BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF036F14

Length=713
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009610927.1|  PREDICTED: endoglucanase 2-like                    312   7e-100   Nicotiana tomentosiformis
ref|XP_009783020.1|  PREDICTED: endoglucanase 2                         310   7e-99    Nicotiana sylvestris
ref|XP_011074667.1|  PREDICTED: endoglucanase 10-like                   307   6e-98    Sesamum indicum [beniseed]
emb|CDP07412.1|  unnamed protein product                                304   8e-97    Coffea canephora [robusta coffee]
ref|XP_006342034.1|  PREDICTED: endoglucanase 10-like                   301   1e-95    Solanum tuberosum [potatoes]
ref|XP_010667385.1|  PREDICTED: endoglucanase 2-like                    299   9e-95    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010061046.1|  PREDICTED: endoglucanase 10-like                   299   1e-94    Eucalyptus grandis [rose gum]
gb|KHF97947.1|  hypothetical protein F383_10892                         298   1e-94    Gossypium arboreum [tree cotton]
gb|AID55377.1|  glycoside hydrolase family 9 B5                         297   4e-94    Gossypium hirsutum [American cotton]
gb|ADU15552.1|  EG                                                      297   5e-94    Gossypium hirsutum [American cotton]
gb|KJB58121.1|  hypothetical protein B456_009G195400                    293   7e-94    Gossypium raimondii
ref|XP_004238345.1|  PREDICTED: endoglucanase 2-like                    296   1e-93    Solanum lycopersicum
gb|EYU36779.1|  hypothetical protein MIMGU_mgv1a004472mg                296   2e-93    Erythranthe guttata [common monkey flower]
gb|KJB58119.1|  hypothetical protein B456_009G195400                    292   2e-93    Gossypium raimondii
ref|XP_006473639.1|  PREDICTED: endoglucanase 10-like                   293   1e-92    Citrus sinensis [apfelsine]
gb|KDO84820.1|  hypothetical protein CISIN_1g009846mg                   293   1e-92    Citrus sinensis [apfelsine]
ref|XP_006435157.1|  hypothetical protein CICLE_v10000849mg             293   1e-92    Citrus clementina [clementine]
gb|KJB58120.1|  hypothetical protein B456_009G195400                    292   3e-92    Gossypium raimondii
gb|KJB58118.1|  hypothetical protein B456_009G195400                    292   4e-92    Gossypium raimondii
ref|XP_002510516.1|  endo-1,4-beta-glucanase, putative                  292   5e-92    Ricinus communis
ref|XP_007017776.1|  EG isoform 2                                       291   1e-91    Theobroma cacao [chocolate]
ref|XP_007017775.1|  EG isoform 1                                       291   1e-91    
ref|XP_010104437.1|  Endoglucanase 24                                   290   3e-91    Morus notabilis
ref|XP_004136389.1|  PREDICTED: endoglucanase 2-like                    289   5e-91    Cucumis sativus [cucumbers]
ref|XP_008466493.1|  PREDICTED: endoglucanase 10                        289   7e-91    Cucumis melo [Oriental melon]
ref|XP_002276739.1|  PREDICTED: endoglucanase 10                        289   9e-91    Vitis vinifera
ref|XP_010244092.1|  PREDICTED: endoglucanase 24-like                   287   3e-90    Nelumbo nucifera [Indian lotus]
ref|XP_002300715.1|  glycosyl hydrolase family 9 family protein         287   4e-90    Populus trichocarpa [western balsam poplar]
ref|XP_011045112.1|  PREDICTED: endoglucanase 2                         285   2e-89    Populus euphratica
ref|XP_003527686.1|  PREDICTED: endoglucanase 10-like                   285   2e-89    Glycine max [soybeans]
dbj|BAF42037.1|  cellulase2                                             285   4e-89    Pyrus communis
gb|KDP36939.1|  hypothetical protein JCGZ_08230                         284   4e-89    Jatropha curcas
ref|XP_007136082.1|  hypothetical protein PHAVU_009G016100g             283   1e-88    Phaseolus vulgaris [French bean]
ref|XP_008364934.1|  PREDICTED: endoglucanase 10-like                   283   1e-88    
gb|AGV22125.1|  endo-1,4-beta-glucanase 3                               283   2e-88    Betula luminifera [liang ye hua]
ref|XP_011028991.1|  PREDICTED: endoglucanase 2-like                    283   2e-88    Populus euphratica
ref|XP_003523541.1|  PREDICTED: endoglucanase 10                        282   3e-88    Glycine max [soybeans]
gb|KHN45917.1|  Endoglucanase 2                                         282   9e-88    Glycine soja [wild soybean]
gb|AFZ78647.1|  korrigan                                                280   3e-87    Populus tomentosa [Chinese white poplar]
ref|XP_002307711.1|  glycosyl hydrolase family 9 family protein         280   3e-87    Populus trichocarpa [western balsam poplar]
gb|KJB14408.1|  hypothetical protein B456_002G123700                    280   4e-87    Gossypium raimondii
ref|XP_010536354.1|  PREDICTED: endoglucanase 10-like                   279   4e-87    Tarenaya hassleriana [spider flower]
ref|XP_004500948.1|  PREDICTED: endoglucanase 10-like                   279   7e-87    Cicer arietinum [garbanzo]
gb|EYU38839.1|  hypothetical protein MIMGU_mgv1a004578mg                278   7e-87    Erythranthe guttata [common monkey flower]
ref|XP_008241905.1|  PREDICTED: endoglucanase 24-like                   278   1e-86    Prunus mume [ume]
ref|XP_009335173.1|  PREDICTED: endoglucanase 2-like                    277   2e-86    
ref|XP_008372790.1|  PREDICTED: endoglucanase 24-like                   277   4e-86    
ref|XP_006840111.1|  hypothetical protein AMTR_s00224p00023160          267   5e-86    
ref|XP_009378180.1|  PREDICTED: endoglucanase 2-like                    276   6e-86    Pyrus x bretschneideri [bai li]
ref|XP_008387935.1|  PREDICTED: endoglucanase 2                         274   3e-85    Malus domestica [apple tree]
gb|AES73992.2|  glycosyl hydrolase family 9 protein                     272   3e-84    Medicago truncatula
ref|XP_010477219.1|  PREDICTED: endoglucanase 2-like                    271   7e-84    Camelina sativa [gold-of-pleasure]
ref|XP_009398708.1|  PREDICTED: endoglucanase 24-like                   270   9e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010501531.1|  PREDICTED: endoglucanase 2                         270   1e-83    
gb|EPS64495.1|  hypothetical protein M569_10284                         270   1e-83    Genlisea aurea
ref|XP_008221286.1|  PREDICTED: endoglucanase 10-like                   270   2e-83    Prunus mume [ume]
ref|XP_004291374.1|  PREDICTED: endoglucanase 10-like                   270   2e-83    Fragaria vesca subsp. vesca
ref|XP_009386441.1|  PREDICTED: endoglucanase 24-like                   270   2e-83    Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW56649.1|  hypothetical protein EUGRSUZ_I02356                     269   3e-83    Eucalyptus grandis [rose gum]
ref|XP_010029690.1|  PREDICTED: endoglucanase 2-like                    269   3e-83    Eucalyptus grandis [rose gum]
ref|XP_010941260.1|  PREDICTED: endoglucanase 24-like                   268   5e-83    Elaeis guineensis
ref|XP_010539853.1|  PREDICTED: endoglucanase 10                        268   7e-83    Tarenaya hassleriana [spider flower]
gb|KHN00484.1|  Endoglucanase 24                                        268   7e-83    Glycine soja [wild soybean]
ref|XP_009103373.1|  PREDICTED: endoglucanase 2                         268   7e-83    Brassica rapa
emb|CDY66396.1|  BnaAnng22170D                                          268   8e-83    Brassica napus [oilseed rape]
emb|CDY43425.1|  BnaC07g14920D                                          268   9e-83    Brassica napus [oilseed rape]
ref|XP_006426144.1|  hypothetical protein CICLE_v10025306mg             268   1e-82    
gb|KDO78852.1|  hypothetical protein CISIN_1g048736mg                   268   1e-82    Citrus sinensis [apfelsine]
ref|XP_003519870.1|  PREDICTED: endoglucanase 24-like                   267   2e-82    Glycine max [soybeans]
ref|XP_010649048.1|  PREDICTED: endoglucanase 24-like                   266   3e-82    Vitis vinifera
ref|XP_003603741.1|  Endoglucanase                                      266   4e-82    
ref|XP_006466419.1|  PREDICTED: endoglucanase 2-like                    267   5e-82    Citrus sinensis [apfelsine]
ref|NP_173423.1|  glycosyl hydrolase 9B5                                266   5e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007046716.1|  EG                                                 266   5e-82    
ref|XP_010935039.1|  PREDICTED: endoglucanase 24-like                   264   2e-81    Elaeis guineensis
ref|XP_008799407.1|  PREDICTED: endoglucanase 24-like                   264   3e-81    Phoenix dactylifera
ref|XP_010459672.1|  PREDICTED: endoglucanase 2                         263   5e-81    Camelina sativa [gold-of-pleasure]
ref|XP_011462352.1|  PREDICTED: endoglucanase 2-like                    263   6e-81    Fragaria vesca subsp. vesca
gb|AID55379.1|  glycoside hydrolase family 9 B7                         263   7e-81    Gossypium hirsutum [American cotton]
gb|KJB63540.1|  hypothetical protein B456_010G005200                    263   9e-81    Gossypium raimondii
ref|XP_006416450.1|  hypothetical protein EUTSA_v10007364mg             263   9e-81    Eutrema salsugineum [saltwater cress]
ref|XP_009149490.1|  PREDICTED: endoglucanase 2                         262   2e-80    Brassica rapa
ref|XP_011100152.1|  PREDICTED: endoglucanase 24-like                   262   2e-80    
ref|XP_006307252.1|  hypothetical protein CARUB_v10008868mg             262   2e-80    Capsella rubella
ref|XP_003629333.1|  Endoglucanase                                      262   2e-80    Medicago truncatula
ref|XP_007156152.1|  hypothetical protein PHAVU_003G262600g             262   2e-80    Phaseolus vulgaris [French bean]
ref|XP_002893081.1|  glycosyl hydrolase family 9 protein                261   3e-80    Arabidopsis lyrata subsp. lyrata
emb|CDY29381.1|  BnaA06g14150D                                          262   3e-80    Brassica napus [oilseed rape]
ref|XP_006435158.1|  hypothetical protein CICLE_v10003402mg             259   5e-80    
gb|KFK44119.1|  hypothetical protein AALP_AA1G218000                    261   5e-80    Arabis alpina [alpine rockcress]
gb|KDO84821.1|  hypothetical protein CISIN_1g036398mg                   259   1e-79    Citrus sinensis [apfelsine]
ref|XP_011083520.1|  PREDICTED: endoglucanase 10                        259   3e-79    Sesamum indicum [beniseed]
ref|XP_011043209.1|  PREDICTED: endoglucanase 2-like                    258   4e-79    Populus euphratica
ref|XP_008788648.1|  PREDICTED: endoglucanase 24                        258   6e-79    Phoenix dactylifera
ref|XP_004509346.1|  PREDICTED: endoglucanase 10-like                   256   4e-78    Cicer arietinum [garbanzo]
gb|KJB43353.1|  hypothetical protein B456_007G195700                    254   2e-77    Gossypium raimondii
gb|KDP46724.1|  hypothetical protein JCGZ_06512                         253   4e-77    Jatropha curcas
ref|XP_010113364.1|  Endoglucanase 24                                   253   1e-76    
gb|AEO97190.1|  endo-1,4-beta-glucanase                                 252   1e-76    Populus trichocarpa [western balsam poplar]
ref|XP_006383120.1|  hypothetical protein POPTR_0005s11750g             252   2e-76    
ref|XP_006340729.1|  PREDICTED: endoglucanase 2-like                    251   2e-76    Solanum tuberosum [potatoes]
emb|CDY44194.1|  BnaC05g15510D                                          260   3e-76    Brassica napus [oilseed rape]
ref|XP_002462729.1|  hypothetical protein SORBIDRAFT_02g030990          249   2e-75    Sorghum bicolor [broomcorn]
gb|EEC84946.1|  hypothetical protein OsI_32163                          249   2e-75    Oryza sativa Indica Group [Indian rice]
gb|EEE70113.1|  hypothetical protein OsJ_30126                          249   2e-75    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063771.1|  Os09g0533900                                       249   2e-75    
gb|AFZ78646.1|  korrigan                                                249   3e-75    Populus tomentosa [Chinese white poplar]
ref|NP_001145749.1|  hypothetical protein                               246   2e-74    Zea mays [maize]
ref|XP_006661478.1|  PREDICTED: endoglucanase 24-like                   245   2e-74    
ref|XP_009624009.1|  PREDICTED: endoglucanase 2-like                    244   2e-73    Nicotiana tomentosiformis
ref|XP_004957464.1|  PREDICTED: endoglucanase 24-like                   243   3e-73    Setaria italica
ref|XP_004232483.1|  PREDICTED: endoglucanase 2-like                    243   3e-73    Solanum lycopersicum
ref|XP_006390284.1|  hypothetical protein EUTSA_v10018397mg             242   8e-73    Eutrema salsugineum [saltwater cress]
gb|EMT32027.1|  Endoglucanase 24                                        241   1e-72    
ref|XP_009128120.1|  PREDICTED: endoglucanase 10                        241   2e-72    Brassica rapa
dbj|BAJ93299.1|  predicted protein                                      241   2e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010416457.1|  PREDICTED: endoglucanase 10-like                   241   3e-72    Camelina sativa [gold-of-pleasure]
ref|XP_010428595.1|  PREDICTED: endoglucanase 10-like                   240   5e-72    Camelina sativa [gold-of-pleasure]
ref|XP_006302134.1|  hypothetical protein CARUB_v10020139mg             240   5e-72    Capsella rubella
ref|XP_009803640.1|  PREDICTED: endoglucanase 2-like                    240   6e-72    Nicotiana sylvestris
ref|XP_003578508.1|  PREDICTED: endoglucanase 24                        239   8e-72    Brachypodium distachyon [annual false brome]
ref|XP_010471690.1|  PREDICTED: endoglucanase 10                        239   9e-72    Camelina sativa [gold-of-pleasure]
ref|XP_002889037.1|  hypothetical protein ARALYDRAFT_895440             239   1e-71    Arabidopsis lyrata subsp. lyrata
emb|CDY39048.1|  BnaA02g17370D                                          238   2e-71    Brassica napus [oilseed rape]
ref|XP_002530743.1|  endo-1,4-beta-glucanase, putative                  235   2e-71    
ref|NP_177697.1|  glycosyl hydrolase 9B7                                238   4e-71    Arabidopsis thaliana [mouse-ear cress]
gb|AAM63477.1|  endo-beta-1,4-glucanase, putative                       238   5e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010530451.1|  PREDICTED: endoglucanase 2-like                    237   5e-71    
gb|ABK24648.1|  unknown                                                 236   2e-70    Picea sitchensis
ref|XP_003563568.1|  PREDICTED: endoglucanase 18-like                   234   1e-69    Brachypodium distachyon [annual false brome]
gb|EAZ38281.1|  hypothetical protein OsJ_22659                          233   1e-69    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058583.1|  Os06g0715300                                       233   3e-69    
gb|EAZ02358.1|  hypothetical protein OsI_24462                          233   3e-69    Oryza sativa Indica Group [Indian rice]
emb|CDY47506.1|  BnaAnng09040D                                          228   8e-68    Brassica napus [oilseed rape]
dbj|BAK04397.1|  predicted protein                                      228   2e-67    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006656489.1|  PREDICTED: endoglucanase 18-like                   227   5e-67    Oryza brachyantha
gb|EMS54236.1|  Endoglucanase 18                                        226   5e-67    Triticum urartu
ref|XP_009106216.1|  PREDICTED: endoglucanase 10-like                   225   2e-66    Brassica rapa
emb|CDX73186.1|  BnaC06g36340D                                          225   4e-66    
ref|XP_002439027.1|  hypothetical protein SORBIDRAFT_10g030140          224   6e-66    Sorghum bicolor [broomcorn]
ref|XP_004966453.1|  PREDICTED: endoglucanase 18-like                   222   3e-65    Setaria italica
ref|NP_001066668.2|  Os12g0428200                                       218   5e-64    
emb|CDP04111.1|  unnamed protein product                                206   1e-63    Coffea canephora [robusta coffee]
ref|XP_002961546.1|  hypothetical protein SELMODRAFT_77612              216   1e-62    
ref|NP_001288527.1|  uncharacterized protein LOC103626453 precursor     216   1e-62    Zea mays [maize]
ref|XP_002971269.1|  hypothetical protein SELMODRAFT_94888              216   1e-62    
gb|ABA97969.1|  Glycosyl hydrolase family 9 protein, expressed          216   7e-62    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ20312.1|  hypothetical protein OsJ_35923                          207   1e-60    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001763275.1|  predicted protein                                  199   4e-57    
ref|XP_001781646.1|  predicted protein                                  196   7e-56    
gb|KHN34290.1|  Endoglucanase 24                                        195   5e-55    Glycine soja [wild soybean]
ref|XP_002966695.1|  hypothetical protein SELMODRAFT_144066             193   1e-54    
ref|XP_002978046.1|  hypothetical protein SELMODRAFT_417952             192   7e-54    Selaginella moellendorffii
gb|AFN16945.1|  cellulase-like protein                                  159   2e-45    Panicum virgatum
gb|AFN16938.1|  cellulase-like protein                                  158   3e-45    Panicum virgatum
gb|AFN16906.1|  cellulase-like protein                                  157   6e-45    Panicum mystasipum
gb|AFN16885.1|  cellulase-like protein                                  157   6e-45    Panicum chloroleucum
gb|AFN16859.1|  cellulase-like protein                                  157   6e-45    Panicum amarum [bitter panic grass]
gb|AFN16911.1|  cellulase-like protein                                  157   6e-45    Panicum racemosum
gb|AFN16888.1|  cellulase-like protein                                  157   7e-45    Panicum chloroleucum
gb|AFN16884.1|  cellulase-like protein                                  156   1e-44    Panicum cervicatum
gb|AFN16886.1|  cellulase-like protein                                  155   3e-44    Panicum chloroleucum
gb|AFN16894.1|  cellulase-like protein                                  155   3e-44    Panicum chloroleucum
gb|AFN16879.1|  cellulase-like protein                                  155   4e-44    Panicum aquaticum
gb|AFN16877.1|  cellulase-like protein                                  155   4e-44    Panicum amarum var. amarulum [coastal panic grass]
gb|AFN16946.1|  cellulase-like protein                                  155   5e-44    Panicum virgatum
gb|AFN16932.1|  cellulase-like protein                                  155   7e-44    Urochloa plantaginea
gb|AFN16944.1|  cellulase-like protein                                  154   8e-44    Panicum virgatum
gb|AFN16904.1|  cellulase-like protein                                  154   8e-44    Panicum miliaceum [broom millet]
gb|AFN16920.1|  cellulase-like protein                                  154   8e-44    Setaria palmifolia [highland pitpit]
gb|AFN16891.1|  cellulase-like protein                                  154   9e-44    Panicum chloroleucum
gb|AFN16881.1|  cellulase-like protein                                  154   9e-44    Panicum bergii
gb|AFN16880.1|  cellulase-like protein                                  154   1e-43    Panicum aquaticum
gb|EPS65630.1|  hypothetical protein M569_09145                         164   1e-43    Genlisea aurea
gb|AFN16917.1|  cellulase-like protein                                  154   1e-43    Panicum racemosum
gb|AFN16922.1|  cellulase-like protein                                  154   1e-43    Panicum stramineum
gb|AFN16900.1|  cellulase-like protein                                  152   5e-43    Panicum elephantipes
gb|AFN16943.1|  cellulase-like protein                                  152   7e-43    Panicum virgatum
gb|AFN16902.1|  cellulase-like protein                                  152   7e-43    Panicum gouinii
gb|KHN38485.1|  Endoglucanase 11                                        158   2e-41    Glycine soja [wild soybean]
ref|XP_003616918.1|  Endoglucanase                                      158   2e-41    Medicago truncatula
ref|XP_003519454.1|  PREDICTED: endoglucanase 11                        158   2e-41    
gb|AFK38997.1|  unknown                                                 158   3e-41    Medicago truncatula
ref|XP_007215908.1|  hypothetical protein PRUPE_ppa004172mg             157   7e-41    Prunus persica
gb|KCW73256.1|  hypothetical protein EUGRSUZ_E01717                     156   7e-41    Eucalyptus grandis [rose gum]
ref|XP_010058568.1|  PREDICTED: endoglucanase 14-like                   156   8e-41    Eucalyptus grandis [rose gum]
ref|XP_006847867.1|  hypothetical protein AMTR_s00029p00087270          157   9e-41    
ref|XP_008230008.1|  PREDICTED: endoglucanase 11                        156   1e-40    Prunus mume [ume]
ref|XP_011047209.1|  PREDICTED: endoglucanase 11-like                   156   1e-40    Populus euphratica
ref|XP_010110634.1|  Endoglucanase 11                                   156   2e-40    
ref|XP_010666165.1|  PREDICTED: endoglucanase 14-like                   155   2e-40    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB13746.1|  hypothetical protein B456_002G092400                    155   2e-40    Gossypium raimondii
ref|XP_010264780.1|  PREDICTED: endoglucanase 12-like                   156   2e-40    Nelumbo nucifera [Indian lotus]
ref|XP_004304093.1|  PREDICTED: endoglucanase 11                        155   2e-40    Fragaria vesca subsp. vesca
ref|XP_010252537.1|  PREDICTED: endoglucanase 11-like                   155   3e-40    Nelumbo nucifera [Indian lotus]
gb|KHM99090.1|  Endoglucanase 11                                        155   3e-40    Glycine soja [wild soybean]
gb|AID55385.1|  glycoside hydrolase family 9 B8                         155   3e-40    Gossypium hirsutum [American cotton]
gb|KJB13747.1|  hypothetical protein B456_002G092400                    155   4e-40    Gossypium raimondii
ref|XP_009334150.1|  PREDICTED: endoglucanase 11-like                   154   4e-40    Pyrus x bretschneideri [bai li]
ref|XP_002321149.2|  hypothetical protein POPTR_0014s15590g             155   5e-40    Populus trichocarpa [western balsam poplar]
gb|EAY82930.1|  hypothetical protein OsI_38148                          152   5e-40    Oryza sativa Indica Group [Indian rice]
ref|XP_008385953.1|  PREDICTED: endoglucanase 11-like                   150   5e-40    
gb|EYU26800.1|  hypothetical protein MIMGU_mgv1a019325mg                154   5e-40    Erythranthe guttata [common monkey flower]
gb|KDP30800.1|  hypothetical protein JCGZ_13743                         154   5e-40    Jatropha curcas
gb|EYU26799.1|  hypothetical protein MIMGU_mgv1a020424mg                154   6e-40    Erythranthe guttata [common monkey flower]
gb|EYU29517.1|  hypothetical protein MIMGU_mgv1a003302mg                154   7e-40    Erythranthe guttata [common monkey flower]
gb|KDP39180.1|  hypothetical protein JCGZ_00937                         153   1e-39    Jatropha curcas
ref|XP_002529469.1|  endo-1,4-beta-glucanase, putative                  153   1e-39    
gb|AEO97204.1|  endo-1,4-beta-glucanase                                 153   2e-39    Populus trichocarpa [western balsam poplar]
gb|AET00580.2|  glycosyl hydrolase family 9 protein                     153   2e-39    Medicago truncatula
gb|AFZ78643.1|  korrigan                                                153   2e-39    Populus tomentosa [Chinese white poplar]
ref|XP_011046752.1|  PREDICTED: endoglucanase 11-like                   152   2e-39    Populus euphratica
ref|XP_003617621.1|  Endoglucanase                                      153   2e-39    
gb|KHN38252.1|  Endoglucanase 11                                        152   3e-39    Glycine soja [wild soybean]
ref|XP_008342129.1|  PREDICTED: endoglucanase 11-like                   152   3e-39    
ref|XP_008366459.1|  PREDICTED: endoglucanase 11-like                   150   3e-39    
ref|XP_002300328.1|  hypothetical protein POPTR_0001s36600g             152   4e-39    
ref|XP_003518530.1|  PREDICTED: endoglucanase 11-like                   152   4e-39    Glycine max [soybeans]
gb|AFZ78645.1|  korrigan                                                152   4e-39    Populus tomentosa [Chinese white poplar]
ref|XP_008460200.1|  PREDICTED: endoglucanase 13-like                   152   4e-39    Cucumis melo [Oriental melon]
ref|XP_006596588.1|  PREDICTED: endoglucanase 11-like                   152   4e-39    
gb|AEO97205.1|  endo-1,4-beta-glucanase                                 152   5e-39    Populus trichocarpa [western balsam poplar]
ref|XP_004491112.1|  PREDICTED: endoglucanase 11-like                   152   5e-39    Cicer arietinum [garbanzo]
ref|XP_007212600.1|  hypothetical protein PRUPE_ppa016852mg             151   6e-39    Prunus persica
emb|CAF18445.1|  endo-1,4-beta-D-glucanase KORRIGAN                     145   7e-39    Pisum sativum [garden pea]
ref|XP_004491466.1|  PREDICTED: endoglucanase 11-like                   151   7e-39    Cicer arietinum [garbanzo]
ref|XP_011085126.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    150   9e-39    Sesamum indicum [beniseed]
ref|XP_007142327.1|  hypothetical protein PHAVU_008G270900g             151   9e-39    Phaseolus vulgaris [French bean]
ref|XP_010688721.1|  PREDICTED: endoglucanase 5                         151   1e-38    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008364782.1|  PREDICTED: endoglucanase 11-like                   150   1e-38    
gb|KHG28140.1|  hypothetical protein F383_15365                         150   1e-38    Gossypium arboreum [tree cotton]
ref|XP_009804981.1|  PREDICTED: endoglucanase 5                         151   1e-38    Nicotiana sylvestris
ref|XP_008227038.1|  PREDICTED: endoglucanase 11-like                   150   1e-38    Prunus mume [ume]
gb|AID55384.1|  glycoside hydrolase family 9 B11                        150   1e-38    Gossypium hirsutum [American cotton]
ref|XP_011072104.1|  PREDICTED: endoglucanase 5-like                    150   2e-38    
ref|XP_009351718.1|  PREDICTED: endoglucanase 5                         150   2e-38    Pyrus x bretschneideri [bai li]
ref|XP_003579470.1|  PREDICTED: endoglucanase 13                        150   2e-38    
ref|XP_008805594.1|  PREDICTED: endoglucanase 11-like                   149   3e-38    
ref|XP_010536683.1|  PREDICTED: endoglucanase 11-like                   149   3e-38    Tarenaya hassleriana [spider flower]
ref|XP_003601390.1|  Endoglucanase                                      149   3e-38    Medicago truncatula
ref|XP_009589429.1|  PREDICTED: endoglucanase 11-like                   149   3e-38    Nicotiana tomentosiformis
ref|XP_009802592.1|  PREDICTED: endoglucanase 11-like                   149   4e-38    Nicotiana sylvestris
emb|CBI27137.3|  unnamed protein product                                150   4e-38    Vitis vinifera
ref|XP_004168441.1|  PREDICTED: endoglucanase 13-like                   149   4e-38    
ref|XP_002277177.2|  PREDICTED: LOW QUALITY PROTEIN: endoglucanase 5    150   4e-38    
gb|AFW74700.1|  hypothetical protein ZEAMMB73_090741                    147   4e-38    
gb|KGN46280.1|  hypothetical protein Csa_6G079740                       149   5e-38    Cucumis sativus [cucumbers]
ref|XP_006843615.1|  hypothetical protein AMTR_s00007p00145080          143   5e-38    
ref|XP_006452448.1|  hypothetical protein CICLE_v10007984mg             149   5e-38    Citrus clementina [clementine]
ref|XP_006447630.1|  hypothetical protein CICLE_v10014884mg             149   6e-38    Citrus clementina [clementine]
gb|AES89439.2|  endo-1,4-beta-glucanase                                 149   6e-38    Medicago truncatula
ref|XP_003607242.1|  Glycosyl hydrolase family                          149   6e-38    
ref|XP_010244161.1|  PREDICTED: endoglucanase 11-like                   149   6e-38    Nelumbo nucifera [Indian lotus]
ref|XP_004153697.1|  PREDICTED: endoglucanase 12-like                   148   6e-38    Cucumis sativus [cucumbers]
gb|KJB08652.1|  hypothetical protein B456_001G095700                    149   6e-38    Gossypium raimondii
gb|AAZ08321.1|  putative endo-1,4-beta-glucanase                        147   7e-38    Eucalyptus globulus [blue gum]
ref|XP_007226370.1|  hypothetical protein PRUPE_ppa022524mg             149   7e-38    
ref|XP_008379665.1|  PREDICTED: endoglucanase 11-like isoform X1        148   7e-38    Malus domestica [apple tree]
ref|XP_009365103.1|  PREDICTED: endoglucanase 11 isoform X1             148   7e-38    Pyrus x bretschneideri [bai li]
ref|XP_007043305.1|  Glycosyl hydrolase 9C1 isoform 1                   149   7e-38    
ref|XP_007043306.1|  Glycosyl hydrolase 9C1 isoform 2                   149   7e-38    
ref|XP_009376856.1|  PREDICTED: endoglucanase 14-like                   148   8e-38    
ref|XP_008340449.1|  PREDICTED: endoglucanase 5                         149   8e-38    Malus domestica [apple tree]
gb|KDP25211.1|  hypothetical protein JCGZ_20367                         148   8e-38    Jatropha curcas
ref|XP_004149748.1|  PREDICTED: endoglucanase 6-like                    149   9e-38    Cucumis sativus [cucumbers]
gb|AGG19097.1|  cellulase                                               147   9e-38    Zea mays [maize]
ref|XP_009618623.1|  PREDICTED: endoglucanase 5                         149   1e-37    Nicotiana tomentosiformis
ref|XP_007049160.1|  Glycosyl hydrolase 9B8                             148   1e-37    
ref|XP_008437388.1|  PREDICTED: endoglucanase 6-like isoform X1         149   1e-37    Cucumis melo [Oriental melon]
ref|XP_007020721.1|  Glycosyl hydrolase 9B8                             148   1e-37    
ref|XP_008366122.1|  PREDICTED: endoglucanase 14-like                   148   1e-37    
ref|XP_004301501.1|  PREDICTED: endoglucanase 5                         148   1e-37    Fragaria vesca subsp. vesca
gb|AFK45497.1|  unknown                                                 149   1e-37    Lotus japonicus
ref|XP_008449473.1|  PREDICTED: endoglucanase 11                        148   1e-37    
ref|XP_009405235.1|  PREDICTED: endoglucanase 13-like                   147   1e-37    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001142480.1|  uncharacterized protein LOC100274698               141   1e-37    
ref|XP_011087276.1|  PREDICTED: endoglucanase 5-like                    148   2e-37    Sesamum indicum [beniseed]
ref|XP_008805729.1|  PREDICTED: endoglucanase 13                        148   2e-37    
ref|XP_008650181.1|  PREDICTED: endoglucanase 14-like                   147   2e-37    
emb|CBG76271.1|  OO_Ba0005L10-OO_Ba0081K17.22                           147   2e-37    
ref|XP_004143869.1|  PREDICTED: endoglucanase 6-like                    147   2e-37    
ref|XP_009361039.1|  PREDICTED: endoglucanase 11-like                   147   2e-37    
ref|XP_010682188.1|  PREDICTED: endoglucanase 25                        147   3e-37    
ref|XP_006475127.1|  PREDICTED: endoglucanase 11-like                   147   3e-37    
gb|ABF98747.1|  endo-1,4-beta-glucanase Cel1, putative, expressed       147   3e-37    
ref|XP_011076830.1|  PREDICTED: endoglucanase 12-like                   146   3e-37    
gb|KDO62113.1|  hypothetical protein CISIN_1g036785mg                   147   3e-37    
ref|XP_009414123.1|  PREDICTED: endoglucanase 7-like                    147   3e-37    
ref|XP_004500768.1|  PREDICTED: endoglucanase 24-like isoform X3        144   3e-37    
ref|XP_010522359.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    147   3e-37    
ref|XP_004295846.1|  PREDICTED: endoglucanase 11-like                   146   3e-37    
gb|AFZ78644.1|  korrigan                                                147   4e-37    
ref|XP_009403726.1|  PREDICTED: endoglucanase 9-like isoform X1         145   4e-37    
ref|NP_001051192.1|  Os03g0736300                                       147   4e-37    
gb|KHN23901.1|  Endoglucanase 11                                        147   4e-37    
ref|XP_010935663.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    147   4e-37    
emb|CDY19174.1|  BnaA04g19140D                                          146   4e-37    
ref|XP_009141285.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    146   4e-37    
ref|XP_002271094.2|  PREDICTED: endoglucanase 11                        146   4e-37    
ref|XP_002525326.1|  endo-1,4-beta-glucanase, putative                  146   4e-37    
ref|XP_009627045.1|  PREDICTED: endoglucanase 11-like                   146   4e-37    
ref|XP_006357959.1|  PREDICTED: endoglucanase 11-like                   146   4e-37    
ref|XP_010457267.1|  PREDICTED: endoglucanase 1-like                    138   4e-37    
ref|XP_010094075.1|  Endoglucanase 5                                    147   4e-37    
ref|XP_009403727.1|  PREDICTED: endoglucanase 9-like isoform X2         145   5e-37    
dbj|BAA21111.1|  endo-1,4-beta-glucanase                                143   5e-37    
ref|XP_006590804.1|  PREDICTED: endoglucanase 5-like                    147   5e-37    
ref|XP_004502038.1|  PREDICTED: endoglucanase 11-like                   146   6e-37    
gb|KHN32282.1|  Endoglucanase 5                                         146   6e-37    
ref|XP_002527135.1|  endo-1,4-beta-glucanase, putative                  146   7e-37    
gb|KFK31096.1|  hypothetical protein AALP_AA6G067600                    145   8e-37    
ref|XP_010413920.1|  PREDICTED: endoglucanase 11                        145   8e-37    
ref|XP_002510937.1|  endo-1,4-beta-glucanase, putative                  145   8e-37    
ref|XP_006410437.1|  hypothetical protein EUTSA_v10016495mg             145   1e-36    
gb|KHN05445.1|  Endoglucanase 5                                         145   1e-36    
emb|CDY17123.1|  BnaA05g10650D                                          145   1e-36    
ref|XP_002310080.1|  endo-1 family protein                              145   1e-36    
ref|XP_006837247.1|  hypothetical protein AMTR_s00112p00038750          145   1e-36    
ref|XP_007040506.1|  Glycosyl hydrolase 9C2                             145   1e-36    
ref|XP_006355746.1|  PREDICTED: endoglucanase 14-like                   144   1e-36    
emb|CDY19428.1|  BnaC04g11710D                                          145   1e-36    
ref|XP_002277353.2|  PREDICTED: endoglucanase 11-like                   145   2e-36    
gb|KHG02199.1|  hypothetical protein F383_00334                         145   2e-36    
ref|XP_003540637.2|  PREDICTED: endoglucanase 5                         145   2e-36    
dbj|BAD95336.1|  cellulase homolog OR16pep precursor                    140   2e-36    
ref|XP_004503629.1|  PREDICTED: endoglucanase 6-like                    145   2e-36    
ref|XP_006437568.1|  hypothetical protein CICLE_v10033912mg             145   2e-36    
ref|XP_002862860.1|  predicted protein                                  144   2e-36    
ref|XP_010533226.1|  PREDICTED: endoglucanase 25                        145   2e-36    
ref|XP_004505716.1|  PREDICTED: endoglucanase 5-like                    145   2e-36    
ref|XP_010681760.1|  PREDICTED: endoglucanase 11-like                   144   2e-36    
gb|AID55393.1|  glycoside hydrolase family 9 C1                         145   2e-36    
ref|XP_006359861.1|  PREDICTED: endoglucanase 17-like                   144   2e-36    
gb|EPS69947.1|  hypothetical protein M569_04812                         144   2e-36    
gb|ADQ73896.1|  endo-1,4-beta-glucanase                                 142   2e-36    
ref|XP_006837249.1|  hypothetical protein AMTR_s00112p00047400          144   2e-36    
ref|XP_004243521.1|  PREDICTED: endoglucanase 11                        144   2e-36    
gb|KDO52762.1|  hypothetical protein CISIN_1g043219mg                   144   2e-36    
ref|XP_009400506.1|  PREDICTED: endoglucanase 10-like                   145   2e-36    
ref|XP_002879427.1|  glycosyl hydrolase family 9 protein                144   3e-36    
ref|XP_010549156.1|  PREDICTED: endoglucanase 5                         145   3e-36    
ref|XP_008801082.1|  PREDICTED: endoglucanase 12-like                   144   3e-36    
ref|XP_010531476.1|  PREDICTED: endoglucanase 23-like                   144   3e-36    
ref|XP_006842476.1|  hypothetical protein AMTR_s00077p00078180          140   3e-36    
gb|EYU35397.1|  hypothetical protein MIMGU_mgv1a003033mg                144   3e-36    
gb|KJB31835.1|  hypothetical protein B456_005G210200                    144   3e-36    
emb|CDY59895.1|  BnaC06g40900D                                          144   3e-36    
ref|XP_002977531.1|  hypothetical protein SELMODRAFT_417347             143   3e-36    
ref|XP_010035530.1|  PREDICTED: endoglucanase 11                        144   3e-36    
ref|XP_010060286.1|  PREDICTED: endoglucanase 11-like                   144   3e-36    
gb|KHG21954.1|  hypothetical protein F383_28246                         144   3e-36    
ref|XP_004981854.1|  PREDICTED: endoglucanase 10-like                   144   3e-36    
gb|KCW66948.1|  hypothetical protein EUGRSUZ_F00710                     144   3e-36    
ref|XP_004238641.1|  PREDICTED: endoglucanase 25-like                   144   3e-36    
ref|XP_008221053.1|  PREDICTED: endoglucanase 5                         144   3e-36    
ref|NP_001234882.1|  endo-1,4-beta-glucanase precursor                  144   3e-36    
ref|XP_010509938.1|  PREDICTED: endoglucanase 11-like isoform X3        144   3e-36    
ref|XP_004500767.1|  PREDICTED: endoglucanase 24-like isoform X2        143   3e-36    
ref|XP_010509936.1|  PREDICTED: endoglucanase 11-like isoform X1        144   4e-36    
ref|XP_008232258.1|  PREDICTED: endoglucanase 14-like                   143   4e-36    
ref|XP_009143907.1|  PREDICTED: endoglucanase 11                        144   4e-36    
gb|AAD28258.1|AF128404_1  cellulase homolog                             143   4e-36    
ref|XP_003594425.1|  Endoglucanase                                      144   4e-36    
emb|CDY23776.1|  BnaC04g43460D                                          144   4e-36    
ref|XP_008461371.1|  PREDICTED: endoglucanase 5                         144   4e-36    
gb|KJB31836.1|  hypothetical protein B456_005G210200                    144   4e-36    
emb|CDY52780.1|  BnaCnng23250D                                          144   4e-36    
ref|XP_004298897.1|  PREDICTED: endoglucanase 6                         144   4e-36    
emb|CDP12150.1|  unnamed protein product                                144   4e-36    
ref|XP_006293986.1|  hypothetical protein CARUB_v10022977mg             143   5e-36    
gb|KEH24407.1|  glycosyl hydrolase family 9 protein                     138   5e-36    
ref|XP_004500766.1|  PREDICTED: endoglucanase 24-like isoform X1        143   5e-36    
gb|AAC78298.2|  cellulase                                               144   5e-36    
gb|KFK36055.1|  hypothetical protein AALP_AA4G071900                    144   5e-36    
gb|KEH27425.1|  endo-1,4-beta-glucanase                                 140   5e-36    
ref|XP_006411695.1|  hypothetical protein EUTSA_v10025010mg             143   5e-36    
emb|CAC94006.1|  endo-beta-1,4-glucanase                                144   5e-36    
ref|XP_009787485.1|  PREDICTED: endoglucanase 11-like                   143   5e-36    
gb|ABR16291.1|  unknown                                                 144   5e-36    
gb|AEL88496.1|  membrane-bound endo-1,4-beta-glucanase                  144   5e-36    
ref|XP_007131338.1|  hypothetical protein PHAVU_011G005500g             142   5e-36    
ref|NP_001054543.1|  Os05g0129200                                       143   5e-36    
ref|XP_006653871.1|  PREDICTED: endoglucanase 13-like                   144   6e-36    
ref|XP_008451938.1|  PREDICTED: endoglucanase 6-like                    144   6e-36    
ref|XP_010436996.1|  PREDICTED: endoglucanase 23-like                   143   6e-36    
emb|CDP13792.1|  unnamed protein product                                143   6e-36    
ref|XP_006388089.1|  hypothetical protein POPTR_0347s002202g            137   6e-36    
gb|KGN50329.1|  hypothetical protein Csa_5G167210                       142   6e-36    
emb|CDY41954.1|  BnaA01g05260D                                          142   6e-36    
ref|XP_011008907.1|  PREDICTED: endoglucanase 5                         143   7e-36    
gb|AEO97200.1|  endo-1,4-beta-glucanase                                 142   7e-36    
gb|ABR15471.1|  endoglucanase                                           143   7e-36    
ref|XP_009797971.1|  PREDICTED: endoglucanase 6-like isoform X2         143   7e-36    
ref|XP_006283596.1|  hypothetical protein CARUB_v10004652mg             142   7e-36    
gb|AFL65037.1|  endoglucanase                                           142   7e-36    
ref|XP_003604007.1|  Endo-1 4-beta-glucanase                            142   8e-36    
ref|NP_180858.1|  glycosyl hydrolase 9B8                                143   8e-36    
gb|AGC94751.1|  endoglucanase-1,4-beta glucanase 6                      142   8e-36    
ref|XP_002301487.1|  hypothetical protein POPTR_0002s20350g             142   8e-36    
emb|CDY22400.1|  BnaA06g37220D                                          142   8e-36    
ref|XP_010533225.1|  PREDICTED: endoglucanase 25-like                   143   8e-36    
ref|XP_010913407.1|  PREDICTED: endoglucanase 11                        143   8e-36    
ref|XP_009797970.1|  PREDICTED: endoglucanase 6-like isoform X1         143   8e-36    
emb|CDX93707.1|  BnaA06g03410D                                          143   9e-36    
ref|XP_009144504.1|  PREDICTED: endoglucanase 23                        142   9e-36    
gb|EMT00674.1|  Endoglucanase 10                                        143   9e-36    
ref|XP_010481246.1|  PREDICTED: endoglucanase 1                         142   9e-36    
gb|EMS52550.1|  Endoglucanase 10                                        142   9e-36    
gb|KCW51302.1|  hypothetical protein EUGRSUZ_J00862                     143   9e-36    
ref|XP_006354983.1|  PREDICTED: endoglucanase 5-like                    143   1e-35    
gb|AID55375.1|  glycoside hydrolase family 9 C3                         142   1e-35    
gb|KEH29369.1|  glycosyl hydrolase family 9 protein                     142   1e-35    
emb|CAN81074.1|  hypothetical protein VITISV_024504                     142   1e-35    
ref|XP_006367808.1|  PREDICTED: endoglucanase 8-like                    142   1e-35    
emb|CDY37459.1|  BnaC08g45970D                                          142   1e-35    
ref|XP_010031904.1|  PREDICTED: endoglucanase 5                         143   1e-35    
gb|AID55378.1|  glycoside hydrolase family 9 B9                         142   1e-35    
ref|XP_006356407.1|  PREDICTED: endoglucanase 25-like                   143   1e-35    
emb|CDY32480.1|  BnaA09g51160D                                          142   1e-35    
dbj|BAJ94336.1|  predicted protein                                      143   1e-35    
ref|XP_010096109.1|  Endoglucanase 11                                   142   1e-35    
gb|AGV22124.1|  endo-1,4-beta-glucanase 2                               142   1e-35    
ref|XP_003526224.2|  PREDICTED: endoglucanase 8-like                    142   1e-35    
ref|XP_011079628.1|  PREDICTED: endoglucanase 17                        142   1e-35    
ref|XP_002448763.1|  hypothetical protein SORBIDRAFT_06g032760          143   1e-35    
dbj|BAA94257.1|  endo-1,4-beta-glucanase Cel1                           143   1e-35    
ref|XP_006418304.1|  hypothetical protein EUTSA_v10007402mg             142   1e-35    
gb|KHN33715.1|  Endoglucanase 23                                        141   1e-35    
ref|XP_004486415.1|  PREDICTED: endoglucanase 25-like                   142   1e-35    
emb|CDY60075.1|  BnaA05g36410D                                          142   1e-35    
ref|XP_002973718.1|  hypothetical protein SELMODRAFT_99802              143   1e-35    
ref|XP_009408428.1|  PREDICTED: endoglucanase 7-like isoform X1         142   1e-35    
ref|XP_009395086.1|  PREDICTED: endoglucanase 10-like                   142   1e-35    
ref|XP_009144994.1|  PREDICTED: endoglucanase 5-like                    142   1e-35    
ref|XP_003611061.1|  Cellulase                                          142   1e-35    
gb|KJB52283.1|  hypothetical protein B456_008G254000                    142   1e-35    
gb|KJB42852.1|  hypothetical protein B456_007G170600                    142   1e-35    
ref|XP_003557996.1|  PREDICTED: endoglucanase 9                         142   1e-35    
gb|KJB52282.1|  hypothetical protein B456_008G254000                    142   2e-35    
gb|KDP25304.1|  hypothetical protein JCGZ_20460                         141   2e-35    
ref|XP_004516730.1|  PREDICTED: uncharacterized protein LOC101505775    145   2e-35    
ref|XP_007220712.1|  hypothetical protein PRUPE_ppa021556mg             141   2e-35    
ref|XP_007131641.1|  hypothetical protein PHAVU_011G030300g             143   2e-35    
emb|CDY65179.1|  BnaCnng45930D                                          142   2e-35    
ref|XP_009408429.1|  PREDICTED: endoglucanase 7-like isoform X2         141   2e-35    
gb|AAL30454.1|AF362949_1  endo-beta-1,4-glucanase precursor             142   2e-35    
ref|XP_009601304.1|  PREDICTED: endoglucanase 6                         142   2e-35    
ref|XP_004135956.1|  PREDICTED: endoglucanase 5-like                    142   2e-35    
gb|AFK41115.1|  unknown                                                 134   2e-35    
ref|XP_009101916.1|  PREDICTED: endoglucanase 22-like                   141   2e-35    
ref|XP_009147931.1|  PREDICTED: endoglucanase 5                         142   2e-35    
ref|XP_010088306.1|  Endoglucanase 17                                   142   2e-35    
gb|KGN45077.1|  hypothetical protein Csa_7G420700                       142   2e-35    
emb|CDY22043.1|  BnaA09g00720D                                          142   2e-35    
ref|XP_006484545.1|  PREDICTED: endoglucanase 5-like                    142   2e-35    
ref|XP_006393331.1|  hypothetical protein EUTSA_v10011318mg             142   2e-35    
gb|AAM13693.1|  endo-1,4-beta-glucanase                                 142   2e-35    
ref|XP_010521418.1|  PREDICTED: endoglucanase 25-like                   142   2e-35    
gb|KDP25379.1|  hypothetical protein JCGZ_20535                         141   2e-35    
ref|XP_003611058.1|  Endo-1 4-beta-glucanase                            140   2e-35    
ref|XP_006643915.1|  PREDICTED: endoglucanase 1-like                    142   2e-35    
emb|CDY01915.1|  BnaC02g28120D                                          140   2e-35    
ref|XP_008374318.1|  PREDICTED: endoglucanase 6-like                    142   2e-35    
gb|AEN70797.1|  endo-1,4-beta-glucanase                                 142   2e-35    
gb|KDP43311.1|  hypothetical protein JCGZ_24232                         142   2e-35    
ref|XP_010069895.1|  PREDICTED: endoglucanase 17                        141   2e-35    
ref|XP_006843611.1|  hypothetical protein AMTR_s00007p00143890          134   2e-35    
ref|XP_004143674.1|  PREDICTED: endoglucanase 8-like                    141   2e-35    
ref|XP_004167915.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    141   2e-35    
ref|XP_002299405.1|  endo-1 family protein                              142   2e-35    
gb|AAZ08322.1|  endo-1,4-beta-glucanase                                 141   2e-35    
gb|KDO76516.1|  hypothetical protein CISIN_1g006835mg                   139   2e-35    
ref|XP_007131339.1|  hypothetical protein PHAVU_011G005600g             140   2e-35    
ref|XP_003540572.2|  PREDICTED: endoglucanase 8-like                    141   2e-35    
ref|XP_009118744.1|  PREDICTED: endoglucanase 1 isoform X1              141   2e-35    
dbj|BAL41418.1|  endo-1,4-beta-glucanase                                141   3e-35    
emb|CAB43938.1|  endo-beta-1,4-glucanase                                142   3e-35    
ref|XP_007147545.1|  hypothetical protein PHAVU_006G133700g             142   3e-35    
gb|EYU42228.1|  hypothetical protein MIMGU_mgv1a004926mg                141   3e-35    
ref|XP_002463915.1|  hypothetical protein SORBIDRAFT_01g008860          142   3e-35    
gb|AID55380.1|  glycoside hydrolase family 9 A2                         142   3e-35    
ref|XP_009626013.1|  PREDICTED: endoglucanase 6-like                    142   3e-35    
ref|XP_009764063.1|  PREDICTED: endoglucanase 6-like                    142   3e-35    
ref|XP_002465324.1|  hypothetical protein SORBIDRAFT_01g036480          142   3e-35    
ref|XP_010541571.1|  PREDICTED: endoglucanase 19                        142   3e-35    
gb|KJB70736.1|  hypothetical protein B456_011G089500                    142   3e-35    
gb|ADY68792.1|  membrane-anchored endo-1,4-beta-glucanase               142   3e-35    
ref|XP_003523510.1|  PREDICTED: endoglucanase 24-like                   141   3e-35    
gb|ADY68794.1|  membrane-anchored endo-1,4-beta-glucanase               142   3e-35    
gb|AAS87601.1|  membrane-anchored endo-1,4-beta-glucanase               142   3e-35    
ref|XP_010999860.1|  PREDICTED: endoglucanase 9-like                    142   3e-35    
ref|XP_007160157.1|  hypothetical protein PHAVU_002G297600g             142   3e-35    
ref|XP_006650027.1|  PREDICTED: endoglucanase 9-like                    142   3e-35    
ref|XP_003560035.1|  PREDICTED: endoglucanase 10                        142   3e-35    
gb|ACT54548.1|  endo-1,4-beta-glucanase                                 141   3e-35    
gb|AEN70816.1|  endo-1,4-beta-glucanase                                 142   3e-35    
ref|XP_004158222.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    142   3e-35    
gb|AAQ08018.1|  endo-1,4-beta-glucanase                                 141   3e-35    
ref|XP_009134219.1|  PREDICTED: endoglucanase 19 isoform X2             142   3e-35    
ref|XP_009134218.1|  PREDICTED: endoglucanase 19 isoform X1             142   3e-35    



