AL+  G+ W++NEGDGAFYGPKIDI+V DA+KR+FQCAT+QLDFQLP RF
Sbjct  477  WDKAEAALKSALDRSGREWKLNEGDGAFYGPKIDITVFDALKRRFQCATVQLDFQLPIRF  536

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            +LSY  E+ S   RP++IHRAILGSVERMFAIL EHF GKWP+WLSP+Q M+ P+S+ S+
Sbjct  537  DLSYVDENNSSV-RPIIIHRAILGSVERMFAILTEHFAGKWPYWLSPKQVMIVPISEASR  595

Query  340  AYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRD  161
             Y  E++ ++ +AG   +VD +DR +QKKVREAQ+ Q+NYILV GE E     V+VR RD
Sbjct  596  DYCYEVKRQLRKAGHFAEVDVTDRKMQKKVREAQLDQFNYILVCGESEKANETVNVRTRD  655

Query  160  IPDHKVMTVDELLAHFK  110
               H ++  +  +  F+
Sbjct  656  NKVHVIIRGETAITRFR  672



>ref|XP_005774035.1| threonine-tRNA ligase, partial [Emiliania huxleyi CCMP1516]
 gb|EOD21606.1| threonine-tRNA ligase, partial [Emiliania huxleyi CCMP1516]
Length=688

 Score =   246 bits (627),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 156/229 (68%), Gaps = 25/229 (11%)
 Frame = -1

Query  700  WEKAEAALTDALNEF----GKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQL  533
            WE AE  + +AL+E+    G+ W +N GDGAFYGPKIDI V DA+KR FQCAT+QLDF  
Sbjct  460  WETAEGMIAEALDEYQAKSGRGWSLNPGDGAFYGPKIDIHVYDALKRPFQCATVQLDFVQ  519

Query  532  PQRFNLSY--------------SAEDESKR-------ERPVMIHRAILGSVERMFAILLE  416
            PQRF+L Y                E+ES         ERPVMIHRA+LGSVERM AIL E
Sbjct  520  PQRFDLKYMTSGAAAAAAEAPKDGEEESAAGALPPGYERPVMIHRAVLGSVERMIAILTE  579

Query  415  HFKGKWPFWLSPRQAMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQV  236
            HF GKWPF+LSPRQA+V PVS     Y  E+R+++H AGF+ DVD S+RT+ K VREAQ+
Sbjct  580  HFAGKWPFFLSPRQAVVVPVSAAFNEYAEEVRNQLHAAGFYCDVDASNRTLNKMVREAQL  639

Query  235  AQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  89
            +QYN+ILVVG++EA    V+VR RD   H   TV+ LLA FK L+A +K
Sbjct  640  SQYNFILVVGKEEAAEAAVNVRTRDNEVHGKKTVEALLADFKQLLADHK  688



>ref|XP_001623293.1| predicted protein [Nematostella vectensis]
 gb|EDO31193.1| predicted protein [Nematostella vectensis]
Length=559

 Score =   243 bits (620),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 144/202 (71%), Gaps = 1/202 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE  L  ALN FG+ W +N GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP+RF
Sbjct  348  WNQAEKELEAALNGFGQAWVLNPGDGAFYGPKIDIQIQDALRRYHQCATIQLDFQLPERF  407

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y   +  +R+RPV++HRAILGSVERM AIL E F GKWPFWLSPRQA+V P+  K  
Sbjct  408  NLTYVTGEGDERKRPVIVHRAILGSVERMIAILTESFGGKWPFWLSPRQAIVIPIGPKYD  467

Query  340  AYGMELRDRIHEAGFHVDVDTS-DRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++   I  AG+HVD D     T+ KKVR AQ+AQYN+I VVGEKEATTG V+VR R
Sbjct  468  EYAQKVMSDILAAGYHVDADLDHGTTLNKKVRNAQLAQYNFIFVVGEKEATTGTVNVRTR  527

Query  163  DIPDHKVMTVDELLAHFKDLMA  98
            D   H   +V+ +L  F  L +
Sbjct  528  DNKVHGEFSVEAVLNKFATLTS  549



>emb|CDY21726.1| BnaA09g44770D [Brassica napus]
Length=436

 Score =   239 bits (611),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 121/226 (54%), Positives = 156/226 (69%), Gaps = 32/226 (14%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEI-NEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            WE++E  L +AL EFGKP+ + N G+GA  GPKIDI++ DAMKRKFQCA++QLDFQLP  
Sbjct  207  WEESENDLVEALQEFGKPFTVVNRGEGALCGPKIDITLSDAMKRKFQCASIQLDFQLPDH  266

Query  523  FNLSYSAEDESKRE------------------RPVMIHRAILGSVERMFAILLEHFKGKW  398
            F L YS  DE K+E                  RPVMIHR +LGS ERM AILL+H+KGKW
Sbjct  267  FKLRYSPSDEEKKENVMIHSKVLGSEDKEKGVRPVMIHRTVLGSFERMLAILLDHYKGKW  326

Query  397  PFWLSPRQAMVCPVSDKS--QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYN  224
            PFW+SPRQ +VC  S+    ++Y  E+R +IHEAG+HV+VDT+DR I +KV EA++AQYN
Sbjct  327  PFWISPRQVIVCSSSNNENHRSYAEEVRRQIHEAGYHVEVDTTDRNISEKVGEAEIAQYN  386

Query  223  YILVVGEKEATTGEVSVRVRD--------IPDHKVMTVDELLAHFK  110
            YILVVG++E  T +V+  +RD        +P   +M+VD LL  FK
Sbjct  387  YILVVGDEEVATRQVTALLRDSSCSDRSKVP---MMSVDALLDVFK  429



>ref|XP_005758375.1| threonine-tRNA ligase, partial [Emiliania huxleyi CCMP1516]
 gb|EOD05946.1| threonine-tRNA ligase, partial [Emiliania huxleyi CCMP1516]
Length=703

 Score =   246 bits (627),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 156/229 (68%), Gaps = 25/229 (11%)
 Frame = -1

Query  700  WEKAEAALTDALNEF----GKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQL  533
            WE AE  + +AL+E+    G+ W +N GDGAFYGPKIDI V DA+KR FQCAT+QLDF  
Sbjct  475  WETAEGMIAEALDEYQAKSGRGWSLNPGDGAFYGPKIDIHVYDALKRPFQCATVQLDFVQ  534

Query  532  PQRFNLSY--------------SAEDESKR-------ERPVMIHRAILGSVERMFAILLE  416
            PQRF+L Y                E+ES         ERPVMIHRA+LGSVERM AIL E
Sbjct  535  PQRFDLKYMTSGAAAAAAEAPKDGEEESAAGALPPGYERPVMIHRAVLGSVERMIAILTE  594

Query  415  HFKGKWPFWLSPRQAMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQV  236
            HF GKWPF+LSPRQA+V PVS     Y  E+R+++H AGF+ DVD S+RT+ K VREAQ+
Sbjct  595  HFAGKWPFFLSPRQAVVVPVSAAFNEYAEEVRNQLHAAGFYCDVDASNRTLNKMVREAQL  654

Query  235  AQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  89
            +QYN+ILVVG++EA    V+VR RD   H   TV+ LLA FK L+A +K
Sbjct  655  SQYNFILVVGKEEAAEAAVNVRTRDNEVHGKKTVEALLADFKQLLADHK  703



>pdb|4P3N|A Chain A, Structural Basis For Full-spectrum Inhibition Of Threonyl-trna 
Synthetase By Borrelidin 1
 pdb|4P3N|B Chain B, Structural Basis For Full-spectrum Inhibition Of Threonyl-trna 
Synthetase By Borrelidin 1
 pdb|4P3N|C Chain C, Structural Basis For Full-spectrum Inhibition Of Threonyl-trna 
Synthetase By Borrelidin 1
 pdb|4P3N|D Chain D, Structural Basis For Full-spectrum Inhibition Of Threonyl-trna 
Synthetase By Borrelidin 1
Length=415

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 143/200 (72%), Gaps = 1/200 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  204  WDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  263

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  264  NLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCD  323

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R R
Sbjct  324  EYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTR  383

Query  163  DIPDHKVMTVDELLAHFKDL  104
            D   H   T+ E +   + L
Sbjct  384  DNKVHGERTISETIERLQQL  403



>ref|XP_004531261.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like isoform X2 
[Ceratitis capitata]
 ref|XP_004531262.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like isoform X3 
[Ceratitis capitata]
Length=689

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 147/193 (76%), Gaps = 2/193 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W  AE AL ++L+EFG+PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RF
Sbjct  480  WNTAEKALAESLDEFGQPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPVRF  539

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y A+D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV  +  
Sbjct  540  NLNYIADDGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQVMVVPVGPQFD  598

Query  340  AYGMELRDRIHEAGFHVDVDTS-DRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y   +RD +H AGF  +VDT    T+ KK+R AQ+AQ+N+ILVVGEKE ++  V+VR R
Sbjct  599  EYAQTVRDELHAAGFMAEVDTDHGDTLNKKIRNAQLAQFNFILVVGEKERSSNTVNVRTR  658

Query  163  DIPDHKVMTVDEL  125
            D   H  ++VD+L
Sbjct  659  DNKVHGEVSVDDL  671



>pdb|4HWT|A Chain A, Crystal Structure Of Human Threonyl-trna Synthetase 
Bound To A Novel Inhibitor
 pdb|4HWT|B Chain B, Crystal Structure Of Human Threonyl-trna Synthetase 
Bound To A Novel Inhibitor
Length=413

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 143/200 (72%), Gaps = 1/200 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  194  WDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  253

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  254  NLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCD  313

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R R
Sbjct  314  EYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTR  373

Query  163  DIPDHKVMTVDELLAHFKDL  104
            D   H   T+ E +   + L
Sbjct  374  DNKVHGERTISETIERLQQL  393



>ref|XP_001989177.1| GH11579 [Drosophila grimshawi]
 gb|EDW04044.1| GH11579 [Drosophila grimshawi]
Length=493

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 150/201 (75%), Gaps = 4/201 (2%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W+ AE AL ++L+EFG PW+ N GDGAFYGPKIDI++ DA+KR FQCAT+QLDFQLP RF
Sbjct  284  WDAAEKALAESLDEFGMPWKENHGDGAFYGPKIDITIMDALKRPFQCATIQLDFQLPIRF  343

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y A+D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  344  NLNYIADDGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQVMVVPVGPAYD  402

Query  340  AYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
             Y   +RD+++ AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE ++  V+VR 
Sbjct  403  EYAKSVRDQLYAAGFMSESDCDAGD-TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRT  461

Query  166  RDIPDHKVMTVDELLAHFKDL  104
            RD   H  ++V EL++  + +
Sbjct  462  RDNKVHGEVSVAELISKLQKI  482



>gb|EDL82978.1| threonyl-tRNA synthetase, isoform CRA_b [Rattus norvegicus]
Length=433

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 142/200 (71%), Gaps = 1/200 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  222  WNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  281

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  282  NLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCD  341

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R   H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R R
Sbjct  342  EYAQKVRQEFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKASGTVNIRTR  401

Query  163  DIPDHKVMTVDELLAHFKDL  104
            D   H   TV E +   + L
Sbjct  402  DNKVHGERTVGETVERLQQL  421



>ref|NP_723726.1| Threonyl-tRNA synthetase, isoform C [Drosophila melanogaster]
 ref|NP_524839.3| Threonyl-tRNA synthetase, isoform B [Drosophila melanogaster]
 gb|AAF53167.1| Threonyl-tRNA synthetase, isoform B [Drosophila melanogaster]
 gb|AAN10805.1| Threonyl-tRNA synthetase, isoform C [Drosophila melanogaster]
Length=690

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 148/201 (74%), Gaps = 4/201 (2%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W  AE AL ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RF
Sbjct  481  WNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRF  540

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NLSY A+D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV     
Sbjct  541  NLSYIADDGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYD  599

Query  340  AYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
             Y   +RD++H+AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE ++  V+VR 
Sbjct  600  QYAQSVRDQLHDAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRT  658

Query  166  RDIPDHKVMTVDELLAHFKDL  104
            RD   H  ++V EL+   + +
Sbjct  659  RDNKVHGEVSVAELITKLQKI  679



>ref|XP_008213480.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Nasonia 
vitripennis]
Length=720

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 145/198 (73%), Gaps = 2/198 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W+ AE AL+++L+ FGKPW +N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RF
Sbjct  510  WDAAEKALSESLDAFGKPWTLNPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRF  569

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y  E   ++ RPV+IHRAILGSVERM AIL E + GKWPFWLSPRQ MV PV     
Sbjct  570  NLNYVNET-GEKTRPVIIHRAILGSVERMIAILTESYAGKWPFWLSPRQVMVIPVGPSLD  628

Query  340  AYGMELRDRIHEAGFHVDVDTS-DRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  + RD+IH AGF  +VDT    T+ KK+R AQ+ Q+N+ILVVGEKE   G V+VR R
Sbjct  629  EYATQTRDKIHAAGFMTEVDTDHGDTLNKKIRNAQLDQFNFILVVGEKEKAAGTVNVRTR  688

Query  163  DIPDHKVMTVDELLAHFK  110
            D   H  + VD+L+  F+
Sbjct  689  DNKVHGEIGVDDLIQKFQ  706



>gb|AAN71609.1| RH56418p [Drosophila melanogaster]
 gb|ACL87841.1| Aats-thr-PB, partial [synthetic construct]
Length=711