>ref|XP_009610927.1| PREDICTED: endoglucanase 2-like [Nicotiana tomentosiformis]
Length=525

 Score =   312 bits (799),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTDSGL+WIS+WNALQHPVASAFLAV+YSDYML+SRTAKITC+G  YTPSDLRK
Sbjct  351  PTATSSRTDSGLIWISEWNALQHPVASAFLAVLYSDYMLTSRTAKITCNGDAYTPSDLRK  410

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQADYVLGDNP KMSYLVGYGDNYP+YVHHRGASIP DA TGCKDG+KWL+ST+PNP
Sbjct  411  FAISQADYVLGDNPSKMSYLVGYGDNYPQYVHHRGASIPKDADTGCKDGWKWLDSTEPNP  470

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPFLNETYIDSRNNSMQAEPTTYNSA+IVGLLSGL
Sbjct  471  NVATGALVGGPFLNETYIDSRNNSMQAEPTTYNSAVIVGLLSGL  514



>ref|XP_009783020.1| PREDICTED: endoglucanase 2 [Nicotiana sylvestris]
Length=525

 Score =   310 bits (793),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTDSGL+WIS+WNALQHPVASAFLAV+YSDYML+SRTAKITC+G  YTPSDLRK
Sbjct  351  PTATSSRTDSGLIWISEWNALQHPVASAFLAVLYSDYMLTSRTAKITCNGDAYTPSDLRK  410

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQADYVLGDNP KMSYLVGYGDNYP+YVHHRGASIP DA T CKDG+KWL+ST+PNP
Sbjct  411  FAISQADYVLGDNPSKMSYLVGYGDNYPQYVHHRGASIPEDADTSCKDGWKWLDSTEPNP  470

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPFLNETYIDSRNNSMQAEPTTYNSA+IVGLLSGL
Sbjct  471  NVATGALVGGPFLNETYIDSRNNSMQAEPTTYNSAVIVGLLSGL  514



>ref|XP_011074667.1| PREDICTED: endoglucanase 10-like [Sesamum indicum]
Length=525

 Score =   307 bits (787),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTDSGLVW+SQWNALQHPVASA LAV+YSDYML+SRTAKI+CDG Y+ PSDLRK
Sbjct  351  PTATSSRTDSGLVWVSQWNALQHPVASALLAVIYSDYMLTSRTAKISCDGHYFRPSDLRK  410

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FAMSQADYVLGDNPMKMSYLVGYGD YP+YVHHRGASIP DATTGCKDGF+WL+S +PNP
Sbjct  411  FAMSQADYVLGDNPMKMSYLVGYGDKYPQYVHHRGASIPADATTGCKDGFQWLKSDKPNP  470

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            N+A+G LVGGPFLNE+++DSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  471  NIAMGALVGGPFLNESFVDSRNNSMQTEPSTYNSAVIVGLLSSL  514



>emb|CDP07412.1| unnamed protein product [Coffea canephora]
Length=526

 Score =   304 bits (779),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTDSGL+WIS+WNALQHPVASAFLAVVYSDYMLSSRTA+I+CD   +TP+DLRK
Sbjct  352  PTATSSRTDSGLIWISEWNALQHPVASAFLAVVYSDYMLSSRTAEISCDSDSFTPADLRK  411

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FAMSQADYVLG+NP K+SYLVGYGDNYPK+VHHRGASIP DA TGCKDGF+WL+S +PNP
Sbjct  412  FAMSQADYVLGNNPAKLSYLVGYGDNYPKFVHHRGASIPMDAKTGCKDGFQWLDSDKPNP  471

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVG LVGGPF+NETYIDSRNNSMQAEP+TYNSA+IV LLSGL
Sbjct  472  NVAVGALVGGPFMNETYIDSRNNSMQAEPSTYNSAVIVALLSGL  515



>ref|XP_006342034.1| PREDICTED: endoglucanase 10-like [Solanum tuberosum]
Length=519

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTDSGL+WI+QWNALQHPVASAFLAVVYSDYML+S+T K+TCDG  YTPSDLRK
Sbjct  345  PTATSSRTDSGLIWITQWNALQHPVASAFLAVVYSDYMLTSKTGKMTCDGNEYTPSDLRK  404

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FAMSQA+YVLGDNP KMSYLVGYGD YP+YVHHRGASIPTDA T CK+G+K+L+ST+PNP
Sbjct  405  FAMSQANYVLGDNPAKMSYLVGYGDKYPQYVHHRGASIPTDADTNCKEGWKYLDSTEPNP  464

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPFLNETYIDSRNNS+Q EPTTYNSA+IVGLLSGL
Sbjct  465  NVATGALVGGPFLNETYIDSRNNSIQGEPTTYNSAVIVGLLSGL  508



>ref|XP_010667385.1| PREDICTED: endoglucanase 2-like [Beta vulgaris subsp. vulgaris]
Length=523

 Score =   299 bits (765),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTD GL+W+S+WNALQHPVASAFLAVVYSDYMLSSRTA+I+C+G  Y PS+LRK
Sbjct  349  PTATSSRTDGGLIWVSEWNALQHPVASAFLAVVYSDYMLSSRTARISCNGNSYKPSELRK  408

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQADYVLG+NPMKMS+LVGYGD YP++VHHRGASIP DA TGC DGFKWL ST+PNP
Sbjct  409  FALSQADYVLGNNPMKMSFLVGYGDKYPQFVHHRGASIPADAKTGCDDGFKWLNSTEPNP  468

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVG LVGGPFLNET+ID RNNSMQ EPTTYN+A++VGLLSGL
Sbjct  469  NVAVGALVGGPFLNETFIDDRNNSMQTEPTTYNNALVVGLLSGL  512



>ref|XP_010061046.1| PREDICTED: endoglucanase 10-like [Eucalyptus grandis]
 gb|KCW67943.1| hypothetical protein EUGRSUZ_F01640 [Eucalyptus grandis]
Length=528

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT+SRTDSGL+W+S+WN+LQHPVASAFLA +YSDYML+SRTAKI+C G+ Y PSDLRK
Sbjct  354  PTATTSRTDSGLIWVSEWNSLQHPVASAFLATIYSDYMLTSRTAKISCSGQTYRPSDLRK  413

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADYVLGDNP+KMSYLVGYGDNYP+YVHHRGASIP +A TGC DGFKWL ST PNP
Sbjct  414  FAQSQADYVLGDNPIKMSYLVGYGDNYPQYVHHRGASIPVNAKTGCTDGFKWLNSTDPNP  473

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPFLNETYIDSRNNSMQ EP+TYNSA+IVGLLSGL
Sbjct  474  NVATGALVGGPFLNETYIDSRNNSMQTEPSTYNSALIVGLLSGL  517



>gb|KHF97947.1| hypothetical protein F383_10892 [Gossypium arboreum]
Length=526

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P+ATSSRTD GLVWIS+WNALQHPVASAFLA +YSDYML+S+TAKITC    + PSDLRK
Sbjct  352  PSATSSRTDGGLVWISEWNALQHPVASAFLAALYSDYMLTSQTAKITCGDHSFKPSDLRK  411

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DATTGC DGFKWL+STQPNP
Sbjct  412  FAKSQADYVLGKNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCTDGFKWLDSTQPNP  471

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA+IVGLLS L
Sbjct  472  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSALIVGLLSSL  515



>gb|AID55377.1| glycoside hydrolase family 9 B5 [Gossypium hirsutum]
Length=526

 Score =   297 bits (761),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P+ATSSRTD GLVWIS+WNALQHPVASAFLA +YSDYML+S+TAKITC    + PSDLRK
Sbjct  352  PSATSSRTDGGLVWISEWNALQHPVASAFLAALYSDYMLTSQTAKITCGDHSFKPSDLRK  411

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DATTGC DGFKWL+ST+PNP
Sbjct  412  FAKSQADYVLGKNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCTDGFKWLDSTEPNP  471

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA+IVGLLS L
Sbjct  472  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSALIVGLLSSL  515



>gb|ADU15552.1| EG [Gossypium hirsutum]
Length=526

 Score =   297 bits (760),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P+ATSSRTD GLVWIS+WNALQHPVASAFLA +YSDYML+S+TAKITC    + PSDLRK
Sbjct  352  PSATSSRTDGGLVWISEWNALQHPVASAFLAALYSDYMLTSQTAKITCGDHSFKPSDLRK  411

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DATTGC DGFKWL+ST+PNP
Sbjct  412  FAKSQADYVLGKNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCTDGFKWLDSTEPNP  471

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA+IVGLLS L
Sbjct  472  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSALIVGLLSSL  515



>gb|KJB58121.1| hypothetical protein B456_009G195400 [Gossypium raimondii]
Length=393

 Score =   293 bits (749),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P+ATSSRTD GLVWIS+WNALQHPVASAFLA +YSDYML+S+TAKITC    + PSDLRK
Sbjct  219  PSATSSRTDGGLVWISEWNALQHPVASAFLAALYSDYMLTSQTAKITCGDHSFKPSDLRK  278

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
             A SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DATTGC DGFKWL+ST+PNP
Sbjct  279  LAKSQADYVLGKNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCTDGFKWLDSTEPNP  338

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVGGLVGGPFLNETYIDSRNNS QAEPTTYNSA+IVGLLS L
Sbjct  339  NVAVGGLVGGPFLNETYIDSRNNSKQAEPTTYNSALIVGLLSSL  382



>ref|XP_004238345.1| PREDICTED: endoglucanase 2-like [Solanum lycopersicum]
 ref|XP_010320423.1| PREDICTED: endoglucanase 2-like [Solanum lycopersicum]
Length=519

 Score =   296 bits (757),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTDSGL+WI++WNALQHPVASAFLAV+YSDYML+S+T K+TCDG  YTPSDLRK
Sbjct  345  PTATSSRTDSGLIWITEWNALQHPVASAFLAVLYSDYMLTSKTDKMTCDGNEYTPSDLRK  404

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FAMSQA+YVLGDNP KMSYLVGYGD YP+YVHHRGASIPTDA T CK+G+K+L+ST+PNP
Sbjct  405  FAMSQANYVLGDNPAKMSYLVGYGDKYPQYVHHRGASIPTDANTNCKEGWKYLDSTEPNP  464

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPFLNETYIDSRNNS+Q EPTTYNSA++V LLSGL
Sbjct  465  NVATGALVGGPFLNETYIDSRNNSVQGEPTTYNSAVVVALLSGL  508



>gb|EYU36779.1| hypothetical protein MIMGU_mgv1a004472mg [Erythranthe guttata]
Length=525

 Score =   296 bits (757),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRT +GLVWISQWNALQHPVASAFLAV+YSDYMLSSRTA+I+C+G  + PSDLRK
Sbjct  351  PTATSSRTKNGLVWISQWNALQHPVASAFLAVIYSDYMLSSRTARISCNGNNFRPSDLRK  410

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQADYVLGDNPMKMSYLVGYGD YP+YVHHRGASIP D  + CK+GFKWL+S +PNP
Sbjct  411  FAISQADYVLGDNPMKMSYLVGYGDKYPQYVHHRGASIPADDKSDCKEGFKWLDSKEPNP  470

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA+G LVGGPFLNE+++DSRNNSMQ EP+TYNSA+IVGLLSGL
Sbjct  471  NVAIGALVGGPFLNESFVDSRNNSMQTEPSTYNSAVIVGLLSGL  514



>gb|KJB58119.1| hypothetical protein B456_009G195400 [Gossypium raimondii]
Length=424

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P+ATSSRTD GLVWIS+WNALQHPVASAFLA +YSDYML+S+TAKITC    + PSDLRK
Sbjct  250  PSATSSRTDGGLVWISEWNALQHPVASAFLAALYSDYMLTSQTAKITCGDHSFKPSDLRK  309

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
             A SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DATTGC DGFKWL+ST+PNP
Sbjct  310  LAKSQADYVLGKNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCTDGFKWLDSTEPNP  369

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVGGLVGGPFLNETYIDSRNNS QAEPTTYNSA+IVGLLS L
Sbjct  370  NVAVGGLVGGPFLNETYIDSRNNSKQAEPTTYNSALIVGLLSSL  413



>ref|XP_006473639.1| PREDICTED: endoglucanase 10-like [Citrus sinensis]
Length=524

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT+SRT+SGL+W+S+WN+LQHPVASAFLA VYSDYML+SRTA++TCDG  + PSDLR 
Sbjct  350  PTATTSRTESGLIWVSEWNSLQHPVASAFLAAVYSDYMLTSRTAELTCDGHSFKPSDLRD  409

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA  QADY+LG+NP+KMS+LVGYG  YP+YVHHRGASIP DATTGC+DGFKWL+S +PNP
Sbjct  410  FAKDQADYILGNNPLKMSFLVGYGKKYPQYVHHRGASIPADATTGCRDGFKWLDSKKPNP  469

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVGGLVGGPFLNETYIDSRNNSMQAEP+TYN A+IVGLLS L
Sbjct  470  NVAVGGLVGGPFLNETYIDSRNNSMQAEPSTYNGAVIVGLLSSL  513



>gb|KDO84820.1| hypothetical protein CISIN_1g009846mg [Citrus sinensis]
Length=524

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT+SRT+SGL+W+S+WN+LQHPVASAFLA VYSDYML+SRTA++TCDG  + PSDLR 
Sbjct  350  PTATTSRTESGLIWVSEWNSLQHPVASAFLAAVYSDYMLTSRTAELTCDGHSFKPSDLRD  409

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA  QADY+LG+NP+KMS+LVGYG  YP+YVHHRGASIP DATTGC+DGFKWL+S +PNP
Sbjct  410  FAKDQADYILGNNPLKMSFLVGYGKKYPQYVHHRGASIPADATTGCRDGFKWLDSKKPNP  469

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVGGLVGGPFLNETYIDSRNNSMQAEP+TYN A+IVGLLS L
Sbjct  470  NVAVGGLVGGPFLNETYIDSRNNSMQAEPSTYNGAVIVGLLSSL  513



>ref|XP_006435157.1| hypothetical protein CICLE_v10000849mg [Citrus clementina]
 gb|ESR48397.1| hypothetical protein CICLE_v10000849mg [Citrus clementina]
Length=524

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT+SRT+SGL+W+S+WN+LQHPVASAFLA VYSDYML+SRTA++TCDG  + PSDLR 
Sbjct  350  PTATTSRTESGLIWVSEWNSLQHPVASAFLATVYSDYMLTSRTAELTCDGHSFKPSDLRD  409

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA  QADY+LG+NP+KMS+LVGYG  YP+YVHHRGASIP DATTGC+DGFKWL+S +PNP
Sbjct  410  FAKDQADYILGNNPLKMSFLVGYGKKYPQYVHHRGASIPADATTGCRDGFKWLDSKKPNP  469

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVGGLVGGPFLNETYIDSRNNSMQAEP+TYN A+IVGLLS L
Sbjct  470  NVAVGGLVGGPFLNETYIDSRNNSMQAEPSTYNGAVIVGLLSSL  513



>gb|KJB58120.1| hypothetical protein B456_009G195400 [Gossypium raimondii]
Length=522

 Score =   292 bits (748),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P+ATSSRTD GLVWIS+WNALQHPVASAFLA +YSDYML+S+TAKITC    + PSDLRK
Sbjct  348  PSATSSRTDGGLVWISEWNALQHPVASAFLAALYSDYMLTSQTAKITCGDHSFKPSDLRK  407

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
             A SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DATTGC DGFKWL+ST+PNP
Sbjct  408  LAKSQADYVLGKNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCTDGFKWLDSTEPNP  467

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVGGLVGGPFLNETYIDSRNNS QAEPTTYNSA+IVGLLS L
Sbjct  468  NVAVGGLVGGPFLNETYIDSRNNSKQAEPTTYNSALIVGLLSSL  511



>gb|KJB58118.1| hypothetical protein B456_009G195400 [Gossypium raimondii]
Length=526

 Score =   292 bits (748),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P+ATSSRTD GLVWIS+WNALQHPVASAFLA +YSDYML+S+TAKITC    + PSDLRK
Sbjct  352  PSATSSRTDGGLVWISEWNALQHPVASAFLAALYSDYMLTSQTAKITCGDHSFKPSDLRK  411

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
             A SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DATTGC DGFKWL+ST+PNP
Sbjct  412  LAKSQADYVLGKNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCTDGFKWLDSTEPNP  471

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVGGLVGGPFLNETYIDSRNNS QAEPTTYNSA+IVGLLS L
Sbjct  472  NVAVGGLVGGPFLNETYIDSRNNSKQAEPTTYNSALIVGLLSSL  515



>ref|XP_002510516.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF52703.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=523

 Score =   292 bits (747),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTD GL+W+S+WNALQHPVASAFLA +YSDYML+SRTAK++CDG  + PSDLRK
Sbjct  349  PTATSSRTDGGLIWVSEWNALQHPVASAFLAALYSDYMLTSRTAKLSCDGTSFKPSDLRK  408

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADYVLG NPMKMSYLVGYGD YP+YVHHRGASIP DATTGCKDG+KWL++ +PNP
Sbjct  409  FAKSQADYVLGKNPMKMSYLVGYGDKYPQYVHHRGASIPADATTGCKDGWKWLDAEEPNP  468

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G  VGGPFLNE+Y+DSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  469  NVAYGAFVGGPFLNESYVDSRNNSMQGEPSTYNSAVIVGLLSSL  512



>ref|XP_007017776.1| EG isoform 2 [Theobroma cacao]
 gb|EOY15001.1| EG isoform 2 [Theobroma cacao]
Length=526

 Score =   291 bits (745),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P+ATSSRTD GL+W+S+WNALQHPVASAFLA +YSDYML+SRT K+ C    + PSDLRK
Sbjct  352  PSATSSRTDGGLIWVSEWNALQHPVASAFLAALYSDYMLTSRTPKLKCGDDSFKPSDLRK  411

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DATTGCKDGFKWL+ST+PNP
Sbjct  412  FAKSQADYVLGSNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCKDGFKWLDSTKPNP  471

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA+G L+GGPFLNETYIDSRNNSMQAEPTTYN AIIVGLLS L
Sbjct  472  NVAIGALLGGPFLNETYIDSRNNSMQAEPTTYNGAIIVGLLSSL  515



>ref|XP_007017775.1| EG isoform 1 [Theobroma cacao]
 gb|EOY15000.1| EG isoform 1 [Theobroma cacao]
Length=533

 Score =   291 bits (745),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P+ATSSRTD GL+W+S+WNALQHPVASAFLA +YSDYML+SRT K+ C    + PSDLRK
Sbjct  352  PSATSSRTDGGLIWVSEWNALQHPVASAFLAALYSDYMLTSRTPKLKCGDDSFKPSDLRK  411

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DATTGCKDGFKWL+ST+PNP
Sbjct  412  FAKSQADYVLGSNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCKDGFKWLDSTKPNP  471

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA+G L+GGPFLNETYIDSRNNSMQAEPTTYN AIIVGLLS L
Sbjct  472  NVAIGALLGGPFLNETYIDSRNNSMQAEPTTYNGAIIVGLLSSL  515



>ref|XP_010104437.1| Endoglucanase 24 [Morus notabilis]
 gb|EXC00970.1| Endoglucanase 24 [Morus notabilis]
Length=525

 Score =   290 bits (742),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT SRT SGL+W+S+WNALQHPVASAFLA +YSDYML+SRTAK++C GK +TP+D+RK
Sbjct  351  PTATESRTKSGLIWVSEWNALQHPVASAFLAALYSDYMLTSRTAKVSCSGKSFTPADIRK  410

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            F  SQADYVLG+NPMKMS+LVGYGD YP+YVHHRGASIP DA TGC DGFKWL+ST+PNP
Sbjct  411  FVRSQADYVLGENPMKMSFLVGYGDKYPQYVHHRGASIPVDAKTGCTDGFKWLDSTEPNP  470

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA+G LVGGPF NET+IDSRNNSMQ EP+TYNSA++VGLLS L
Sbjct  471  NVAIGALVGGPFQNETFIDSRNNSMQVEPSTYNSAVMVGLLSSL  514



>ref|XP_004136389.1| PREDICTED: endoglucanase 2-like [Cucumis sativus]
 ref|XP_004162553.1| PREDICTED: endoglucanase 2-like [Cucumis sativus]
 gb|KGN60025.1| hypothetical protein Csa_3G872070 [Cucumis sativus]
Length=523

 Score =   289 bits (740),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTD+GL+W+S+WN+LQHPV+SAFLA +YSDYML+SRTAK +C+G  YTP+DLRK
Sbjct  349  PTATSSRTDNGLIWVSEWNSLQHPVSSAFLASLYSDYMLTSRTAKFSCNGDTYTPADLRK  408

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADYVLG+NP+KMSYLVGYGD +P+YVHHRGASIP DA T CKDGFKWL+ST+PNP
Sbjct  409  FAKSQADYVLGNNPLKMSYLVGYGDKFPQYVHHRGASIPADAKTKCKDGFKWLDSTEPNP  468

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            N+A G LVGGPFLN+TYIDSRNNSMQ EP+TYNSA++VGLLS L
Sbjct  469  NIAYGALVGGPFLNDTYIDSRNNSMQGEPSTYNSALVVGLLSSL  512



>ref|XP_008466493.1| PREDICTED: endoglucanase 10 [Cucumis melo]
Length=523

 Score =   289 bits (739),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTD+GL+W+S+WN+LQHPV+SAFLA +YSDYML+SRTAK +C+G  YTP+DLRK
Sbjct  349  PTATSSRTDNGLIWVSEWNSLQHPVSSAFLASLYSDYMLTSRTAKFSCNGDSYTPADLRK  408

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADYVLG+NP+KMSYLVGYGD +P+YVHHRGASIP DA T CKDGFKWL+ST+PNP
Sbjct  409  FAKSQADYVLGNNPLKMSYLVGYGDKFPQYVHHRGASIPADAKTKCKDGFKWLDSTEPNP  468

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            N+A G LVGGPFLN+TYIDSRNNSMQ EP+TYNSA++VGLLS L
Sbjct  469  NIAYGALVGGPFLNDTYIDSRNNSMQGEPSTYNSALVVGLLSSL  512



>ref|XP_002276739.1| PREDICTED: endoglucanase 10 [Vitis vinifera]
 emb|CBI19843.3| unnamed protein product [Vitis vinifera]
Length=525

 Score =   289 bits (739),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT SRTDSGL+W+S+WNALQHPVASAFLAV+YSDYMLSSRTAK++CDG  Y PSDLR 
Sbjct  351  PTATISRTDSGLIWVSEWNALQHPVASAFLAVLYSDYMLSSRTAKLSCDGDSYKPSDLRH  410

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQ +YVLG+NPMKMSYLVGYGD YP+YVHHRGASIP DATTGC DGFKWL+S  PNP
Sbjct  411  FAISQVNYVLGENPMKMSYLVGYGDKYPQYVHHRGASIPADATTGCSDGFKWLKSKDPNP  470

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPF NE+++DSRNNSMQ EP+TYN A+IVGLLS L
Sbjct  471  NVATGALVGGPFKNESFVDSRNNSMQVEPSTYNGAVIVGLLSSL  514



>ref|XP_010244092.1| PREDICTED: endoglucanase 24-like [Nelumbo nucifera]
 ref|XP_010244093.1| PREDICTED: endoglucanase 24-like [Nelumbo nucifera]
Length=527

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT SRTD GL+W S+WN+L HPVASAFLAV+YSDYML ++TA ITC G+ +TP+DLR 
Sbjct  353  PRATHSRTDGGLLWFSEWNSLLHPVASAFLAVIYSDYMLMTQTASITCGGEAFTPADLRN  412

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQADYVLGDNP+KMSYLVGYG  YPKYVHHRGASIP DA TGC DGFKWL S++PNP
Sbjct  413  FAISQADYVLGDNPLKMSYLVGYGSKYPKYVHHRGASIPADADTGCTDGFKWLSSSKPNP  472

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA+GGLVGGPFLNETYIDSRNNSMQ EPTTYNSA+IVGLLSGL
Sbjct  473  NVAMGGLVGGPFLNETYIDSRNNSMQGEPTTYNSALIVGLLSGL  516



>ref|XP_002300715.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|EEE79988.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|AEO97188.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97215.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=523

 Score =   287 bits (734),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT SRTDSGL+W+S+WNALQHPVASAFLA +YSDYM SS TAK++C+G  Y PSDLRK
Sbjct  349  PTATQSRTDSGLIWVSEWNALQHPVASAFLASLYSDYMRSSGTAKLSCNGYSYKPSDLRK  408

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADYVLG+NPMKMS+LVGYG+NYP+YVHHRGASIP DA TGCKDG+ WLE  +PNP
Sbjct  409  FAKSQADYVLGNNPMKMSFLVGYGENYPQYVHHRGASIPADAKTGCKDGWTWLERKEPNP  468

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPFLNET++D RNNSMQAEPTTYN A+IVGLLSGL
Sbjct  469  NVATGALVGGPFLNETFVDDRNNSMQAEPTTYNGAVIVGLLSGL  512



>ref|XP_011045112.1| PREDICTED: endoglucanase 2 [Populus euphratica]
Length=523

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 150/165 (91%), Gaps = 1/165 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT SRTD GL+W+S+WNALQHPVASAFLAV+YSDYMLSS TAKI+C+G  Y PSDLRK
Sbjct  348  PTATKSRTDGGLIWVSEWNALQHPVASAFLAVLYSDYMLSSGTAKISCNGDSYKPSDLRK  407

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADYVLG+NPMKMSYLVGYG+ YP+YVHHRGASIPTDATTGCKDG+ WL+S +PNP
Sbjct  408  FAKSQADYVLGNNPMKMSYLVGYGEKYPQYVHHRGASIPTDATTGCKDGWTWLKSKEPNP  467

Query  351  NVAVGGLVGGPFLNETYI-DSRNNSMQAEPTTYNSAIIVGLLSGL  220
            N A G LVGGPFLNET++ + RNNSMQAEP+TYNSA+IVGLLSGL
Sbjct  468  NEATGALVGGPFLNETFVSNDRNNSMQAEPSTYNSALIVGLLSGL  512



>ref|XP_003527686.1| PREDICTED: endoglucanase 10-like [Glycine max]
 gb|KHN09095.1| Endoglucanase 24 [Glycine soja]
Length=529

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT SRTD GL+W+SQWN+LQHPVASAFLA VYSDYML+S+T K+ CD   +TPSDLR 
Sbjct  355  PTATKSRTDDGLIWVSQWNSLQHPVASAFLAAVYSDYMLTSQTPKLKCDSDSFTPSDLRD  414

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADYVLG NPM MS+LVGYGD YP++VHHRGASIP DA TGCKDGF+WLES+ PNP
Sbjct  415  FAKSQADYVLGKNPMHMSFLVGYGDKYPQFVHHRGASIPADAKTGCKDGFQWLESSDPNP  474

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPFLNET+IDSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  475  NVATGALVGGPFLNETFIDSRNNSMQTEPSTYNSAVIVGLLSSL  518



>dbj|BAF42037.1| cellulase2 [Pyrus communis]
Length=526

 Score =   285 bits (728),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT SRTD+GL+W+S+WNALQ PVA+AFLA +YSDYML+SR+ K+ CDG  Y PSD+RK
Sbjct  352  PTATKSRTDNGLIWVSEWNALQQPVAAAFLAALYSDYMLTSRSTKLECDGDTYKPSDIRK  411

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            F  SQADYVLGDNPMKMSYLVGYGD YPKYVHHRGASIP +  TGCKDGFK+L+ST PNP
Sbjct  412  FVRSQADYVLGDNPMKMSYLVGYGDKYPKYVHHRGASIPANQKTGCKDGFKYLDSTDPNP  471

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            N+AVG LVGGPFLNETYID+RNNS QAEP+TYNSA+IVGLLS L
Sbjct  472  NIAVGALVGGPFLNETYIDARNNSKQAEPSTYNSAVIVGLLSSL  515



>gb|KDP36939.1| hypothetical protein JCGZ_08230 [Jatropha curcas]
Length=523

 Score =   284 bits (727),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT++RT+SGL+W+S+WNALQHPVASAFLA +YSDYML+SRT +++C G+ Y PSDLRK
Sbjct  348  PTATTNRTESGLIWVSEWNALQHPVASAFLAALYSDYMLTSRTKELSCSGESYKPSDLRK  407

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADYVLG NPMKMSYLVGYGD YP+YVHHRGASIP DATTGCKDG+KWLES  PNP
Sbjct  408  FAKSQADYVLGKNPMKMSYLVGYGDKYPQYVHHRGASIPADATTGCKDGWKWLESEDPNP  467

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPF NE+++DSRNNS Q EP+TYNSA+IVGLLS L
Sbjct  468  NVATGALVGGPFQNESFVDSRNNSKQGEPSTYNSAVIVGLLSSL  511



>ref|XP_007136082.1| hypothetical protein PHAVU_009G016100g [Phaseolus vulgaris]
 gb|ESW08076.1| hypothetical protein PHAVU_009G016100g [Phaseolus vulgaris]
Length=529

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT SRTD GL+W+SQWN+LQ PVASAFLAVVYSDYML+S+T K+ CD   YTPSDLR 
Sbjct  355  PTATKSRTDEGLIWVSQWNSLQQPVASAFLAVVYSDYMLTSQTPKLKCDSDSYTPSDLRD  414

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADYVLG NPM MS+LVGYGD +P++VHHRGASIP DA TGCKDGFKWL+S+ PNP
Sbjct  415  FAKSQADYVLGKNPMDMSFLVGYGDKFPQFVHHRGASIPADAKTGCKDGFKWLDSSDPNP  474

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPFLNET+IDSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  475  NVATGALVGGPFLNETFIDSRNNSMQTEPSTYNSAVIVGLLSSL  518



>ref|XP_008364934.1| PREDICTED: endoglucanase 10-like [Malus domestica]
Length=526

 Score =   283 bits (724),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT SRTD+GL+W+S+WNALQHPVA+AFLA +YSDYML+SR+ K+ CDG  Y PSD+RK
Sbjct  352  PTATKSRTDNGLIWVSEWNALQHPVAAAFLAALYSDYMLTSRSTKLECDGDTYKPSDIRK  411

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            F  SQADYVLGDNPMKMS+LVGYGD YP+YVHHRGASIP +  TGCKDGFK+L ST+PNP
Sbjct  412  FVRSQADYVLGDNPMKMSFLVGYGDKYPEYVHHRGASIPANQKTGCKDGFKYLNSTEPNP  471

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            N+AVG LVGGPFLNETYID RNNS Q EP+TYNSA+IVGLLS L
Sbjct  472  NIAVGALVGGPFLNETYIDDRNNSKQGEPSTYNSAVIVGLLSSL  515



>gb|AGV22125.1| endo-1,4-beta-glucanase 3 [Betula luminifera]
Length=527

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTDSGL+W+S+WN+LQHPVASAFL  ++S+YML+S+TAK++C+GK ++ +DL+ 
Sbjct  353  PTATSSRTDSGLIWVSEWNSLQHPVASAFLVTLFSNYMLTSQTAKLSCNGKSFSAADLQD  412

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADYVLGDNP+KMS+LVGYGD YP++VHHRGASIP DA T C +GF+WL+STQPNP
Sbjct  413  FAKSQADYVLGDNPLKMSFLVGYGDKYPQFVHHRGASIPIDAKTNCTEGFQWLDSTQPNP  472

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVGGLVGGPF NETY+DSRNNSMQ EPTTYN+A++VGLLSGL
Sbjct  473  NVAVGGLVGGPFQNETYLDSRNNSMQGEPTTYNNAVLVGLLSGL  516



>ref|XP_011028991.1| PREDICTED: endoglucanase 2-like [Populus euphratica]
Length=523

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT SRT+SGL+W+S+WNALQHPVASAFLA +YSDYM SS TAK++C+G  Y PSDLRK
Sbjct  349  PTATQSRTESGLIWVSEWNALQHPVASAFLASLYSDYMRSSGTAKLSCNGYSYKPSDLRK  408

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADYVLG+NPMKMS+LVGYG+NYP+YVHHRGASIP DA TGCKDG+ WLE  +PNP
Sbjct  409  FAKSQADYVLGNNPMKMSFLVGYGENYPQYVHHRGASIPADAKTGCKDGWTWLERKEPNP  468

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPF NE ++D RNNSMQAEPTTYN A+IVGLLSGL
Sbjct  469  NVATGALVGGPFFNEKFVDDRNNSMQAEPTTYNGAVIVGLLSGL  512



>ref|XP_003523541.1| PREDICTED: endoglucanase 10 [Glycine max]
Length=529

 Score =   282 bits (722),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT SRTD GL+W+SQWN+LQHPVASAFLA VYSDYML+S+T K+ C    +TPSDLR 
Sbjct  355  PTATKSRTDDGLIWVSQWNSLQHPVASAFLAAVYSDYMLTSQTPKLKCGSDSFTPSDLRD  414

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADYVLG NPM MS+LVGYGD YP++VHHRGASIP DA TGCKDGF+WLES+ PNP
Sbjct  415  FAKSQADYVLGKNPMHMSFLVGYGDKYPQFVHHRGASIPADAKTGCKDGFQWLESSDPNP  474

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPFLNET+IDSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  475  NVATGALVGGPFLNETFIDSRNNSMQTEPSTYNSAVIVGLLSSL  518



>gb|KHN45917.1| Endoglucanase 2 [Glycine soja]
Length=570

 Score =   282 bits (722),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT SRTD GL+W+SQWN+LQHPVASAFLA VYSDYML+S+T K+ C    +TPSDLR 
Sbjct  396  PTATKSRTDDGLIWVSQWNSLQHPVASAFLAAVYSDYMLTSQTPKLKCGSDSFTPSDLRD  455

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADYVLG NPM MS+LVGYGD YP++VHHRGASIP DA TGCKDGF+WLES+ PNP
Sbjct  456  FAKSQADYVLGKNPMHMSFLVGYGDKYPQFVHHRGASIPADAKTGCKDGFQWLESSDPNP  515

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPFLNET+IDSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  516  NVATGALVGGPFLNETFIDSRNNSMQTEPSTYNSAVIVGLLSSL  559



>gb|AFZ78647.1| korrigan [Populus tomentosa]
Length=523

 Score =   280 bits (715),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT SRTD GL+W+SQWNALQHPVASAFLA +YSDYMLSS TAK++C+G  Y PS+LRK
Sbjct  348  PTATKSRTDGGLIWVSQWNALQHPVASAFLAALYSDYMLSSGTAKLSCNGDSYKPSELRK  407

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADYVLG+NPMKMSYLVGYG+ YP+YVHHRGASIPT A TGCKDG+ WLES +PNP
Sbjct  408  FAKSQADYVLGNNPMKMSYLVGYGEKYPQYVHHRGASIPTGAKTGCKDGWTWLESKEPNP  467

Query  351  NVAVGGLVGGPFLNETYI-DSRNNSMQAEPTTYNSAIIVGLLSGL  220
            N A G LVGGPFLNET++ + RNNSMQAEP+TYNSA+IVGLLSGL
Sbjct  468  NEATGALVGGPFLNETFVSNDRNNSMQAEPSTYNSALIVGLLSGL  512



>ref|XP_002307711.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|EEE94707.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|AEO97189.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97216.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=523

 Score =   280 bits (715),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT SRTD GL+W+SQWNALQHPVASAFLA +YSDYMLSS TAK++C+G  Y PS+LRK
Sbjct  348  PTATKSRTDGGLIWVSQWNALQHPVASAFLAALYSDYMLSSGTAKLSCNGDSYKPSELRK  407

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADYVLG+NPMKMSYLVGYG+ YP+YVHHRGASIPT A TGCKDG+ WLES +PNP
Sbjct  408  FAKSQADYVLGNNPMKMSYLVGYGEKYPQYVHHRGASIPTGAKTGCKDGWTWLESKEPNP  467

Query  351  NVAVGGLVGGPFLNETYI-DSRNNSMQAEPTTYNSAIIVGLLSGL  220
            N A G LVGGPFLNET++ + RNNSMQAEP+TYNSA+IVGLLSGL
Sbjct  468  NEATGALVGGPFLNETFVSNDRNNSMQAEPSTYNSALIVGLLSGL  512



>gb|KJB14408.1| hypothetical protein B456_002G123700 [Gossypium raimondii]
Length=529

 Score =   280 bits (715),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRT+SGL+W+S+WN+LQHPVASAFLA +Y DYML+++TAK+TC    + PSDLRK
Sbjct  349  PTATSSRTESGLIWVSEWNSLQHPVASAFLAALYGDYMLTTQTAKLTCGDHSFEPSDLRK  408

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA  QADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP +ATTGC DGF+WL ST+PNP
Sbjct  409  FAKLQADYVLGSNPLKMSFLVGYGDKYPQYVHHRGASIPVNATTGCTDGFQWLNSTKPNP  468

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVG LVGGPFLNET+ DSRNN+MQ EPTTYNSA+IVGLLS L
Sbjct  469  NVAVGALVGGPFLNETFFDSRNNTMQTEPTTYNSAVIVGLLSSL  512



>ref|XP_010536354.1| PREDICTED: endoglucanase 10-like [Tarenaya hassleriana]
Length=524

 Score =   279 bits (714),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT+SRTD GL+W+S+WNALQHPV+SAFLA +YSDYML+SR  K++C GK +  SDLRK
Sbjct  350  PTATASRTDDGLIWVSEWNALQHPVSSAFLAALYSDYMLTSRNVKLSCSGKTFRASDLRK  409

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQA+Y+LG NPM+MS+LVGYGD YP+YVHHRGASIP DATTGCKDGFKWL S  PNP
Sbjct  410  FAKSQAEYMLGKNPMEMSFLVGYGDKYPQYVHHRGASIPADATTGCKDGFKWLNSEDPNP  469

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPFLNET+IDSRNNSMQ EP+TYNSA++VGLLS L
Sbjct  470  NVAYGALVGGPFLNETFIDSRNNSMQNEPSTYNSALVVGLLSSL  513



>ref|XP_004500948.1| PREDICTED: endoglucanase 10-like [Cicer arietinum]
Length=528

 Score =   279 bits (713),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT SRT+ GL+W+S+WNALQHPVASAFLA VYSDYML+S+T KI CD   +TPSDLR 
Sbjct  354  PTATKSRTNDGLIWVSEWNALQHPVASAFLAAVYSDYMLTSQTPKIECDSDSFTPSDLRD  413

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADYVLG NPM MS+LVGYG  +P++VHHRGASIP DA+TGCKDGF+WL+S+ PNP
Sbjct  414  FARSQADYVLGKNPMHMSFLVGYGKKFPQFVHHRGASIPADASTGCKDGFQWLDSSDPNP  473

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPFLNETYIDSRNNS QAEP+TYNSA++VGLLS L
Sbjct  474  NVATGALVGGPFLNETYIDSRNNSEQAEPSTYNSAVLVGLLSSL  517



>gb|EYU38839.1| hypothetical protein MIMGU_mgv1a004578mg [Erythranthe guttata]
Length=519

 Score =   278 bits (712),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  708  TATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKF  529
            +ATSSRT++GL+W+S+WNALQHPVASAFLAVVYSDYML+SRT K++CDG  +  SDLR+F
Sbjct  346  SATSSRTENGLIWVSEWNALQHPVASAFLAVVYSDYMLTSRTDKLSCDGDNFKASDLREF  405

Query  528  AMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPN  349
            A++QA+YVLG+NPMKMSYLVG+G+ YP+YVHHRGAS+P D   GCKDGFKWL+S  PNPN
Sbjct  406  AITQANYVLGNNPMKMSYLVGFGNKYPEYVHHRGASVPGDENPGCKDGFKWLDSDDPNPN  465

Query  348  VAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            VA G LVGGPFLNE+Y+DSRNNSMQ EPTTYNSA IVGLLSGL
Sbjct  466  VATGALVGGPFLNESYVDSRNNSMQGEPTTYNSAFIVGLLSGL  508



>ref|XP_008241905.1| PREDICTED: endoglucanase 24-like [Prunus mume]
Length=533

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRT SGL+W+ +WN LQH VASAFLAV+YSDYML+S+T  + CDGK+Y P+DLR 
Sbjct  359  PTATSSRTASGLIWVIKWNCLQHAVASAFLAVLYSDYMLTSKTEVLYCDGKFYKPTDLRN  418

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQ DYVLG+NPM+MSYLVGYG  YP+YVHHRG+SIP DA TGC+DGFKWL S+ PNP
Sbjct  419  FAISQVDYVLGENPMEMSYLVGYGSKYPQYVHHRGSSIPADAHTGCQDGFKWLNSSNPNP  478

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVG LVGGPFLNETYID+RNNSMQ EP+TYNSA+IV LLSGL
Sbjct  479  NVAVGALVGGPFLNETYIDNRNNSMQGEPSTYNSALIVALLSGL  522



>ref|XP_009335173.1| PREDICTED: endoglucanase 2-like [Pyrus x bretschneideri]
Length=526

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTD+GL+W+S+WNALQ PVA+AFLA +YSDYML+S + K+ CDG+ Y PSD+RK
Sbjct  352  PTATSSRTDNGLIWVSEWNALQQPVAAAFLAALYSDYMLTSGSTKLECDGETYKPSDIRK  411

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            F  SQA+YVLGDNPMKMSYLVGYGD YPKYVHHRGASIP +  T CK+GFK+L+ST+PNP
Sbjct  412  FVRSQANYVLGDNPMKMSYLVGYGDKYPKYVHHRGASIPANKKTSCKEGFKYLDSTKPNP  471

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVG LVGGPFLNETYID+RNNS Q EP+TYNSA++VGLLS L
Sbjct  472  NVAVGALVGGPFLNETYIDARNNSRQGEPSTYNSAVVVGLLSSL  515



>ref|XP_008372790.1| PREDICTED: endoglucanase 24-like [Malus domestica]
Length=537

 Score =   277 bits (708),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRT SGL+W+ +WN LQH VASAFLA++YSDYML+S+T  + CDGK Y P DLRK
Sbjct  363  PTATSSRTSSGLIWVIKWNCLQHAVASAFLAILYSDYMLTSKTEILYCDGKSYNPVDLRK  422

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQADYVLG+NPM+MSYLVGYG +YP+YVHHRGASIP  A TGC DGFKWL+S  PNP
Sbjct  423  FAISQADYVLGENPMRMSYLVGYGSSYPQYVHHRGASIPVGAETGCIDGFKWLDSPNPNP  482

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVG LVGGPF+NETYIDSRNNSMQ EP+TYNSA+IV LLSGL
Sbjct  483  NVAVGALVGGPFMNETYIDSRNNSMQGEPSTYNSALIVALLSGL  526



>ref|XP_006840111.1| hypothetical protein AMTR_s00224p00023160 [Amborella trichopoda]
 gb|ERN01786.1| hypothetical protein AMTR_s00224p00023160 [Amborella trichopoda]
Length=233

 Score =   267 bits (682),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT++RTD GLVWISQWNALQHPVASAFLAVVYSDYML+SRT+ + C+ K  +P DLR 
Sbjct  60   PTATTNRTDGGLVWISQWNALQHPVASAFLAVVYSDYMLTSRTSTMYCNNKANSPIDLRT  119

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQADYVLGDNP K+S+LVGYG NYPK VHHRGASIP +A TGCK GF+WL+ T  NP
Sbjct  120  FAISQADYVLGDNPTKLSFLVGYGTNYPKQVHHRGASIPVNANTGCK-GFQWLDLTADNP  178

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVG LVGGPF N++YID RNNSMQ EP+TYNSA+IVGLLSGL
Sbjct  179  NVAVGALVGGPFQNDSYIDFRNNSMQGEPSTYNSAVIVGLLSGL  222



>ref|XP_009378180.1| PREDICTED: endoglucanase 2-like [Pyrus x bretschneideri]
 ref|XP_009378181.1| PREDICTED: endoglucanase 2-like [Pyrus x bretschneideri]
Length=537

 Score =   276 bits (707),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P ATSSRT SGL+W+ +WN LQ+ VASAFLA++YSDYML+S+T  + CDGK Y P DLRK
Sbjct  363  PMATSSRTSSGLIWVIKWNCLQYAVASAFLAILYSDYMLTSKTEMLYCDGKSYNPVDLRK  422

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQADYVLG+NPM+MSYLVGYG +YP+YVHHRGASIP DA TGC DGFKWL+S  PNP
Sbjct  423  FAISQADYVLGENPMRMSYLVGYGSSYPQYVHHRGASIPVDAETGCSDGFKWLDSPNPNP  482

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVG LVGGPF+NETYIDSRNNSMQ EP+TYNSA+IV LLSGL
Sbjct  483  NVAVGALVGGPFMNETYIDSRNNSMQGEPSTYNSALIVALLSGL  526



>ref|XP_008387935.1| PREDICTED: endoglucanase 2 [Malus domestica]
Length=526

 Score =   274 bits (701),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRT++GL+W+S+WNALQ PVA+AFLA +YSDYML+S + K+ CDG+ Y PSD+RK
Sbjct  352  PTATSSRTENGLIWVSEWNALQQPVAAAFLAALYSDYMLTSGSTKLECDGETYKPSDIRK  411

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            F  SQA+YVLGDNPMKMSYLVGYGD YP+YVHHRGASIP +  T CK+GFK+L+ST+PNP
Sbjct  412  FVRSQANYVLGDNPMKMSYLVGYGDKYPEYVHHRGASIPANKKTSCKEGFKYLDSTKPNP  471

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVG LVGGPFLNETYID+RNNS Q EP+TYNSA++VGLLS L
Sbjct  472  NVAVGALVGGPFLNETYIDARNNSRQGEPSTYNSAVVVGLLSSL  515



>gb|AES73992.2| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=529

 Score =   272 bits (695),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT SRTD+GL+W+S+WNALQHPVASAFLA VYSDYML+++T  I CD   + PSDLR 
Sbjct  355  PTATKSRTDNGLIWVSEWNALQHPVASAFLASVYSDYMLTTQTPNIKCDSDSFKPSDLRD  414

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADYVLG NP  MS+LVGYG N+P++VHHRGASIP +A TGCKDG++WL+S+ PNP
Sbjct  415  FARSQADYVLGKNPQHMSFLVGYGKNFPQFVHHRGASIPANAKTGCKDGWQWLDSSDPNP  474

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPFLNETYIDSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  475  NVATGALVGGPFLNETYIDSRNNSMQGEPSTYNSAVIVGLLSSL  518



>ref|XP_010477219.1| PREDICTED: endoglucanase 2-like [Camelina sativa]
Length=517

 Score =   271 bits (692),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTD GLVW+S+WNALQHPV+SAFLA +YSDYML+S   +++CD + + PSDLR 
Sbjct  344  PTATSSRTDGGLVWVSEWNALQHPVSSAFLATLYSDYMLTSGIKELSCDDQSFKPSDLRT  403

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NP KMSYLVGYG+ YP++VHHRGASIP DA TGCKDGFKWL S +PNP
Sbjct  404  FARSQADYMLGKNPEKMSYLVGYGEKYPEFVHHRGASIPADANTGCKDGFKWLNSDEPNP  463

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VGLLS L
Sbjct  464  NVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVGLLSSL  507



>ref|XP_009398708.1| PREDICTED: endoglucanase 24-like [Musa acuminata subsp. malaccensis]
Length=524

 Score =   270 bits (691),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTD GLVWI +W+ALQHPVA++FLAVVYSDYML+SRT++I C GK +TPSDLR 
Sbjct  351  PTATSSRTDGGLVWIDEWDALQHPVAASFLAVVYSDYMLTSRTSEIDCSGKTFTPSDLRD  410

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG+NPMK+SYLVGYG +YP+ VHHRGASIP +A TGC +GF+WL ST PNP
Sbjct  411  FATSQADYILGNNPMKLSYLVGYGSSYPQQVHHRGASIPANAKTGC-NGFQWLSSTDPNP  469

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA+G LVGGPF N++YIDSRNNSMQ EP+TYNSA++VGLLSGL
Sbjct  470  NVAMGALVGGPFQNDSYIDSRNNSMQGEPSTYNSAVLVGLLSGL  513



>ref|XP_010501531.1| PREDICTED: endoglucanase 2 [Camelina sativa]
Length=517

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTD GL+W+S+WNALQHPV+SAFLA +YSDYML+S   +++CD + + PSDLRK
Sbjct  344  PTATSSRTDGGLIWVSEWNALQHPVSSAFLATLYSDYMLTSGIKELSCDDQSFKPSDLRK  403

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NP KMSYLVGYG+ YP++VHHRGASIP DA TGCKDGFKWL S +PNP
Sbjct  404  FARSQADYMLGKNPEKMSYLVGYGEKYPEFVHHRGASIPADANTGCKDGFKWLNSEEPNP  463

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  229
            NVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VGLL
Sbjct  464  NVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVGLL  504



>gb|EPS64495.1| hypothetical protein M569_10284, partial [Genlisea aurea]
Length=530

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 145/167 (87%), Gaps = 3/167 (2%)
 Frame = -3

Query  711  PTATSSRTDSG-LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLR  535
            PTAT+SRT+ G L+W+SQW+ALQHP ASAFLA +YSDYML+SRT K++CD + + PSDLR
Sbjct  354  PTATTSRTEDGSLIWVSQWDALQHPTASAFLAAIYSDYMLTSRTPKLSCDARDFAPSDLR  413