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 148/201 (74%), Gaps = 4/201 (2%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W  AE AL ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RF
Sbjct  502  WNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRF  561

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NLSY A+D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV     
Sbjct  562  NLSYIADDGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYD  620

Query  340  AYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
             Y   +RD++H+AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE ++  V+VR 
Sbjct  621  QYAQSVRDQLHDAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRT  679

Query  166  RDIPDHKVMTVDELLAHFKDL  104
            RD   H  ++V EL+   + +
Sbjct  680  RDNKVHGEVSVAELITKLQKI  700



>ref|XP_011212426.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Bactrocera 
dorsalis]
 ref|XP_011212434.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Bactrocera 
dorsalis]
Length=689

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 148/195 (76%), Gaps = 2/195 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W  AE AL ++L+EFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLPQRF
Sbjct  480  WNTAEKALAESLDEFGLPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPQRF  539

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y A+D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV  +  
Sbjct  540  NLNYIADDGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQVMVVPVGPQYD  598

Query  340  AYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y   +RD++H AGF  + DT +  T+ KK+R AQ+AQ+N+ILVVGEKE ++  V+VR R
Sbjct  599  EYAQSVRDQLHSAGFMAEADTDAGDTLNKKIRNAQLAQFNFILVVGEKERSSDTVNVRTR  658

Query  163  DIPDHKVMTVDELLA  119
            D   H  +++ +L+ 
Sbjct  659  DNKVHGEVSITDLIT  673



>ref|XP_001603180.2| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Nasonia 
vitripennis]
Length=705

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 145/198 (73%), Gaps = 2/198 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W+ AE AL+++L+ FGKPW +N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RF
Sbjct  495  WDAAEKALSESLDAFGKPWTLNPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRF  554

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y  E   ++ RPV+IHRAILGSVERM AIL E + GKWPFWLSPRQ MV PV     
Sbjct  555  NLNYVNE-TGEKTRPVIIHRAILGSVERMIAILTESYAGKWPFWLSPRQVMVIPVGPSLD  613

Query  340  AYGMELRDRIHEAGFHVDVDTS-DRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  + RD+IH AGF  +VDT    T+ KK+R AQ+ Q+N+ILVVGEKE   G V+VR R
Sbjct  614  EYATQTRDKIHAAGFMTEVDTDHGDTLNKKIRNAQLDQFNFILVVGEKEKAAGTVNVRTR  673

Query  163  DIPDHKVMTVDELLAHFK  110
            D   H  + VD+L+  F+
Sbjct  674  DNKVHGEIGVDDLIQKFQ  691



>ref|XP_003397155.1| PREDICTED: threonyl-tRNA synthetase, cytoplasmic-like [Bombus 
terrestris]
Length=725

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 150/198 (76%), Gaps = 2/198 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE AL ++L+ FG+PW+IN  DGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RF
Sbjct  515  WDQAEKALAESLDAFGEPWKINPEDGAFYGPKIDITIMDALKRHHQCATIQLDFQLPIRF  574

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NLSY  E   +R RPV+IHRAILGSVERM AIL E + GKWPFWLSPRQ MV PVS +  
Sbjct  575  NLSYINES-GERTRPVIIHRAILGSVERMIAILTESYAGKWPFWLSPRQVMVIPVSSQFD  633

Query  340  AYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  +++D++  +G  V++DT S  T+ KK+R AQ+AQ+N+ILVVGEKE   G V+VR R
Sbjct  634  EYAEQVKDKLWNSGIMVEIDTDSSDTLNKKIRNAQLAQFNFILVVGEKELNAGTVNVRTR  693

Query  163  DIPDHKVMTVDELLAHFK  110
            D   H  + VD+L+A FK
Sbjct  694  DNVVHGEILVDDLIAKFK  711



>emb|CDF89359.1| ZYBA0S04-02388g1_1 [Zygosaccharomyces bailii CLIB 213]
 emb|CDH08320.1| Threonine--tRNA ligase, cytoplasmic [Zygosaccharomyces bailii 
ISA1307]
Length=736

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 145/207 (70%), Gaps = 7/207 (3%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W  AEA L  AL ++G  WE+N GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP R
Sbjct  519  TWNDAEATLAAALQKWGGKWELNPGDGAFYGPKIDIMISDALRRWHQCATVQLDFQLPDR  578

Query  523  FNLSYSA---EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVS  353
            F L Y +   E+    ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV 
Sbjct  579  FGLEYKSKENEESESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQILVVPVG  638

Query  352  DKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSV  173
             K Q Y  E+RD++H AGF+ DVD S  T+QKKVR  Q+ +YN+I +VGE+E     V++
Sbjct  639  VKYQPYAQEVRDKLHAAGFYADVDLSGNTLQKKVRNGQMLKYNFIFIVGEQEMNENSVNI  698

Query  172  RVRDIPDHK----VMTVDELLAHFKDL  104
            R RD+ D +     +T+D +L   K L
Sbjct  699  RNRDVMDQQGKNATVTLDTVLEQLKKL  725



>gb|EFA05822.1| hypothetical protein TcasGA2_TC008604 [Tribolium castaneum]
Length=685

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 152/204 (75%), Gaps = 2/204 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            WE+AE AL++ L++FG PW +N GDGAFYGPKIDI+V DA+KR  QC T+QLDFQLP RF
Sbjct  476  WEQAEKALSEGLDDFGAPWSVNPGDGAFYGPKIDITVHDALKRAHQCGTIQLDFQLPIRF  535

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NLSY +E   K+ RPV+IHRAILGSVERM AIL E   GKWPFW+SPRQAMV PV     
Sbjct  536  NLSYVSESGEKK-RPVIIHRAILGSVERMIAILTESCGGKWPFWISPRQAMVIPVGPTYD  594

Query  340  AYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  +++ +++EAGF  +VDT +  T+ KK+R AQ+AQ+N+ILVVGEKE ++  V+VR R
Sbjct  595  EYAQDVKKKLYEAGFMAEVDTDAGDTMNKKIRNAQLAQFNFILVVGEKERSSQTVNVRTR  654

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D   H  ++V+ L+  FK L  +Y
Sbjct  655  DNIVHGEISVEGLIEKFKVLQENY  678



>ref|XP_003489967.1| PREDICTED: threonyl-tRNA synthetase, cytoplasmic-like [Bombus 
impatiens]
Length=690

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 150/198 (76%), Gaps = 2/198 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE AL ++L+ FG+PW++N  DGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RF
Sbjct  480  WDQAEKALAESLDAFGEPWKLNPEDGAFYGPKIDITIMDALKRHHQCATIQLDFQLPIRF  539

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NLSY  E   +R RPV+IHRAILGSVERM AIL E + GKWPFWLSPRQ MV PVS +  
Sbjct  540  NLSYINES-GERTRPVIIHRAILGSVERMIAILTESYAGKWPFWLSPRQVMVIPVSSQFD  598

Query  340  AYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  +++D++  +G  V++DT S  T+ KK+R AQ+AQ+N+ILVVGEKE   G V+VR R
Sbjct  599  EYAEQVKDKLWNSGIMVEIDTDSSDTLNKKIRNAQLAQFNFILVVGEKELNAGTVNVRTR  658

Query  163  DIPDHKVMTVDELLAHFK  110
            D   H  + VD+L+A FK
Sbjct  659  DNVVHGEILVDDLIAKFK  676



>ref|XP_008198247.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Tribolium 
castaneum]
Length=712

 Score =   245 bits (625),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 152/204 (75%), Gaps = 2/204 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            WE+AE AL++ L++FG PW +N GDGAFYGPKIDI+V DA+KR  QC T+QLDFQLP RF
Sbjct  503  WEQAEKALSEGLDDFGAPWSVNPGDGAFYGPKIDITVHDALKRAHQCGTIQLDFQLPIRF  562

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NLSY +E   K+ RPV+IHRAILGSVERM AIL E   GKWPFW+SPRQAMV PV     
Sbjct  563  NLSYVSESGEKK-RPVIIHRAILGSVERMIAILTESCGGKWPFWISPRQAMVIPVGPTYD  621

Query  340  AYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  +++ +++EAGF  +VDT +  T+ KK+R AQ+AQ+N+ILVVGEKE ++  V+VR R
Sbjct  622  EYAQDVKKKLYEAGFMAEVDTDAGDTMNKKIRNAQLAQFNFILVVGEKERSSQTVNVRTR  681

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D   H  ++V+ L+  FK L  +Y
Sbjct  682  DNIVHGEISVEGLIEKFKVLQENY  705



>ref|XP_967345.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Tribolium 
castaneum]
Length=707

 Score =   244 bits (624),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 152/204 (75%), Gaps = 2/204 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            WE+AE AL++ L++FG PW +N GDGAFYGPKIDI+V DA+KR  QC T+QLDFQLP RF
Sbjct  498  WEQAEKALSEGLDDFGAPWSVNPGDGAFYGPKIDITVHDALKRAHQCGTIQLDFQLPIRF  557

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NLSY +E   K+ RPV+IHRAILGSVERM AIL E   GKWPFW+SPRQAMV PV     
Sbjct  558  NLSYVSESGEKK-RPVIIHRAILGSVERMIAILTESCGGKWPFWISPRQAMVIPVGPTYD  616

Query  340  AYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  +++ +++EAGF  +VDT +  T+ KK+R AQ+AQ+N+ILVVGEKE ++  V+VR R
Sbjct  617  EYAQDVKKKLYEAGFMAEVDTDAGDTMNKKIRNAQLAQFNFILVVGEKERSSQTVNVRTR  676

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D   H  ++V+ L+  FK L  +Y
Sbjct  677  DNIVHGEISVEGLIEKFKVLQENY  700



>ref|XP_004531260.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like isoform X1 
[Ceratitis capitata]
Length=785

 Score =   246 bits (628),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 147/193 (76%), Gaps = 2/193 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W  AE AL ++L+EFG+PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RF
Sbjct  576  WNTAEKALAESLDEFGQPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPVRF  635

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y A+D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV  +  
Sbjct  636  NLNYIADDGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQVMVVPVGPQFD  694

Query  340  AYGMELRDRIHEAGFHVDVDTS-DRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y   +RD +H AGF  +VDT    T+ KK+R AQ+AQ+N+ILVVGEKE ++  V+VR R
Sbjct  695  EYAQTVRDELHAAGFMAEVDTDHGDTLNKKIRNAQLAQFNFILVVGEKERSSNTVNVRTR  754

Query  163  DIPDHKVMTVDEL  125
            D   H  ++VD+L
Sbjct  755  DNKVHGEVSVDDL  767



>ref|XP_319682.4| AGAP008929-PA [Anopheles gambiae str. PEST]
 gb|EAA14818.5| AGAP008929-PA [Anopheles gambiae str. PEST]
Length=761

 Score =   245 bits (626),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 153/205 (75%), Gaps = 4/205 (2%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE AL D+L++FG+PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RF
Sbjct  552  WNEAEKALADSLDKFGEPWKENPGDGAFYGPKIDITIMDALKRNHQCATIQLDFQLPIRF  611

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y  +D  +++RPV+IHRA+LGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  612  NLNY-IDDSGEKKRPVIIHRAVLGSVERMIAILTENYAGKWPFWLSPRQVMVVPVGPAYD  670

Query  340  AYGMELRDRIHEAGFHV--DVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
             Y  ++R R+HEAGF V  D+D  D T+ KK+R AQ+AQ+N+ILVVGEKE ++  V+VR 
Sbjct  671  DYADQVRQRLHEAGFMVEADLDAGD-TMNKKIRNAQLAQFNFILVVGEKERSSETVNVRT  729

Query  166  RDIPDHKVMTVDELLAHFKDLMASY  92
            RD   H  +TV++L+     L   Y
Sbjct  730  RDNKVHGEVTVNDLVTKLSKLRDEY  754



>ref|XP_002002014.1| GI17149 [Drosophila mojavensis]
 gb|EDW11456.1| GI17149 [Drosophila mojavensis]
Length=691

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 150/201 (75%), Gaps = 4/201 (2%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W+ AE AL ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR FQCAT+QLDFQLP RF
Sbjct  482  WDAAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRPFQCATIQLDFQLPIRF  541

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y A+D  KR RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  542  NLNYIADDGEKR-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQVMVVPVGPAYD  600

Query  340  AYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
             Y   +RD ++ AGF   VD D  D T+ KK+R AQ+AQ+N+ILVVG+KE ++  V+VR 
Sbjct  601  EYAKTVRDELYAAGFMSEVDCDAGD-TMNKKIRNAQLAQFNFILVVGDKERSSKTVNVRT  659

Query  166  RDIPDHKVMTVDELLAHFKDL  104
            RD   H  ++V EL++  + +
Sbjct  660  RDNKVHGEVSVAELISKLQKI  680



>ref|XP_004349538.1| threonyl-tRNA synthetase [Capsaspora owczarzaki ATCC 30864]
 gb|KJE91684.1| threonyl-tRNA synthetase [Capsaspora owczarzaki ATCC 30864]
Length=726

 Score =   245 bits (625),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 149/203 (73%), Gaps = 2/203 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W+KAE  L ++LN+FG PW++N GDGAFYGPKIDI++ DA++R  QCAT+QLDFQLP RF
Sbjct  505  WDKAEKQLEESLNKFGAPWKLNPGDGAFYGPKIDITIMDALRRSHQCATIQLDFQLPIRF  564