Query  534  KFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDA--TTGCKDGFKWLESTQ  361
            KFA SQADYVLG NPMKMSYLVGYGD+YP+YVHHRGASIP  A   TGCKDGF WL S Q
Sbjct  414  KFAASQADYVLGSNPMKMSYLVGYGDSYPQYVHHRGASIPVGAKNNTGCKDGFAWLTSAQ  473

Query  360  PNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            PNPNVA GGLVGGPFLN +++D+RNNSMQ EPTTYNSA+++GLLS L
Sbjct  474  PNPNVAAGGLVGGPFLNGSFVDTRNNSMQNEPTTYNSALVIGLLSAL  520



>ref|XP_008221286.1| PREDICTED: endoglucanase 10-like [Prunus mume]
Length=526

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT+SRT++GL+W+S+WNALQHPV+SAFLA +YSDYML+SRT+K+ CDG  Y  SD+RK
Sbjct  352  PTATNSRTENGLIWVSEWNALQHPVSSAFLAALYSDYMLTSRTSKLECDGDSYKASDIRK  411

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQA+YVLG+NP+KMSYLVGYGD YPKYVHHRGASIP +    C++GF++L +  PNP
Sbjct  412  FARSQANYVLGENPLKMSYLVGYGDKYPKYVHHRGASIPANKKPNCREGFEYLNTKDPNP  471

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVG LVGGPFLNETY+D+RNNS Q EP+TYNSA+IVGLLSGL
Sbjct  472  NVAVGALVGGPFLNETYVDARNNSRQGEPSTYNSALIVGLLSGL  515



>ref|XP_004291374.1| PREDICTED: endoglucanase 10-like [Fragaria vesca subsp. vesca]
Length=529

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT+SRT  GL+WIS+WNALQHPVAS+FLAVVYSDYML+S+TAK+TC+G  + P+D+RK
Sbjct  350  PTATTSRTKDGLIWISEWNALQHPVASSFLAVVYSDYMLTSKTAKLTCNGDSFKPADIRK  409

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQ +YVLG+NPMKMSYLVGYGDNYPKYVHHRGASIP DA   C DGFK+ +S+ PNP
Sbjct  410  FAISQIEYVLGNNPMKMSYLVGYGDNYPKYVHHRGASIPADAKPSCSDGFKYFKSSDPNP  469

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPFLNETY D R+N+ Q EP+TYNSA++VGLLS L
Sbjct  470  NVATGALVGGPFLNETYHDIRDNARQGEPSTYNSAVLVGLLSSL  513



>ref|XP_009386441.1| PREDICTED: endoglucanase 24-like [Musa acuminata subsp. malaccensis]
Length=523

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTD GLVWI +WNALQHPVA++FLAVVYSDYML+SRT +I C GK +TP+DLR 
Sbjct  350  PTATSSRTDGGLVWIDEWNALQHPVAASFLAVVYSDYMLTSRTPEIRCSGKSFTPTDLRN  409

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG+NPMK+SYLVGYG +YP+ VHHRGASIP +  TGCK GFKWL S  PNP
Sbjct  410  FATSQADYILGNNPMKLSYLVGYGSSYPQQVHHRGASIPANLDTGCK-GFKWLTSIAPNP  468

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA GGLVGGPF N+++IDSRNNSMQ EP+TYNSA++VGLLSGL
Sbjct  469  NVATGGLVGGPFKNDSFIDSRNNSMQTEPSTYNSAVLVGLLSGL  512



>gb|KCW56649.1| hypothetical protein EUGRSUZ_I02356 [Eucalyptus grandis]
Length=523

 Score =   269 bits (688),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRT+SGL+W+++WN+L HPV SAFLAV+YSDYML+S T  + C  + YTP +LR 
Sbjct  349  PTATSSRTESGLIWVTEWNSLLHPVGSAFLAVLYSDYMLTSGTEALFCSERSYTPGNLRD  408

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQ DYVLG+NPMK+SYLVG+G+NYP+YVHHRG+SIP DATTGCKDGFKWL S+ PNP
Sbjct  409  FAISQVDYVLGENPMKLSYLVGFGENYPQYVHHRGSSIPADATTGCKDGFKWLNSSAPNP  468

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVG LVGGPF NETY DSRNNSMQ EP+TYNSA+ VG+LSGL
Sbjct  469  NVAVGALVGGPFRNETYSDSRNNSMQGEPSTYNSALPVGVLSGL  512



>ref|XP_010029690.1| PREDICTED: endoglucanase 2-like [Eucalyptus grandis]
Length=527

 Score =   269 bits (688),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRT+SGL+W+++WN+L HPV SAFLAV+YSDYML+S T  + C  + YTP +LR 
Sbjct  353  PTATSSRTESGLIWVTEWNSLLHPVGSAFLAVLYSDYMLTSGTEALFCSERSYTPGNLRD  412

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQ DYVLG+NPMK+SYLVG+G+NYP+YVHHRG+SIP DATTGCKDGFKWL S+ PNP
Sbjct  413  FAISQVDYVLGENPMKLSYLVGFGENYPQYVHHRGSSIPADATTGCKDGFKWLNSSAPNP  472

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVG LVGGPF NETY DSRNNSMQ EP+TYNSA+ VG+LSGL
Sbjct  473  NVAVGALVGGPFRNETYSDSRNNSMQGEPSTYNSALPVGVLSGL  516



>ref|XP_010941260.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941261.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941262.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941263.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941264.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
Length=524

 Score =   268 bits (686),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 145/164 (88%), Gaps = 1/164 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT SRTD GL+WI QWN+LQHPVA++FLAVVYSDYML+SRT+++ C+G+ YTP DLRK
Sbjct  351  PTATKSRTDGGLIWIDQWNSLQHPVAASFLAVVYSDYMLTSRTSEVQCNGETYTPLDLRK  410

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FAMSQADY+LGDNPMKMSYLVGYG +YP+ VHHRGASIP +A TGCK G++WL S  PNP
Sbjct  411  FAMSQADYILGDNPMKMSYLVGYGSSYPQQVHHRGASIPANANTGCK-GWQWLSSPNPNP  469

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            N+A G LVGGPF N++YID RNNSMQ+EP+TYNSA +VGLLSGL
Sbjct  470  NIATGALVGGPFQNDSYIDLRNNSMQSEPSTYNSASLVGLLSGL  513



>ref|XP_010539853.1| PREDICTED: endoglucanase 10 [Tarenaya hassleriana]
Length=524

 Score =   268 bits (686),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRT  GL+W+S+WN+LQHPV+SAFLA +YSDYML+SR  K++C GK +  SDLRK
Sbjct  350  PTATSSRTHGGLIWVSEWNSLQHPVSSAFLATLYSDYMLTSRIGKLSCSGKTFRASDLRK  409

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NP  MS+LVG+G+ YPK +HHRGASIP DATTGCKDGFKWL S  PNP
Sbjct  410  FAKSQADYMLGKNPTGMSFLVGFGEKYPKNIHHRGASIPADATTGCKDGFKWLTSEDPNP  469

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            N+A G LVGGPFLNET++DSRNNSMQ EP+TYNSA++VGLLS L
Sbjct  470  NIAYGALVGGPFLNETFVDSRNNSMQNEPSTYNSALVVGLLSSL  513



>gb|KHN00484.1| Endoglucanase 24 [Glycine soja]
Length=509

 Score =   268 bits (685),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT++RT+SGL+W+  WN+LQH VASAFLAV+YSDYML+S+T  + C GK Y P DLRK
Sbjct  336  PTATANRTESGLIWVVPWNSLQHSVASAFLAVLYSDYMLTSQTEILYCSGKLYKPVDLRK  395

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQADYVLG+NPMKMSYLVGYG  YPKY+HHRG+SIP +ATTGCKDGFKW +S  PNP
Sbjct  396  FAISQADYVLGENPMKMSYLVGYGTQYPKYIHHRGSSIPVNATTGCKDGFKWFDSPHPNP  455

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPF +ETY D RNNSMQAEPTTY+SA+ V LLSGL
Sbjct  456  NVAFGALVGGPFFDETYNDFRNNSMQAEPTTYSSALFVALLSGL  499



>ref|XP_009103373.1| PREDICTED: endoglucanase 2 [Brassica rapa]
Length=533

 Score =   268 bits (686),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTD GL+W+++WNALQHPV+SAFLA +YSDYML+S   K++C    + PSDLRK
Sbjct  359  PTATSSRTDGGLIWVAEWNALQHPVSSAFLATLYSDYMLTSGVDKLSCGDTSFKPSDLRK  418

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NP  MSYLVGYGD YP++VHHRGASIP DA TGCKDGFKWL S +PNP
Sbjct  419  FARSQADYMLGKNPETMSYLVGYGDKYPEFVHHRGASIPGDANTGCKDGFKWLNSEEPNP  478

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPFLNET+ID+RNNSMQ EP+TYNSA++VGLLS L
Sbjct  479  NVAYGALVGGPFLNETFIDARNNSMQNEPSTYNSALVVGLLSSL  522



>emb|CDY66396.1| BnaAnng22170D [Brassica napus]
Length=533

 Score =   268 bits (686),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTD GL+W+++WNALQHPV+SAFLA +YSDYML+S   K++C    + PSDLRK
Sbjct  359  PTATSSRTDGGLIWVAEWNALQHPVSSAFLATLYSDYMLTSGVDKLSCGDTSFKPSDLRK  418

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NP  MSYLVGYGD YP++VHHRGASIP DA TGCKDGFKWL S +PNP
Sbjct  419  FARSQADYMLGKNPETMSYLVGYGDKYPEFVHHRGASIPGDANTGCKDGFKWLNSEEPNP  478

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPFLNET+ID+RNNSMQ EP+TYNSA++VGLLS L
Sbjct  479  NVAYGALVGGPFLNETFIDARNNSMQNEPSTYNSALVVGLLSSL  522



>emb|CDY43425.1| BnaC07g14920D [Brassica napus]
Length=533

 Score =   268 bits (685),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTD GL+W+++WNALQHPV+SAFLA +YSDYML+S   K++C    + PSDLRK
Sbjct  359  PTATSSRTDGGLIWVAEWNALQHPVSSAFLATLYSDYMLTSGVDKLSCGDTSFKPSDLRK  418

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NP  MSYLVGYGD YP++VHHRGASIP DA TGCKDGFKWL S +PNP
Sbjct  419  FARSQADYMLGKNPETMSYLVGYGDKYPEFVHHRGASIPGDANTGCKDGFKWLNSDEPNP  478

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPFLNET+ID+RNNSMQ EP+TYNSA++VGLLS L
Sbjct  479  NVAYGALVGGPFLNETFIDARNNSMQNEPSTYNSALVVGLLSSL  522



>ref|XP_006426144.1| hypothetical protein CICLE_v10025306mg [Citrus clementina]
 gb|ESR39384.1| hypothetical protein CICLE_v10025306mg [Citrus clementina]
Length=550

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTDSGL+WI +WN+LQHPVASAFLAV+YSDYM++S T  + C GK Y P DLRK
Sbjct  376  PTATSSRTDSGLIWIVKWNSLQHPVASAFLAVLYSDYMIASGTETLYCSGKSYQPHDLRK  435

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQ DY+LG NPM+MSYLVGYG+NYP YVHHRG+SIP DA TGC DGFKWLES  PNP
Sbjct  436  FAISQVDYLLGKNPMEMSYLVGYGNNYPLYVHHRGSSIPADANTGCTDGFKWLESESPNP  495

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  247
            NVA+G LVGGPFLNE+YIDSRNNSMQ EPTTYNSA
Sbjct  496  NVAIGALVGGPFLNESYIDSRNNSMQGEPTTYNSA  530



>gb|KDO78852.1| hypothetical protein CISIN_1g048736mg [Citrus sinensis]
Length=550

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTDSGL+WI +WN+LQHPVASAFLAV+YSDYM++S T  + C GK Y P DLRK
Sbjct  376  PTATSSRTDSGLIWIVKWNSLQHPVASAFLAVLYSDYMIASGTETLYCSGKSYQPHDLRK  435

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQ DY+LG NPM+MSYLVGYG+NYP YVHHRG+SIP DA TGC DGFKWLES  PNP
Sbjct  436  FAISQVDYLLGKNPMEMSYLVGYGNNYPLYVHHRGSSIPADANTGCTDGFKWLESESPNP  495

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  247
            NVA+G LVGGPFLNE+YIDSRNNSMQ EPTTYNSA
Sbjct  496  NVAIGALVGGPFLNESYIDSRNNSMQGEPTTYNSA  530



>ref|XP_003519870.1| PREDICTED: endoglucanase 24-like [Glycine max]
Length=535

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT++RT+SGL+W+  WN+LQH VASAFLAV+YSDYML+S+T  + C GK Y P DLRK
Sbjct  362  PTATANRTESGLIWVVPWNSLQHSVASAFLAVLYSDYMLTSQTEILYCSGKLYKPVDLRK  421

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQADYVLG+NPMKMSYLVGYG  YPKY+HHRG+SIP +ATTGCKDGFKW +S  PNP
Sbjct  422  FAISQADYVLGENPMKMSYLVGYGTQYPKYIHHRGSSIPVNATTGCKDGFKWFDSPHPNP  481

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPF +ETY D RNNSMQAEPTTY+SA+ V LLSGL
Sbjct  482  NVAFGALVGGPFFDETYNDFRNNSMQAEPTTYSSALFVALLSGL  525



>ref|XP_010649048.1| PREDICTED: endoglucanase 24-like [Vitis vinifera]
 emb|CBI17386.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTDSGL+W+++WN LQH VASAFLAV+YSDYML+S+T  + C GK+Y P+DLRK
Sbjct  352  PTATSSRTDSGLIWVTEWNPLQHSVASAFLAVIYSDYMLTSKTETLYCSGKHYKPADLRK  411

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQ +YVLG+NPM M YLVG+G NYP+YVHHRGASIP DA TGC DGFKWLES  PNP
Sbjct  412  FAISQTEYVLGNNPMNMCYLVGHGSNYPQYVHHRGASIPVDAETGCHDGFKWLESLDPNP  471

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  247
            N+AVG LVGGPFLNETYIDSRNN+MQ EP+TYNSA
Sbjct  472  NLAVGALVGGPFLNETYIDSRNNTMQGEPSTYNSA  506



>ref|XP_003603741.1| Endoglucanase [Medicago truncatula]
Length=535

 Score =   266 bits (681),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 142/170 (84%), Gaps = 6/170 (4%)
 Frame = -3

Query  711  PTATSSRTDS------GLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYT  550
            PTAT SRTDS      GL+W+S+WNALQHPVASAFLA VYSDYML+++T  I CD   + 
Sbjct  355  PTATKSRTDSNVLLEYGLIWVSEWNALQHPVASAFLASVYSDYMLTTQTPNIKCDSDSFK  414

Query  549  PSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLE  370
            PSDLR FA SQADYVLG NP  MS+LVGYG N+P++VHHRGASIP +A TGCKDG++WL+
Sbjct  415  PSDLRDFARSQADYVLGKNPQHMSFLVGYGKNFPQFVHHRGASIPANAKTGCKDGWQWLD  474

Query  369  STQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            S+ PNPNVA G LVGGPFLNETYIDSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  475  SSDPNPNVATGALVGGPFLNETYIDSRNNSMQGEPSTYNSAVIVGLLSSL  524



>ref|XP_006466419.1| PREDICTED: endoglucanase 2-like [Citrus sinensis]
Length=551

 Score =   267 bits (682),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTDSGL+WI +WN+LQHPVASAFLAV+YSDYM++S T  + C GK Y P DLRK
Sbjct  377  PTATSSRTDSGLIWIVKWNSLQHPVASAFLAVLYSDYMITSGTETLYCSGKSYQPHDLRK  436

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQ DY+LG NPM+MSYLVGYG+NYP YVHHRG+SIP +A TGC DGFKWLES  PNP
Sbjct  437  FAISQVDYLLGKNPMEMSYLVGYGNNYPLYVHHRGSSIPANANTGCTDGFKWLESESPNP  496

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  247
            NVA+G LVGGPFLNE+YIDSRNNSMQ EPTTYNSA
Sbjct  497  NVAIGALVGGPFLNESYIDSRNNSMQGEPTTYNSA  531



>ref|NP_173423.1| glycosyl hydrolase 9B5 [Arabidopsis thaliana]
 sp|Q9FXI9.1|GUN2_ARATH RecName: Full=Endoglucanase 2; AltName: Full=Endo-1,4-beta glucanase 
2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG12562.1|AC007797_22 Similar to endo-beta-1,4-glucanase [Arabidopsis thaliana]
 gb|AAK82507.1| At1g19940/F6F9_1 [Arabidopsis thaliana]
 gb|AAM47371.1| At1g19940/F6F9_1 [Arabidopsis thaliana]
 gb|AEE29915.1| probably endoglucanase [Arabidopsis thaliana]
Length=515

 Score =   266 bits (679),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTD GL+W+S+WNALQHPV+SAFLA +YSDYML+S   +++C  + + PSDLRK
Sbjct  342  PTATSSRTDGGLIWVSEWNALQHPVSSAFLATLYSDYMLTSGVKELSCSDQSFKPSDLRK  401

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NP KMSYLVGYG+ YP++VHHRGASIP DATTGCKDGFKWL S +PNP
Sbjct  402  FARSQADYMLGKNPEKMSYLVGYGEKYPEFVHHRGASIPADATTGCKDGFKWLNSDEPNP  461

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  235
            NVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VG
Sbjct  462  NVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVG  500



>ref|XP_007046716.1| EG [Theobroma cacao]
 gb|EOX90873.1| EG [Theobroma cacao]
Length=527

 Score =   266 bits (680),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATS RTD GL+WI++WN+LQHP+ASAFLA++YSDYML+S+T  + C G  Y P DLRK
Sbjct  353  PTATSRRTDGGLIWITEWNSLQHPMASAFLAIIYSDYMLTSQTETLYCSGNSYKPEDLRK  412

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FAMSQADYVLG NPMK+SYLVGYG +YP+YVHHRGASIP DA TGCKDGF+WL S  PNP
Sbjct  413  FAMSQADYVLGTNPMKISYLVGYGSSYPQYVHHRGASIPVDADTGCKDGFRWLNSDDPNP  472

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            N+A G LVGGP LN++Y+DSR N  Q EP+TYN+A+IVGLLSGL
Sbjct  473  NIAFGALVGGPSLNDSYLDSRKNVKQGEPSTYNTALIVGLLSGL  516



>ref|XP_010935039.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
Length=520

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT SRTD GLVWI QWN+LQHPVA++FLAVVYSDYML+SRTA++ C+G+ +TP DLRK
Sbjct  347  PTATKSRTDDGLVWIDQWNSLQHPVAASFLAVVYSDYMLTSRTAEVQCNGESFTPMDLRK  406

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQADYVLGDNPM+MSYLVGYG +YP+ VHHRGASIP +A +GCK G++WL S  PNP
Sbjct  407  FAISQADYVLGDNPMEMSYLVGYGSSYPQQVHHRGASIPANANSGCK-GWQWLSSPDPNP  465

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPF N++YID RNNSMQAEPTTY+SA +V LLSGL
Sbjct  466  NVATGALVGGPFKNDSYIDLRNNSMQAEPTTYSSASLVALLSGL  509



>ref|XP_008799407.1| PREDICTED: endoglucanase 24-like [Phoenix dactylifera]
Length=524

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 146/164 (89%), Gaps = 1/164 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT SRTD GL+WI QWN+LQHPVA++FLAVVYSDYML+SRT+++ C+G+ ++P DLRK
Sbjct  351  PTATKSRTDGGLIWIDQWNSLQHPVAASFLAVVYSDYMLTSRTSEMHCNGETFSPLDLRK  410

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FAM+QADY+LGDNPMKMSYLVGYG NYP+ VHHRGASIP +A TGCK G++WL+S  PNP
Sbjct  411  FAMAQADYILGDNPMKMSYLVGYGSNYPQQVHHRGASIPANANTGCK-GWQWLKSPNPNP  469

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPF N+++ID RNNSMQ+EP+TY+SA +VGLLSGL
Sbjct  470  NVATGALVGGPFQNDSFIDLRNNSMQSEPSTYSSASLVGLLSGL  513



>ref|XP_010459672.1| PREDICTED: endoglucanase 2 [Camelina sativa]
 ref|XP_010459674.1| PREDICTED: endoglucanase 2 [Camelina sativa]
Length=518

 Score =   263 bits (672),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTD GL+W+S+WNALQHPV+SAFLA +YSDYML+S   +++CD + +  SDLRK
Sbjct  344  PTATSSRTDGGLIWVSEWNALQHPVSSAFLATLYSDYMLTSGIKELSCDDQSFKSSDLRK  403

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NP KMSYLVGYG+ YP++VHHRGASIP DA TGCKDGFKWL S +PNP
Sbjct  404  FARSQADYMLGKNPEKMSYLVGYGEKYPEFVHHRGASIPADANTGCKDGFKWLNSEEPNP  463

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  235
            NVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VG
Sbjct  464  NVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVG  502



>ref|XP_011462352.1| PREDICTED: endoglucanase 2-like [Fragaria vesca subsp. vesca]
Length=531

 Score =   263 bits (673),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATS RTD+GL+W+ +WN LQH ++SAFLAV+YSDYM++S+T  + CDGK Y P DLR 
Sbjct  358  PTATSDRTDNGLIWVEEWNCLQHALSSAFLAVLYSDYMVASQTEMLYCDGKIYNPEDLRS  417

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQADY LG NPMKMSYLVGYG NYP+ VHHRG+SIP DA TGC DGFKWL S  PNP
Sbjct  418  FAISQADYALGKNPMKMSYLVGYGSNYPQQVHHRGSSIPVDADTGCSDGFKWLYSPDPNP  477

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVG LVGGPF N++Y+D RNNSMQ EP+TYNSA+IV LLSGL
Sbjct  478  NVAVGALVGGPFQNDSYMDIRNNSMQGEPSTYNSALIVALLSGL  521



>gb|AID55379.1| glycoside hydrolase family 9 B7 [Gossypium hirsutum]
Length=525

 Score =   263 bits (672),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P+AT+SRT SGL+WI++W++LQHPV SAFLAV+YSDYM +S    ++C    + PSDLRK
Sbjct  349  PSATASRTKSGLIWITKWDSLQHPVGSAFLAVLYSDYMRASDNEILSCGDDSFEPSDLRK  408

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADYVLGDNPM +SYLVGYG  YP++VHHRGASIP DATTGC +GFKWL S +PNP
Sbjct  409  FAQSQADYVLGDNPMDISYLVGYGGKYPEFVHHRGASIPVDATTGCSEGFKWLSSKKPNP  468

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA+G LVGGPF NE++IDSRNNSMQ EPTTYNSA++VGLLS L
Sbjct  469  NVAIGALVGGPFKNESFIDSRNNSMQTEPTTYNSAVLVGLLSSL  512



>gb|KJB63540.1| hypothetical protein B456_010G005200 [Gossypium raimondii]
Length=525

 Score =   263 bits (671),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P+AT+SRT SGL+WI++W++LQHPV SAFLAV+YSDYM +S    ++C    + PSDLRK
Sbjct  349  PSATASRTKSGLIWITKWDSLQHPVGSAFLAVLYSDYMRASDNEILSCGDDSFEPSDLRK  408

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADYVLGDNPM +SYLVGYG  YP++VHHRGASIP DATTGC +GFKWL S +PNP
Sbjct  409  FAQSQADYVLGDNPMDISYLVGYGGKYPEFVHHRGASIPVDATTGCSEGFKWLSSKKPNP  468

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA+G LVGGPF NE++IDSRNNSMQ EPTTYNSA++VGLLS L
Sbjct  469  NVAIGALVGGPFKNESFIDSRNNSMQTEPTTYNSAVLVGLLSSL  512



>ref|XP_006416450.1| hypothetical protein EUTSA_v10007364mg [Eutrema salsugineum]
 gb|ESQ34803.1| hypothetical protein EUTSA_v10007364mg [Eutrema salsugineum]
Length=523

 Score =   263 bits (671),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTD GL+W+++WNA+QHPV+SAFLA +YSDYML+S   + +C    + PSDLRK
Sbjct  349  PTATSSRTDGGLIWVAEWNAMQHPVSSAFLATLYSDYMLTSGIEQFSCGDTSFKPSDLRK  408

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NP KMSYLVGYG+ YP++VHHRGASIP DA TGCKDGFKWL+S +PNP
Sbjct  409  FARSQADYMLGKNPEKMSYLVGYGEKYPEFVHHRGASIPADANTGCKDGFKWLQSEEPNP  468

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  235
            NVA G LVGGPFLNET+ID+RNNSMQ EP+TYNSA++VG
Sbjct  469  NVAYGALVGGPFLNETFIDARNNSMQNEPSTYNSALVVG  507



>ref|XP_009149490.1| PREDICTED: endoglucanase 2 [Brassica rapa]
 ref|XP_009149491.1| PREDICTED: endoglucanase 2 [Brassica rapa]
Length=525

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRT+ GL+W+++WNALQ PV+S+FLA +YSDYML+S    + C    + PSDLRK
Sbjct  351  PTATSSRTEGGLIWVAEWNALQQPVSSSFLATLYSDYMLTSGIENLACGDTSFKPSDLRK  410

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NP KMSYLVGYGD YP+YVHHRGASIP DA TGCKDGF+WL S +PNP
Sbjct  411  FARSQADYMLGKNPEKMSYLVGYGDKYPEYVHHRGASIPADANTGCKDGFEWLNSEEPNP  470

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VGLLS L
Sbjct  471  NVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVGLLSSL  514



>ref|XP_011100152.1| PREDICTED: endoglucanase 24-like [Sesamum indicum]
Length=528

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -3

Query  705  ATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFA  526
            ATS RT+ GL+W+ +W+ALQ+PVASAFLA+VYSDYML+S T  + CDG+ Y P DLR  A
Sbjct  356  ATSYRTEGGLIWVREWDALQYPVASAFLALVYSDYMLTSHTRNLYCDGELYEPMDLRNLA  415

Query  525  MSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNV  346
            + QADYVLG+NPM MSYLVGYG +YP+YVHHRGASIPTDA TGC DGF WL ST PNPNV
Sbjct  416  IMQADYVLGNNPMNMSYLVGYGSSYPQYVHHRGASIPTDAKTGCSDGFMWLSSTAPNPNV  475

Query  345  AVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            A+G LVGGPF N++YIDSRNN+ QAEPTTYNSA++VGLLSGL
Sbjct  476  AIGALVGGPFQNDSYIDSRNNTAQAEPTTYNSAVLVGLLSGL  517



>ref|XP_006307252.1| hypothetical protein CARUB_v10008868mg [Capsella rubella]
 gb|EOA40150.1| hypothetical protein CARUB_v10008868mg [Capsella rubella]
Length=517

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRT+ GL+W+S+WNALQHPV+SAFLA +YSDYML+S   + +C  + + PSDLRK
Sbjct  343  PTATSSRTEGGLIWVSEWNALQHPVSSAFLATLYSDYMLTSGIKEFSCSDQSFKPSDLRK  402

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NP KMSYLVGYG+ YP++VHHRGASIP DA TGCKDGFKWL S +PNP
Sbjct  403  FARSQADYMLGKNPEKMSYLVGYGEKYPEFVHHRGASIPADANTGCKDGFKWLNSEEPNP  462

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  235
            NVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VG
Sbjct  463  NVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVG  501



>ref|XP_003629333.1| Endoglucanase [Medicago truncatula]
 gb|AET03809.1| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=534

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT++RT SG +W+  WN+LQH VASAFLAV+YSDYML+S+T  + C GK Y P DLRK
Sbjct  361  PTATTNRTKSGQIWVVPWNSLQHSVASAFLAVLYSDYMLTSQTENLYCSGKMYKPVDLRK  420

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQ +YVLG+NPMKMS+LVGYG NYPKY+HHRG+SIP +A TGCKDGFKW +S QPNP
Sbjct  421  FAISQVEYVLGENPMKMSFLVGYGSNYPKYIHHRGSSIPVNAKTGCKDGFKWYDSPQPNP  480

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G +VGGPF NETY D RNNSMQAEPTTY++A++V LLSGL
Sbjct  481  NVAFGAIVGGPFFNETYNDFRNNSMQAEPTTYSNALLVALLSGL  524



>ref|XP_007156152.1| hypothetical protein PHAVU_003G262600g [Phaseolus vulgaris]
 gb|ESW28146.1| hypothetical protein PHAVU_003G262600g [Phaseolus vulgaris]
Length=534

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT++RT+SGL+W+  WN+LQH VASAFLA++YSDYM +S+T  + C GK Y P DLRK
Sbjct  361  PTATTNRTESGLIWLVPWNSLQHSVASAFLAILYSDYMQTSQTEILYCGGKLYKPVDLRK  420

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQADYVLG+NPMKMSYLVGYG + P Y+HHRG+SIP +ATTGCKDGFKWL S  PNP
Sbjct  421  FAISQADYVLGENPMKMSYLVGYGTHNPNYIHHRGSSIPVNATTGCKDGFKWLYSPYPNP  480

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA+G LVGGPFLNETY D RNNSMQ EPTTYNSA+ V LLSGL
Sbjct  481  NVALGALVGGPFLNETYNDFRNNSMQGEPTTYNSALFVALLSGL  524



>ref|XP_002893081.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69340.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=516

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRTD GL+W+S+WNALQHPV+SAFLA +YSDYML+S   +++C  + + PSDLRK
Sbjct  343  PTATSSRTDGGLIWVSEWNALQHPVSSAFLATLYSDYMLTSGIKELSCSDQSFKPSDLRK  402

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NP KMSYLVGYG+ YP++VHHRGASIP DA TGCKDGFKWL+S + NP
Sbjct  403  FARSQADYMLGKNPEKMSYLVGYGEKYPEFVHHRGASIPADANTGCKDGFKWLDSDEQNP  462

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  235
            NVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VG
Sbjct  463  NVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVG  501



>emb|CDY29381.1| BnaA06g14150D [Brassica napus]
Length=548

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRT+ GL+W+++WNALQ PV+S+FLA +YSDYML+S    + C    + PSDLRK
Sbjct  344  PTATSSRTEGGLIWVAEWNALQQPVSSSFLATLYSDYMLTSGIENLACGDTSFKPSDLRK  403

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NP KMSYLVGYGD YP+YVHHRGASIP DA TGCKDGF+WL S +PNP
Sbjct  404  FARSQADYMLGKNPEKMSYLVGYGDKYPEYVHHRGASIPADANTGCKDGFEWLNSEEPNP  463

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VGLLS L
Sbjct  464  NVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVGLLSSL  507



>ref|XP_006435158.1| hypothetical protein CICLE_v10003402mg, partial [Citrus clementina]
 gb|ESR48398.1| hypothetical protein CICLE_v10003402mg, partial [Citrus clementina]
Length=480

 Score =   259 bits (663),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P+ATS RT+ GL+WI++WNALQHPVA AFLA +Y DYM  S    + CD K +   DLR+
Sbjct  305  PSATSDRTNGGLIWIAEWNALQHPVAVAFLASLYGDYMEKSDNENLECDEKTFKSEDLRE  364

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA  QADYVLGDNP  MSYLVGY   +PK+VHHRGASIP DATTGCKDG++WLEST+PNP
Sbjct  365  FAKKQADYVLGDNPNSMSYLVGYSKKFPKFVHHRGASIPADATTGCKDGYQWLESTKPNP  424

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            N A G LVGGPF+NETYIDSRNNSMQ EPTTYNSA++VGLLS L
Sbjct  425  NEATGALVGGPFMNETYIDSRNNSMQGEPTTYNSALLVGLLSSL  468



>gb|KFK44119.1| hypothetical protein AALP_AA1G218000 [Arabis alpina]
Length=517

 Score =   261 bits (666),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT SRTD GL+W+S+WNALQHPV+S FLA +YSDYML+S   K++C  + + PSDLRK
Sbjct  343  PTATESRTDGGLIWVSEWNALQHPVSSGFLASLYSDYMLTSGIEKLSCSDQDFKPSDLRK  402

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NP KMSYLVGYG+ YP++VHHRGASIP DA  GCKDGFKWL S +PNP
Sbjct  403  FAKSQADYMLGKNPEKMSYLVGYGEKYPEFVHHRGASIPGDANVGCKDGFKWLNSEEPNP  462

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  235
            NVA G LVGGPF+NET+ID+RNNSMQ EP+TYNSA++VG
Sbjct  463  NVAYGALVGGPFMNETFIDARNNSMQNEPSTYNSALVVG  501



>gb|KDO84821.1| hypothetical protein CISIN_1g036398mg [Citrus sinensis]
Length=514

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P+ATS RT+ GL+WI++WNALQHPVA AFLA +Y DYM  S    + CD K +   DLR+
Sbjct  339  PSATSDRTNGGLIWIAEWNALQHPVAVAFLASLYGDYMEKSDNENLECDEKTFKSEDLRE  398

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA  QADYVLGDNP  MSYLVGY   +PK+VHHRGASIP DATTGCKDG++WLEST+PNP
Sbjct  399  FAKKQADYVLGDNPNSMSYLVGYSKKFPKFVHHRGASIPADATTGCKDGYQWLESTKPNP  458

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            N A G LVGGPF+NETYIDSRNNSMQ EPTTYNSA++VGLLS L
Sbjct  459  NEATGALVGGPFMNETYIDSRNNSMQGEPTTYNSALLVGLLSSL  502