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
             L Y A D ++ + PV+IHRAILGSVERM AIL E+F GKWPFWLSPRQA+V  VS    
Sbjct  565  GLKYQAPDGTE-QTPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQALVIAVSKDCN  623

Query  340  AYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  E++ ++H+AGFHVD D   D T+ KKVR AQ+AQYN+ILVVG +E  +   +VR R
Sbjct  624  DYAHEVQKQLHDAGFHVDYDLWPDETLNKKVRNAQLAQYNFILVVGARERESRSANVRTR  683

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H   T+ +L+A F +L  S
Sbjct  684  DNKVHGERTIPQLIAEFTELAKS  706



>ref|NP_723725.1| Threonyl-tRNA synthetase, isoform A [Drosophila melanogaster]
 ref|NP_001285868.1| Threonyl-tRNA synthetase, isoform D [Drosophila melanogaster]
 gb|AAF53166.2| Threonyl-tRNA synthetase, isoform A [Drosophila melanogaster]
 gb|ACJ13176.1| FI05224p [Drosophila melanogaster]
 gb|AHN54382.1| Threonyl-tRNA synthetase, isoform D [Drosophila melanogaster]
Length=747

 Score =   245 bits (626),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 148/201 (74%), Gaps = 4/201 (2%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W  AE AL ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RF
Sbjct  538  WNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRF  597

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NLSY A+D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV     
Sbjct  598  NLSYIADDGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYD  656

Query  340  AYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
             Y   +RD++H+AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE ++  V+VR 
Sbjct  657  QYAQSVRDQLHDAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRT  715

Query  166  RDIPDHKVMTVDELLAHFKDL  104
            RD   H  ++V EL+   + +
Sbjct  716  RDNKVHGEVSVAELITKLQKI  736



>ref|XP_001969762.1| GG23767 [Drosophila erecta]
 gb|EDV58821.1| GG23767 [Drosophila erecta]
Length=746

 Score =   245 bits (625),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 148/201 (74%), Gaps = 4/201 (2%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W  AE AL ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RF
Sbjct  537  WNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRF  596

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NLSY A+D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV     
Sbjct  597  NLSYIADDGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYD  655

Query  340  AYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
             Y   +RD++H+AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE ++  V+VR 
Sbjct  656  QYAQSVRDQLHDAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRT  714

Query  166  RDIPDHKVMTVDELLAHFKDL  104
            RD   H  ++V EL+   + +
Sbjct  715  RDNKVHGEVSVAELITKLQKI  735



>gb|AAM50188.1| GH20022p [Drosophila melanogaster]
Length=747

 Score =   245 bits (625),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 148/201 (74%), Gaps = 4/201 (2%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W  AE AL ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RF
Sbjct  538  WNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRF  597

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NLSY A+D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV     
Sbjct  598  NLSYIADDGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYD  656

Query  340  AYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
             Y   +RD++H+AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE ++  V+VR 
Sbjct  657  QYAQSVRDQLHDAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRT  715

Query  166  RDIPDHKVMTVDELLAHFKDL  104
            RD   H  ++V EL+   + +
Sbjct  716  RDNKVHGEVSVAELITKLQKI  736



>gb|KGK38420.1| hypothetical protein JL09_g2427 [Pichia kudriavzevii]
Length=725

 Score =   244 bits (624),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 148/207 (71%), Gaps = 4/207 (2%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W  AEA L +ALN++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP R
Sbjct  511  TWNGAEAKLEEALNKWGGDWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNR  570

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F L +  ++E+   RPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K 
Sbjct  571  FELEFKGKEETNAVRPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGVKY  630

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
              Y  E++ ++H AGF  DVD +  T+QKKVR  QV +YN+I +VGE+E+T   V++R R
Sbjct  631  FEYAEEVQQKLHNAGFFADVDVTGNTLQKKVRNGQVQKYNFIFIVGEQESTEKSVNIRNR  690

Query  163  DIPD----HKVMTVDELLAHFKDLMAS  95
            DI D    ++ +++D ++A    L  S
Sbjct  691  DIQDLQGKNEAVSLDTVIAQLLKLKES  717



>ref|XP_011342020.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Cerapachys 
biroi]
Length=711

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 149/203 (73%), Gaps = 2/203 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE AL D+LN FG+PW +N  DGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RF
Sbjct  501  WDQAERALEDSLNAFGEPWTLNPQDGAFYGPKIDITIMDALKRPHQCATIQLDFQLPIRF  560

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NLSY  E   ++ RPV+IHRAILGSVERM AIL E + GKWP+WLSPRQAM+ PV+ +  
Sbjct  561  NLSYINE-AGEKTRPVIIHRAILGSVERMIAILTESYGGKWPYWLSPRQAMIVPVASQFN  619

Query  340  AYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  E+  ++  AG  V+VDT S  T+ KK+R AQ+AQ+N+ILVVGEKE   G V++R R
Sbjct  620  DYAYEVEQKLWNAGVMVEVDTDSSDTLNKKIRNAQLAQFNFILVVGEKEQIAGTVNIRTR  679

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H  M V+EL+A  K L  S
Sbjct  680  DNVVHGEMAVEELIAKLKVLKES  702



>ref|XP_011212417.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Bactrocera 
dorsalis]
Length=784

 Score =   245 bits (626),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 148/195 (76%), Gaps = 2/195 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W  AE AL ++L+EFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLPQRF
Sbjct  575  WNTAEKALAESLDEFGLPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPQRF  634

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y A+D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV  +  
Sbjct  635  NLNYIADDGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQVMVVPVGPQYD  693

Query  340  AYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y   +RD++H AGF  + DT +  T+ KK+R AQ+AQ+N+ILVVGEKE ++  V+VR R
Sbjct  694  EYAQSVRDQLHSAGFMAEADTDAGDTLNKKIRNAQLAQFNFILVVGEKERSSDTVNVRTR  753

Query  163  DIPDHKVMTVDELLA  119
            D   H  +++ +L+ 
Sbjct  754  DNKVHGEVSITDLIT  768



>ref|XP_002079196.1| GD23818 [Drosophila simulans]
 gb|EDX04781.1| GD23818 [Drosophila simulans]
Length=747

 Score =   245 bits (625),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 148/201 (74%), Gaps = 4/201 (2%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W  AE AL ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RF
Sbjct  538  WNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRF  597

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NLSY A+D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV     
Sbjct  598  NLSYIADDGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYD  656

Query  340  AYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
             Y   +RD++H+AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE ++  V+VR 
Sbjct  657  QYAQAVRDQLHDAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRT  715

Query  166  RDIPDHKVMTVDELLAHFKDL  104
            RD   H  ++V EL+   + +
Sbjct  716  RDNKVHGEVSVAELITKLQKI  736



>ref|XP_002042027.1| GM26732 [Drosophila sechellia]
 gb|EDW45894.1| GM26732 [Drosophila sechellia]
Length=747

 Score =   245 bits (625),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 148/201 (74%), Gaps = 4/201 (2%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W  AE AL ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RF
Sbjct  538  WNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRF  597

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NLSY A+D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV     
Sbjct  598  NLSYIADDGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYD  656

Query  340  AYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
             Y   +RD++H+AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE ++  V+VR 
Sbjct  657  QYAQAVRDQLHDAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRT  715

Query  166  RDIPDHKVMTVDELLAHFKDL  104
            RD   H  ++V EL+   + +
Sbjct  716  RDNKVHGEVSVAELITKLQKI  736



>gb|EPY73150.1| threonine--tRNA ligase, cytoplasmic [Camelus ferus]
Length=628

 Score =   243 bits (619),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 145/204 (71%), Gaps = 1/204 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  417  WNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  476

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL++ + D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  477  NLTFVSHDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCD  536

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++  + H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE T+G V++R R
Sbjct  537  EYAQKVWQQFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKTSGTVNIRTR  596

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D   H   TV E +   + L  SY
Sbjct  597  DNKVHGERTVSETIERLQQLKQSY  620



>ref|XP_001965104.1| GF21565 [Drosophila ananassae]
 gb|EDV33238.1| GF21565 [Drosophila ananassae]
Length=749

 Score =   244 bits (624),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 147/201 (73%), Gaps = 4/201 (2%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W  AE AL ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RF
Sbjct  540  WNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRF  599

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NLSY A+D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV     
Sbjct  600  NLSYIADDGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYD  658

Query  340  AYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
             Y   +RD++H AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE ++  V+VR 
Sbjct  659  QYAQSVRDQLHAAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRT  717

Query  166  RDIPDHKVMTVDELLAHFKDL  104
            RD   H  ++V EL+   + +
Sbjct  718  RDNKVHGEVSVAELITKLQKI  738



>ref|XP_010208524.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic, partial 
[Colius striatus]
Length=254

 Score =   232 bits (591),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 141/204 (69%), Gaps = 1/204 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W+ AE  L ++LN FG+ W +N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  43   WDHAEKQLQNSLNNFGEQWNLNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRF  102

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y  +D   ++RPV+IHRA+LGSVERM AIL E++ GKWPFWLSPRQ MV PV    +
Sbjct  103  NLTYVGKDGDDKKRPVIIHRAVLGSVERMIAILAENYGGKWPFWLSPRQVMVVPVGPTCE  162

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++  +  EAGF  DVD     T+ KK+R AQ+AQYN+ILVVGEKE     V+VR R
Sbjct  163  EYARQVCCQFFEAGFMSDVDLDPSCTLNKKIRNAQLAQYNFILVVGEKEKANSAVNVRTR  222

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D   H  ++V   +   K+  +S+
Sbjct  223  DNKVHGEISVSAAIEKLKEFKSSH  246



>emb|CDX81854.1| BnaC08g37470D [Brassica napus]
Length=433

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 118/223 (53%), Positives = 148/223 (66%), Gaps = 29/223 (13%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            WE+ E  L +AL EFGKP+ +N G GA  GPKIDI++ DAMKRKFQCA++QLDFQLP  F
Sbjct  207  WEEGENDLVEALQEFGKPFTVNRGVGALCGPKIDITLSDAMKRKFQCASIQLDFQLPDHF  266

Query  520  NLSYSAEDESKRE------------------RPVMIHRAILGSVERMFAILLEHFKGKWP  395
             L YS  DE K+E                  RP MIHR +LGS ERM AILL+H+KGKWP
Sbjct  267  KLRYSPSDEEKKENVMIHSKVLGSEDKDKGVRPFMIHRTVLGSFERMLAILLDHYKGKWP  326

Query  394  FWLSPRQAMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYIL  215
            FW+SPRQ +VC  S+        +R +IHEAG+HVDVDT+DR I +KV EA++ QYNYIL
Sbjct  327  FWISPRQVIVCSSSNNENDLTWRVRRQIHEAGYHVDVDTTDRNISEKVGEAEIVQYNYIL  386

Query  214  VVGEKEATTGEVSVRVRD--------IPDHKVMTVDELLAHFK  110
            VVG++E  T +V+  +RD        +P   +M+VD LL  FK
Sbjct  387  VVGDEEVATRQVTALLRDSSCSDRSKVP---MMSVDALLDVFK  426



>ref|XP_002088448.1| Aats-thr [Drosophila yakuba]
 gb|EDW88160.1| Aats-thr [Drosophila yakuba]
Length=747

 Score =   244 bits (624),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 147/201 (73%), Gaps = 4/201 (2%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W  AE AL ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RF
Sbjct  538  WNAAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRF  597

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NLSY A+D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV     
Sbjct  598  NLSYIADDGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYD  656

Query  340  AYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
             Y   +RD++H AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE ++  V+VR 
Sbjct  657  QYAQSVRDQLHAAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRT  715

Query  166  RDIPDHKVMTVDELLAHFKDL  104
            RD   H  ++V EL+   + +
Sbjct  716  RDNKVHGEVSVAELITKLQKI  736



>ref|XP_003729486.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like, partial 
[Strongylocentrotus purpuratus]
Length=591

 Score =   241 bits (615),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 145/203 (71%), Gaps = 2/203 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W+ AE  L + LN+FG  W IN  DGAFYGPKIDI++ DA++R  QCAT+QLDFQLP RF
Sbjct  381  WDSAEKQLENTLNKFGAEWRINPADGAFYGPKIDITILDALRRSHQCATIQLDFQLPIRF  440

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL YSA D +++ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ +V P+     
Sbjct  441  NLKYSAADGTEK-RPVIIHRAILGSVERMMAILTENFGGKWPFWLSPRQCIVIPIGPAFN  499

Query  340  AYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y + ++D++H AGF  + DT +  T+ KK+R  Q+AQ+N+ILVVGEKE T G  +VR R
Sbjct  500  DYAITVKDKLHNAGFSCEADTDAGDTMNKKIRNGQLAQFNFILVVGEKEKTNGTANVRTR  559

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H   ++DE++  F  L  S
Sbjct  560  DNQVHGEKSIDEIITRFSALKDS  582



>ref|XP_011342019.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Cerapachys 
biroi]
 gb|EZA52272.1| Threonyl-tRNA synthetase, cytoplasmic [Cerapachys biroi]
Length=716

 Score =   244 bits (622),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 149/203 (73%), Gaps = 2/203 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE AL D+LN FG+PW +N  DGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RF
Sbjct  506  WDQAERALEDSLNAFGEPWTLNPQDGAFYGPKIDITIMDALKRPHQCATIQLDFQLPIRF  565