>ref|XP_011083520.1| PREDICTED: endoglucanase 10 [Sesamum indicum]
Length=518

 Score =   259 bits (661),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT SRT++GL+W+S+WNALQ  V+SAFLAVVYSDYML+SRTA I+C G  + PSDLR 
Sbjct  344  PTATESRTENGLIWVSEWNALQQSVSSAFLAVVYSDYMLTSRTAHISCSGSTFKPSDLRD  403

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA++QA+YVLGDNPM++SY+VGYGDNYP+ VHHRGASIP D    CKDGFKWLE+  PNP
Sbjct  404  FAITQANYVLGDNPMQLSYIVGYGDNYPQQVHHRGASIPADENPSCKDGFKWLEADTPNP  463

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  247
            N+A G LVGGPFLNETYID RNNSMQ EP+TYNSA
Sbjct  464  NIATGALVGGPFLNETYIDVRNNSMQGEPSTYNSA  498



>ref|XP_011043209.1| PREDICTED: endoglucanase 2-like [Populus euphratica]
Length=530

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRT  GL+W+SQWN LQH +ASAFLAV++SDYM++++ + + C GK Y+P+DLR 
Sbjct  356  PTATSSRTKGGLIWVSQWNCLQHAMASAFLAVLFSDYMVTTQISTLYCHGKSYSPADLRD  415

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            F++SQADY+LG+NPMKMSYLVGYG NYP+ VHHRGASIP DA T CKDGF WL+S  PNP
Sbjct  416  FSISQADYILGNNPMKMSYLVGYGSNYPQKVHHRGASIPVDANTTCKDGFTWLDSINPNP  475

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAII  241
            NVAVG +VGGPFLNETYIDSRNN MQAEPTTYNSA++
Sbjct  476  NVAVGAVVGGPFLNETYIDSRNNWMQAEPTTYNSALV  512



>ref|XP_008788648.1| PREDICTED: endoglucanase 24 [Phoenix dactylifera]
Length=524

 Score =   258 bits (659),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT SRT+ GL+WI QWN+LQHPVA++FLA+VYSDYML+SRTA++ C G+ +T  DLRK
Sbjct  351  PTATKSRTNGGLIWIDQWNSLQHPVAASFLAIVYSDYMLTSRTAEVQCSGETFTLMDLRK  410

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQADY+LGDNPMKMSYLVGYG +YP+ VHHRGASIP +A TGCK G++WL S  PNP
Sbjct  411  FAISQADYILGDNPMKMSYLVGYGSSYPRQVHHRGASIPVNANTGCK-GWQWLSSADPNP  469

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G +VGGPF N++YID RNNSMQ EP+TY+SA +VGLLSGL
Sbjct  470  NVATGAVVGGPFKNDSYIDLRNNSMQGEPSTYSSASLVGLLSGL  513



>ref|XP_004509346.1| PREDICTED: endoglucanase 10-like [Cicer arietinum]
Length=533

 Score =   256 bits (654),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = -3

Query  708  TATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKF  529
            TAT++RT SGL+W+  WN+LQH VASAFLAV+YSDYML+S+T  + C GK Y P DLRKF
Sbjct  361  TATTNRTKSGLIWVVPWNSLQHSVASAFLAVLYSDYMLTSQTEFLYCSGKMYKPVDLRKF  420

Query  528  AMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPN  349
            A+SQ +YVLG+NPM+MS++VGYG+ YPKY HHRG+SIP DA TGC+DGFKW +S QPNPN
Sbjct  421  AISQVEYVLGENPMRMSFVVGYGNEYPKYTHHRGSSIPFDAKTGCRDGFKWYDSPQPNPN  480

Query  348  VAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            VA G LVGGPF N+TY D RNNSMQAEPTTY++A++V LLSGL
Sbjct  481  VAFGALVGGPFFNDTYNDFRNNSMQAEPTTYSNALLVALLSGL  523



>gb|KJB43353.1| hypothetical protein B456_007G195700, partial [Gossypium raimondii]
Length=521

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATS RTD GL+WI++WN LQH VASAFLAV+YSDYML+S+T  + C G  Y P DLR 
Sbjct  352  PTATSRRTDGGLIWITEWNPLQHAVASAFLAVLYSDYMLTSQTETLYCSGNSYKPDDLRN  411

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQADYVLG+NPMKMSYLVGYG  YP YVHHRG+SIP +A T C+DGFKWL S  PNP
Sbjct  412  FAISQADYVLGENPMKMSYLVGYGSRYPLYVHHRGSSIPVNADTSCQDGFKWLYSDDPNP  471

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            N+AVG LVGGP LN++Y D+R+N  Q+EP+TYNSA++VGLLSGL
Sbjct  472  NIAVGALVGGPSLNDSYSDTRDNVKQSEPSTYNSALLVGLLSGL  515



>gb|KDP46724.1| hypothetical protein JCGZ_06512 [Jatropha curcas]
Length=538

 Score =   253 bits (647),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRT++GL+W+ +WN+LQ+ VASAF+A+++SDYM++S    + C G  Y+P++LR 
Sbjct  364  PTATSSRTENGLIWVVKWNSLQYSVASAFIALLFSDYMVASHIPTLYCSGILYSPTELRS  423

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQADY+LG NPM+MS+LVGYG+ YP+YVHHRG+SIP DA TGCKDGF+WL+S  PNP
Sbjct  424  FAISQADYILGKNPMEMSFLVGYGNEYPQYVHHRGSSIPVDAKTGCKDGFEWLDSPNPNP  483

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            N+AVG LVGGPFLNETY DSR N +QAE TTYN A+IVGLLSGL
Sbjct  484  NIAVGALVGGPFLNETYNDSRRNIIQAEATTYNGALIVGLLSGL  527



>ref|XP_010113364.1| Endoglucanase 24 [Morus notabilis]
 gb|EXC35371.1| Endoglucanase 24 [Morus notabilis]
Length=544

 Score =   253 bits (645),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P ATSSRT +GL+W+  W+ LQH +ASAFLAV+Y DYML+S+T  + CDG+ YTP DLRK
Sbjct  370  PPATSSRTQNGLIWVINWHCLQHSMASAFLAVLYGDYMLTSQTEILYCDGQSYTPEDLRK  429

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FAMSQ DYVLG NPM+MSYLVGYG+NYP+ VHHRG+SIP DA TGCKDGF+WL S +PNP
Sbjct  430  FAMSQVDYVLGQNPMEMSYLVGYGNNYPQQVHHRGSSIPVDAKTGCKDGFEWLYSPKPNP  489

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  235
            N+A+G LVGGPFLNETY+D RNNSM +EP+TYN+A++V 
Sbjct  490  NLAIGALVGGPFLNETYVDYRNNSMLSEPSTYNNALLVA  528



>gb|AEO97190.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97217.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=530

 Score =   252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRT  GLVW+S+WN LQH +ASAFLAV++ DYM++++ + + C GK Y+P+DLR 
Sbjct  356  PTATSSRTKGGLVWVSKWNCLQHAMASAFLAVLFGDYMVTTQISTLYCQGKSYSPADLRN  415

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQADY+LG+NPMKMSYLVGYG NYP+ VHHRGASIP DA T CKDGF WL+S  PNP
Sbjct  416  FAISQADYILGNNPMKMSYLVGYGSNYPQNVHHRGASIPVDANTTCKDGFTWLDSINPNP  475

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYN  253
            NVAVG +VGGPFLNETYIDSRNN MQAEPTTYN
Sbjct  476  NVAVGAVVGGPFLNETYIDSRNNWMQAEPTTYN  508



>ref|XP_006383120.1| hypothetical protein POPTR_0005s11750g [Populus trichocarpa]
 gb|ERP60917.1| hypothetical protein POPTR_0005s11750g [Populus trichocarpa]
Length=530

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRT  GLVW+S+WN LQH +ASAFLAV++ DYM++++ + + C GK Y+P+DLR 
Sbjct  356  PTATSSRTKGGLVWVSKWNCLQHAMASAFLAVLFGDYMVTTQISTLYCHGKSYSPADLRN  415

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQADY+LG+NPMKMSYLVGYG NYP+ VHHRGASIP DA T CKDGF WL+S  PNP
Sbjct  416  FAISQADYILGNNPMKMSYLVGYGSNYPQNVHHRGASIPVDANTTCKDGFTWLDSINPNP  475

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYN  253
            NVAVG +VGGPFLNETYIDSRNN MQAEPTTYN
Sbjct  476  NVAVGAVVGGPFLNETYIDSRNNWMQAEPTTYN  508



>ref|XP_006340729.1| PREDICTED: endoglucanase 2-like [Solanum tuberosum]
Length=526

 Score =   251 bits (642),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATS RT  GLVW++QWN  Q+ VAS+FLAVVYSDYMLSS+T+ + C GK Y P++LR 
Sbjct  350  PTATSQRTADGLVWVNQWNPFQYSVASSFLAVVYSDYMLSSQTSNLYCSGKLYEPTELRN  409

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQ DY+LG+NPM+MSYLVGYG  YP+ VHHRGASIP +A + C DGFKWL +  PNP
Sbjct  410  FAVSQLDYILGNNPMEMSYLVGYGSRYPQQVHHRGASIPVNANSNCSDGFKWLHTRHPNP  469

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVG LVGGP L++TY+DSRNN  Q+EPTTYNSA+IVGL+SGL
Sbjct  470  NVAVGALVGGPSLSDTYMDSRNNISQSEPTTYNSALIVGLISGL  513



>emb|CDY44194.1| BnaC05g15510D [Brassica napus]
Length=1131

 Score =   260 bits (664),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT+SRT+ GL+W+++WNALQ PV+SAFLA +YSDY+L+S    ++C    + PSDLRK
Sbjct  366  PTATTSRTEGGLIWVAEWNALQQPVSSAFLATLYSDYLLTSGIENLSCGDTSFKPSDLRK  425

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            F+ SQADY+LG NP KMSYLVGYGD YP++VHHRGASIP DA TGCKDGFKWL S +PNP
Sbjct  426  FSRSQADYMLGKNPEKMSYLVGYGDKYPEFVHHRGASIPADANTGCKDGFKWLNSEEPNP  485

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  226
            NVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VGLLS
Sbjct  486  NVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVGLLS  527



>ref|XP_002462729.1| hypothetical protein SORBIDRAFT_02g030990 [Sorghum bicolor]
 gb|EER99250.1| hypothetical protein SORBIDRAFT_02g030990 [Sorghum bicolor]
Length=525

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GLVWIS WN+LQH   +AFLAVVYSDYMLS+RTA + C GKYY+P+D+R 
Sbjct  352  PQATASRTGGGLVWISGWNSLQHATNAAFLAVVYSDYMLSTRTAAVQCSGKYYSPTDIRN  411

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGASIP DA TGCK GF++L S+ PNP
Sbjct  412  FAASQANYILGDNPMKLSYLVGYGSSYPQQVHHRGASIPADAKTGCK-GFQYLHSSDPNP  470

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVG LVGGPF N+T++DSR+N++Q E +TYNS  +VGLLSGL
Sbjct  471  NVAVGALVGGPFQNDTFVDSRDNAVQTESSTYNSGTLVGLLSGL  514



>gb|EEC84946.1| hypothetical protein OsI_32163 [Oryza sativa Indica Group]
Length=528

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P+AT+SRT  GLVWIS WN+LQH   +AFLAVVYSDYML+S+TA + C GKYY+P+D+R 
Sbjct  355  PSATASRTGGGLVWISGWNSLQHATNAAFLAVVYSDYMLTSQTAAVQCSGKYYSPTDIRN  414

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGASIP DA TGCK GF++L ST PNP
Sbjct  415  FAISQANYILGDNPMKLSYLVGYGSSYPQQVHHRGASIPADAKTGCK-GFQYLHSTSPNP  473

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA+G LVGGPF N+T++DSR+N++Q E +TYNS  +VGLLSGL
Sbjct  474  NVAMGALVGGPFQNDTFVDSRDNAVQTESSTYNSGTLVGLLSGL  517



>gb|EEE70113.1| hypothetical protein OsJ_30126 [Oryza sativa Japonica Group]
Length=528

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P+AT+SRT  GLVWIS WN+LQH   +AFLAVVYSDYML+S+TA + C GKYY+P+D+R 
Sbjct  355  PSATASRTGGGLVWISGWNSLQHATNAAFLAVVYSDYMLTSQTAAVQCSGKYYSPTDIRN  414

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGASIP DA TGCK GF++L ST PNP
Sbjct  415  FAISQANYILGDNPMKLSYLVGYGSSYPQQVHHRGASIPADAKTGCK-GFQYLHSTSPNP  473

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA+G LVGGPF N+T++DSR+N++Q E +TYNS  +VGLLSGL
Sbjct  474  NVAMGALVGGPFQNDTFVDSRDNAVQTESSTYNSGTLVGLLSGL  517



>ref|NP_001063771.1| Os09g0533900 [Oryza sativa Japonica Group]
 sp|Q69SG5.1|GUN24_ORYSJ RecName: Full=Endoglucanase 24; AltName: Full=Endo-1,4-beta glucanase 
24; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD33331.1| putative cellulase [Oryza sativa Japonica Group]
 dbj|BAF25685.1| Os09g0533900 [Oryza sativa Japonica Group]
 dbj|BAG94612.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGW30395.1| cellulase [Oryza sativa]
Length=528

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P+AT+SRT  GLVWIS WN+LQH   +AFLAVVYSDYML+S+TA + C GKYY+P+D+R 
Sbjct  355  PSATASRTGGGLVWISGWNSLQHATNAAFLAVVYSDYMLTSQTAAVQCSGKYYSPTDIRN  414

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGASIP DA TGCK GF++L ST PNP
Sbjct  415  FAISQANYILGDNPMKLSYLVGYGSSYPQQVHHRGASIPADAKTGCK-GFQYLHSTSPNP  473

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA+G LVGGPF N+T++DSR+N++Q E +TYNS  +VGLLSGL
Sbjct  474  NVAMGALVGGPFQNDTFVDSRDNAVQTESSTYNSGTLVGLLSGL  517



>gb|AFZ78646.1| korrigan [Populus tomentosa]
Length=530

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATSSRT  GL W+S+WN LQH +ASAFLAV++SDYM++++ + + C GK Y+P+D+R 
Sbjct  356  PTATSSRTKGGLAWVSKWNCLQHAMASAFLAVLFSDYMVTTQISTLYCHGKSYSPADMRD  415

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
             A+SQADY+LG+NPMKMSYLVGYG NYP+ VHHRGASIP DA T CKDGF WL+S  PNP
Sbjct  416  LAISQADYILGNNPMKMSYLVGYGSNYPQNVHHRGASIPVDANTTCKDGFTWLDSINPNP  475

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYN  253
            NVAVG +VGGPFLNETYIDSRNN MQAEPTTYN
Sbjct  476  NVAVGAVVGGPFLNETYIDSRNNWMQAEPTTYN  508



>ref|NP_001145749.1| hypothetical protein [Zea mays]
 gb|ACL52523.1| unknown [Zea mays]
 tpg|DAA62473.1| TPA: hypothetical protein ZEAMMB73_855274 [Zea mays]
Length=526

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GLVWIS WN+LQH   +AFL+VVYSDYMLS+RTA + C GKYY+P+D+R 
Sbjct  353  PQATASRTGGGLVWISGWNSLQHATNAAFLSVVYSDYMLSTRTAAVQCSGKYYSPTDIRN  412

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQA+Y+LGDNPMK+SYLVGYG +YPK VHHRGASIP DA TGCK GF++L S  PNP
Sbjct  413  FAASQANYILGDNPMKLSYLVGYGSSYPKQVHHRGASIPADAKTGCK-GFEYLHSPSPNP  471

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G LVGGPF N+T++DSR+N++Q E +TYNS  +VGLLSGL
Sbjct  472  NVATGALVGGPFQNDTFVDSRDNAVQTESSTYNSGTLVGLLSGL  515



>ref|XP_006661478.1| PREDICTED: endoglucanase 24-like [Oryza brachyantha]
Length=498

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P+AT+SRT  GLVWIS WN+LQH   +AFLAVVYSDYML+S+TA + C GKYY+P+D+R 
Sbjct  325  PSATASRTGGGLVWISPWNSLQHATNAAFLAVVYSDYMLTSQTAAVQCSGKYYSPTDIRN  384

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQ +Y+LGDNPMK+SYLVGYG +YP+ VHHRGASIP DA TGCK GF++L S+ PNP
Sbjct  385  FAISQVNYILGDNPMKLSYLVGYGSSYPQQVHHRGASIPADAKTGCK-GFQYLHSSSPNP  443

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA+G LVGGPF N+T++DSR+N++Q E +TYNS  +VG+LSGL
Sbjct  444  NVAMGALVGGPFQNDTFVDSRDNALQTESSTYNSGTLVGVLSGL  487



>ref|XP_009624009.1| PREDICTED: endoglucanase 2-like [Nicotiana tomentosiformis]
Length=527

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATS RT  GLVW++QWN LQ+ VAS+FLAVVYSDYMLSS+T  + C G+ Y P++LR 
Sbjct  351  PTATSQRTPDGLVWVNQWNPLQYSVASSFLAVVYSDYMLSSQTPNLYCIGELYEPTELRN  410

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+ Q DY+LG+NPM+MSYLVGYG  YP+ VHHRGASIP D  + C DGFKWL + +PNP
Sbjct  411  FAVLQLDYILGNNPMEMSYLVGYGSRYPQQVHHRGASIPVDVNSNCSDGFKWLHTREPNP  470

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVG LVGGP L++TY+DSRNN  Q+E TTYN+A+IVGL+SGL
Sbjct  471  NVAVGALVGGPSLSDTYMDSRNNISQSETTTYNTALIVGLISGL  514



>ref|XP_004957464.1| PREDICTED: endoglucanase 24-like [Setaria italica]
Length=528

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GL+WIS WN+LQH   +AFLA+VYSDYMLS++TA + C GKYY+P+D+R 
Sbjct  355  PQATASRTGGGLIWISGWNSLQHATNAAFLAIVYSDYMLSTQTAAVQCSGKYYSPTDIRN  414

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQA+Y+LGDNPMK+SYLVGYG  YP+ VHHRGASIP DA TGCK GF++L S  PNP
Sbjct  415  FAASQANYILGDNPMKLSYLVGYGSVYPQQVHHRGASIPADAKTGCK-GFQYLHSPDPNP  473

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA+G LVGGPF N+T++DSR+N++Q E +TYNS  +VGLLSGL
Sbjct  474  NVAMGALVGGPFQNDTFVDSRDNALQTESSTYNSGTLVGLLSGL  517



>ref|XP_004232483.1| PREDICTED: endoglucanase 2-like [Solanum lycopersicum]
Length=526

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P ATS RT  GLVW++QWN  Q+ VAS+FLAVVYSDYMLSS+T+ + C GK Y P++LR 
Sbjct  350  PMATSQRTADGLVWVNQWNPFQYSVASSFLAVVYSDYMLSSQTSNLYCSGKLYEPTELRN  409

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQ DY+LG+N M+MSYLVGYG  YP+ VHHRGASIP +A + C DGFKWL +   NP
Sbjct  410  FAVSQLDYILGNNSMEMSYLVGYGSRYPQQVHHRGASIPVNANSNCSDGFKWLHTRHSNP  469

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVG LVGGP L++TY+DSRNN  Q+EPTTYNSA+IVGL+SGL
Sbjct  470  NVAVGALVGGPSLSDTYMDSRNNISQSEPTTYNSALIVGLISGL  513



>ref|XP_006390284.1| hypothetical protein EUTSA_v10018397mg [Eutrema salsugineum]
 gb|ESQ27570.1| hypothetical protein EUTSA_v10018397mg [Eutrema salsugineum]
Length=524

 Score =   242 bits (617),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT+SRT+ GLVW+S+WN+LQ  V++AFLA ++SDYMLSSR  KI+CDGK +  ++LR 
Sbjct  350  PTATASRTNGGLVWVSEWNSLQQSVSAAFLASLFSDYMLSSRIHKISCDGKIFKATELRD  409

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NPM MS++VGYGD YP++VHHRGASIP DATTGC DGFK+  ST+PNP
Sbjct  410  FAKSQADYMLGKNPMGMSFVVGYGDKYPEFVHHRGASIPADATTGCLDGFKYFNSTKPNP  469

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  247
            N+A G LVGGPF NET++DSR+N MQ EPTTYN+A
Sbjct  470  NIAYGALVGGPFFNETFLDSRDNPMQNEPTTYNNA  504



>gb|EMT32027.1| Endoglucanase 24 [Aegilops tauschii]
Length=504

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P+AT SRT  GLVWIS WN+LQH + +AFLAVVYSDYML+S+TA + C GKY++P+D+R 
Sbjct  331  PSATGSRTSGGLVWISGWNSLQHGINAAFLAVVYSDYMLTSQTAAVECSGKYFSPTDIRN  390

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQA+YVLGDNPMK+SYLVGYG +YP+ VHHRGASIP DA TGCK GF++L S+ PNP
Sbjct  391  FAISQANYVLGDNPMKLSYLVGYGSSYPQQVHHRGASIPADAKTGCK-GFEYLHSSSPNP  449

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA G +VGGPF N++++D R+N++Q E +TYNS   VGLL+GL
Sbjct  450  NVATGAVVGGPFQNDSFVDLRDNAVQTESSTYNSGTFVGLLAGL  493



>ref|XP_009128120.1| PREDICTED: endoglucanase 10 [Brassica rapa]
 ref|XP_009128121.1| PREDICTED: endoglucanase 10 [Brassica rapa]
Length=526

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT+SR++ GLV +S+WNALQ  V++AFLA ++SDYML+SR  KI+C+GK +  ++LR 
Sbjct  352  PTATTSRSNGGLVLVSEWNALQQSVSAAFLASLFSDYMLTSRLHKISCNGKIFKATELRD  411

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NPM MS++VGYGD YP+Y+HHRGASIP DATTGC DGF++  ST+PNP
Sbjct  412  FAKSQADYILGKNPMGMSFVVGYGDKYPEYIHHRGASIPEDATTGCLDGFEYFNSTKPNP  471

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            N+A G LVGGPFLNET+ D+R+N  Q EPTTYN+A++VGL+S L
Sbjct  472  NIAYGALVGGPFLNETFRDARDNVRQNEPTTYNNALLVGLMSSL  515



>dbj|BAJ93299.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=531

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P+AT SRT  GLVWIS WN+LQH + +AFLAVVYSDYML+S+TA + C GKY++P+D+R 
Sbjct  358  PSATGSRTSGGLVWISGWNSLQHGINAAFLAVVYSDYMLTSQTAAVECSGKYFSPTDIRN  417

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQA+YVLGDN MK+SYLVGYG NYP+ VHHRGASIP DA TGCK GF++L S+ PNP
Sbjct  418  FAISQANYVLGDNTMKLSYLVGYGSNYPQQVHHRGASIPADAKTGCK-GFEYLHSSSPNP  476

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA+G +VGGPF N+T++D R+N++Q E +TYNS   VGLL+GL
Sbjct  477  NVAMGAVVGGPFQNDTFVDLRDNAVQTESSTYNSGTFVGLLAGL  520



>ref|XP_010416457.1| PREDICTED: endoglucanase 10-like [Camelina sativa]
Length=525

 Score =   241 bits (614),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT+SRT+ GLVW+S+WN++Q  V+SAFLA ++SDYML+SR  KI+CDGK +  ++LR 
Sbjct  351  PTATASRTNGGLVWVSEWNSMQQSVSSAFLASLFSDYMLTSRIHKISCDGKIFKATELRD  410

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NP+  S++VGYGD YP++VHHRGASIPTDATTGC DGFKW  ST+PNP
Sbjct  411  FAKSQADYMLGKNPLGTSFVVGYGDKYPEFVHHRGASIPTDATTGCLDGFKWFNSTKPNP  470

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  247
            N+A G LVGGPF NET+ DSR N MQ EPTTYN+A
Sbjct  471  NIAYGALVGGPFFNETFTDSRENPMQNEPTTYNNA  505



>ref|XP_010428595.1| PREDICTED: endoglucanase 10-like [Camelina sativa]
Length=525

 Score =   240 bits (612),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT+SRT+ GLVW+S+WN+LQ  V+SAFLA ++SDYML+SR  KI+CDGK +  ++LR 
Sbjct  351  PTATASRTNGGLVWVSEWNSLQQSVSSAFLASLFSDYMLTSRIHKISCDGKIFKATELRD  410

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NP+  S++VGYGD YP++VHHRGASIP DATTGC DGFKW  ST+PNP
Sbjct  411  FAKSQADYMLGKNPLGTSFVVGYGDKYPEFVHHRGASIPADATTGCLDGFKWFNSTKPNP  470

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  247
            N+A G LVGGPF NET+ DSR N MQ EPTTYN+A
Sbjct  471  NIAYGALVGGPFFNETFTDSRENPMQNEPTTYNNA  505



>ref|XP_006302134.1| hypothetical protein CARUB_v10020139mg [Capsella rubella]
 gb|EOA35032.1| hypothetical protein CARUB_v10020139mg [Capsella rubella]
Length=525

 Score =   240 bits (612),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT+SRT+ GL+W+S+WN++Q  V+SAFLA ++SDYML+SR  KI+CDGK +  ++LR 
Sbjct  351  PTATASRTNGGLIWVSEWNSMQQSVSSAFLASLFSDYMLTSRIHKISCDGKIFKATELRD  410

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NP+  S++VGYGD YP++VHHRGASIP DATTGC DGFKW  ST+PNP
Sbjct  411  FAKSQADYMLGKNPLGTSFVVGYGDKYPQFVHHRGASIPADATTGCLDGFKWFNSTKPNP  470

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  247
            N+A G LVGGPFLNET+ DSR N MQ EPTTYN+A
Sbjct  471  NIAYGALVGGPFLNETFTDSRENPMQNEPTTYNNA  505



>ref|XP_009803640.1| PREDICTED: endoglucanase 2-like [Nicotiana sylvestris]
Length=527

 Score =   240 bits (612),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTATS RT  GLVW++QWN LQ+ VAS+FLAVVYSDYML S+T+ + C G+ Y P++LR 
Sbjct  351  PTATSQRTADGLVWVNQWNPLQYSVASSFLAVVYSDYMLCSQTSNLYCSGELYEPTELRN  410

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQ DY+LG+N M++SYLVGYG  YP+ VHHRGASIP D  + C DGFKWL + +PNP
Sbjct  411  FAVSQLDYILGNNRMEISYLVGYGSRYPQQVHHRGASIPVDDNSNCSDGFKWLHTREPNP  470

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVAVG LVGGP L++TY+D RNN  Q+E TTYNSA+IVGL+SGL
Sbjct  471  NVAVGALVGGPSLSDTYMDFRNNISQSETTTYNSALIVGLISGL  514



>ref|XP_003578508.1| PREDICTED: endoglucanase 24 [Brachypodium distachyon]
Length=529

 Score =   239 bits (611),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P+AT SRT  GLVWIS WN++QH   S FLA VYSDYML+S+TA + C GKY++P+D+R 
Sbjct  356  PSATGSRTSGGLVWISGWNSIQHGTNSGFLASVYSDYMLTSQTAAVQCSGKYFSPTDIRN  415

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA+SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGASIP DA TGCK GF++L S+ PNP
Sbjct  416  FAISQANYILGDNPMKLSYLVGYGSSYPQQVHHRGASIPADAKTGCK-GFEYLHSSSPNP  474

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NVA+G LVGGPF N++++DSR+N++Q E +TYNS  +VGLL+GL
Sbjct  475  NVAMGALVGGPFQNDSFVDSRDNAVQTESSTYNSGTLVGLLAGL  518



>ref|XP_010471690.1| PREDICTED: endoglucanase 10 [Camelina sativa]
Length=525

 Score =   239 bits (611),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT+SRT+ GLVW+S+WN++Q  V+SAFLA ++SDYML+SR  KI+CDGK +  ++LR 
Sbjct  351  PTATASRTNGGLVWVSEWNSMQQSVSSAFLASLFSDYMLTSRIHKISCDGKIFKATELRD  410

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NP+  S++VGYGD YP++VHHRGASIP DATTGC DGFKW  ST+PNP
Sbjct  411  FAKSQADYMLGKNPLGTSFVVGYGDKYPEFVHHRGASIPADATTGCLDGFKWFNSTKPNP  470

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  247
            N+A G LVGGPF NET+ DSR N MQ EPTTYN+A
Sbjct  471  NIAYGALVGGPFFNETFTDSRENPMQNEPTTYNNA  505



>ref|XP_002889037.1| hypothetical protein ARALYDRAFT_895440 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65296.1| hypothetical protein ARALYDRAFT_895440 [Arabidopsis lyrata subsp. 
lyrata]
Length=525

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT+SRT+ GL+W+S+WN++Q  V+SAFLA ++SDYML+SR  KI+CDGK +  ++LR 
Sbjct  351  PTATASRTNGGLIWVSEWNSMQQSVSSAFLASLFSDYMLTSRIHKISCDGKIFKATELRD  410

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NP+  S++VGYGD YP++VHHRGASIP DATTGC DGFKW  ST+PNP
Sbjct  411  FAKSQADYMLGKNPLGTSFVVGYGDKYPQFVHHRGASIPADATTGCLDGFKWFNSTKPNP  470

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  247
            N+A G LVGGPF NET+ DSR N MQ EPTTYN+A
Sbjct  471  NIAYGALVGGPFFNETFTDSRENPMQNEPTTYNNA  505



>emb|CDY39048.1| BnaA02g17370D [Brassica napus]
Length=526

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT+SR++ GLV +S+WNALQ  V++AFLA ++SDYML+SR  KI+C+GK +  ++LR 
Sbjct  352  PTATTSRSNGGLVLVSEWNALQQSVSAAFLASLFSDYMLTSRLHKISCNGKIFKATELRD  411

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NPM MS++VGYGD YP+Y+HHRGASIP DATTGC DGF++  ST+PNP
Sbjct  412  FAKSQADYILGKNPMGMSFVVGYGDKYPEYIHHRGASIPEDATTGCLDGFEYFNSTKPNP  471

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            N+A G LV GPFLNET+ D+R+N  Q EPTTYN+A++VGL+S L
Sbjct  472  NIAYGALVRGPFLNETFRDARDNVRQNEPTTYNNALLVGLMSSL  515



>ref|XP_002530743.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF31649.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=414

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 133/167 (80%), Gaps = 3/167 (2%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTP---SD  541
            PTATSSRT++GL+W+ +WN LQ+ VASAFLAV++SDYM++S    + C G++Y     + 
Sbjct  239  PTATSSRTENGLIWVLKWNPLQYAVASAFLAVLFSDYMVASHIPTLYCSGQFYRQMIFAA  298

Query  540  LRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQ  361
            LR     QADYVLG NPM+MS+LVGYG N+P+YVHHRG+SIP DA TGCKDGF WL S  
Sbjct  299  LRFRRCFQADYVLGKNPMEMSFLVGYGLNFPRYVHHRGSSIPVDARTGCKDGFMWLHSQN  358

Query  360  PNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            PNPNV VG LVGGPFLNETY+DSRNN+  AEPTTY+SA+ VGLLS L
Sbjct  359  PNPNVPVGALVGGPFLNETYVDSRNNTDIAEPTTYSSALFVGLLSAL  405



>ref|NP_177697.1| glycosyl hydrolase 9B7 [Arabidopsis thaliana]
 sp|Q8LCP6.2|GUN10_ARATH RecName: Full=Endoglucanase 10; AltName: Full=Endo-1,4-beta glucanase 
10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF87112.1|AC006434_8 F10A5.13 [Arabidopsis thaliana]
 gb|AAK64042.1| putative endo-beta-1,4-glucanase [Arabidopsis thaliana]
 gb|AAN12892.1| putative endo-beta-1,4-glucanase [Arabidopsis thaliana]
 gb|AEE35745.1| glycosyl hydrolase 9B7 [Arabidopsis thaliana]
Length=525

 Score =   238 bits (606),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PT+T+SRT+ GL+W+S+WN++Q  V+SAFLA ++SDYML+SR  KI+CDGK +  ++LR 
Sbjct  351  PTSTASRTNGGLIWVSEWNSMQQSVSSAFLASLFSDYMLTSRIHKISCDGKIFKATELRD  410

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NP+  S++VGYGD YP++VHHRGASIP DATTGC DGFKW  ST+PNP
Sbjct  411  FAKSQADYMLGKNPLGTSFVVGYGDKYPQFVHHRGASIPADATTGCLDGFKWFNSTKPNP  470

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  247
            N+A G LVGGPF NET+ DSR N MQ EPTTYN+A
Sbjct  471  NIAYGALVGGPFFNETFTDSRENPMQNEPTTYNNA  505



>gb|AAM63477.1| endo-beta-1,4-glucanase, putative [Arabidopsis thaliana]
Length=525

 Score =   238 bits (606),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PT+T+SRT+ GL+W+S+WN++Q  V+SAFLA ++SDYML+SR  KI+CDGK +  ++LR 
Sbjct  351  PTSTASRTNGGLIWVSEWNSMQQSVSSAFLASLFSDYMLTSRIHKISCDGKIFKATELRD  410

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NP+  S++VGYGD YP++VHHRGASIP DATTGC DGFKW  ST+PNP
Sbjct  411  FAKSQADYMLGKNPLGTSFVVGYGDKYPQFVHHRGASIPADATTGCLDGFKWFNSTKPNP  470