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NLSY  E   ++ RPV+IHRAILGSVERM AIL E + GKWP+WLSPRQAM+ PV+ +  
Sbjct  566  NLSYINE-AGEKTRPVIIHRAILGSVERMIAILTESYGGKWPYWLSPRQAMIVPVASQFN  624

Query  340  AYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  E+  ++  AG  V+VDT S  T+ KK+R AQ+AQ+N+ILVVGEKE   G V++R R
Sbjct  625  DYAYEVEQKLWNAGVMVEVDTDSSDTLNKKIRNAQLAQFNFILVVGEKEQIAGTVNIRTR  684

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H  M V+EL+A  K L  S
Sbjct  685  DNVVHGEMAVEELIAKLKVLKES  707



>ref|XP_002052626.1| GJ17652 [Drosophila virilis]
 gb|EDW64781.1| GJ17652 [Drosophila virilis]
Length=745

 Score =   244 bits (623),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 150/205 (73%), Gaps = 4/205 (2%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W+ AE AL ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR FQCAT+QLDFQLP RF
Sbjct  536  WDAAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRPFQCATIQLDFQLPIRF  595

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y A+D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  596  NLNYIADDGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQVMVVPVGPAYD  654

Query  340  AYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
             Y   +RD+++ AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE ++  V+VR 
Sbjct  655  EYAKSVRDQLYAAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRT  713

Query  166  RDIPDHKVMTVDELLAHFKDLMASY  92
            RD   H  ++V EL+   + +   Y
Sbjct  714  RDNKVHGEVSVAELITKLQKIRDEY  738



>gb|AAH04621.1| Tars protein, partial [Mus musculus]
Length=457

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 142/200 (71%), Gaps = 1/200 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  246  WNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  305

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  306  NLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCD  365

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F  D D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R R
Sbjct  366  EYAQKVRQQFHDAKFMADTDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKASGTVNIRTR  425

Query  163  DIPDHKVMTVDELLAHFKDL  104
            D   H   TV+E +   + L
Sbjct  426  DNKVHGERTVEETVRRLQQL  445



>gb|ETN67379.1| threonyl-tRNA synthetase [Anopheles darlingi]
Length=706

 Score =   243 bits (621),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 153/205 (75%), Gaps = 4/205 (2%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE AL ++L++FG+PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RF
Sbjct  497  WNEAEKALAESLDKFGEPWKENPGDGAFYGPKIDITIMDALKRHHQCATIQLDFQLPIRF  556

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y  +D  +++RPV+IHRA+LGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  557  NLNY-VDDSGEKKRPVIIHRAVLGSVERMIAILTENYAGKWPFWLSPRQVMVVPVGPAYD  615

Query  340  AYGMELRDRIHEAGFHV--DVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
             Y  ++R R+H+AGF V  D+D  D T+ KK+R AQ+AQ+N+ILVVGEKE ++  V+VR 
Sbjct  616  EYADKVRLRLHDAGFTVEADLDAGD-TMNKKIRNAQLAQFNFILVVGEKERSSETVNVRT  674

Query  166  RDIPDHKVMTVDELLAHFKDLMASY  92
            RD   H  +TVDEL+     L   Y
Sbjct  675  RDNKVHGEVTVDELVTKLAKLRDEY  699



>ref|XP_009238891.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Pongo 
abelii]
Length=563

 Score =   240 bits (613),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 144/203 (71%), Gaps = 1/203 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  352  WDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  411

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  412  NLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCD  471

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R R
Sbjct  472  EYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTR  531

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H   T+ E +   + L  S
Sbjct  532  DNKVHGERTISETIERLQQLKES  554



>ref|XP_449908.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG62888.1| unnamed protein product [Candida glabrata]
Length=726

 Score =   243 bits (621),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 148/209 (71%), Gaps = 7/209 (3%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+ AE  L +ALN++G  WE+N GDGAFYGPKIDI + DA++R  QCAT+QLDFQLPQR
Sbjct  509  TWDAAEKKLENALNKWGGAWELNPGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPQR  568

Query  523  FNLSYSAEDESKRE---RPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVS  353
            F L + A+D  + E   RPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV 
Sbjct  569  FELEFKAKDTEESENYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQILVVPVG  628

Query  352  DKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSV  173
             K Q Y  ++RD++H AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE E     V++
Sbjct  629  VKYQEYAQQVRDKMHNAGFYADVDLTGNTLQKKVRTGQLMKYNFIFIVGETEMNENSVNI  688

Query  172  RVRDIPDHK----VMTVDELLAHFKDLMA  98
            R RD+ + +     + VD +L   + L A
Sbjct  689  RNRDVMEQQGKNATVNVDIVLEQLQKLKA  717



>emb|CCD74804.1| unnamed protein product [Schistosoma mansoni]
Length=249

 Score =   231 bits (588),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 149/234 (64%), Gaps = 32/234 (14%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE  L ++L+E G  WE+N GDGAFYGPKIDI++ DA++R+ QCAT+QLDFQLP RF
Sbjct  7    WDRAEKQLKESLDEVGLKWELNPGDGAFYGPKIDINIMDALRRRHQCATIQLDFQLPVRF  66

Query  520  NLSYSAEDES-------------------------------KRERPVMIHRAILGSVERM  434
            NLSY++E ++                                  RPV+IHRAILGSVER+
Sbjct  67   NLSYASETDNPSGSDNNCNNISNTTNGISNHHEPINHQTDLNTHRPVIIHRAILGSVERI  126

Query  433  FAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTS-DRTIQK  257
             AIL E + GKWPFWLSPRQ +V PV      Y +++++R+H+AGF V VDT   RT+ K
Sbjct  127  IAILTESYGGKWPFWLSPRQVLVVPVVSACDEYAIDVKNRLHDAGFMVSVDTDPGRTLNK  186

Query  256  KVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  95
            K+R  Q+ Q N+ILVVGEKE   G V+VR RD   H    V+ ++  F+ L AS
Sbjct  187  KIRNGQLLQNNFILVVGEKEIANGTVNVRTRDNKVHGEHPVEHVIERFRQLAAS  240



>ref|XP_004088253.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Nomascus leucogenys]
Length=559

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 144/203 (71%), Gaps = 1/203 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  348  WDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  407

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  408  NLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCD  467

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R R
Sbjct  468  EYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTR  527

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H   T+ E +   + L  S
Sbjct  528  DNKVHGERTISETIERLQQLKQS  550



>ref|XP_001658309.1| AAEL001206-PA [Aedes aegypti]
 gb|EAT47704.1| AAEL001206-PA [Aedes aegypti]
Length=716

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 153/201 (76%), Gaps = 4/201 (2%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE AL ++L++FG+PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RF
Sbjct  507  WNEAEKALAESLDKFGQPWKENPGDGAFYGPKIDITIMDALKRNHQCATIQLDFQLPIRF  566

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y  +D  +++RPV+IHRA+LGSVERM AIL E + GKWPFWLSPRQ MV PV  +  
Sbjct  567  NLNY-IDDSGEKKRPVIIHRAVLGSVERMIAILTESYAGKWPFWLSPRQVMVVPVGPQYD  625

Query  340  AYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
             Y  ++R R+HEAGF    D+D  D T+ KK+R AQ+AQ+N+ILVVGEKE ++  V+VR 
Sbjct  626  DYADKVRQRLHEAGFMAEADLDAGD-TMNKKIRNAQLAQFNFILVVGEKERSSETVNVRT  684

Query  166  RDIPDHKVMTVDELLAHFKDL  104
            RD   H  ++VD+L+A  + L
Sbjct  685  RDNKVHGEVSVDDLVAKLRRL  705



>ref|XP_003503703.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Cricetulus griseus]
 ref|XP_007618308.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Cricetulus griseus]
 gb|EGW00926.1| Threonyl-tRNA synthetase, cytoplasmic [Cricetulus griseus]
 gb|ERE81441.1| threonyl-tRNA synthetase, cytoplasmic isoform 1 [Cricetulus griseus]
Length=722

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 145/203 (71%), Gaps = 1/203 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  511  WNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  570

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NLSY + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  571  NLSYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCD  630

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R R
Sbjct  631  EYAQKVRQQFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKASGTVNIRTR  690

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H   TV+E +   + L  S
Sbjct  691  DNKVHGERTVEETVERLQQLKQS  713



>ref|XP_001642915.1| hypothetical protein Kpol_411p2 [Vanderwaltozyma polyspora DSM 
70294]
 gb|EDO15057.1| hypothetical protein Kpol_411p2 [Vanderwaltozyma polyspora DSM 
70294]
Length=729

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 136/185 (74%), Gaps = 3/185 (2%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W  AEA L  AL ++G  WE+N GDGAFYGPKIDI + DA+KR  QCAT+QLDFQLP R
Sbjct  512  TWNNAEAKLQSALEKWGGDWELNPGDGAFYGPKIDIMISDALKRWHQCATIQLDFQLPNR  571

Query  523  FNLSYSAEDESKRE---RPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVS  353
            F L + A+D  + E   RPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV 
Sbjct  572  FELEFKAKDNQENENYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVG  631

Query  352  DKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSV  173
             K Q Y  E+RD++H AGF+ DVD S  T+QKKVR  Q+ +YN+I +VGE E T   V++
Sbjct  632  VKYQEYAQEVRDKLHAAGFYADVDLSGNTLQKKVRTGQLLKYNFIFIVGEDELTNKTVNI  691

Query  172  RVRDI  158
            R RDI
Sbjct  692  RNRDI  696



>ref|XP_001950747.2| PREDICTED: threonine--tRNA ligase, cytoplasmic-like [Acyrthosiphon 
pisum]
Length=714

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 146/203 (72%), Gaps = 2/203 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            WE AE  L D+LN FG+PW +N GDGAFYGPKIDI++ DA+KR+ QCAT+QLDFQLP RF
Sbjct  504  WENAEKQLADSLNSFGEPWTLNPGDGAFYGPKIDITISDALKRQHQCATIQLDFQLPIRF  563

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL++ +E   K+ RPV+IHRAI GSVERM AIL E F GKWPFWLSPRQA+V PV  +  
Sbjct  564  NLNFISESGEKK-RPVIIHRAIFGSVERMIAILTESFAGKWPFWLSPRQAIVIPVGPQFD  622

Query  340  AYGMELRDRIHEAGFHVDVDTS-DRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  +++  I+EAGF  DVD     T+ KK+R AQ+AQYN+ILVVG+KE T   V+VR R
Sbjct  623  EYSEKVKKEIYEAGFMCDVDVDHGDTLNKKIRNAQLAQYNFILVVGDKEKTANTVNVRTR  682

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H   +++E +   + L  S
Sbjct  683  DNNVHGEFSIEETIQRLQKLKIS  705



>emb|CDW52205.1| threonyl tRNA synthetase, cytoplasmic [Trichuris trichiura]
Length=707

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 145/205 (71%), Gaps = 2/205 (1%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W  AE  L  AL+ F  PW +N GDGAFYGPKIDI V DAM+R  QCAT+QLDFQLP R
Sbjct  496  TWNDAEEQLKCALDNFNLPWTLNAGDGAFYGPKIDIIVLDAMRRGHQCATVQLDFQLPIR  555

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F+L Y+ E+  K +RPV++HRAILGS+ERM A+L E+F GKWPFWLSPRQA+V PV    
Sbjct  556  FDLHYTDENGVK-QRPVIVHRAILGSIERMIAVLTENFGGKWPFWLSPRQAIVVPVHPVL  614

Query  343  QAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
             +Y   ++D+I+EAGF  DVD  S  T  KKVR AQVAQYNYILVVGEKE   G V+VR 
Sbjct  615  DSYAEAVKDKIYEAGFECDVDLDSSDTFNKKVRNAQVAQYNYILVVGEKEKENGTVNVRT  674

Query  166  RDIPDHKVMTVDELLAHFKDLMASY  92
            RD   H   TV +L+  F+ L   Y
Sbjct  675  RDNKVHGEFTVSDLIQRFRRLKDEY  699



>ref|XP_003674309.1| hypothetical protein NCAS_0A13710 [Naumovozyma castellii CBS 
4309]
 emb|CCC67929.1| hypothetical protein NCAS_0A13710 [Naumovozyma castellii CBS 
4309]
Length=753

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 147/207 (71%), Gaps = 7/207 (3%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+ AE  L  AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP R
Sbjct  536  TWDAAETKLASALKKWGGNWEINPGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPSR  595

Query  523  FNLSYSAED---ESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVS  353
            F L + ++D   E   ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV 
Sbjct  596  FELEFKSKDGQNEENYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVG  655

Query  352  DKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSV  173
             K Q Y  E+RD++H AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++
Sbjct  656  VKYQEYAQEVRDQLHNAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNI  715

Query  172  RVRDIPDHK----VMTVDELLAHFKDL  104
            R RDI + +     +TV+ ++   K+L
Sbjct  716  RNRDIMEQQGKNATVTVEAVVEQLKNL  742



>ref|XP_005556719.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X4 [Macaca 
fascicularis]
Length=602

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 144/203 (71%), Gaps = 1/203 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  391  WDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  450

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  451  NLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCD  510

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R R
Sbjct  511  EYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTR  570

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H   T+ E +   + L  S
Sbjct  571  DNKVHGERTISETMERLQQLKES  593



>ref|XP_006194878.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Camelus ferus]
 ref|XP_010953863.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Camelus bactrianus]
 ref|XP_010975928.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Camelus dromedarius]
Length=709