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  247
            N+A G LVGGPF NET+ DSR N MQ EPTTYN+A
Sbjct  471  NIAYGALVGGPFFNETFTDSRENPMQNEPTTYNNA  505



>ref|XP_010530451.1| PREDICTED: endoglucanase 2-like [Tarenaya hassleriana]
Length=501

 Score =   237 bits (604),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 131/156 (84%), Gaps = 1/156 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAK-ITCDGKYYTPSDLR  535
            PTA+ SRT SGL+W+S+WNALQ  VASAFLA +Y+DY++SS + + + C G+ + PS+L+
Sbjct  336  PTASPSRTQSGLIWVSEWNALQEAVASAFLASLYADYIISSPSDQTLLCGGQSFDPSELK  395

Query  534  KFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPN  355
             FA SQ DYVLG NPM MSYLVGYGD+YP+ VHHRGASIP +ATTGC DGF WL S +PN
Sbjct  396  SFAKSQVDYVLGQNPMNMSYLVGYGDSYPRQVHHRGASIPANATTGCTDGFVWLMSEEPN  455

Query  354  PNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  247
            PNVAVG LVGGPFLNETY+D RNN+MQAEPTTYN+A
Sbjct  456  PNVAVGALVGGPFLNETYVDDRNNTMQAEPTTYNTA  491



>gb|ABK24648.1| unknown [Picea sitchensis]
Length=532

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 129/166 (78%), Gaps = 2/166 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PT+  +RT+ GL+WI+QWNA+QH V SA L ++YSDY+L+SR   I C  K + P DLRK
Sbjct  356  PTSAPNRTEGGLIWITQWNAIQHSVNSALLTLIYSDYLLTSRVENIKCGDKDFAPEDLRK  415

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT--GCKDGFKWLESTQP  358
            FA SQ DY+LG+NPMKMSYLVG+G NYPK VHHRGASIP DA+T   C  GF W +S  P
Sbjct  416  FAFSQVDYILGENPMKMSYLVGFGGNYPKQVHHRGASIPADASTVYDCNSGFVWFKSKSP  475

Query  357  NPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NPNV  G LVGGPFLN+++ID R+N MQ EP+TYNSA +VGLLSGL
Sbjct  476  NPNVVTGALVGGPFLNDSFIDIRSNPMQNEPSTYNSAALVGLLSGL  521



>ref|XP_003563568.1| PREDICTED: endoglucanase 18-like [Brachypodium distachyon]
Length=516

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 133/158 (84%), Gaps = 1/158 (1%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            RT+ GL++++ WN+LQHPVASAFLA VYSDYML+S   +++C  + ++P+DLRKFA SQA
Sbjct  349  RTEGGLLYVADWNSLQHPVASAFLAAVYSDYMLTSGKTELSCGSQTFSPADLRKFAKSQA  408

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGG  334
            DYVLG+NPMK+SYLVGYGD+YP+ VHHRGASIP D  TGC  G +WLES +PNPNVA G 
Sbjct  409  DYVLGENPMKVSYLVGYGDSYPQQVHHRGASIPADVDTGCG-GQEWLESPEPNPNVATGA  467

Query  333  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            LVGGPF N++++D R+N MQ E TTYNSA+IVGLLSG+
Sbjct  468  LVGGPFRNDSFVDKRDNVMQNEATTYNSALIVGLLSGI  505



>gb|EAZ38281.1| hypothetical protein OsJ_22659 [Oryza sativa Japonica Group]
Length=494

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 132/158 (84%), Gaps = 1/158 (1%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            RT+ GL+++++WN+LQHPVASAFLA VYSDYM SS   +++C G+ ++P+DLRKFA SQA
Sbjct  327  RTEGGLLYVAEWNSLQHPVASAFLAAVYSDYMQSSGKTELSCSGQGFSPADLRKFAKSQA  386

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGG  334
            DY+LG NPMK+SYLVGYGD YP+ VHHRGASIP D  TGC DG KWLE+++PNPNVA G 
Sbjct  387  DYLLGSNPMKISYLVGYGDRYPEKVHHRGASIPEDVDTGC-DGHKWLETSKPNPNVATGA  445

Query  333  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            LVGGP+ N++++D R+N MQ E TTYNSA++ GLLS L
Sbjct  446  LVGGPYKNDSFVDERDNVMQNEATTYNSALVAGLLSAL  483



>ref|NP_001058583.1| Os06g0715300 [Oryza sativa Japonica Group]
 sp|Q5Z9P8.1|GUN18_ORYSJ RecName: Full=Endoglucanase 18; AltName: Full=Endo-1,4-beta glucanase 
18 [Oryza sativa Japonica Group]
 dbj|BAD53575.1| putative endo-beta-1,4-D-glucanase [Oryza sativa Japonica Group]
 dbj|BAF20497.1| Os06g0715300 [Oryza sativa Japonica Group]
Length=518

 Score =   233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 132/158 (84%), Gaps = 1/158 (1%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            RT+ GL+++++WN+LQHPVASAFLA VYSDYM SS   +++C G+ ++P+DLRKFA SQA
Sbjct  351  RTEGGLLYVAEWNSLQHPVASAFLAAVYSDYMQSSGKTELSCSGQGFSPADLRKFAKSQA  410

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGG  334
            DY+LG NPMK+SYLVGYGD YP+ VHHRGASIP D  TGC DG KWLE+++PNPNVA G 
Sbjct  411  DYLLGSNPMKISYLVGYGDRYPEKVHHRGASIPEDVDTGC-DGHKWLETSKPNPNVATGA  469

Query  333  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            LVGGP+ N++++D R+N MQ E TTYNSA++ GLLS L
Sbjct  470  LVGGPYKNDSFVDERDNVMQNEATTYNSALVAGLLSAL  507



>gb|EAZ02358.1| hypothetical protein OsI_24462 [Oryza sativa Indica Group]
Length=518

 Score =   233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 132/158 (84%), Gaps = 1/158 (1%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            RT+ GL+++++WN+LQHPVASAFLA VYSDYM SS   +++C G+ ++P+DLRKFA SQA
Sbjct  351  RTEGGLLYVAEWNSLQHPVASAFLAAVYSDYMQSSGKTELSCSGQGFSPADLRKFAKSQA  410

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGG  334
            DY+LG NPMK+SYLVGYGD YP+ VHHRGASIP D  TGC DG KWLE+++PNPNVA G 
Sbjct  411  DYLLGSNPMKISYLVGYGDRYPEKVHHRGASIPEDVDTGC-DGHKWLETSKPNPNVATGA  469

Query  333  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            LVGGP+ N++++D R+N MQ E TTYNSA++ GLLS L
Sbjct  470  LVGGPYKNDSFVDERDNVMQNEATTYNSALVAGLLSAL  507



>emb|CDY47506.1| BnaAnng09040D [Brassica napus]
Length=499

 Score =   228 bits (582),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT SR++SGLV +S WN LQ  V++AFLA ++SDYML+SR  KI+C+GK +  ++LR 
Sbjct  325  PTATGSRSNSGLVLVSDWNPLQQSVSAAFLASLFSDYMLTSRIHKISCNGKIFKATELRD  384

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NPM MS++VGYGD YP+Y+HHRGASIP DATTGC DGFK+  ST+PNP
Sbjct  385  FAKSQADYILGKNPMGMSFVVGYGDKYPEYIHHRGASIPADATTGCLDGFKYFNSTKPNP  444

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  247
            N+A G LVGGP+LNET+ DSR N  Q EPTTYN+A
Sbjct  445  NIAYGALVGGPYLNETFSDSRENVRQNEPTTYNNA  479



>dbj|BAK04397.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=519

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 126/152 (83%), Gaps = 1/152 (1%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            RT  GL+++++WN+LQHPVASAFLA VY DYML+S   ++TC G+ ++P+DLRKFA SQA
Sbjct  351  RTQGGLLYVAEWNSLQHPVASAFLAAVYGDYMLTSGKTELTCGGQSFSPADLRKFAQSQA  410

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGG  334
            DYVLGDNPMK+SYLVGYGD+YP+ VHHRGASIP+D  TGC  G +WLES  PNPNVA G 
Sbjct  411  DYVLGDNPMKLSYLVGYGDSYPQRVHHRGASIPSDVNTGCG-GQEWLESPDPNPNVATGA  469

Query  333  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIV  238
            LVGGPF N++++D R N MQ E TTYNSA+IV
Sbjct  470  LVGGPFKNDSFVDERQNVMQNEATTYNSALIV  501



>ref|XP_006656489.1| PREDICTED: endoglucanase 18-like [Oryza brachyantha]
Length=519

 Score =   227 bits (578),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 127/153 (83%), Gaps = 1/153 (1%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            RT+ GL+++++WN+LQHPVASAFLA VYSDYML+S   +++C G+ ++P+DLRKFA SQA
Sbjct  352  RTEGGLLYVAEWNSLQHPVASAFLAAVYSDYMLTSGKTELSCGGQSFSPADLRKFAKSQA  411

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGG  334
            DYVLG NPMK+SYLVGYGD YP+ VHHRGASIP D  TGC DG KWLES++ NPNVA G 
Sbjct  412  DYVLGSNPMKISYLVGYGDRYPQRVHHRGASIPADVDTGC-DGHKWLESSKDNPNVATGA  470

Query  333  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  235
            LVGGPF N+T+ D R+N MQ E TTYNSA++ G
Sbjct  471  LVGGPFKNDTFSDKRDNVMQNEATTYNSALVAG  503



>gb|EMS54236.1| Endoglucanase 18 [Triticum urartu]
Length=485

 Score =   226 bits (576),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 125/152 (82%), Gaps = 1/152 (1%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            RT+ GL++++ WN+LQHPVASAFLA VY DYML+S   ++TC G+ ++P+DLRKFA SQA
Sbjct  317  RTEGGLLYVADWNSLQHPVASAFLAAVYGDYMLTSGKTELTCGGQSFSPADLRKFAQSQA  376

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGG  334
            DYVLGDNPMK+SYLVGYGD+YP+ VHHRGASIP D  TGC  G +WLES  PNPNVA G 
Sbjct  377  DYVLGDNPMKLSYLVGYGDSYPQRVHHRGASIPADVNTGCG-GQEWLESPDPNPNVAAGA  435

Query  333  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIV  238
            LVGGPF N++++D R N MQ E TTYNSA+IV
Sbjct  436  LVGGPFKNDSFVDERQNVMQNEATTYNSALIV  467



>ref|XP_009106216.1| PREDICTED: endoglucanase 10-like [Brassica rapa]
Length=527

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT SR++SGLV +S WN LQ  V++AFLA ++SDYML+SR  KI+C+GK +  ++LR 
Sbjct  353  PTATGSRSNSGLVLVSDWNPLQQSVSAAFLASLFSDYMLTSRIHKISCNGKIFKATELRD  412

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG NPM MS++VGYGD YP+Y+HHRGASIP DATTGC D FK+  ST+PNP
Sbjct  413  FAKSQADYILGKNPMGMSFVVGYGDKYPEYIHHRGASIPADATTGCLDEFKYFNSTKPNP  472

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  247
            N+A G LVGGP+LNET+ DSR N  Q EPTTYN+A
Sbjct  473  NIAYGALVGGPYLNETFSDSRENVRQNEPTTYNNA  507



>emb|CDX73186.1| BnaC06g36340D [Brassica napus]
Length=527

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT+SR++SGLV +S WN LQ  V++AFLA ++SDYML+SR  KI+C+GK +  ++LR 
Sbjct  353  PTATTSRSNSGLVLVSDWNPLQQSVSAAFLASLFSDYMLTSRIHKISCNGKIFKATELRD  412

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG N M MS++VGYGD YP+++HHRGASIP DATTGC DGFK+  ST+PNP
Sbjct  413  FAKSQADYILGKNSMGMSFVVGYGDKYPEFIHHRGASIPADATTGCLDGFKYFNSTKPNP  472

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  247
            N+A G LVGGP+LNET+ DSR N  Q EPTTYN+A
Sbjct  473  NIAYGALVGGPYLNETFSDSRENVRQNEPTTYNNA  507



>ref|XP_002439027.1| hypothetical protein SORBIDRAFT_10g030140 [Sorghum bicolor]
 gb|EER90394.1| hypothetical protein SORBIDRAFT_10g030140 [Sorghum bicolor]
Length=522

 Score =   224 bits (571),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 126/153 (82%), Gaps = 1/153 (1%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            RT+ GL+++++W++LQHPVASAFLA VYS+YM +S  +++TC GK +T  DLRKFA SQA
Sbjct  355  RTEGGLLYVAEWDSLQHPVASAFLANVYSNYMATSGKSELTCSGKSFTALDLRKFAKSQA  414

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGG  334
            DYVLGDNPMK+SYLVG+GD YP+ VHHRGASIP D  TGC DG KWL+S  PNPNVA G 
Sbjct  415  DYVLGDNPMKLSYLVGFGDTYPQRVHHRGASIPADVDTGC-DGQKWLKSPDPNPNVATGA  473

Query  333  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  235
            LVGGPF N++++D R N  Q EPTTYNSA++VG
Sbjct  474  LVGGPFKNDSFVDDRENVQQNEPTTYNSALVVG  506



>ref|XP_004966453.1| PREDICTED: endoglucanase 18-like [Setaria italica]
Length=521

 Score =   222 bits (566),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 125/151 (83%), Gaps = 1/151 (1%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            RT+ GL+++++WN+LQHPVASAFLA VYSDYM +S   ++TC GK +T +DLRKFA SQA
Sbjct  354  RTEGGLLYVAEWNSLQHPVASAFLAAVYSDYMSTSGKTELTCSGKSFTAADLRKFAKSQA  413

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGG  334
            DYVLGDNPMK+SYLVG+GD+YP+ VHHRGASIP D  TGC DG +WL+S +PNPNVA G 
Sbjct  414  DYVLGDNPMKLSYLVGFGDSYPQRVHHRGASIPADVDTGC-DGQEWLKSPKPNPNVATGA  472

Query  333  LVGGPFLNETYIDSRNNSMQAEPTTYNSAII  241
            LVGGPF N+++ID R N  Q E TTYNSA+I
Sbjct  473  LVGGPFKNDSFIDDRENVRQNEATTYNSALI  503



>ref|NP_001066668.2| Os12g0428200 [Oryza sativa Japonica Group]
 dbj|BAF29687.2| Os12g0428200 [Oryza sativa Japonica Group]
Length=471

 Score =   218 bits (554),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = -3

Query  690  TDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQAD  511
            T  GL+++++WN+LQHPVASAFLA VYSDYM SSR  ++TC G+ ++PSDLRKFA SQAD
Sbjct  198  TKGGLLYVAEWNSLQHPVASAFLAAVYSDYMQSSRKTELTCSGQGFSPSDLRKFAKSQAD  257

Query  510  YVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGL  331
            Y+LG NPMK+SYLVGYGD YP+ VHHRG SIP +  TGC D  KWLE+++PNPNV    L
Sbjct  258  YLLGSNPMKISYLVGYGDRYPERVHHRGISIPENVDTGC-DSHKWLETSKPNPNVTTDAL  316

Query  330  VGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            VGG + N +++D R+N M  E TTYN A++ GLLS L
Sbjct  317  VGGLYKNNSFVDERDNVMHNEATTYNCALVAGLLSAL  353



>emb|CDP04111.1| unnamed protein product [Coffea canephora]
Length=138

 Score =   206 bits (524),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = -3

Query  600  MLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGAS  421
            M  S T  + C+G  Y P DLR FA+SQA+YVLG NPMKMSYLVGY  +YPKYVHHRGAS
Sbjct  1    MFWSGTPTLYCNGDQYEPMDLRSFAISQANYVLGSNPMKMSYLVGYSSDYPKYVHHRGAS  60

Query  420  IPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAII  241
            IP DA TGCKDGFKWL S  PNPN+A G LVGGPFLN+TYIDSRNNS+QAEPTTYNSA I
Sbjct  61   IPADANTGCKDGFKWLRSPSPNPNIATGALVGGPFLNDTYIDSRNNSIQAEPTTYNSAFI  120

Query  240  VGLLSGL  220
            VGLLSGL
Sbjct  121  VGLLSGL  127



>ref|XP_002961546.1| hypothetical protein SELMODRAFT_77612 [Selaginella moellendorffii]
 gb|EFJ36806.1| hypothetical protein SELMODRAFT_77612 [Selaginella moellendorffii]
Length=562

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 124/164 (76%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTA+++R+  GL+W+SQ NA+QH V SAFLAVVY+DY+ SS   +  C G  +   DLR 
Sbjct  388  PTASTNRSTGGLLWVSQRNAVQHAVGSAFLAVVYADYLSSSGVKQFRCSGNSFAAKDLRA  447

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG+NPM  SYLVGYG N+P+ +HHR ASIP DA TGCKDGF+WL ++ PNP
Sbjct  448  FAASQADYILGENPMSKSYLVGYGANFPQQLHHREASIPLDAATGCKDGFRWLHASAPNP  507

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            +VA G LVGGPF N++Y D R+N+MQ E TTYNSA +  LL  L
Sbjct  508  HVATGALVGGPFQNDSYSDLRDNTMQNEATTYNSAAMSALLVAL  551



>ref|NP_001288527.1| uncharacterized protein LOC103626453 precursor [Zea mays]
 gb|AFW69494.1| hypothetical protein ZEAMMB73_138975 [Zea mays]
 gb|AGG19095.1| cellulase [Zea mays]
Length=521

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 123/149 (83%), Gaps = 1/149 (1%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            RT+ GL+++++WN+LQHPVASAFLA VYS+YM +S  +++TC GK +T  DLR+FA SQA
Sbjct  354  RTEGGLLYVAEWNSLQHPVASAFLANVYSNYMATSGKSELTCSGKSFTALDLRRFAKSQA  413

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGG  334
            DYVLGDNPMK+SYLVG+GD+YP+ VHHRGASIP    TGC DG +WL+S +PNPNVA G 
Sbjct  414  DYVLGDNPMKLSYLVGFGDSYPQRVHHRGASIPAGVDTGC-DGQEWLKSPEPNPNVATGA  472

Query  333  LVGGPFLNETYIDSRNNSMQAEPTTYNSA  247
            LVGGPF N++++D R N  Q EPTTYNSA
Sbjct  473  LVGGPFKNDSFVDDRENVQQNEPTTYNSA  501



>ref|XP_002971269.1| hypothetical protein SELMODRAFT_94888 [Selaginella moellendorffii]
 gb|EFJ27867.1| hypothetical protein SELMODRAFT_94888 [Selaginella moellendorffii]
Length=561

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 124/164 (76%), Gaps = 0/164 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTA+++R+  GL+W+SQ NA+QH V SAFLAVVY+DY+ SS   +  C G  +   DLR 
Sbjct  387  PTASTNRSTGGLLWVSQRNAVQHAVGSAFLAVVYADYLSSSGVKQFRCSGNSFAAKDLRA  446

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNP  352
            FA SQADY+LG+NPM  SYLVGYG N+P+ +HHR ASIP DA TGCKDGF+WL ++ PNP
Sbjct  447  FAASQADYILGENPMSKSYLVGYGANFPQQLHHREASIPLDAATGCKDGFRWLHASAPNP  506

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            +VA G LVGGPF N++Y D R+N+MQ E TTYNSA +  LL  L
Sbjct  507  HVATGALVGGPFQNDSYSDLRDNTMQNEATTYNSAAMSALLVAL  550



>gb|ABA97969.1| Glycosyl hydrolase family 9 protein, expressed [Oryza sativa 
Japonica Group]
Length=694

 Score =   216 bits (551),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = -3

Query  690  TDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQAD  511
            T  GL+++++WN+LQHPVASAFLA VYSDYM SSR  ++TC G+ ++PSDLRKFA SQAD
Sbjct  376  TKGGLLYVAEWNSLQHPVASAFLAAVYSDYMQSSRKTELTCSGQGFSPSDLRKFAKSQAD  435

Query  510  YVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGL  331
            Y+LG NPMK+SYLVGYGD YP+ VHHRG SIP +  TGC D  KWLE+++PNPNV    L
Sbjct  436  YLLGSNPMKISYLVGYGDRYPERVHHRGISIPENVDTGC-DSHKWLETSKPNPNVTTDAL  494

Query  330  VGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            VGG + N +++D R+N M  E TTYN A++ GLLS L
Sbjct  495  VGGLYKNNSFVDERDNVMHNEATTYNCALVAGLLSAL  531



>gb|EAZ20312.1| hypothetical protein OsJ_35923 [Oryza sativa Japonica Group]
Length=392

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 117/149 (79%), Gaps = 1/149 (1%)
 Frame = -3

Query  690  TDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQAD  511
            T  GL+++++WN+LQHPVASAFLA VYSDYM SSR  ++TC G+ ++PSDLRKFA SQAD
Sbjct  198  TKGGLLYVAEWNSLQHPVASAFLAAVYSDYMQSSRKTELTCSGQGFSPSDLRKFAKSQAD  257

Query  510  YVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQPNPNVAVGGL  331
            Y+LG NPMK+SYLVGYGD YP+ VHHRG SIP +  TGC D  KWLE+++PNPNV    L
Sbjct  258  YLLGSNPMKISYLVGYGDRYPERVHHRGISIPENVDTGC-DSHKWLETSKPNPNVTTDAL  316

Query  330  VGGPFLNETYIDSRNNSMQAEPTTYNSAI  244
            VGG + N +++D R+N M  E TTYN A+
Sbjct  317  VGGLYKNNSFVDERDNVMHNEATTYNCAL  345



>ref|XP_001763275.1| predicted protein [Physcomitrella patens]
 gb|EDQ71805.1| predicted protein [Physcomitrella patens]
Length=475

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 121/165 (73%), Gaps = 1/165 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTA+  RT  G++WI QW+ALQH + SA LA  YSDY+ +++   I+C G  +TP++LR 
Sbjct  298  PTASKDRTKGGMLWIEQWSALQHGINSALLATFYSDYLSAAQLPGISCSGISFTPAELRS  357

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT-GCKDGFKWLESTQPN  355
            FA SQADYVLG NP+  S++VGYG  YP+ +HHRGASIP + T   CK GF W +STQPN
Sbjct  358  FAASQADYVLGANPLSTSFMVGYGAEYPQKLHHRGASIPVNPTVYDCKGGFIWFDSTQPN  417

Query  354  PNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            PN+A G +VGGPF NETY D+R+N +Q E +T+NSA +  L +GL
Sbjct  418  PNIAHGAIVGGPFKNETYSDTRDNILQNEASTHNSAAMASLTAGL  462



>ref|XP_001781646.1| predicted protein [Physcomitrella patens]
 gb|EDQ53532.1| predicted protein [Physcomitrella patens]
Length=474

 Score =   196 bits (499),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 121/165 (73%), Gaps = 1/165 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTA++ RT  G +W+++W+ALQH + SA LA  YSDY+++++++ ITC GK +T + LR 
Sbjct  297  PTASTDRTKGGYIWLNEWSALQHGINSALLASFYSDYLVAAKSSGITCSGKSFTHAQLRA  356

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT-TGCKDGFKWLESTQPN  355
            FA SQA+YVLG+NP+  S++VGYG+ +PKY+HHRGASIP D   T C   + W +S +PN
Sbjct  357  FASSQANYVLGNNPLSTSFMVGYGEKHPKYLHHRGASIPVDQIKTDCAHSWGWYDSKEPN  416

Query  354  PNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            PN+A G +VGGPF NETY D+R N MQ E + Y SA   GL +GL
Sbjct  417  PNIAYGAVVGGPFKNETYTDARTNIMQNEASVYTSAAFAGLSAGL  461



>gb|KHN34290.1| Endoglucanase 24 [Glycine soja]
Length=516

 Score =   195 bits (495),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 106/131 (81%), Gaps = 2/131 (2%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PTAT++RT+SGL+W+  WN+LQ  VAS FLAV+Y DYML+S+T  + C GK Y P DLRK
Sbjct  372  PTATTNRTESGLIWVVPWNSLQLSVASVFLAVLYRDYMLTSQTEILYCSGKLYKPVDLRK  431

Query  531  FAMSQ--ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKWLESTQP  358
            F++SQ  ADYVLG+NPMKMSYLVGYG  YPKY+HHRG+SI  +ATTGCKDGFKW ES  P
Sbjct  432  FSISQFQADYVLGENPMKMSYLVGYGTQYPKYLHHRGSSIAVNATTGCKDGFKWFESPHP  491

Query  357  NPNVAVGGLVG  325
            NPNVA G L+ 
Sbjct  492  NPNVAFGALIA  502



>ref|XP_002966695.1| hypothetical protein SELMODRAFT_144066 [Selaginella moellendorffii]
 gb|EFJ32722.1| hypothetical protein SELMODRAFT_144066 [Selaginella moellendorffii]
Length=472

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 122/165 (74%), Gaps = 1/165 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PT +++RT +G++W+SQWN++QH V SAFL+ +Y+DY+ S+    ++C GK +    LR+
Sbjct  293  PTTSTNRTRAGMIWVSQWNSIQHAVNSAFLSCLYADYLSSAGITTLSCSGKIFQVEHLRE  352

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIP-TDATTGCKDGFKWLESTQPN  355
             A  QADY+LG NPM MSY+VGYG  YP  +HHR ASIP T +   CK+GF++L ++ PN
Sbjct  353  LAGFQADYILGKNPMGMSYVVGYGKKYPLRLHHRAASIPSTLSEVECKEGFQYLHTSTPN  412

Query  354  PNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            PN+A G LVGGPF N++++D R+NSMQ E T+YNSA +  L++ L
Sbjct  413  PNIAEGALVGGPFQNDSFVDDRDNSMQNEATSYNSAGLAALMASL  457



>ref|XP_002978046.1| hypothetical protein SELMODRAFT_417952 [Selaginella moellendorffii]
 gb|EFJ20703.1| hypothetical protein SELMODRAFT_417952 [Selaginella moellendorffii]
Length=551

 Score =   192 bits (489),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 122/165 (74%), Gaps = 1/165 (1%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            PT +++RT +G++W+SQWN++QH V SAFL+ +Y+DY+ S+    ++C GK +    LR+
Sbjct  372  PTTSTNRTRAGMIWVSQWNSIQHAVNSAFLSCLYADYLSSAGITTLSCSGKIFEVEHLRE  431

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIP-TDATTGCKDGFKWLESTQPN  355
             A  QADY+LG NPM MSY+VGYG  YP  +HHR ASIP T +   CK+GF++L ++ PN
Sbjct  432  LAGFQADYILGKNPMGMSYVVGYGKKYPLRLHHRAASIPSTLSEVECKEGFQYLHTSTPN  491

Query  354  PNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            PN+A G LVGGPF N++++D R+NSMQ E T+YNSA +  L++ L
Sbjct  492  PNIAEGALVGGPFQNDSFVDDRDNSMQNEATSYNSAGLAALMASL  536



>gb|AFN16945.1| cellulase-like protein, partial [Panicum virgatum]
Length=107

 Score =   159 bits (401),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS+RTAK+ C GKYY+P+D+R 
Sbjct  12   PQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTRTAKVQCSGKYYSPTDIRN  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  72   FAASQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16938.1| cellulase-like protein, partial [Panicum virgatum]
Length=107

 Score =   158 bits (400),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C+GKYY+P+D+R 
Sbjct  12   PQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTRTAEVQCNGKYYSPTDIRN  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  72   FAASQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16906.1| cellulase-like protein, partial [Panicum mystasipum]
 gb|AFN16908.1| cellulase-like protein, partial [Panicum olyroides]
 gb|AFN16909.1| cellulase-like protein, partial [Panicum olyroides]
Length=107

 Score =   157 bits (398),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GL+WIS WN+LQH   +AFLA+VYSDYMLS+RTA++ C GKYY+PSD+R 
Sbjct  12   PQATASRTGGGLIWISGWNSLQHATNAAFLALVYSDYMLSTRTAEVQCSGKYYSPSDIRN  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  72   FAASQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16885.1| cellulase-like protein, partial [Panicum chloroleucum]
Length=107

 Score =   157 bits (398),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C GKYY+P+D+R 
Sbjct  12   PQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSARTAEVQCSGKYYSPTDIRN  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  72   FAASQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16859.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16860.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16861.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16862.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16863.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16864.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16865.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16866.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16867.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16868.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16869.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16870.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16871.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16872.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16873.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16874.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16875.1| cellulase-like protein, partial [Panicum amarum var. amarulum]
 gb|AFN16876.1| cellulase-like protein, partial [Panicum amarum var. amarulum]
 gb|AFN16878.1| cellulase-like protein, partial [Panicum amarum var. amarulum]
 gb|AFN16887.1| cellulase-like protein, partial [Panicum chloroleucum]
 gb|AFN16889.1| cellulase-like protein, partial [Panicum chloroleucum]
 gb|AFN16892.1| cellulase-like protein, partial [Panicum chloroleucum]
 gb|AFN16893.1| cellulase-like protein, partial [Panicum chloroleucum]
 gb|AFN16895.1| cellulase-like protein, partial [Panicum chloroleucum]
 gb|AFN16896.1| cellulase-like protein, partial [Panicum virgatum var. cubense]
 gb|AFN16897.1| cellulase-like protein, partial [Panicum virgatum var. cubense]
 gb|AFN16913.1| cellulase-like protein, partial [Panicum racemosum]
 gb|AFN16914.1| cellulase-like protein, partial [Panicum racemosum]
 gb|AFN16915.1| cellulase-like protein, partial [Panicum racemosum]
 gb|AFN16916.1| cellulase-like protein, partial [Panicum racemosum]
 gb|AFN16918.1| cellulase-like protein, partial [Panicum racemosum]
 gb|AFN16924.1| cellulase-like protein, partial [Panicum tricholaenoides]
 gb|AFN16925.1| cellulase-like protein, partial [Panicum tricholaenoides]
 gb|AFN16926.1| cellulase-like protein, partial [Panicum tricholaenoides]
 gb|AFN16927.1| cellulase-like protein, partial [Panicum tricholaenoides]
 gb|AFN16928.1| cellulase-like protein, partial [Panicum tricholaenoides]
 gb|AFN16929.1| cellulase-like protein, partial [Panicum tricholaenoides]
 gb|AFN16930.1| cellulase-like protein, partial [Panicum tricholaenoides]
 gb|AFN16931.1| cellulase-like protein, partial [Panicum tricholaenoides]
 gb|AFN16933.1| cellulase-like protein, partial [Panicum urvilleanum]
 gb|AFN16934.1| cellulase-like protein, partial [Panicum urvilleanum]
 gb|AFN16936.1| cellulase-like protein, partial [Panicum urvilleanum]
 gb|AFN16937.1| cellulase-like protein, partial [Panicum virgatum]
 gb|AFN16939.1| cellulase-like protein, partial [Panicum virgatum]
 gb|AFN16940.1| cellulase-like protein, partial [Panicum virgatum]
 gb|AFN16941.1| cellulase-like protein, partial [Panicum virgatum]
 gb|AFN16942.1| cellulase-like protein, partial [Panicum virgatum]
Length=107

 Score =   157 bits (398),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C GKYY+P+D+R 
Sbjct  12   PQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTRTAEVQCSGKYYSPTDIRN  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  72   FAASQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16911.1| cellulase-like protein, partial [Panicum racemosum]
 gb|AFN16912.1| cellulase-like protein, partial [Panicum racemosum]
Length=107

 Score =   157 bits (397),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C GKYY+P+D+R 
Sbjct  12   PQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTRTAEVQCSGKYYSPTDIRS  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  72   FAASQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16888.1| cellulase-like protein, partial [Panicum chloroleucum]
Length=107

 Score =   157 bits (397),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C GKYY+P+D+R 
Sbjct  12   PQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTRTAEVRCSGKYYSPTDIRN  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  72   FATSQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16884.1| cellulase-like protein, partial [Panicum cervicatum]
 gb|AFN16905.1| cellulase-like protein, partial [Panicum mystasipum]
 gb|AFN16919.1| cellulase-like protein, partial [Panicum rudgei]
Length=107

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GL+WIS WN+LQH   +AFLA+VYSDYMLS+RTA++ C GKYY+P+D+R 
Sbjct  12   PQATASRTGGGLIWISGWNSLQHATNAAFLALVYSDYMLSTRTAEVQCSGKYYSPTDIRN  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  72   FAASQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16886.1| cellulase-like protein, partial [Panicum chloroleucum]
 gb|AFN16890.1| cellulase-like protein, partial [Panicum chloroleucum]
 gb|AFN16935.1| cellulase-like protein, partial [Panicum urvilleanum]
Length=107

 Score =   155 bits (393),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS++TA++ C GKYY+P+D+R 
Sbjct  12   PQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTQTAEVQCSGKYYSPTDIRN  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  72   FAASQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16894.1| cellulase-like protein, partial [Panicum chloroleucum]
Length=107

 Score =   155 bits (393),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS++TA++ C GKYY+P+D+R 
Sbjct  12   PQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTQTAEVQCSGKYYSPTDIRN  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  72   FATSQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16879.1| cellulase-like protein, partial [Panicum aquaticum]
 gb|AFN16882.1| cellulase-like protein, partial [Panicum bergii]
 gb|AFN16901.1| cellulase-like protein, partial [Panicum gouinii]
 gb|AFN16910.1| cellulase-like protein, partial [Panicum pedersenii]
 gb|AFN16923.1| cellulase-like protein, partial [Panicum stramineum]
Length=107

 Score =   155 bits (392),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C GKYY+P+D+R 
Sbjct  12   PQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTRTAEVQCSGKYYSPTDIRN  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGA
Sbjct  72   FAASQANYILGDNPMKLSYLVGYGSSYPQQVHHRGA  107