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 145/204 (71%), Gaps = 1/204 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  498  WNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  557

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL++ + D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  558  NLTFVSHDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCD  617

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++  + H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE T+G V++R R
Sbjct  618  EYAQKVWQQFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKTSGTVNIRTR  677

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D   H   TV E +   + L  SY
Sbjct  678  DNKVHGERTVSETIERLQQLKQSY  701



>ref|XP_004088252.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Nomascus leucogenys]
Length=619

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 144/203 (71%), Gaps = 1/203 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  408  WDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  467

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  468  NLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCD  527

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R R
Sbjct  528  EYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTR  587

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H   T+ E +   + L  S
Sbjct  588  DNKVHGERTISETIERLQQLKQS  610



>gb|EHJ63622.1| hypothetical protein KGM_17077 [Danaus plexippus]
Length=712

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 149/203 (73%), Gaps = 2/203 (1%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W +AE AL D+LN FGK W++N GDGAFYGPKIDI++ DA++R  QCAT+QLDFQLP+R
Sbjct  499  TWNQAEKALEDSLNRFGKVWQLNPGDGAFYGPKIDITIQDALRRSHQCATIQLDFQLPER  558

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNLSY +E   K+ RPV+IHRA+LGSVERM AIL E + GKWPFWLSPRQ  V PV    
Sbjct  559  FNLSYISETGEKK-RPVIIHRAVLGSVERMIAILSESYAGKWPFWLSPRQTCVVPVGPSF  617

Query  343  QAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
              Y   + +++  AGF  +VDT +  T+ KKVR AQ+AQ+NYILVVGE+E ++  V+VR 
Sbjct  618  DDYATYVNEKLFAAGFMSEVDTDAGDTLNKKVRNAQLAQFNYILVVGEREKSSNTVNVRT  677

Query  166  RDIPDHKVMTVDELLAHFKDLMA  98
            RD   H  M+++ L+ H   L+A
Sbjct  678  RDNKVHGEMSIEGLIEHLNKLVA  700



>gb|KFB38665.1| AGAP008929-PA-like protein [Anopheles sinensis]
Length=764

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 151/201 (75%), Gaps = 4/201 (2%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE AL D+L++FG+PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RF
Sbjct  555  WNEAEKALADSLDKFGEPWKENPGDGAFYGPKIDITIMDALKRNHQCATIQLDFQLPIRF  614

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y  +D  +++RPV+IHRA+LGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  615  NLNY-IDDNGEKKRPVIIHRAVLGSVERMIAILTENYAGKWPFWLSPRQVMVVPVGPAYD  673

Query  340  AYGMELRDRIHEAGFHV--DVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
             Y  ++R R+HEAGF V  D+D  D T+ KK+R AQ+AQ+N+ILVVGEKE  +  V+VR 
Sbjct  674  EYADKVRQRLHEAGFMVEADLDAGD-TMNKKIRNAQLAQFNFILVVGEKERNSETVNVRT  732

Query  166  RDIPDHKVMTVDELLAHFKDL  104
            RD   H  ++VD+L+     L
Sbjct  733  RDNKVHGEVSVDDLVTKLSKL  753



>ref|XP_002942619.2| PREDICTED: threonine--tRNA ligase, cytoplasmic-like [Xenopus 
(Silurana) tropicalis]
Length=731

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 143/200 (72%), Gaps = 1/200 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AEA L  +LN FG PWE+N GDGAFYGPKIDI + DAM R  QCAT+QLDFQLP RF
Sbjct  520  WQQAEAELEKSLNGFGLPWELNPGDGAFYGPKIDIQIQDAMGRYHQCATIQLDFQLPLRF  579

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NLSY+ + +   ERPVMIHRA+LGSVERM AIL E++ GKWP WLSP Q MV PV    +
Sbjct  580  NLSYTGKADGAVERPVMIHRAVLGSVERMLAILAENYGGKWPLWLSPFQVMVIPVGPNVE  639

Query  340  AYGMELRDRIHEAGFHVDVDTS-DRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            +Y  +++  IH+AGF VD+DT    T+ KK+R+AQVAQYN+ILVVG+KE     V+VR R
Sbjct  640  SYAYKVQRMIHDAGFMVDLDTDHGTTLNKKIRKAQVAQYNFILVVGDKEKQNSTVNVRTR  699

Query  163  DIPDHKVMTVDELLAHFKDL  104
            D   H    +  LL    +L
Sbjct  700  DSKQHGERELKALLVRLTEL  719



>ref|XP_003955557.1| hypothetical protein KAFR_0B01230 [Kazachstania africana CBS 
2517]
 emb|CCF56422.1| hypothetical protein KAFR_0B01230 [Kazachstania africana CBS 
2517]
Length=729

 Score =   242 bits (618),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 148/211 (70%), Gaps = 12/211 (6%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W  AE  L  ALN++G  WE+N GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP R
Sbjct  510  TWNAAEKKLESALNKWGGNWELNPGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNR  569

Query  523  FNLSYSAEDESKR-----ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCP  359
            F L + A+D  +      ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V P
Sbjct  570  FELEFKAKDNKEEANENYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVP  629

Query  358  VSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEV  179
            V  K Q Y  E+RD++H+AGF+ DVD S  T+QKKVR  Q+ +YN+I +VGE+E T   V
Sbjct  630  VGVKYQDYAQEVRDQLHDAGFYADVDLSGNTLQKKVRNGQLLKYNFIFIVGEQEMTEKSV  689

Query  178  SVRVRDIPDHK-------VMTVDELLAHFKD  107
            ++R RD+ + +       + TV E L + K+
Sbjct  690  NIRNRDVMEQQGKNATISLATVIEQLNNLKE  720



>ref|XP_004059038.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform 5 [Gorilla 
gorilla gorilla]
Length=602

 Score =   239 bits (611),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 143/200 (72%), Gaps = 1/200 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  391  WDQAEKQLENSLNEFGEKWELNAGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  450

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y + D   ++RPV++HRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV     
Sbjct  451  NLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENFGGKWPFWLSPRQVMVVPVGPTCD  510

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R R
Sbjct  511  EYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTR  570

Query  163  DIPDHKVMTVDELLAHFKDL  104
            D   H   T+ E +   + L
Sbjct  571  DNKVHGERTISETIERLQQL  590



>ref|XP_005556718.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X3 [Macaca 
fascicularis]
Length=639

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 144/203 (71%), Gaps = 1/203 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  428  WDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  487

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  488  NLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCD  547

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R R
Sbjct  548  EYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTR  607

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H   T+ E +   + L  S
Sbjct  608  DNKVHGERTISETMERLQQLKES  630



>ref|XP_005325709.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Ictidomys 
tridecemlineatus]
Length=722

 Score =   242 bits (617),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 144/203 (71%), Gaps = 1/203 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  511  WNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  570

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL++ + D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  571  NLTFVSHDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCD  630

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE T+G V++R R
Sbjct  631  EYAQQVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKTSGTVNIRTR  690

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H   TV E +   + L  S
Sbjct  691  DNKVHGERTVSETIERLRQLKQS  713



>ref|XP_004990683.1| threonyl-tRNA synthetase isoform 2 [Salpingoeca rosetta]
 gb|EGD77339.1| threonyl-tRNA synthetase isoform 2 [Salpingoeca rosetta]
Length=766

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 146/202 (72%), Gaps = 3/202 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            WE+AEA+L  AL+EFG  W++N GDGAFYGPKIDI+V DA+KR FQCAT+QLDFQLP RF
Sbjct  515  WERAEASLAKALDEFGHEWKLNPGDGAFYGPKIDITVHDALKRSFQCATIQLDFQLPIRF  574

Query  520  NLSY--SAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDK  347
            NL Y  + ++E    RPV+IHRAILGSVERMFAIL EH+ GKWPFWLSPRQA V P+  +
Sbjct  575  NLEYVPARKEEGVVYRPVIIHRAILGSVERMFAILCEHYAGKWPFWLSPRQAQVVPIHPE  634

Query  346  SQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  170
               Y  E+R   H  GF VDVD  D  T+QKKVR A V QYN+ILVVGE E     V+VR
Sbjct  635  FNKYAEEVRMFFHTHGFAVDVDADDSLTLQKKVRRACVEQYNFILVVGEAECKKRTVNVR  694

Query  169  VRDIPDHKVMTVDELLAHFKDL  104
             RD      +++DELL  +K L
Sbjct  695  TRDGSRIGELSLDELLCDWKQL  716



>gb|KHJ41146.1| hypothetical protein D918_08732 [Trichuris suis]
Length=706

 Score =   242 bits (617),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 144/205 (70%), Gaps = 2/205 (1%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W  AE  L  AL+ F  PW +N GDGAFYGPKIDI V DAM+R  QCAT+QLDFQLP R
Sbjct  495  TWNNAEEQLKCALDNFNLPWTLNAGDGAFYGPKIDIIVLDAMRRGHQCATVQLDFQLPIR  554

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            F+L Y+ E+  K +RPV++HRAILGS+ERM A+L E+F GKWPFWLSPRQA+V PV    
Sbjct  555  FDLHYTDENGVK-QRPVIVHRAILGSIERMIAVLTENFGGKWPFWLSPRQAVVVPVHPVL  613

Query  343  QAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
             +Y   ++D I+EAGF  DVD  S  T  KKVR AQVAQYNYILVVGEKE   G V+VR 
Sbjct  614  DSYAEAVKDEIYEAGFECDVDLDSSDTFNKKVRNAQVAQYNYILVVGEKEKENGTVNVRT  673

Query  166  RDIPDHKVMTVDELLAHFKDLMASY  92
            RD   H   TV +L+  F+ L   Y
Sbjct  674  RDNKVHGEFTVSDLIQRFRRLKDEY  698



>ref|XP_005003846.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Cavia 
porcellus]
Length=721

 Score =   242 bits (617),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 145/204 (71%), Gaps = 1/204 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE  L ++LNEFG+ WE+N GDGAFYGPK+DI + DA+ R  QCAT+QLDFQLP RF
Sbjct  510  WNQAEKQLENSLNEFGQKWELNPGDGAFYGPKVDIQIKDAIGRYHQCATIQLDFQLPIRF  569

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL++ + D   ++RPVMIHRAILGSVERM AIL E++ GKWPFWLSP Q MV PV     
Sbjct  570  NLTFVSHDGDDKKRPVMIHRAILGSVERMIAILTENYGGKWPFWLSPCQVMVVPVGPTCD  629

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F VDVD     T+ KK+R AQ+AQYN+ILVVGEKE T+G V++R R
Sbjct  630  EYAQKVRQQFHDAKFMVDVDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKTSGTVNIRTR  689

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D   H   T+ E +   + L  S+
Sbjct  690  DNKVHGERTISETIERLQQLKQSH  713



>gb|EDL03283.1| threonyl-tRNA synthetase, isoform CRA_a [Mus musculus]
Length=544

 Score =   238 bits (607),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 142/200 (71%), Gaps = 1/200 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  333  WNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  392

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  393  NLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCD  452

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F  D D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R R
Sbjct  453  EYAQKVRQQFHDAKFMADTDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKASGTVNIRTR  512

Query  163  DIPDHKVMTVDELLAHFKDL  104
            D   H   TV+E +   + L
Sbjct  513  DNKVHGERTVEETVRRLQQL  532



>ref|NP_001125825.1| threonine--tRNA ligase, cytoplasmic [Pongo abelii]
 emb|CAH91401.1| hypothetical protein [Pongo abelii]
Length=563

 Score =   238 bits (608),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 143/203 (70%), Gaps = 1/203 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  352  WDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  411

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  412  NLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCD  471

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN ILVVGEKE  +G V++R R
Sbjct  472  EYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNLILVVGEKEKISGTVNIRTR  531

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H   T+ E +   + L  S
Sbjct  532  DNKVHGERTISETIERLQQLKES  554



>ref|XP_004059037.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform 4 [Gorilla 
gorilla gorilla]
Length=619

 Score =   240 bits (612),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 143/200 (72%), Gaps = 1/200 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  408  WDQAEKQLENSLNEFGEKWELNAGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  467

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y + D   ++RPV++HRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV     
Sbjct  468  NLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENFGGKWPFWLSPRQVMVVPVGPTCD  527

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R R
Sbjct  528  EYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTR  587

Query  163  DIPDHKVMTVDELLAHFKDL  104
            D   H   T+ E +   + L
Sbjct  588  DNKVHGERTISETIERLQQL  607



>ref|XP_003475575.2| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Cavia 
porcellus]
Length=742

 Score =   242 bits (618),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 144/203 (71%), Gaps = 1/203 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE  L ++L EFGKPW+IN GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  531  WDEAEKQLQNSLVEFGKPWKINPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRF  590

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y ++D   ++RPV+IHRAILGS+ERM AIL EH+ GKWPFWLSPRQ MV PV    +
Sbjct  591  NLTYVSKDGDDKKRPVIIHRAILGSLERMIAILSEHYGGKWPFWLSPRQVMVIPVGPTCE  650

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y +++     E GF  D D  D  T+ KK+R AQ+AQYN+ILVVGEKE     V+VR R
Sbjct  651  KYALQVSSEFFEEGFMADTDLDDSCTLNKKIRNAQLAQYNFILVVGEKEKINNAVNVRTR  710

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H  ++V  ++   K+L  S
Sbjct  711  DNKIHGEISVTSVIDKLKNLKKS  733



>ref|XP_004372697.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Trichechus 
manatus latirostris]
Length=799