>gb|AFN16877.1| cellulase-like protein, partial [Panicum amarum var. amarulum]
Length=107

 Score =   155 bits (392),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GL+WIS W++LQH   SAFLA+VYSDYMLS+RTA++ C GKYY+P+D+R 
Sbjct  12   PQATASRTGGGLIWISGWSSLQHATNSAFLALVYSDYMLSTRTAEVQCSGKYYSPTDIRN  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  72   FAASQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16946.1| cellulase-like protein, partial [Panicum virgatum]
Length=107

 Score =   155 bits (391),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GL+WIS WN+LQH    AFLA+VYSDYMLS+RTA++ C GKYY+P+D+R 
Sbjct  12   PQATASRTGGGLIWISGWNSLQHATNPAFLALVYSDYMLSTRTAEVQCSGKYYSPTDIRN  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  72   FAASQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16932.1| cellulase-like protein, partial [Urochloa plantaginea]
Length=107

 Score =   155 bits (391),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P ATSSRT  GL+WIS WN+LQH   +AFL+VVYSDYMLS+RTA + C GKYY+P+D+R 
Sbjct  12   PQATSSRTGGGLIWISGWNSLQHATNAAFLSVVYSDYMLSTRTAAVQCSGKYYSPTDIRN  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGA
Sbjct  72   FAASQANYILGDNPMKLSYLVGYGSSYPQQVHHRGA  107



>gb|AFN16944.1| cellulase-like protein, partial [Panicum virgatum]
Length=107

 Score =   154 bits (390),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C GKYY+P+D+R 
Sbjct  12   PQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTRTAEVQCSGKYYSPTDIRN  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+Y+LGDNPMK+SYLVG G NYP+ VHHRGA
Sbjct  72   FAASQANYILGDNPMKLSYLVGNGSNYPQQVHHRGA  107



>gb|AFN16904.1| cellulase-like protein, partial [Panicum miliaceum]
Length=107

 Score =   154 bits (390),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYM+S+RTA++ C GKYY+P+D+R 
Sbjct  12   PQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMISTRTAEVQCSGKYYSPTDIRN  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGA
Sbjct  72   FAASQANYILGDNPMKLSYLVGYGSSYPQQVHHRGA  107



>gb|AFN16920.1| cellulase-like protein, partial [Setaria palmifolia]
 gb|AFN16921.1| cellulase-like protein, partial [Setaria palmifolia]
Length=107

 Score =   154 bits (390),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GL+WIS WN+LQH   +AFLA+VYSDYMLS+RTA + C GKYY+P+D+R 
Sbjct  12   PQATASRTGGGLIWISGWNSLQHATNAAFLAIVYSDYMLSTRTAAVQCSGKYYSPTDIRN  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+Y+LGDNPMK+SYLVGYG  YP+ VHHRGA
Sbjct  72   FAASQANYILGDNPMKLSYLVGYGSTYPRQVHHRGA  107



>gb|AFN16891.1| cellulase-like protein, partial [Panicum chloroleucum]
Length=107

 Score =   154 bits (390),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C GKYY+P+D+R 
Sbjct  12   PQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTRTAEVQCSGKYYSPTDIRN  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+Y+LGD+PM++SYLVGYG NYP+ VHHRGA
Sbjct  72   FAASQANYILGDSPMRLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16881.1| cellulase-like protein, partial [Panicum bergii]
 gb|AFN16883.1| cellulase-like protein, partial [Panicum capillare]
 gb|AFN16903.1| cellulase-like protein, partial [Panicum miliaceum]
 gb|AFN16907.1| cellulase-like protein, partial [Panicum nephelophilum]
Length=107

 Score =   154 bits (390),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GL+WIS WN+LQH   +AFLA+VYSDYMLS+RTA++ C GKYY+P+D+R 
Sbjct  12   PQATASRTGGGLIWISGWNSLQHATNAAFLALVYSDYMLSTRTAEVQCSGKYYSPTDIRN  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGA
Sbjct  72   FAASQANYILGDNPMKLSYLVGYGSSYPQQVHHRGA  107



>gb|AFN16880.1| cellulase-like protein, partial [Panicum aquaticum]
 gb|AFN16898.1| cellulase-like protein, partial [Panicum dichotomiflorum]
 gb|AFN16899.1| cellulase-like protein, partial [Panicum dichotomiflorum]
Length=107

 Score =   154 bits (389),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS+ TA++ C GKYY+P+D+R 
Sbjct  12   PQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTGTAEVQCSGKYYSPTDIRN  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  72   FAASQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|EPS65630.1| hypothetical protein M569_09145, partial [Genlisea aurea]
Length=483

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 110/164 (67%), Gaps = 6/164 (4%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITC-DGKYYTPSDLRKFAMSQ  517
            +T  GL+++ +WN LQ+  ++AFL   YS Y+   +TA + C DG+   P DL  FA SQ
Sbjct  319  KTPGGLLYVQKWNNLQYTSSAAFLMAAYSGYLSEGKTAVVNCPDGRQLQPLDLLNFARSQ  378

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT----TGCKDGFK-WLESTQPNP  352
            ADY+LG NPM +SYLVGYGD+YP  VHHRGASIP+ +      GC +G++ W  S++ NP
Sbjct  379  ADYILGKNPMSLSYLVGYGDHYPIRVHHRGASIPSTSVLRSAVGCAEGYEVWYGSSKGNP  438

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV  GGLVGGP  N+ + D R+N  Q EPT   +A +VGLLS L
Sbjct  439  NVIFGGLVGGPDENDEFTDERSNYEQNEPTLSGTAPMVGLLSKL  482



>gb|AFN16917.1| cellulase-like protein, partial [Panicum racemosum]
Length=107

 Score =   154 bits (389),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS++ A++ C GKYY+P+D+R 
Sbjct  12   PQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTQAAEVQCSGKYYSPTDIRN  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  72   FAASQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16922.1| cellulase-like protein, partial [Panicum stramineum]
Length=107

 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+ RT  GL+WIS WN+LQH   +AFLA+VYSDYMLS+RTA++ C GKYY+PSD+R 
Sbjct  12   PQATAGRTGGGLIWISGWNSLQHATNAAFLALVYSDYMLSTRTAEVQCSGKYYSPSDIRN  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGA
Sbjct  72   FAASQANYILGDNPMKLSYLVGYGSSYPQQVHHRGA  107



>gb|AFN16900.1| cellulase-like protein, partial [Panicum elephantipes]
Length=107

 Score =   152 bits (385),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GL+WIS WN+LQH   +AFLA+VYSDYMLS++TA++ C GKYY+P+D+R 
Sbjct  12   PQATASRTGGGLIWISGWNSLQHATNAAFLALVYSDYMLSTQTAEVQCSGKYYSPTDIRN  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+Y+LGDNPMK+SYLVGYG  YP+ VHHRGA
Sbjct  72   FAASQANYILGDNPMKLSYLVGYGSTYPQQVHHRGA  107



>gb|AFN16943.1| cellulase-like protein, partial [Panicum virgatum]
Length=107

 Score =   152 bits (384),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C GKYY+P+ +R 
Sbjct  12   PQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTRTAEVQCSGKYYSPTGIRN  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+ +LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  72   FAASQANCILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16902.1| cellulase-like protein, partial [Panicum gouinii]
Length=107

 Score =   152 bits (384),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  711  PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRK  532
            P AT+SRT  GL+WIS WN+LQH   +AFLA+VYSDYMLS++TA++ C GKYY+P+D+R 
Sbjct  12   PQATASRTGGGLIWISGWNSLQHATNAAFLALVYSDYMLSTQTAEVQCSGKYYSPTDIRN  71

Query  531  FAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  424
            FA SQA+Y+LGDNPMK+SYLVGYG  YP+ VHHRGA
Sbjct  72   FAASQANYILGDNPMKLSYLVGYGSAYPQQVHHRGA  107



>gb|KHN38485.1| Endoglucanase 11 [Glycine soja]
Length=514

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 101/162 (62%), Gaps = 6/162 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             RT +GL+++ QWN +Q+   +AFL  +YSD+ L S   K+ C G      ++  FA SQ
Sbjct  331  ERTPAGLIYVRQWNNMQYVSTAAFLLSIYSDF-LQSTNQKLNCHGGTVDHEEILNFAKSQ  389

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNP  352
            ADY+LG NPM MSYLVGYG NYPK VHHRGASI          GC  G+  W  S  PNP
Sbjct  390  ADYILGSNPMNMSYLVGYGPNYPKRVHHRGASIVSYKKNKGFIGCTQGYDNWYGSQAPNP  449

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  226
            NV VG LVGGP   + + D RNN MQ E  TYN+A +VG+ +
Sbjct  450  NVLVGALVGGPDGKDNFEDRRNNFMQTEACTYNTAPLVGVFA  491



>ref|XP_003616918.1| Endoglucanase [Medicago truncatula]
 gb|AES99876.1| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=517

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 99/162 (61%), Gaps = 6/162 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             RT +GL+++ QWN +QH   ++FL  +YSDY L +   K+TC G      ++  FA SQ
Sbjct  334  ERTPAGLLYVRQWNNMQHVSTASFLLTIYSDY-LKNTNQKLTCHGGILDHKEILSFAKSQ  392

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNP  352
             DY+LG NPM MSYLVGYG +YPK VHHRGASI          GC  G+  W     PNP
Sbjct  393  VDYILGSNPMNMSYLVGYGPSYPKRVHHRGASIMSYKENKGFIGCTQGYDNWYSKEDPNP  452

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  226
            NV VG LVGGP   + + D RNN MQ E  TYN+A +V L +
Sbjct  453  NVLVGALVGGPDWQDNFEDKRNNFMQTEACTYNTAPLVALFA  494



>ref|XP_003519454.1| PREDICTED: endoglucanase 11 [Glycine max]
Length=524

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 101/162 (62%), Gaps = 6/162 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             RT +GL+++ QWN +Q+   +AFL  +YSD+ L S   K+ C G      ++  FA SQ
Sbjct  341  ERTPAGLIYVRQWNNMQYVSTAAFLLSIYSDF-LQSTNQKLNCHGGTVDHEEILNFAKSQ  399

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNP  352
            ADY+LG NPM MSYLVGYG NYPK VHHRGASI          GC  G+  W  S  PNP
Sbjct  400  ADYILGSNPMNMSYLVGYGPNYPKRVHHRGASIVSYKKNKGFIGCTQGYDNWYGSQAPNP  459

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  226
            NV VG LVGGP   + + D RNN MQ E  TYN+A +VG+ +
Sbjct  460  NVLVGALVGGPDGKDNFEDRRNNFMQTEACTYNTAPLVGVFA  501



>gb|AFK38997.1| unknown [Medicago truncatula]
Length=517

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 99/162 (61%), Gaps = 6/162 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             RT +GL+++ QWN +QH   ++FL  +YSDY L +   K+TC G      ++  FA SQ
Sbjct  334  ERTPAGLLYVRQWNNMQHVSTASFLFTIYSDY-LKNTNQKLTCHGGILDHKEILSFAKSQ  392

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNP  352
             DY+LG NPM MSYLVGYG +YPK VHHRGASI          GC  G+  W     PNP
Sbjct  393  VDYILGSNPMNMSYLVGYGPSYPKRVHHRGASIMSYKENKGFIGCTQGYDNWYSKEDPNP  452

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  226
            NV VG LVGGP   + + D RNN MQ E  TYN+A +V L +
Sbjct  453  NVLVGALVGGPDWQDNFEDKRNNFMQTEACTYNTAPLVALFA  494



>ref|XP_007215908.1| hypothetical protein PRUPE_ppa004172mg [Prunus persica]
 gb|EMJ17107.1| hypothetical protein PRUPE_ppa004172mg [Prunus persica]
Length=525

 Score =   157 bits (397),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 104/166 (63%), Gaps = 6/166 (4%)
 Frame = -3

Query  708  TATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKF  529
            T    RT +GL++I QWN +Q+   +AFL  VYSD++ SS   K++C G      ++  F
Sbjct  341  TKNVERTPAGLLYIRQWNNMQYVSTAAFLLTVYSDFLKSS-NQKLSCHGGMVGHEEVLDF  399

Query  528  AMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLEST  364
            A SQ DY+LG NPM MSYLVGYG  YP+ VHHRGAS+ +        GC  G+  W    
Sbjct  400  AKSQIDYILGSNPMNMSYLVGYGPKYPQRVHHRGASVESYRENKGFIGCTQGYDNWYGRE  459

Query  363  QPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  226
            +PNPNV VG LVGGP   + ++D R+N MQ E  TYN+A +VG+ +
Sbjct  460  EPNPNVLVGALVGGPDCQDNFVDQRDNYMQTEACTYNTAPLVGVFA  505



>gb|KCW73256.1| hypothetical protein EUGRSUZ_E01717 [Eucalyptus grandis]
Length=475

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 102/163 (63%), Gaps = 6/163 (4%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            +T  GL+W   WN LQ+   +AF+A VY+DY L S+ A I C G   + SDL + A SQA
Sbjct  313  KTPGGLLWFQPWNNLQYTSTAAFIAAVYADY-LDSKKASIQCPGGIASSSDLIELAQSQA  371

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGA---SIPTDAT-TGCKDGFK-WLESTQPNPN  349
            DY+LG+NP K+SY+VGYG NYP  VHHRGA   SI  D T   C  GF  W     PNPN
Sbjct  372  DYILGENPNKLSYMVGYGSNYPTQVHHRGASIVSIKKDPTPVSCSQGFDLWFNKNAPNPN  431

Query  348  VAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            V  G LVGGP   + Y DSR+N   AEP T N+A  VG+L+ L
Sbjct  432  VLDGALVGGPDQQDGYSDSRSNYQMAEPATANTAPFVGVLARL  474



>ref|XP_010058568.1| PREDICTED: endoglucanase 14-like [Eucalyptus grandis]
Length=492

 Score =   156 bits (395),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 102/163 (63%), Gaps = 6/163 (4%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            +T  GL+W   WN LQ+   +AF+A VY+DY L S+ A I C G   + SDL + A SQA
Sbjct  330  KTPGGLLWFQPWNNLQYTSTAAFIAAVYADY-LDSKKASIQCPGGIASSSDLIELAQSQA  388

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGA---SIPTDAT-TGCKDGFK-WLESTQPNPN  349
            DY+LG+NP K+SY+VGYG NYP  VHHRGA   SI  D T   C  GF  W     PNPN
Sbjct  389  DYILGENPNKLSYMVGYGSNYPTQVHHRGASIVSIKKDPTPVSCSQGFDLWFNKNAPNPN  448

Query  348  VAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            V  G LVGGP   + Y DSR+N   AEP T N+A  VG+L+ L
Sbjct  449  VLDGALVGGPDQQDGYSDSRSNYQMAEPATANTAPFVGVLARL  491



>ref|XP_006847867.1| hypothetical protein AMTR_s00029p00087270 [Amborella trichopoda]
 gb|ERN09448.1| hypothetical protein AMTR_s00029p00087270 [Amborella trichopoda]
Length=617

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 104/162 (64%), Gaps = 6/162 (4%)
 Frame = -3

Query  690  TDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQAD  511
            T  GL+++  WN +Q   +SAFL VVYSDY L +  A + C      PS+L  FA SQAD
Sbjct  325  TPGGLLYVGDWNNMQFVSSSAFLVVVYSDY-LRAANAPLNCPEAQLHPSNLISFAQSQAD  383

Query  510  YVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT----GCKDGFK-WLESTQPNPNV  346
            Y+LG NP  MSYLVG+G NYP  VHHRGASI + A +     C +GF+ W    Q +PN+
Sbjct  384  YILGKNPRAMSYLVGFGPNYPTRVHHRGASIVSKAVSPAPVRCLEGFESWFNREQRDPNI  443

Query  345  AVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
             VG LVGGP  N+ +ID R+N  Q EPTTYN A ++GL + L
Sbjct  444  LVGALVGGPDRNDRFIDERSNYEQTEPTTYNVAPLIGLFAKL  485



>ref|XP_008230008.1| PREDICTED: endoglucanase 11 [Prunus mume]
Length=526

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 104/166 (63%), Gaps = 6/166 (4%)
 Frame = -3

Query  708  TATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKF  529
            T    RT +GL++I QWN +Q+   +AFL  VYSD++ SS   K++C G      ++  F
Sbjct  342  TKNVERTPAGLLYIRQWNNMQYVSTAAFLLTVYSDFLKSS-NQKLSCHGGMVGHEEVLDF  400

Query  528  AMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLEST  364
            A SQ DY+LG NPM MSYLVGYG  YP+ VHHRGAS+ +        GC  G+  W    
Sbjct  401  AKSQTDYILGANPMNMSYLVGYGPKYPQRVHHRGASVESYRENKGFIGCTQGYDNWYGRD  460

Query  363  QPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  226
            +PNPNV VG LVGGP   + ++D R+N MQ E  TYN+A +VG+ +
Sbjct  461  EPNPNVLVGALVGGPDCQDNFVDQRDNYMQTEACTYNTAPLVGVFA  506



>ref|XP_011047209.1| PREDICTED: endoglucanase 11-like [Populus euphratica]
 ref|XP_011047210.1| PREDICTED: endoglucanase 11-like [Populus euphratica]
Length=528

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 101/164 (62%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
            +RT  GL+ I QWN +Q+   +AFL  VYSD++L+S   K+ C G    P ++  FA SQ
Sbjct  346  NRTPGGLLHIRQWNNMQYVSTAAFLLTVYSDFLLNS-NQKLKCHGGSVDPEEILGFAKSQ  404

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNP  352
             DY+LG NPM MSYLVGYG  YP  VHHRGASI          GC  G+  W    +PNP
Sbjct  405  VDYILGSNPMNMSYLVGYGPKYPARVHHRGASIVSYRENKGFIGCTQGYDNWYGREEPNP  464

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV VG LVGGP   + + D R+N MQ E  TYN+A +VG+ + L
Sbjct  465  NVLVGALVGGPDCQDNFTDQRSNYMQTEACTYNTAPLVGVFAKL  508



>ref|XP_010110634.1| Endoglucanase 11 [Morus notabilis]
 gb|EXC27256.1| Endoglucanase 11 [Morus notabilis]
Length=522

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 103/164 (63%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             RT SGL+++ QWN +Q+   ++FL +VYSDY+ +S   K+TC G+  +  ++  FA SQ
Sbjct  340  ERTPSGLLYVRQWNNMQYVSTASFLLIVYSDYLKAS-NQKLTCQGEAISHEEVFTFAKSQ  398

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNP  352
             DY+LG NP   SYLVGYG NYPK VHHRGASI          GC  G+  W    +PNP
Sbjct  399  VDYILGSNPQNKSYLVGYGPNYPKRVHHRGASIGSYRENKGFIGCTQGYDNWYGRDEPNP  458

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV VG LVGGP   + + D R N MQ E  TYN+A +VG+ + L
Sbjct  459  NVLVGALVGGPDCQDNFSDERYNYMQTEACTYNTAPLVGVFAKL  502



>ref|XP_010666165.1| PREDICTED: endoglucanase 14-like [Beta vulgaris subsp. vulgaris]
Length=484

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 102/161 (63%), Gaps = 6/161 (4%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            +T  GL+W + W+ LQ+   + F+  +Y+DY+ +S  + + C      P DL  FA SQ 
Sbjct  322  KTSGGLLWFNDWDNLQYTSTATFVITIYADYLFASEKS-LNCPSSLVNPPDLIAFAKSQV  380

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGA---SIPTDAT-TGCKDGF-KWLESTQPNPN  349
            DY+LG NP   SY+VGYG NYP+ VHHRG+   SI  D T  GCKDGF  W    QPNPN
Sbjct  381  DYILGANPKNTSYMVGYGSNYPQQVHHRGSSIVSIKKDPTPVGCKDGFTNWFNKNQPNPN  440

Query  348  VAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  226
            V VG +VGGP  N+ Y+D R++   AEP T NSA +VG+L+
Sbjct  441  VLVGAIVGGPDKNDNYVDQRSDYQLAEPATANSAGLVGVLA  481



>gb|KJB13746.1| hypothetical protein B456_002G092400 [Gossypium raimondii]
Length=452

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 104/164 (63%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
            +RT +GL++I QWN +Q+   +AFL  VYSDY+ +S   ++ CD     P ++  FA SQ
Sbjct  272  NRTPAGLLYIRQWNNMQYVSNAAFLLTVYSDYLRAS-NQRLRCDRGKVGPEEVLLFARSQ  330

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFK-WLESTQPNP  352
            ADY+LG NPM MSYLVGYG  YP+ +HHRGASI +        GC  G+  W     PNP
Sbjct  331  ADYILGANPMGMSYLVGYGSRYPQRMHHRGASIESYRENKGFIGCTQGYDYWYPRNDPNP  390

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV VG LVGGP   + + D R N MQ E  TYN+A +VG+L+ L
Sbjct  391  NVVVGALVGGPDHMDRFSDDRKNFMQTEACTYNTASLVGVLAKL  434



>ref|XP_010264780.1| PREDICTED: endoglucanase 12-like [Nelumbo nucifera]
Length=628

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 104/163 (64%), Gaps = 6/163 (4%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            R+  GL+W   WN LQ+  ++ F+A  YS+Y+ ++R A I C G    PSDL  F  SQA
Sbjct  466  RSPGGLLWWQPWNDLQYTTSAMFVATAYSEYLTAAR-ATIQCQGGRVGPSDLISFVRSQA  524

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGA---SIPTDAT-TGCKDGFK-WLESTQPNPN  349
            +Y+LG NP  MSY+VG+G +YP+ VHHRGA   SI  D T   CK G+  W     PNPN
Sbjct  525  NYILGSNPKGMSYMVGFGSSYPQMVHHRGASIVSIKKDRTPVTCKGGYDMWFNRNAPNPN  584

Query  348  VAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            V VG +VGGP  N+ Y DSR+N  QAEP T N+A  VG+L+ L
Sbjct  585  VLVGAIVGGPDQNDAYTDSRSNFQQAEPATVNTAPFVGVLAKL  627



>ref|XP_004304093.1| PREDICTED: endoglucanase 11 [Fragaria vesca subsp. vesca]
Length=517

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 105/166 (63%), Gaps = 6/166 (4%)
 Frame = -3

Query  708  TATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKF  529
            T    RT +GL++I QWN +Q+   ++FL  +YSD++ SS   K++C G      ++  F
Sbjct  330  TTNVERTPAGLLYIRQWNNMQYVSTASFLLTMYSDFLKSS-NQKLSCHGGTVAHQEILSF  388

Query  528  AMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLEST  364
            A SQ DY+LG NP  MSYLVGYG NYP+ VHHRGAS+       A  GC  G+  W    
Sbjct  389  AKSQVDYILGSNPSNMSYLVGYGSNYPQRVHHRGASVVSYRENKAFIGCTQGYDNWYGRL  448

Query  363  QPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  226
            +PNPNV VG LVGGP  ++ ++D R+N MQ E  TYN+A +VG+ +
Sbjct  449  EPNPNVLVGALVGGPDSHDNFLDQRDNYMQTEACTYNTAPLVGVFA  494



>ref|XP_010252537.1| PREDICTED: endoglucanase 11-like [Nelumbo nucifera]
Length=526

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 99/161 (61%), Gaps = 5/161 (3%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            RT  GL++I QWN +Q+   +AFL  VYSDY+      K+ C G    P ++  FA+SQ 
Sbjct  343  RTPGGLLYIRQWNNMQYVSTAAFLLTVYSDYLQRYSDQKLNCPGGEVGPREILDFAISQV  402

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNPN  349
            DY+LG NPM MSYLVGYG  YP+ VHHRGASI     +    GC  G+  W    + NPN
Sbjct  403  DYILGSNPMGMSYLVGYGPKYPRRVHHRGASIVSYRESKGFIGCTQGYDNWYGRDEANPN  462

Query  348  VAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  226
            V VG LVGGP   + + D R+N MQ E  TYN+A +VGL +
Sbjct  463  VLVGALVGGPDCQDNFRDRRSNFMQTEACTYNTAPLVGLFA  503



>gb|KHM99090.1| Endoglucanase 11 [Glycine soja]
Length=527

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 100/164 (61%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             RT +GL+++ QWN +Q+   +AFL  +YSD+ L +   K+ C G      ++  FA SQ
Sbjct  344  ERTPAGLIYVRQWNNMQYVSTAAFLLSIYSDF-LQNTNQKLNCHGGTVDHEEILNFAKSQ  402

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNP  352
             DY+LG NPM MSYLVGYG NYPK VHHRGASI          GC  G+  W  S  PNP
Sbjct  403  VDYILGSNPMNMSYLVGYGPNYPKRVHHRGASIVSYKKNKGFIGCTQGYDNWYGSQAPNP  462

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV VG LVGGP   + + D RNN MQ E  TYN+A +VG+ +  
Sbjct  463  NVLVGALVGGPDGKDNFEDRRNNFMQTEACTYNTAPLVGVFAKF  506



>gb|AID55385.1| glycoside hydrolase family 9 B8 [Gossypium hirsutum]
Length=522

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 104/164 (63%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
            +RT +GL++I QWN +Q+   +AFL  VYSDY+ +S   ++ CD     P ++  FA SQ
Sbjct  342  NRTPAGLLYIRQWNNMQYVSNAAFLLTVYSDYLRAS-NQRLRCDRGKVGPEEVLLFARSQ  400

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFK-WLESTQPNP  352
            ADY+LG NPM MSYLVGYG  YP+ +HHRGASI +        GC  G+  W     PNP
Sbjct  401  ADYILGANPMGMSYLVGYGSRYPQRMHHRGASIESYRENKGFIGCTQGYDYWYPRNDPNP  460

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV VG LVGGP   + + D R N MQ E  TYN+A +VG+L+ L
Sbjct  461  NVVVGALVGGPDHMDRFSDDRKNFMQTEACTYNTASLVGVLAKL  504



>gb|KJB13747.1| hypothetical protein B456_002G092400 [Gossypium raimondii]
Length=522

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 104/164 (63%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
            +RT +GL++I QWN +Q+   +AFL  VYSDY+ +S   ++ CD     P ++  FA SQ
Sbjct  342  NRTPAGLLYIRQWNNMQYVSNAAFLLTVYSDYLRAS-NQRLRCDRGKVGPEEVLLFARSQ  400

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFK-WLESTQPNP  352
            ADY+LG NPM MSYLVGYG  YP+ +HHRGASI +        GC  G+  W     PNP
Sbjct  401  ADYILGANPMGMSYLVGYGSRYPQRMHHRGASIESYRENKGFIGCTQGYDYWYPRNDPNP  460

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV VG LVGGP   + + D R N MQ E  TYN+A +VG+L+ L
Sbjct  461  NVVVGALVGGPDHMDRFSDDRKNFMQTEACTYNTASLVGVLAKL  504



>ref|XP_009334150.1| PREDICTED: endoglucanase 11-like [Pyrus x bretschneideri]
Length=509

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 103/168 (61%), Gaps = 6/168 (4%)
 Frame = -3

Query  708  TATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKF  529
             A   RT  GL++I QWN +Q+   +AFL   Y+DY+ ++    +TCD    +P ++  F
Sbjct  325  VANVQRTPGGLLYIRQWNNMQYVSNAAFLLTTYTDYLQATH-ENLTCDKGQVSPQEILSF  383

Query  528  AMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLEST  364
            A SQ DY+LG NPM MSYLVGYG  YP+ VHHRGASI +        GC  G+  W    
Sbjct  384  AKSQVDYILGSNPMAMSYLVGYGPKYPQRVHHRGASIDSYKKNKGFIGCTQGYDSWYGKQ  443

Query  363  QPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
             PNPNV VG LVGGP  N+ + D R N MQ E  TYN+A +VG+L+ L
Sbjct  444  GPNPNVLVGALVGGPDGNDGFRDERWNYMQTEACTYNTATLVGVLAKL  491



>ref|XP_002321149.2| hypothetical protein POPTR_0014s15590g [Populus trichocarpa]
 gb|EEE99464.2| hypothetical protein POPTR_0014s15590g [Populus trichocarpa]
Length=528

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 101/164 (62%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
            +RT SGL+ I QWN +Q+   +AFL  VYSD++L+S   K+ C G      ++  FA SQ
Sbjct  346  NRTPSGLLHIRQWNNMQYVSTAAFLLTVYSDFLLNS-NQKLKCHGGSVDHEEILGFAKSQ  404

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNP  352
             DY+LG NPM MSYLVGYG  YP  VHHRGASI          GC  G+  W    +PNP
Sbjct  405  VDYILGSNPMNMSYLVGYGPKYPARVHHRGASIVSYRENKGFIGCTQGYDNWYGREEPNP  464

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV VG LVGGP   + + D R+N MQ E  TYN+A +VG+ + L
Sbjct  465  NVLVGALVGGPDCQDNFTDQRSNYMQTEACTYNTAPLVGVFAKL  508



>gb|EAY82930.1| hypothetical protein OsI_38148 [Oryza sativa Indica Group]
Length=348

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            RT  GL+++ +WN+LQHPVASAFLA VYSDYM SSR  +++C G+ ++PSDLRKFA SQA
Sbjct  23   RTKGGLLYVDEWNSLQHPVASAFLAAVYSDYMQSSRKTELSCSGQGFSPSDLRKFAKSQA  82

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  397
            DY+LG NPMK+S LVGYGD YP+ VHHRG SIP D  TG
Sbjct  83   DYLLGSNPMKISCLVGYGDRYPERVHHRGTSIPEDVDTG  121



>ref|XP_008385953.1| PREDICTED: endoglucanase 11-like [Malus domestica]
Length=286

 Score =   150 bits (379),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 100/168 (60%), Gaps = 6/168 (4%)
 Frame = -3

Query  708  TATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKF  529
             A   RT  G ++I QWN +Q+   +AFL   YSDY+ ++    +TCD    +P ++  F
Sbjct  102  VANVQRTPGGXLYIRQWNNMQYXSNAAFLLTTYSDYLQATHE-NLTCDKGQVSPQEILSF  160

Query  528  AMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLEST  364
            A SQ DY+LG NPM MSYL GYG  YP+ VHHRGASI +        GC  G+  W    
Sbjct  161  AKSQVDYILGSNPMAMSYLXGYGPKYPQRVHHRGASIDSYKKNKGFIGCTQGYDSWYGRQ  220

Query  363  QPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
             PNPNV  G LVGGP  N+ + D R N MQ E  TYN+A +VG+L+ L
Sbjct  221  GPNPNVLXGALVGGPDGNDGFXDERWNYMQTEACTYNTATLVGVLAKL  268



>gb|EYU26800.1| hypothetical protein MIMGU_mgv1a019325mg [Erythranthe guttata]
Length=474

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 104/164 (63%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             RT  GL+W  QW+ LQ+  +++F+   Y+DY LS     I C      P+DL  FA SQ
Sbjct  310  QRTSGGLLWFLQWSNLQYVTSASFIITAYADY-LSKTHKNIQCASGIVGPNDLMAFAKSQ  368

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNP  352
             DY+LG NP  MSY+VG+G NYPK VHHRGASI +         C++GF +W  + Q NP
Sbjct  369  VDYMLGSNPKNMSYMVGFGSNYPKQVHHRGASIVSIKKDSRPMSCQEGFEEWFHNNQENP  428

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV  G +VGGP  ++ Y D+R+N  QAEP+T N+A +VG+L+ L
Sbjct  429  NVLTGAIVGGPDRSDQYTDARDNYQQAEPSTANNAPLVGVLARL  472



>gb|KDP30800.1| hypothetical protein JCGZ_13743 [Jatropha curcas]
Length=532

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 99/163 (61%), Gaps = 6/163 (4%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            RT +GL+ + QWN +Q+   +AFL  +YSD++ SS   K+ C G      ++  FA SQ 
Sbjct  347  RTPAGLLHVRQWNNMQYVSTAAFLLTIYSDFLRSS-DRKLVCHGGLVDHEEILNFAKSQV  405

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNPN  349
            DY+LG NPM MSYLVGYG  YP  VHHRGASI          GC  G+  W    +PNPN
Sbjct  406  DYILGSNPMNMSYLVGYGSKYPTRVHHRGASIVSYRENKGFIGCTQGYDNWYSQKEPNPN  465

Query  348  VAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            V VG LVGGP   + ++D R N MQ E  TYN+A +VG+ + L
Sbjct  466  VLVGALVGGPDCQDNFMDQRGNYMQTEACTYNTAPLVGVFAKL  508



>gb|EYU26799.1| hypothetical protein MIMGU_mgv1a020424mg [Erythranthe guttata]
Length=458

 Score =   154 bits (388),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 107/163 (66%), Gaps = 6/163 (4%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            +T  GL+W   W+ LQ+  +++F+   Y+DY+  +R A + C G    P+DL  FA SQ 
Sbjct  295  KTKGGLLWFLPWSNLQYVNSASFIMSAYADYLSKAR-ATLRCAGGAVGPNDLISFARSQV  353

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGA---SIPTDAT-TGCKDGF-KWLESTQPNPN  349
            DY+LG+NP ++SY+VG+G NYPK VHHRGA   SI  D T  GC+DGF  W      NPN
Sbjct  354  DYILGNNPKRLSYMVGFGSNYPKRVHHRGASIVSIKKDRTRVGCQDGFNNWYNRNADNPN  413

Query  348  VAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            V  G +VGGP  ++ Y D+RNN  QAEP+T N+A +VG+L+ L
Sbjct  414  VITGAIVGGPDQSDQYTDARNNYQQAEPSTANNAPLVGVLARL  456