 Score =   243 bits (620),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 145/203 (71%), Gaps = 1/203 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE  L ++L EFGKPW++N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  588  WDQAEKQLQNSLMEFGKPWKMNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRF  647

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y ++D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV    +
Sbjct  648  NLTYVSKDGDDKKRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMVIPVGPTCE  707

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y +++     E GF  DVD  D  T+ KK+R AQ+AQYN+ILVVGEKE T   V+VR R
Sbjct  708  KYALQVSSEFFEEGFMADVDLDDSCTLNKKIRNAQLAQYNFILVVGEKEKTNNAVNVRTR  767

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H  ++V   +   K+L  S
Sbjct  768  DNKIHGEISVTSAMDKLKNLKNS  790



>ref|XP_011264917.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X3 [Camponotus 
floridanus]
 gb|EFN62386.1| Threonyl-tRNA synthetase, cytoplasmic [Camponotus floridanus]
Length=689

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 148/198 (75%), Gaps = 2/198 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE AL ++LN FG+PW +N  DGAFYGPKIDI++ DA+KR  Q AT+QLDFQLP RF
Sbjct  479  WDRAEKALEESLNAFGQPWTLNPQDGAFYGPKIDITLMDALKRAHQTATIQLDFQLPMRF  538

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NLSY  E+  ++ RPV+IHRAILGSVERM AIL E + GKWP+WLSPRQAMV PV  +  
Sbjct  539  NLSYVNEN-GEKTRPVIIHRAILGSVERMIAILTESYGGKWPYWLSPRQAMVVPVVSQFD  597

Query  340  AYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  E++ ++ +AG  V+VDT S  T+ KK+R AQ+AQ+N+ILVVGEKE   G V++R R
Sbjct  598  EYAYEVKQKLWDAGVMVEVDTDSSDTLNKKIRNAQLAQFNFILVVGEKERNAGTVNIRTR  657

Query  163  DIPDHKVMTVDELLAHFK  110
            D   H  M V+EL+A  K
Sbjct  658  DNVVHGEMAVEELIAKLK  675



>ref|XP_003470228.2| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Cavia 
porcellus]
Length=721

 Score =   241 bits (616),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 145/204 (71%), Gaps = 1/204 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE  L ++LNEFG+ WE+N GDGAFYGPK+DI + DA+ R  QCAT+QLDFQLP RF
Sbjct  510  WNQAEKQLENSLNEFGQKWELNPGDGAFYGPKVDIQIKDAIGRYHQCATIQLDFQLPIRF  569

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL++ + D   ++RPVMIHRAILGSVERM AIL E++ GKWPFWLSP Q MV PV     
Sbjct  570  NLTFVSHDGDDKKRPVMIHRAILGSVERMIAILTENYGGKWPFWLSPCQVMVVPVGPTCD  629

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F VDVD     T+ KK+R AQ+AQYN+ILVVGEKE T+G V++R R
Sbjct  630  EYAQKVRQQFHDAKFMVDVDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKTSGTVNIRTR  689

Query  163  DIPDHKVMTVDELLAHFKDLMASY  92
            D   H   T+ E +   + L  S+
Sbjct  690  DNKVHGERTISETIERLQQLKQSH  713



>gb|EWG95461.1| Ths1p [Saccharomyces cerevisiae R103]
 gb|EWH17895.1| Ths1p [Saccharomyces cerevisiae P283]
Length=734

 Score =   242 bits (617),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 150/206 (73%), Gaps = 6/206 (3%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+ AE+ L  AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP R
Sbjct  518  TWDAAESKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNR  577

Query  523  FNLSYSAEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSD  350
            F L + ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  
Sbjct  578  FELEFKSKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGV  637

Query  349  KSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  170
            K Q Y  ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R
Sbjct  638  KYQGYAEDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIR  697

Query  169  VRDIPDHK----VMTVDELLAHFKDL  104
             RD+ + +     ++V+E+L   ++L
Sbjct  698  NRDVMEQQGKNATVSVEEVLKQLRNL  723



>gb|EDZ71519.1| YIL078Wp-like protein [Saccharomyces cerevisiae AWRI1631]
Length=689

 Score =   241 bits (615),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 150/206 (73%), Gaps = 6/206 (3%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+ AE+ L  AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP R
Sbjct  473  TWDAAESKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNR  532

Query  523  FNLSYSAEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSD  350
            F L + ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  
Sbjct  533  FELEFKSKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGV  592

Query  349  KSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  170
            K Q Y  ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R
Sbjct  593  KYQGYAEDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIR  652

Query  169  VRDIPDHK----VMTVDELLAHFKDL  104
             RD+ + +     ++V+E+L   ++L
Sbjct  653  NRDVMEQQGKNATVSVEEVLKQLRNL  678



>ref|XP_002499537.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO60795.1| predicted protein [Micromonas sp. RCC299]
Length=722

 Score =   241 bits (616),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 147/181 (81%), Gaps = 1/181 (1%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W KAEAAL  ALN  GK W++N GDGAFYGPKIDI+V DA+KR+FQCAT+QLDFQLP R
Sbjct  482  TWNKAEAALEAALNGTGKEWKLNPGDGAFYGPKIDITVFDALKRRFQCATVQLDFQLPIR  541

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNLSY +E  ++ ERP++IHRAILGSVERMFAIL EHF GKWPFWLSPRQ M+ P+S++S
Sbjct  542  FNLSYVSE-ANEPERPIIIHRAILGSVERMFAILTEHFAGKWPFWLSPRQVMIVPISEQS  600

Query  343  QAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
            + Y  E+R  + + GF+ +VD SDR +QKKVREAQ+ Q+NYILVVGE E T   V++R R
Sbjct  601  RDYAHEVRSVLRKEGFYCEVDDSDRKMQKKVREAQLEQWNYILVVGEGEKTNRTVNIRTR  660

Query  163  D  161
            D
Sbjct  661  D  661



>ref|XP_004088251.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Nomascus leucogenys]
Length=664

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 144/203 (71%), Gaps = 1/203 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  453  WDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  512

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  513  NLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCD  572

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R R
Sbjct  573  EYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTR  632

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H   T+ E +   + L  S
Sbjct  633  DNKVHGERTISETIERLQQLKQS  655



>ref|XP_011192188.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Bactrocera 
cucurbitae]
 ref|XP_011192189.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Bactrocera 
cucurbitae]
 ref|XP_011192190.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Bactrocera 
cucurbitae]
Length=689

 Score =   241 bits (615),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 148/200 (74%), Gaps = 2/200 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W  AE AL ++L+EFG  W+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP+RF
Sbjct  480  WNAAEKALAESLDEFGMDWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPERF  539

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NLSY A+D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV  +  
Sbjct  540  NLSYIADDGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQVMVVPVGPQFD  598

Query  340  AYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y   +RD++H AGF  + DT +  T+ KK+R AQ+AQ+N+ILVVGEKE ++  V+VR R
Sbjct  599  EYAQSVRDQLHSAGFMAEADTDAGDTLNKKIRNAQLAQFNFILVVGEKERSSDTVNVRTR  658

Query  163  DIPDHKVMTVDELLAHFKDL  104
            D   H  +++ +L+     +
Sbjct  659  DNKVHGEVSIKDLITKLNKI  678



>gb|EDV09560.1| threonyl-tRNA synthetase [Saccharomyces cerevisiae RM11-1a]
 emb|CAY80430.1| Ths1p [Saccharomyces cerevisiae EC1118]
 gb|EGA74554.1| Ths1p [Saccharomyces cerevisiae AWRI796]
 gb|EGA86420.1| Ths1p [Saccharomyces cerevisiae VL3]
 gb|EWG85322.1| Ths1p [Saccharomyces cerevisiae R008]
 gb|EWG90489.1| Ths1p [Saccharomyces cerevisiae P301]
 gb|AHY75925.1| Ths1p [Saccharomyces cerevisiae YJM993]
 gb|AJP39393.1| Ths1p [Saccharomyces cerevisiae YJM1078]
 gb|AJR36686.1| Ths1p [Saccharomyces cerevisiae YJM189]
 gb|AJR36881.1| Ths1p [Saccharomyces cerevisiae YJM193]
 gb|AJR37220.1| Ths1p [Saccharomyces cerevisiae YJM244]
 gb|AJR37412.1| Ths1p [Saccharomyces cerevisiae YJM248]
 gb|AJR37606.1| Ths1p [Saccharomyces cerevisiae YJM270]
 gb|AJR37802.1| Ths1p [Saccharomyces cerevisiae YJM271]
 gb|AJR38368.1| Ths1p [Saccharomyces cerevisiae YJM428]
 gb|AJR38560.1| Ths1p [Saccharomyces cerevisiae YJM450]
 gb|AJR38751.1| Ths1p [Saccharomyces cerevisiae YJM451]
 gb|AJR39875.1| Ths1p [Saccharomyces cerevisiae YJM555]
 gb|AJR40067.1| Ths1p [Saccharomyces cerevisiae YJM627]
 gb|AJR40255.1| Ths1p [Saccharomyces cerevisiae YJM681]
 gb|AJR41015.1| Ths1p [Saccharomyces cerevisiae YJM693]
 gb|AJR41187.1| Ths1p [Saccharomyces cerevisiae YJM969]
 gb|AJR41381.1| Ths1p [Saccharomyces cerevisiae YJM972]
 gb|AJR41574.1| Ths1p [Saccharomyces cerevisiae YJM975]
 gb|AJR41768.1| Ths1p [Saccharomyces cerevisiae YJM978]
 gb|AJR41961.1| Ths1p [Saccharomyces cerevisiae YJM981]
 gb|AJR42155.1| Ths1p [Saccharomyces cerevisiae YJM984]
 gb|AJR42345.1| Ths1p [Saccharomyces cerevisiae YJM987]
 gb|AJR42539.1| Ths1p [Saccharomyces cerevisiae YJM990]
 gb|AJR42733.1| Ths1p [Saccharomyces cerevisiae YJM996]
 gb|AJR43114.1| Ths1p [Saccharomyces cerevisiae YJM1129]
 gb|AJR43308.1| Ths1p [Saccharomyces cerevisiae YJM1133]
 gb|AJR43694.1| Ths1p [Saccharomyces cerevisiae YJM1199]
 gb|AJR44267.1| Ths1p [Saccharomyces cerevisiae YJM1242]
 gb|AJR44460.1| Ths1p [Saccharomyces cerevisiae YJM1244]
 gb|AJR44845.1| Ths1p [Saccharomyces cerevisiae YJM1250]
 gb|AJR45226.1| Ths1p [Saccharomyces cerevisiae YJM1252]
 gb|AJR45988.1| Ths1p [Saccharomyces cerevisiae YJM1311]
 gb|AJR46179.1| Ths1p [Saccharomyces cerevisiae YJM1326]
 gb|AJR46368.1| Ths1p [Saccharomyces cerevisiae YJM1332]
 gb|AJR46560.1| Ths1p [Saccharomyces cerevisiae YJM1336]
 gb|AJR46753.1| Ths1p [Saccharomyces cerevisiae YJM1338]
 gb|AJR46947.1| Ths1p [Saccharomyces cerevisiae YJM1341]
 gb|AJR47520.1| Ths1p [Saccharomyces cerevisiae YJM1356]
 gb|AJR47711.1| Ths1p [Saccharomyces cerevisiae YJM1381]
 gb|AJR47899.1| Ths1p [Saccharomyces cerevisiae YJM1383]
 gb|AJR48070.1| Ths1p [Saccharomyces cerevisiae YJM1385]
 gb|AJR48261.1| Ths1p [Saccharomyces cerevisiae YJM1386]
 gb|AJR48454.1| Ths1p [Saccharomyces cerevisiae YJM1387]
 gb|AJR48839.1| Ths1p [Saccharomyces cerevisiae YJM1389]
 gb|AJR49032.1| Ths1p [Saccharomyces cerevisiae YJM1399]
 gb|AJR49737.1| Ths1p [Saccharomyces cerevisiae YJM1415]
 gb|AJR49930.1| Ths1p [Saccharomyces cerevisiae YJM1417]
 gb|AJR50119.1| Ths1p [Saccharomyces cerevisiae YJM1418]
 gb|AJR50306.1| Ths1p [Saccharomyces cerevisiae YJM1419]
 gb|AJR50499.1| Ths1p [Saccharomyces cerevisiae YJM1433]
 gb|AJR51073.1| Ths1p [Saccharomyces cerevisiae YJM1443]
 gb|AJR51447.1| Ths1p [Saccharomyces cerevisiae YJM1447]
 gb|AJR51826.1| Ths1p [Saccharomyces cerevisiae YJM1460]
 gb|AJR52013.1| Ths1p [Saccharomyces cerevisiae YJM1463]
 gb|AJR52206.1| Ths1p [Saccharomyces cerevisiae YJM1477]
 gb|AJR52394.1| Ths1p [Saccharomyces cerevisiae YJM1478]
 gb|AJR52703.1| Ths1p [Saccharomyces cerevisiae YJM1526]
 gb|AJR53473.1| Ths1p [Saccharomyces cerevisiae YJM1574]
 gb|AJR53666.1| Ths1p [Saccharomyces cerevisiae YJM1592]
Length=734

 Score =   242 bits (617),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 150/206 (73%), Gaps = 6/206 (3%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+ AE+ L  AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP R
Sbjct  518  TWDAAESKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNR  577

Query  523  FNLSYSAEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSD  350
            F L + ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  
Sbjct  578  FELEFKSKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGV  637

Query  349  KSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  170
            K Q Y  ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R
Sbjct  638  KYQGYAEDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIR  697

Query  169  VRDIPDHK----VMTVDELLAHFKDL  104
             RD+ + +     ++V+E+L   ++L
Sbjct  698  NRDVMEQQGKNATVSVEEVLKQLRNL  723



>ref|XP_006875438.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like isoform X2 
[Chrysochloris asiatica]
Length=696

 Score =   241 bits (615),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 144/203 (71%), Gaps = 1/203 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  485  WNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  544

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL++ + D   ++RPV++HRAILGSVERM AIL E++ GKWP WLSPRQ MV PV     
Sbjct  545  NLTFVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPLWLSPRQVMVVPVGPTCD  604

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F  DVD     T+ KK+R AQ+AQYN+ILVVGEKE ++G V++R R
Sbjct  605  EYAQKVRQQFHDAKFMTDVDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKSSGTVNIRTR  664

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H   TV E +   + LM S
Sbjct  665  DNKVHGERTVSETITRLQQLMQS  687



>gb|AJR39322.1| Ths1p [Saccharomyces cerevisiae YJM470]
Length=734

 Score =   242 bits (617),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 150/206 (73%), Gaps = 6/206 (3%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+ AE+ L  AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP R
Sbjct  518  TWDAAESKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNR  577

Query  523  FNLSYSAEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSD  350
            F L + ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  
Sbjct  578  FELEFKSKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGV  637

Query  349  KSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  170
            K Q Y  ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R
Sbjct  638  KYQGYAEDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIR  697

Query  169  VRDIPDHK----VMTVDELLAHFKDL  104
             RD+ + +     ++V+E+L   ++L
Sbjct  698  NRDVMEQQGKNATVSVEEVLKQLRNL  723



>ref|XP_004085211.2| PREDICTED: threonine--tRNA ligase, cytoplasmic-like, partial 
[Oryzias latipes]
Length=234

 Score =   228 bits (582),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 139/196 (71%), Gaps = 1/196 (1%)
 Frame = -1

Query  679  LTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  500
            L ++LNEFG+ W +N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL+Y + 
Sbjct  30   LENSLNEFGEKWVLNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLAYVSH  89

Query  499  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAYGMELR  320
            +   ++RPV+IHRAILGSVERM AIL E++ GKWP WLSPRQ M+ PV    + Y  +++
Sbjct  90   EGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPLWLSPRQVMLVPVGPTCEEYAEKVK  149

Query  319  DRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKV  143
               H +GF  DVD     T+ KK+R AQ++QYN+ILVVGEKE T+  V+VR RD   H  
Sbjct  150  QEFHSSGFMADVDLDPSCTLNKKIRNAQLSQYNFILVVGEKEKTSNTVNVRTRDNKVHGE  209

Query  142  MTVDELLAHFKDLMAS  95
             +V+E +   K L AS
Sbjct  210  CSVEECIQRLKRLKAS  225



>ref|XP_011264916.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Camponotus 
floridanus]
Length=710

 Score =   241 bits (615),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 148/198 (75%), Gaps = 2/198 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE AL ++LN FG+PW +N  DGAFYGPKIDI++ DA+KR  Q AT+QLDFQLP RF
Sbjct  500  WDRAEKALEESLNAFGQPWTLNPQDGAFYGPKIDITLMDALKRAHQTATIQLDFQLPMRF  559

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NLSY  E+  ++ RPV+IHRAILGSVERM AIL E + GKWP+WLSPRQAMV PV  +  
Sbjct  560  NLSYVNEN-GEKTRPVIIHRAILGSVERMIAILTESYGGKWPYWLSPRQAMVVPVVSQFD  618

Query  340  AYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  E++ ++ +AG  V+VDT S  T+ KK+R AQ+AQ+N+ILVVGEKE   G V++R R
Sbjct  619  EYAYEVKQKLWDAGVMVEVDTDSSDTLNKKIRNAQLAQFNFILVVGEKERNAGTVNIRTR  678

Query  163  DIPDHKVMTVDELLAHFK  110
            D   H  M V+EL+A  K
Sbjct  679  DNVVHGEMAVEELIAKLK  696



>ref|XP_002714160.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Oryctolagus cuniculus]
Length=723

 Score =   241 bits (616),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 145/203 (71%), Gaps = 1/203 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  512  WNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  571

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL++ + D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  572  NLTFVSHDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCD  631

Query  340  AYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F  D+D  +  T+ KK+R AQ+AQYN+ILVVGEKE T+G V++R R
Sbjct  632  EYAQKVRQQFHDAKFMADIDLDAGCTLNKKIRNAQLAQYNFILVVGEKEKTSGTVNIRTR  691

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H   T+ E +   + L  S
Sbjct  692  DNKVHGERTISETIERLQQLKQS  714



>ref|XP_005325710.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Ictidomys 
tridecemlineatus]
Length=758

 Score =   242 bits (617),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 144/203 (71%), Gaps = 1/203 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  547  WNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  606

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL++ + D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  607  NLTFVSHDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCD  666

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE T+G V++R R
Sbjct  667  EYAQQVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKTSGTVNIRTR  726

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H   TV E +   + L  S
Sbjct  727  DNKVHGERTVSETIERLRQLKQS  749



>gb|EIW09934.1| Ths1p [Saccharomyces cerevisiae CEN.PK113-7D]
 gb|AJR44073.1| Ths1p [Saccharomyces cerevisiae YJM1208]
Length=734

 Score =   241 bits (616),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 150/206 (73%), Gaps = 6/206 (3%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+ AE+ L  AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP R
Sbjct  518  TWDAAESKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNR  577

Query  523  FNLSYSAEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSD  350
            F L + ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  
Sbjct  578  FELEFKSKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGV  637

Query  349  KSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  170
            K Q Y  ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R
Sbjct  638  KYQGYAEDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIR  697

Query  169  VRDIPDHK----VMTVDELLAHFKDL  104
             RD+ + +     ++V+E+L   ++L
Sbjct  698  NRDVMEQQGKNATVSVEEVLKQLRNL  723



>gb|EFB17446.1| hypothetical protein PANDA_008118 [Ailuropoda melanoleuca]
Length=678

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 144/203 (71%), Gaps = 1/203 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  467  WNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  526

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL++ + D   ++RPV++HRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV     
Sbjct  527  NLTFVSHDGDDKKRPVIVHRAILGSVERMIAILTENFGGKWPFWLSPRQVMVVPVGPTCD  586

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F VD+D     T+ KK+R AQ+AQYN+ILV+GEKE  +G V++R R
Sbjct  587  EYAQKVRQQFHDAKFTVDIDLDPGCTLNKKIRNAQLAQYNFILVIGEKEKASGTVNIRTR  646

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H   T+ E +   + L  S
Sbjct  647  DNKVHGERTISETIERLQQLKQS  669



>gb|AJR45798.1| Ths1p [Saccharomyces cerevisiae YJM1307]
Length=734

 Score =   241 bits (616),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 150/206 (73%), Gaps = 6/206 (3%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+ AE+ L  AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP R
Sbjct  518  TWDAAESKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNR  577

Query  523  FNLSYSAEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSD  350
            F L + ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  
Sbjct  578  FELEFKSKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGV  637

Query  349  KSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  170
            K Q Y  ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R
Sbjct  638  KYQGYAEDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIR  697

Query  169  VRDIPDHK----VMTVDELLAHFKDL  104
             RD+ + +     ++V+E+L   ++L
Sbjct  698  NRDVMEQQGKNATVSVEEVLKQLRNL  723



>gb|AJR38945.1| Ths1p [Saccharomyces cerevisiae YJM453]
Length=734

 Score =   241 bits (616),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 150/206 (73%), Gaps = 6/206 (3%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+ AE+ L  AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP R
Sbjct  518  TWDAAESKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNR  577

Query  523  FNLSYSAEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSD  350
            F L + ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  
Sbjct  578  FELEFKSKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGV  637

Query  349  KSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  170
            K Q Y  ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R
Sbjct  638  KYQGYAEDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIR  697

Query  169  VRDIPDHK----VMTVDELLAHFKDL  104
             RD+ + +     ++V+E+L   ++L
Sbjct  698  NRDVMEQQGKNATVSVEEVLKQLRNL  723



>gb|EEU08659.1| Ths1p [Saccharomyces cerevisiae JAY291]
 dbj|GAA24039.1| K7_Ths1p [Saccharomyces cerevisiae Kyokai no. 7]
Length=734

 Score =   241 bits (616),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 150/206 (73%), Gaps = 6/206 (3%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+ AE+ L  AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP R
Sbjct  518  TWDAAESKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNR  577

Query  523  FNLSYSAEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSD  350
            F L + ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  
Sbjct  578  FELEFKSKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGV  637

Query  349  KSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  170
            K Q Y  ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R
Sbjct  638  KYQGYAEDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIR  697

Query  169  VRDIPDHK----VMTVDELLAHFKDL  104
             RD+ + +     ++V+E+L   ++L
Sbjct  698  NRDVMEQQGKNATVSVEEVLKQLRNL  723



>gb|EHN06623.1| Ths1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
Length=734

 Score =   241 bits (616),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 150/206 (73%), Gaps = 6/206 (3%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+ AE+ L  AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP R
Sbjct  518  TWDAAESKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNR  577

Query  523  FNLSYSAEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSD  350
            F L + ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  
Sbjct  578  FELEFKSKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGV  637

Query  349  KSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  170
            K Q Y  ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R
Sbjct  638  KYQGYAEDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIR  697

Query  169  VRDIPDHK----VMTVDELLAHFKDL  104
             RD+ + +     ++V+E+L   ++L
Sbjct  698  NRDVMEQQGKNATVSVEEVLKQLRNL  723



>gb|AJR37072.1| Ths1p [Saccharomyces cerevisiae YJM195]
 gb|AJR44653.1| Ths1p [Saccharomyces cerevisiae YJM1248]
 gb|AJR50884.1| Ths1p [Saccharomyces cerevisiae YJM1439]
Length=734

 Score =   241 bits (616),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 150/206 (73%), Gaps = 6/206 (3%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+ AE+ L  AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP R
Sbjct  518  TWDAAESKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNR  577

Query  523  FNLSYSAEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSD  350
            F L + ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  
Sbjct  578  FELEFKSKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGV  637

Query  349  KSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  170
            K Q Y  ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R
Sbjct  638  KYQGYAEDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIR  697

Query  169  VRDIPDHK----VMTVDELLAHFKDL  104
             RD+ + +     ++V+E+L   ++L
Sbjct  698  NRDVMEQQGKNATVSVEEVLKQLRNL  723



>gb|AJR53093.1| Ths1p [Saccharomyces cerevisiae YJM1549]
Length=734

 Score =   241 bits (616),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 150/206 (73%), Gaps = 6/206 (3%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+ AE+ L  AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP R
Sbjct  518  TWDAAESKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNR  577

Query  523  FNLSYSAEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSD  350
            F L + ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  
Sbjct  578  FELEFKSKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVIPVGV  637

Query  349  KSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  170
            K Q Y  ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R
Sbjct  638  KYQGYAEDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIR  697

Query  169  VRDIPDHK----VMTVDELLAHFKDL  104
             RD+ + +     ++V+E+L   ++L
Sbjct  698  NRDVMEQQGKNATVSVEEVLKQLRNL  723



>ref|NP_116578.3| threonine--tRNA ligase THS1 [Saccharomyces cerevisiae S288c]
 sp|P04801.2|SYTC_YEAST RecName: Full=Threonine--tRNA ligase, cytoplasmic; AltName: Full=Threonyl-tRNA 
synthetase; Short=ThrRS [Saccharomyces cerevisiae 
S288c]
 emb|CAA86092.1| threonyl-tRNA synthetase [Saccharomyces cerevisiae]
 tpg|DAA08472.1| TPA: threonine--tRNA ligase THS1 [Saccharomyces cerevisiae S288c]
 gb|AJR48647.1| Ths1p [Saccharomyces cerevisiae YJM1388]
 gb|AJR51635.1| Ths1p [Saccharomyces cerevisiae YJM1450]
Length=734

 Score =   241 bits (616),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 150/206 (73%), Gaps = 6/206 (3%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+ AE+ L  AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP R
Sbjct  518  TWDAAESKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNR  577

Query  523  FNLSYSAEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSD  350
            F L + ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  
Sbjct  578  FELEFKSKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGV  637

Query  349  KSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  170
            K Q Y  ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R
Sbjct  638  KYQGYAEDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIR  697

Query  169  VRDIPDHK----VMTVDELLAHFKDL  104
             RD+ + +     ++V+E+L   ++L
Sbjct  698  NRDVMEQQGKNATVSVEEVLKQLRNL  723



>emb|CAA26666.1| unnamed protein product [Saccharomyces cerevisiae]
Length=734

 Score =   241 bits (616),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 150/206 (73%), Gaps = 6/206 (3%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+ AE+ L  AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP R
Sbjct  518  TWDAAESKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNR  577

Query  523  FNLSYSAEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSD  350
            F L + ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  
Sbjct  578  FELEFKSKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGV  637

Query  349  KSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  170
            K Q Y  ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R
Sbjct  638  KYQGYAEDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIR  697

Query  169  VRDIPDHK----VMTVDELLAHFKDL  104
             RD+ + +     ++V+E+L   ++L
Sbjct  698  NRDVMEQQGKNATVSVEEVLKQLRNL  723



>ref|XP_005320129.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic isoform 
X3 [Ictidomys tridecemlineatus]
Length=713

 Score =   241 bits (615),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 144/203 (71%), Gaps = 1/203 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE  L ++L EFGKPW++N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  502  WNEAEKQLQNSLTEFGKPWKMNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRF  561

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y ++D   ++RPV+IHRA+LGSVERM AIL E++ GKWPFWLSPRQ MV PV    +
Sbjct  562  NLTYVSKDGDDKKRPVIIHRAVLGSVERMIAILAENYGGKWPFWLSPRQVMVIPVGSTCE  621

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y +++ +   E GF  DVD  D  T+ KK+R AQ+AQYN+ILVVGEKE     V+VR R
Sbjct  622  EYAVQVSNEFFEEGFMADVDLDDSCTLNKKIRNAQLAQYNFILVVGEKEKINNAVNVRTR  681

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H  ++V   +   K+L  S
Sbjct  682  DNKIHGEISVTSAINKLKNLKKS  704



>ref|XP_001513531.2| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Ornithorhynchus 
anatinus]
Length=707

 Score =   241 bits (615),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 145/204 (71%), Gaps = 1/204 (0%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W++AE  L ++L EFG+PW++N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP R
Sbjct  495  TWDQAEKQLQNSLKEFGEPWKLNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIR  554

Query  523  FNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS  344
            FNL+Y +++   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV    
Sbjct  555  FNLTYVSKESDDKKRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMVIPVGPTC  614

Query  343  QAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
            + Y  ++R    EAGF  DVD     T+ KK+R AQ+AQYN+ILVVGEKE     V+VR 
Sbjct  615  EEYAQQIRSEFFEAGFMADVDLDQSSTLNKKIRNAQLAQYNFILVVGEKEKGNNAVNVRT  674

Query  166  RDIPDHKVMTVDELLAHFKDLMAS  95
            RD   H  ++V+  +   K L  S
Sbjct  675  RDNKIHGEISVNSAIEKLKKLKKS  698



>gb|EDN61420.1| threonyl-tRNA synthetase [Saccharomyces cerevisiae YJM789]
 gb|AJR39138.1| Ths1p [Saccharomyces cerevisiae YJM456]
 gb|AJR43502.1| Ths1p [Saccharomyces cerevisiae YJM1190]
 gb|AJR43881.1| Ths1p [Saccharomyces cerevisiae YJM1202]
 gb|AJR45033.1| Ths1p [Saccharomyces cerevisiae YJM1615]
 gb|AJR45418.1| Ths1p [Saccharomyces cerevisiae YJM1273]
 gb|AJR45610.1| Ths1p [Saccharomyces cerevisiae YJM1304]
 gb|AJR47326.1| Ths1p [Saccharomyces cerevisiae YJM1355]
 gb|AJR49168.1| Ths1p [Saccharomyces cerevisiae YJM1400]
 gb|AJR49354.1| Ths1p [Saccharomyces cerevisiae YJM1401]
 gb|AJR49544.1| Ths1p [Saccharomyces cerevisiae YJM1402]
 gb|AJR50692.1| Ths1p [Saccharomyces cerevisiae YJM1434]
 gb|AJR51264.1| Ths1p [Saccharomyces cerevisiae YJM1444]
 gb|AJR52586.1| Ths1p [Saccharomyces cerevisiae YJM1479]
 gb|AJR52897.1| Ths1p [Saccharomyces cerevisiae YJM1527]
 gb|AJR53284.1| Ths1p [Saccharomyces cerevisiae YJM1573]
Length=734

 Score =   241 bits (616),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 150/206 (73%), Gaps = 6/206 (3%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+ AE+ L  AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP R
Sbjct  518  TWDAAESKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNR  577

Query  523  FNLSYSAEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSD  350
            F L + ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  
Sbjct  578  FELEFKSKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGV  637

Query  349  KSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  170
            K Q Y  ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R
Sbjct  638  KYQGYAEDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIR  697

Query  169  VRDIPDHK----VMTVDELLAHFKDL  104
             RD+ + +     ++V+E+L   ++L
Sbjct  698  NRDVMEQQGKNATVSVEEVLKQLRNL  723



>ref|XP_010168916.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic, partial 
[Caprimulgus carolinensis]
 gb|KFZ47626.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Caprimulgus 
carolinensis]
Length=395

 Score =   233 bits (595),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 142/205 (69%), Gaps = 3/205 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W+ AE  L ++LN FG+ W +N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  184  WDHAEKQLQNSLNNFGEKWNLNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRF  243

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y  +D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV   S+
Sbjct  244  NLTYVGKDGDDKKRPVIIHRAILGSVERMIAILAENYGGKWPFWLSPRQVMVVPVGPTSE  303

Query  340  AYGMELRDRIHEAGFHVDVDTSDR--TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRV  167
             Y  ++     EAGF  DVD  DR  T+ KK+R AQ+AQYN+ILVVGEKE     V+VR 
Sbjct  304  EYARQVCSEFFEAGFMSDVDL-DRSCTLNKKIRNAQLAQYNFILVVGEKEKANNAVNVRT  362

Query  166  RDIPDHKVMTVDELLAHFKDLMASY  92
            RD   H  ++V   +   K L  S+
Sbjct  363  RDNKVHGEISVCSAIEKLKKLKTSH  387



>gb|AJR47138.1| Ths1p [Saccharomyces cerevisiae YJM1342]
Length=734

 Score =   241 bits (616),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 150/206 (73%), Gaps = 6/206 (3%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+ AE+ L  AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP R
Sbjct  518  TWDAAESKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNR  577

Query  523  FNLSYSAEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSD  350
            F L + ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  
Sbjct  578  FELEFKSKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGV  637

Query  349  KSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  170
            K Q Y  ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R
Sbjct  638  KYQGYAEDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIR  697

Query  169  VRDIPDHK----VMTVDELLAHFKDL  104
             RD+ + +     ++V+E+L   ++L
Sbjct  698  NRDVMEQQGKNATVSVEEVLKQLRNL  723



>dbj|BAG59361.1| unnamed protein product [Homo sapiens]
Length=602

 Score =   239 bits (609),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 143/200 (72%), Gaps = 1/200 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  391  WDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  450

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  451  NLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCD  510

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R R
Sbjct  511  EYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTR  570

Query  163  DIPDHKVMTVDELLAHFKDL  104
            D   H   T+ E +   + L
Sbjct  571  DNKVHGERTISETIERLQQL  590



>ref|XP_004385288.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform 3 [Trichechus 
manatus latirostris]
Length=602

 Score =   239 bits (609),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 143/203 (70%), Gaps = 1/203 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  391  WNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  450

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL++ + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSP Q MV PV     
Sbjct  451  NLTFVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPHQVMVVPVGPMCD  510

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F  DVD     T+ KK+R AQ+AQYN+ILVVGEKE T+G V++R R
Sbjct  511  EYAQKVRQQFHDAKFMTDVDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKTSGTVNIRTR  570

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H   TV E +   + L  S
Sbjct  571  DNKVHGERTVSETIERLQQLKQS  593



>gb|EGA78432.1| Ths1p [Saccharomyces cerevisiae Vin13]
Length=734

 Score =   241 bits (616),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 150/206 (73%), Gaps = 6/206 (3%)
 Frame = -1

Query  703  SWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQR  524
            +W+ AE+ L  AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP R
Sbjct  518  TWDAAESKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNR  577

Query  523  FNLSYSAEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSD  350
            F L + ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  
Sbjct  578  FELEFKSKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGV  637

Query  349  KSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  170
            K Q Y  ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R
Sbjct  638  KYQGYAEDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIR  697

Query  169  VRDIPDHK----VMTVDELLAHFKDL  104
             RD+ + +     ++V+E+L   ++L
Sbjct  698  NRDVMEQQGKNATVSVEEVLKQLRNL  723



>ref|XP_004698143.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Echinops telfairi]
Length=664

 Score =   240 bits (612),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 143/203 (70%), Gaps = 1/203 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  453  WNQAEKQLENSLNEFGERWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  512

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL++ + D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV     
Sbjct  513  NLTFVSHDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCD  572

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A    DVD     T+ KK+R AQ+AQYN+ILVVGEKE T+G V++R R
Sbjct  573  EYAQKVRLQFHDANIMADVDLDPGCTLNKKIRHAQLAQYNFILVVGEKEKTSGTVNIRTR  632

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H   TV E L   K L  S
Sbjct  633  DNKVHGERTVSETLERLKQLKQS  655



>emb|CDQ73765.1| unnamed protein product [Oncorhynchus mykiss]
Length=215

 Score =   228 bits (580),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 138/199 (69%), Gaps = 1/199 (1%)
 Frame = -1

Query  688  EAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSY  509
            +  L ++LNEFG+PW++N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL++
Sbjct  8    QGQLENSLNEFGEPWKLNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTF  67

Query  508  SAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAYGM  329
              +D   + +PV+IHRAILGSVERM AIL E++ GKWP WLSPRQ M  PV+   + Y  
Sbjct  68   VGKDGDDKGKPVIIHRAILGSVERMIAILTENYAGKWPLWLSPRQVMFVPVNPTCEEYAK  127

Query  328  ELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPD  152
             +  +  EAGF  D D  S   + KK+R AQ+AQYN+ILVVGEKE  T  V+VR RD   
Sbjct  128  RMCKQFVEAGFMADADLDSSCLLNKKIRNAQLAQYNFILVVGEKEKLTNSVNVRTRDNKV  187

Query  151  HKVMTVDELLAHFKDLMAS  95
            H  ++V E+LA    L  S
Sbjct  188  HGELSVSEVLARLTLLKES  206



>gb|ELK31735.1| Threonyl-tRNA synthetase, cytoplasmic [Myotis davidii]
Length=649

 Score =   239 bits (611),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 143/200 (72%), Gaps = 1/200 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W  AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  438  WNHAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  497

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL++ + D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ M+ PV     
Sbjct  498  NLTFVSHDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQVMIVPVGPTCD  557

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R R
Sbjct  558  DYAQKVRQQFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKASGTVNIRTR  617

Query  163  DIPDHKVMTVDELLAHFKDL  104
            D   H   TV E +A  + L
Sbjct  618  DNKVHGERTVAETVARLQQL  637



>ref|XP_004059036.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform 3 [Gorilla 
gorilla gorilla]
Length=664

 Score =   240 bits (612),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 143/200 (72%), Gaps = 1/200 (1%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  453  WDQAEKQLENSLNEFGEKWELNAGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  512

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL+Y + D   ++RPV++HRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV     
Sbjct  513  NLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENFGGKWPFWLSPRQVMVVPVGPTCD  572

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R R
Sbjct  573  EYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTR  632

Query  163  DIPDHKVMTVDELLAHFKDL  104
            D   H   T+ E +   + L
Sbjct  633  DNKVHGERTISETIERLQQL  652



>ref|XP_009163294.1| hypothetical protein T265_01087 [Opisthorchis viverrini]
 gb|KER33001.1| hypothetical protein T265_01087 [Opisthorchis viverrini]
Length=737

 Score =   241 bits (615),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 118/224 (53%), Positives = 153/224 (68%), Gaps = 22/224 (10%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W++AE  L ++++E G  WE+N GDGAFYGPKIDI++ DA++R+ QCAT+QLDFQ+P RF
Sbjct  505  WDRAETQLRESMDEMGLRWELNPGDGAFYGPKIDITIMDALRRRHQCATIQLDFQMPTRF  564

Query  520  NLSYSAED---------------------ESKRERPVMIHRAILGSVERMFAILLEHFKG  404
            +L Y+ E                      E+   RPV+IHRAILGSVER+ AIL E F G
Sbjct  565  SLVYACETDPTSTMNGGDSIAHVPTTNHPEAHLRRPVIIHRAILGSVERIMAILTESFAG  624

Query  403  KWPFWLSPRQAMVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQY  227
            KWPFWLSPRQA+V PV+     Y  E++ R+H+AGF VDVDT   RT+ KK+R  Q+AQY
Sbjct  625  KWPFWLSPRQALVVPVASPFDQYATEVKTRLHDAGFEVDVDTDPGRTMNKKIRTGQLAQY  684

Query  226  NYILVVGEKEATTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  95
            N+ILVVGEKEAT+G V+VR RD   H   TV+ ++  F+ L  S
Sbjct  685  NFILVVGEKEATSGTVNVRTRDNKIHGEHTVEHVIERFRALAES  728



>ref|XP_006875437.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like isoform X1 
[Chrysochloris asiatica]
Length=723

 Score =   241 bits (615),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 144/203 (71%), Gaps = 1/203 (0%)
 Frame = -1

Query  700  WEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRF  521
            W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RF
Sbjct  512  WNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRF  571

Query  520  NLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ  341
            NL++ + D   ++RPV++HRAILGSVERM AIL E++ GKWP WLSPRQ MV PV     
Sbjct  572  NLTFVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPLWLSPRQVMVVPVGPTCD  631

Query  340  AYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR  164
             Y  ++R + H+A F  DVD     T+ KK+R AQ+AQYN+ILVVGEKE ++G V++R R
Sbjct  632  EYAQKVRQQFHDAKFMTDVDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKSSGTVNIRTR  691

Query  163  DIPDHKVMTVDELLAHFKDLMAS  95
            D   H   TV E +   + LM S
Sbjct  692  DNKVHGERTVSETITRLQQLMQS  714



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1193157586335