>gb|EYU29517.1| hypothetical protein MIMGU_mgv1a003302mg [Erythranthe guttata]
Length=593

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 105/162 (65%), Gaps = 6/162 (4%)
 Frame = -3

Query  690  TDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQAD  511
            T  GL+++ +WN LQ+  +SAFL  VYSDY+  S++  + C      P +L  FA SQAD
Sbjct  332  TPGGLLYVREWNNLQYTASSAFLLAVYSDYLAKSKSV-VKCPSVQVQPQELLTFAKSQAD  390

Query  510  YVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFK-WLESTQPNPNV  346
            Y+LG NP  MSYLVG+G +YP +VHHRGASI +     +  GC +GF+ W +  + +PNV
Sbjct  391  YILGKNPKSMSYLVGFGQSYPLHVHHRGASITSISLLKSAVGCVEGFESWYKRVEADPNV  450

Query  345  AVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
              G LVGGP  N+ Y DSR+N  Q+EPT   +A +VGL S L
Sbjct  451  IYGALVGGPNANDEYFDSRSNYEQSEPTISGTAPLVGLFSRL  492



>gb|KDP39180.1| hypothetical protein JCGZ_00937 [Jatropha curcas]
Length=502

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 101/164 (62%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             RT  GL++I QWN LQ+   +AFL  VYSDY+ +S   ++ CD     P ++  FA SQ
Sbjct  329  ERTPGGLLYIRQWNNLQYASTAAFLLTVYSDYLQAS-NQRLKCDRGTLDPQEIFGFAKSQ  387

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFKW-LESTQPNP  352
             DY+LG NPM MSYLVGYG  YP+ VHHRGASI +        GC  G+     S  PNP
Sbjct  388  VDYILGANPMNMSYLVGYGSKYPQKVHHRGASIASYKEYKGFVGCTQGYDIGYNSQDPNP  447

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV VG +VGGP  N+ + D R N +Q E  TYN+A +VG+ + L
Sbjct  448  NVLVGAIVGGPDKNDEFRDERGNYVQTEACTYNTACLVGVFAKL  491



>ref|XP_002529469.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF32935.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=510

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 101/164 (62%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             RT  GL++I QWN LQ+   +AFL  VYSD++L+S   ++ CD     P ++   A SQ
Sbjct  330  KRTPGGLLYIRQWNNLQYVSTAAFLLTVYSDHLLAS-NQRLKCDRGILDPQEILSVAKSQ  388

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFK-WLESTQPNP  352
             DY+LG NP+ MSYLVGYG  YP+ VHHRGASI +        GC  G+  W     PNP
Sbjct  389  IDYILGANPVGMSYLVGYGTEYPQRVHHRGASIESYKGNKGFIGCTQGYDMWYNRQDPNP  448

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV VG LVGGP   + + D R N MQ E  TYN+A +VG+L+ L
Sbjct  449  NVVVGALVGGPDEKDEFSDERGNYMQTEACTYNTASLVGVLARL  492



>gb|AEO97204.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97231.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=528

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 100/164 (61%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
            +RT  GL+ I QWN +Q+   +AFL  VYSD++L+S   K+ C G      ++  FA SQ
Sbjct  346  NRTPGGLLHIRQWNNMQYVSTAAFLLTVYSDFLLNS-NQKLKCHGGSVDHEEILGFAKSQ  404

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNP  352
             DY+LG NPM MSYLVGYG  YP  VHHRGASI          GC  G+  W    +PNP
Sbjct  405  VDYILGSNPMNMSYLVGYGPKYPARVHHRGASIVSYRENKGFIGCTQGYDNWYGREEPNP  464

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV VG LVGGP   + + D R+N MQ E  TYN+A +VG+ + L
Sbjct  465  NVLVGALVGGPDCQDNFTDQRSNYMQTEACTYNTAPLVGVFAKL  508



>gb|AET00580.2| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=504

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 103/163 (63%), Gaps = 6/163 (4%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            RT  GL++I QWN +Q+   +AFL  +YSD++L++   K+ C      P++L  FA SQ 
Sbjct  339  RTPGGLLYIRQWNNMQYVANAAFLLAIYSDHLLAT-NQKLHCQKGEVGPNELLAFAKSQV  397

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNPN  349
            DY+LG NPM MSYLVGYG N+P+ VHHRGAS  +        GC  G+  W ES +PNPN
Sbjct  398  DYILGSNPMGMSYLVGYGSNFPQRVHHRGASTESYKGNMGFIGCTQGYDNWYESPKPNPN  457

Query  348  VAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            + +G LVGGP   + + D R N  Q E  TYN+A +VG+ + L
Sbjct  458  ILIGALVGGPDNKDQFRDERRNFEQLEACTYNTAALVGVFARL  500



>gb|AFZ78643.1| korrigan [Populus tomentosa]
Length=528

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 100/164 (61%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
            +RT  GL+ I QWN +Q+   +AFL  VYSD++L+S   K+ C G      ++  FA SQ
Sbjct  346  NRTPGGLLHIRQWNNMQYVSTAAFLLTVYSDFLLNS-NQKLNCHGGSVDHEEILGFAKSQ  404

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNP  352
             DY+LG NPM MSYLVGYG  YP  VHHRGASI          GC  G+  W    +PNP
Sbjct  405  VDYILGSNPMNMSYLVGYGPKYPARVHHRGASIVSYRENKGFIGCTQGYDNWYGREEPNP  464

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV VG LVGGP   + + D R+N MQ E  TYN+A +VG+ + L
Sbjct  465  NVLVGALVGGPDCQDNFTDQRSNYMQTEACTYNTAPLVGVFAKL  508



>ref|XP_011046752.1| PREDICTED: endoglucanase 11-like [Populus euphratica]
Length=493

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 101/164 (62%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             RT  GL++I QWN +Q+   +AFL   YSD++ +S   ++ CD     PSD+ KFA SQ
Sbjct  312  QRTPGGLLYIRQWNNMQYVSTAAFLLTTYSDHLQAS-NQRLQCDQGTLDPSDIFKFAKSQ  370

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFKWLESTQ-PNP  352
             DY+LG NPM MSYLVGYG  YP  VHHRGASI +        GC  G+    S Q PNP
Sbjct  371  VDYILGYNPMGMSYLVGYGAKYPARVHHRGASIESYKEQKDFIGCMQGYDIGYSRQGPNP  430

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV  G LVGGP + + + D R N MQ E  TYN+A +VG+ + L
Sbjct  431  NVLTGALVGGPDMKDQFRDERENYMQTEACTYNTATLVGVFAKL  474



>ref|XP_003617621.1| Endoglucanase [Medicago truncatula]
Length=574

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 103/163 (63%), Gaps = 6/163 (4%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            RT  GL++I QWN +Q+   +AFL  +YSD++L++   K+ C      P++L  FA SQ 
Sbjct  409  RTPGGLLYIRQWNNMQYVANAAFLLAIYSDHLLAT-NQKLHCQKGEVGPNELLAFAKSQV  467

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNPN  349
            DY+LG NPM MSYLVGYG N+P+ VHHRGAS  +        GC  G+  W ES +PNPN
Sbjct  468  DYILGSNPMGMSYLVGYGSNFPQRVHHRGASTESYKGNMGFIGCTQGYDNWYESPKPNPN  527

Query  348  VAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            + +G LVGGP   + + D R N  Q E  TYN+A +VG+ + L
Sbjct  528  ILIGALVGGPDNKDQFRDERRNFEQLEACTYNTAALVGVFARL  570



>gb|KHN38252.1| Endoglucanase 11 [Glycine soja]
Length=515

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 102/164 (62%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             RT  GL++I QWN +Q+   ++FL  VYSD++L++   K+ C      P ++  FA SQ
Sbjct  338  ERTPGGLLYIRQWNNMQYVATASFLLTVYSDHLLAT-DQKLHCQKGEVGPHEMLAFAKSQ  396

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNP  352
             DY+LG NPM MSYLVGYG  +P+ VHHRGASI +        GC  G+  W    +PNP
Sbjct  397  VDYILGTNPMAMSYLVGYGPKFPQKVHHRGASIESYGENKGFIGCTQGYDNWYGRVEPNP  456

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV +G LVGGP + + + D R N +Q E  TYN+A +VG+ + L
Sbjct  457  NVLIGALVGGPDIKDQFKDERRNYIQTEACTYNTAALVGVFARL  500



>ref|XP_008342129.1| PREDICTED: endoglucanase 11-like [Malus domestica]
Length=516

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 104/166 (63%), Gaps = 6/166 (4%)
 Frame = -3

Query  708  TATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKF  529
            T    RT +GL+++ QWN +Q+   ++FL  VYSD++ +S   K++C G      ++  F
Sbjct  329  TKNVERTPAGLLYVRQWNNMQYVSTASFLLTVYSDFLETS-NQKLSCHGGTAGHEEVLSF  387

Query  528  AMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLEST  364
            A SQ DY+LG NP+ MSYLVGYG  YP+ VHHRGAS+ +        GC  G+  W    
Sbjct  388  AKSQIDYILGSNPLNMSYLVGYGPKYPRRVHHRGASVESYRENKGFIGCTQGYDNWYGRE  447

Query  363  QPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  226
            +PNPNV VG LVGGP   + ++D R+N MQ E  TYN+A +VG+ +
Sbjct  448  EPNPNVLVGALVGGPDCKDNFVDRRDNYMQTEACTYNTAPLVGVFA  493



>ref|XP_008366459.1| PREDICTED: endoglucanase 11-like [Malus domestica]
Length=371

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 99/168 (59%), Gaps = 6/168 (4%)
 Frame = -3

Query  708  TATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKF  529
             A   RT  G ++I QWN +Q+   +AFL   YSDY L +    +TCD    +P ++  F
Sbjct  191  VANVQRTPGGXLYIRQWNNMQYXSNAAFLLTTYSDY-LQATHENLTCDKGQVSPQEILSF  249

Query  528  AMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLEST  364
            A SQ DY+LG NPM MSYL GYG  YP+ VHHRGASI +        GC  G+  W    
Sbjct  250  AKSQVDYILGSNPMAMSYLXGYGPKYPQRVHHRGASIDSYKKNKGFIGCTQGYDSWYGRQ  309

Query  363  QPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
             PNPNV  G LVGGP  N+ + D R N MQ E  TYN+A +VG+L+ L
Sbjct  310  GPNPNVLXGALVGGPDGNDGFXDERWNYMQTEACTYNTATLVGVLAKL  357



>ref|XP_002300328.1| hypothetical protein POPTR_0001s36600g [Populus trichocarpa]
 gb|EEE85133.1| hypothetical protein POPTR_0001s36600g [Populus trichocarpa]
Length=517

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 102/164 (62%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             RT  GL++I QWN +Q+   +AFL   YSD++ +S   ++ CD     PSD+ KFA SQ
Sbjct  336  QRTPGGLLYIRQWNNMQYVSTAAFLLTTYSDHLQAS-NQRLQCDQGTLDPSDIFKFAKSQ  394

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFKWLESTQ-PNP  352
             DY+LG NP+ MSYLVGYG  YP+ VHHRGASI +        GC  G+    S Q PNP
Sbjct  395  VDYILGYNPLGMSYLVGYGAKYPERVHHRGASIESYKGQKDFIGCMQGYDIGYSRQGPNP  454

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV  G LVGGP + + + D R N MQ E  TYN+A +VG+ + L
Sbjct  455  NVLTGALVGGPDMKDQFRDERENYMQTEACTYNTATLVGVFAKL  498



>ref|XP_003518530.1| PREDICTED: endoglucanase 11-like [Glycine max]
Length=515

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 102/164 (62%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             RT  GL++I QWN +Q+   ++FL  VYSD++L++   K+ C      P ++  FA SQ
Sbjct  338  ERTPGGLLYIRQWNNMQYVATASFLLTVYSDHLLAT-DQKLHCQKGEVGPHEMLAFAKSQ  396

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNP  352
             DY+LG NPM MSYLVGYG  +P+ VHHRGASI +        GC  G+  W    +PNP
Sbjct  397  VDYILGTNPMAMSYLVGYGPKFPQKVHHRGASIESYGENKGFIGCTQGYDNWYGRVEPNP  456

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV +G LVGGP + + + D R N +Q E  TYN+A +VG+ + L
Sbjct  457  NVLIGALVGGPDIKDQFKDERRNYIQTEACTYNTAALVGVFARL  500



>gb|AFZ78645.1| korrigan [Populus tomentosa]
Length=505

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 102/164 (62%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             RT  GL++I QWN +Q+   +AFL   YSD++ +S   ++ CD     PSD+ KFA SQ
Sbjct  324  QRTPGGLLYIRQWNNMQYVSTAAFLLTTYSDHLQAS-NQRLQCDQGTLDPSDIFKFAKSQ  382

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFKWLESTQ-PNP  352
             DY+LG NP+ MSYLVGYG  YP+ VHHRGASI +        GC  G+    S Q PNP
Sbjct  383  VDYILGYNPLGMSYLVGYGAKYPERVHHRGASIESYKGQKDFIGCMQGYDIGYSRQGPNP  442

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV  G LVGGP + + + D R N MQ E  TYN+A +VG+ + L
Sbjct  443  NVLTGALVGGPDMKDQFRDERENYMQTEACTYNTATLVGVFAKL  486



>ref|XP_008460200.1| PREDICTED: endoglucanase 13-like [Cucumis melo]
Length=492

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 101/165 (61%), Gaps = 10/165 (6%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            +T +GL+W   WN LQ+  ++ FLA VYSDY LSS+   I C G    PSDL  FA SQ 
Sbjct  330  KTPAGLLWFQPWNNLQYVTSATFLATVYSDY-LSSKGVSIQCPGGLVQPSDLISFAKSQV  388

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI------PTDATTGCKDGFK-WLESTQPN  355
            DY+LG NP  MSY+VG+G  YP  VHHRGASI      PT  T  C+ GF  W     PN
Sbjct  389  DYILGSNPSGMSYMVGFGSKYPTQVHHRGASIVSIKRDPTLVT--CQGGFNLWFNRNAPN  446

Query  354  PNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            PNV  G +VGGP  N+ Y DSR+N   AEP T   A +VG+L+ L
Sbjct  447  PNVLHGAVVGGPDPNDAYWDSRSNFKTAEPATVTPAPLVGVLARL  491



>ref|XP_006596588.1| PREDICTED: endoglucanase 11-like [Glycine max]
Length=523

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 102/164 (62%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             RT  GL+++ QWN +Q+   ++FL  VYSD++L++   K+ C      P ++  FA SQ
Sbjct  339  ERTPGGLLYVRQWNNMQYVATASFLLTVYSDHLLAT-DQKLHCQKGEVGPHEMLAFAKSQ  397

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNP  352
             DY+LG NPM MSYLVGYG  +P+ VHHRGASI +        GC  G+  W    +PNP
Sbjct  398  VDYILGSNPMAMSYLVGYGPKFPRRVHHRGASIESYGENKGFIGCTQGYDNWYGRVEPNP  457

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV +G LVGGP + + + D R N +Q E  TYN+A +VG+ + L
Sbjct  458  NVLIGALVGGPDIKDQFKDERRNYVQTEACTYNTAALVGVFARL  501



>gb|AEO97205.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97232.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=524

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 102/164 (62%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             RT  GL++I QWN +Q+   +AFL   YSD++ +S   ++ CD     PSD+ KFA SQ
Sbjct  343  QRTPGGLLYIRQWNNMQYVSTAAFLLTTYSDHLQAS-NQRLQCDQGTLDPSDIFKFAKSQ  401

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFKWLESTQ-PNP  352
             DY+LG NP+ MSYLVGYG  YP+ VHHRGASI +        GC  G+    S Q PNP
Sbjct  402  VDYILGYNPLGMSYLVGYGAKYPERVHHRGASIESYKGQKDFIGCMQGYDIGYSRQGPNP  461

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV  G LVGGP + + + D R N MQ E  TYN+A +VG+ + L
Sbjct  462  NVLTGALVGGPDMKDQFRDERENYMQTEACTYNTATLVGVFAKL  505



>ref|XP_004491112.1| PREDICTED: endoglucanase 11-like [Cicer arietinum]
Length=532

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 100/162 (62%), Gaps = 6/162 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             RT +GL++I QWN +Q+   ++FL  +YSD+ L +   K+TC        ++  FA SQ
Sbjct  349  ERTPAGLLYIRQWNNMQYVSTASFLLTIYSDF-LKNTNQKLTCHEGIVDHEEILSFAKSQ  407

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNP  352
             DY+LG NPM MSYLVG+G +YPK VHHRGASI          GC  G+  W  S  PNP
Sbjct  408  VDYILGSNPMNMSYLVGFGPSYPKRVHHRGASIMSYKENKGFIGCTQGYDNWYSSEDPNP  467

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  226
            NV +G LVGGP   + + D R+N MQ E  TYN+A +VGL +
Sbjct  468  NVLIGALVGGPDWEDNFEDRRSNFMQTEACTYNTAPLVGLFA  509



>ref|XP_007212600.1| hypothetical protein PRUPE_ppa016852mg [Prunus persica]
 gb|EMJ13799.1| hypothetical protein PRUPE_ppa016852mg [Prunus persica]
Length=513

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 101/164 (62%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             RT  GL++I QWN +Q+   +AFL   YSDY+ ++    +TCD     P +L  FA SQ
Sbjct  333  QRTPGGLLYIRQWNNMQYVSNAAFLLTTYSDYLQATHQ-NLTCDKGQVGPQELLSFAKSQ  391

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNP  352
             DY+LG NP  MSYLVGYG  YP+ +HHRGASI +        GC +G+  W     PNP
Sbjct  392  VDYILGSNPTAMSYLVGYGPKYPQRLHHRGASIESYKRNKGFIGCTEGYDSWYGMHDPNP  451

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV VG LVGGP  N+ + D R N MQ E  TYN+A +VG+L+ L
Sbjct  452  NVLVGALVGGPDGNDGFRDERWNYMQTEACTYNTATLVGVLAKL  495



>emb|CAF18445.1| endo-1,4-beta-D-glucanase KORRIGAN [Pisum sativum]
Length=229

 Score =   145 bits (367),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 109/168 (65%), Gaps = 4/168 (2%)
 Frame = -3

Query  711  PTATS-SRTDSGLVWISQW--NALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSD  541
            P  TS +RT  GL+ ++      LQ+ V +AFLA +YSDY+ ++ T    C   +Y+   
Sbjct  36   PVFTSFNRTKGGLIQLNHGRPQPLQYVVNAAFLATLYSDYLDAADTPGWYCGPNFYSTDK  95

Query  540  LRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIP-TDATTGCKDGFKWLEST  364
            LR+FA +Q DY+LG NP KMSY+VG+G++YPK+VHHRGASIP T     CK G+KW +++
Sbjct  96   LREFARTQIDYILGKNPRKMSYIVGFGNHYPKHVHHRGASIPKTKVKYNCKGGWKWRDTS  155

Query  363  QPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            +PNPN+ VG +V GP  ++ + D R+N    EPT   +A +V  L  L
Sbjct  156  KPNPNILVGAMVAGPDRHDGFHDVRSNYNYTEPTLAGNAGLVAALVAL  203



>ref|XP_004491466.1| PREDICTED: endoglucanase 11-like [Cicer arietinum]
Length=519

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 105/165 (64%), Gaps = 7/165 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             RT  GL++I QWN +Q+   +AFL  +YSD++L++   K+ C      P+++  FA SQ
Sbjct  336  ERTPGGLLYIRQWNNMQYVANAAFLLTIYSDHLLAN-NQKLHCQKNEVGPNEIFAFAKSQ  394

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT-----TGCKDGFK-WLESTQPN  355
             DY+LG NPM +SYLVGYG  +P+ VHHRGASI +         GC  G++ W ES++PN
Sbjct  395  VDYILGSNPMGISYLVGYGPKFPQRVHHRGASIKSYNKGNMDFIGCTQGYENWYESSEPN  454

Query  354  PNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            PN+ +G LVGGP   + + D R N  Q E  TYN+A +VG+ + L
Sbjct  455  PNILIGALVGGPDNKDLFKDERRNYEQMEACTYNTAALVGVFARL  499



>ref|XP_011085126.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 14-like [Sesamum 
indicum]
Length=489

 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 100/163 (61%), Gaps = 5/163 (3%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            RT+ GL+W  +W+ LQ+  +S+F+   Y+  +  +RT  + C      P DL  FA SQ 
Sbjct  324  RTNGGLLWFLEWDNLQYVTSSSFIITAYARILAGTRTKTLRCAAGDVGPHDLMAFARSQV  383

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNPN  349
            DY+LG NP  MSY+VG+G NYPK VHHRGASI +         C++GF +W      NPN
Sbjct  384  DYILGSNPKXMSYMVGFGSNYPKQVHHRGASIVSIKKDSRPVSCQEGFNEWFHKNAENPN  443

Query  348  VAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            V  G +VGGP   + Y D+R+N  QAEP T N+A +VG+L+ L
Sbjct  444  VLEGAVVGGPDQRDEYRDARDNYQQAEPATANNAPLVGVLASL  486



>ref|XP_007142327.1| hypothetical protein PHAVU_008G270900g [Phaseolus vulgaris]
 gb|ESW14321.1| hypothetical protein PHAVU_008G270900g [Phaseolus vulgaris]
Length=515

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 100/164 (61%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             RT  GL++  +WN +Q+   ++FL  +YSD++ ++   K+ C      P  +  FA SQ
Sbjct  335  ERTPGGLLYTREWNNMQYVATASFLLTLYSDHLQATHQ-KLQCHRGEVGPHQMFAFAKSQ  393

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT----GCKDGFK-WLESTQPNP  352
             DY+LG NPM MSYLVGYG N+PK VHHRGASI +        GC  G+  W    QPNP
Sbjct  394  VDYILGSNPMAMSYLVGYGPNFPKRVHHRGASIESSKENKGFIGCVQGYDTWYGRVQPNP  453

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV +G LVGGP   + + D R N +Q EP TYN+A +VG+ + L
Sbjct  454  NVLIGALVGGPDRKDQFKDERQNYIQTEPCTYNTAALVGVFARL  497



>ref|XP_010688721.1| PREDICTED: endoglucanase 5 [Beta vulgaris subsp. vulgaris]
Length=639

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 100/162 (62%), Gaps = 6/162 (4%)
 Frame = -3

Query  690  TDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQAD  511
            T  GLV++ QWN +Q+  ++AFL  VYSDY LS   A + C      P DL  FA SQAD
Sbjct  335  TPGGLVYVRQWNNMQYASSAAFLIAVYSDY-LSQGKAVVNCPEGTMKPQDLLNFAQSQAD  393

Query  510  YVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNPNV  346
            Y+LG NP  +SYLVG+G NYP  VHHRGASI      +A  GC  GF +W   +  NPNV
Sbjct  394  YILGKNPKSISYLVGFGKNYPTQVHHRGASIAAISVHNAQVGCVQGFEEWYHRSSANPNV  453

Query  345  AVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
              GGLVGGP  N+ Y + R+N  Q EPT   +A ++GL S L
Sbjct  454  VHGGLVGGPDNNDEYDNDRSNYEQTEPTLSGTAPLIGLFSKL  495



>ref|XP_008364782.1| PREDICTED: endoglucanase 11-like [Malus domestica]
Length=507

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 101/164 (62%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             RT  GL++I QWN +Q+   +AFL  +YSDY+ ++    +TCD     P ++  F  SQ
Sbjct  328  QRTPGGLLYIRQWNNMQYVSNAAFLLTIYSDYIQAAH-HNLTCDKGQVGPQEILSFTKSQ  386

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFK-WLESTQPNP  352
             DY+LG NPM MSYLVGYG  YP+ +HHRGASI +        GC  G+  W     PNP
Sbjct  387  VDYILGSNPMGMSYLVGYGPKYPRRLHHRGASIDSYKKNXGFIGCTQGYHNWYGRQGPNP  446

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV VG LVGGP  N+ + D R N MQ E  TYN+A +VG+L+ L
Sbjct  447  NVLVGALVGGPDGNDGFRDERWNYMQTEACTYNTATLVGVLAKL  490



>gb|KHG28140.1| hypothetical protein F383_15365 [Gossypium arboreum]
Length=511

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 99/164 (60%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             RT  GL++I QWN +Q+   + FL  VYSD++ +S +  + C      P ++  FA SQ
Sbjct  334  ERTPGGLLYIRQWNNMQYMSTATFLLTVYSDFLRNS-SQHLRCPTGTIDPEEILSFAKSQ  392

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNP  352
             DY+LG NPM MSYLVGYG  YP  VHHRGASI          GC  G+  W    +PNP
Sbjct  393  VDYILGSNPMNMSYLVGYGSKYPIRVHHRGASIVSYREKKGFIGCTQGYDNWYSRVEPNP  452

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV VG LVGGP   + ++D R+N MQ E  TYN+A +VG+ + L
Sbjct  453  NVLVGALVGGPDCRDNFMDQRDNYMQTEACTYNTAPLVGVFARL  496



>ref|XP_009804981.1| PREDICTED: endoglucanase 5 [Nicotiana sylvestris]
Length=630

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 101/162 (62%), Gaps = 6/162 (4%)
 Frame = -3

Query  690  TDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQAD  511
            T  GL+++ +WN LQ+  ++AFL  +YSDY LS R A +TC      PSD+  FA SQAD
Sbjct  330  TPGGLIYVREWNNLQYASSAAFLLAMYSDY-LSERKAVLTCPEGQVQPSDVLSFAKSQAD  388

Query  510  YVLGDNPMKMSYLVGYGDNYPKYVHHRGASIP----TDATTGCKDGFK-WLESTQPNPNV  346
            Y+LG NP  +SYLVGYG NYP +VHHRGASI       +   C +GF+ W    Q NPN+
Sbjct  389  YILGKNPKSISYLVGYGQNYPIHVHHRGASIAPVSVLHSAVTCIEGFETWYRRPQANPNI  448

Query  345  AVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
              GGLVGGP   + + D R+N  Q EPT   SA +VGL   L
Sbjct  449  IYGGLVGGPSKTDDFSDDRSNYEQTEPTLSGSAPLVGLFCKL  490



>ref|XP_008227038.1| PREDICTED: endoglucanase 11-like [Prunus mume]
Length=513

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 100/164 (61%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             RT  GL++I QWN +Q+   +AFL   YSDY+ ++    + CD     P +L  FA SQ
Sbjct  333  QRTPGGLLYIRQWNNMQYVSNAAFLLTTYSDYLQATHQ-NLACDKGRVGPQELLSFAKSQ  391

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNP  352
             DY+LG NP  MSYLVGYG  YP+ +HHRGASI +        GC  G+  W    +PNP
Sbjct  392  VDYILGSNPTAMSYLVGYGPKYPQRLHHRGASIESYKRNKGFIGCTQGYDSWYRMHRPNP  451

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV VG LVGGP  N+ + D R N MQ E  TYN+A +VG+L+ L
Sbjct  452  NVLVGALVGGPDGNDGFRDERWNYMQTEACTYNTATLVGVLAKL  495



>gb|AID55384.1| glycoside hydrolase family 9 B11 [Gossypium hirsutum]
Length=511

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 98/164 (60%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             RT  GL++I QWN +Q+   + FL  VYSD++ +S    + C      P ++  FA SQ
Sbjct  334  ERTPGGLLYIRQWNNMQYVSTATFLLTVYSDFLRNS-NQHLRCPTGTIDPEEILSFAKSQ  392

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNP  352
             DY+LG NPM MSYLVGYG  YP  VHHRGASI          GC  G+  W    +PNP
Sbjct  393  VDYILGSNPMNMSYLVGYGSKYPIRVHHRGASIVSYRENKGFIGCTQGYDNWYSRVEPNP  452

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV VG LVGGP   + ++D R+N MQ E  TYN+A +VG+ + L
Sbjct  453  NVLVGALVGGPDCRDNFMDQRDNYMQTEACTYNTAPLVGVFARL  496



>ref|XP_011072104.1| PREDICTED: endoglucanase 5-like [Sesamum indicum]
Length=584

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 102/162 (63%), Gaps = 6/162 (4%)
 Frame = -3

Query  690  TDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQAD  511
            T  GL+++ +WN LQ+P ++AFL  VYSDY+  +++  + C        DL  FA SQAD
Sbjct  301  TPGGLLYLHEWNNLQYPASAAFLLAVYSDYLAKAKSV-VKCPDGELQHQDLLNFAKSQAD  359

Query  510  YVLGDNPMKMSYLVGYGDNYPKYVHHRGASIP----TDATTGCKDGFK-WLESTQPNPNV  346
            Y+LG NPM +SY+VGYG NYP +VHHRGASI       +  GC +GF+ W +  + NPNV
Sbjct  360  YILGKNPMSLSYIVGYGQNYPMHVHHRGASIAPVSLLKSAVGCVEGFETWYKRPEANPNV  419

Query  345  AVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
              G LVGGP   + + D R+N  Q EPT   +A +VGL S L
Sbjct  420  IHGALVGGPNAKDEFTDDRSNYEQTEPTLSGTAPLVGLFSKL  461



>ref|XP_009351718.1| PREDICTED: endoglucanase 5 [Pyrus x bretschneideri]
Length=628

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 103/164 (63%), Gaps = 6/164 (4%)
 Frame = -3

Query  696  SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQ  517
             +T  GL+++ +WN LQ+  ++AFL  VYSDY LS+  AK+ C      P +L  FA SQ
Sbjct  333  QKTPGGLLYVREWNNLQYVTSAAFLLAVYSDY-LSAANAKLACPDGQAQPQELLNFAKSQ  391

Query  516  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGFK-WLESTQPNP  352
            ADY+LG NP  MSY+VG G NYP +VHHRGASIP+     +   C  GF+ W   T+ NP
Sbjct  392  ADYILGKNPKSMSYIVGIGQNYPVHVHHRGASIPSVFTLHSAVECVQGFEMWYHRTEANP  451

Query  351  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            NV  G LVGGP  N+ + D R++  Q EPT   +  +VGLLS L
Sbjct  452  NVIYGALVGGPDQNDYFSDDRSSYEQTEPTLSGTGPLVGLLSKL  495



>ref|XP_003579470.1| PREDICTED: endoglucanase 13 [Brachypodium distachyon]
Length=612

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 108/163 (66%), Gaps = 8/163 (5%)
 Frame = -3

Query  690  TDSGLVWISQWNALQHPVASAFLAVVYSDYM-LSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            T +GL++++ WN +Q+  +SAFL  VY+DY+ +S R  ++ C     +PS++ +F   Q 
Sbjct  336  TPAGLLYVADWNNMQYVTSSAFLLAVYADYLAVSGR--QLKCPDGEVSPSEMIRFVRRQV  393

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIP----TDATTGCKDGF-KWLESTQPNPN  349
            DYVLGDNP  MSY+VGYG+N+P+ VHHRGASIP     +   GC DGF ++  + + +PN
Sbjct  394  DYVLGDNPASMSYMVGYGENFPRRVHHRGASIPAVGSVNGIVGCMDGFDRFYNTKEADPN  453

Query  348  VAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            V  G LVGGP  N+ ++D R N  +AEPT   +A IVG+ + L
Sbjct  454  VLYGALVGGPDANDAFVDDRCNYQRAEPTIATAAPIVGVFARL  496



>ref|XP_008805594.1| PREDICTED: endoglucanase 11-like [Phoenix dactylifera]
Length=424

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 98/163 (60%), Gaps = 6/163 (4%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            RT  GL+++ QWN +Q+   +AFL  +YSDY+   R  ++ C      P +L   A SQA
Sbjct  244  RTPGGLLYVRQWNNMQYVSGAAFLLTIYSDYLTELRR-ELHCPDGVVKPGELLALARSQA  302

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNPN  349
            DY+LG NPM +SYLVGYG  YP+ VHHRGAS+     +    GC  G+  W    Q NPN
Sbjct  303  DYILGSNPMGISYLVGYGPRYPRKVHHRGASVVSYKESKGFVGCTQGYDDWYHRRQANPN  362

Query  348  VAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            V VG LVGGP   + + D R N MQ E  TYN+A +VG+ + L
Sbjct  363  VLVGALVGGPDFQDNFSDDRGNYMQTEACTYNTAPMVGVFARL  405



>ref|XP_010536683.1| PREDICTED: endoglucanase 11-like [Tarenaya hassleriana]
Length=437

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 104/168 (62%), Gaps = 6/168 (4%)
 Frame = -3

Query  708  TATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKF  529
             A  +RT  GL+++ QWN LQ+ V ++FL  VYSD+ L +   ++ C        ++  F
Sbjct  259  AANVARTPGGLLYVRQWNNLQYVVTASFLLAVYSDH-LRATGRRLVCGQGAVGAGEVLAF  317

Query  528  AMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLEST  364
            A +QADY+LG+NP  MSY+VGYG  +P  VHHRGASI +        GC DG+ +W  S 
Sbjct  318  AKAQADYILGNNPQGMSYMVGYGPRFPVRVHHRGASIASYRDEKGFIGCVDGYHRWFHSK  377

Query  363  QPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
             PNPN+ +G +VGGP  N+ + D R+N  Q E  TYN+A  VG+L+ L
Sbjct  378  DPNPNIIIGAIVGGPDKNDDFEDRRDNFRQTEACTYNTAAFVGVLARL  425



>ref|XP_003601390.1| Endoglucanase [Medicago truncatula]
 gb|AES71641.1| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=525

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 100/166 (60%), Gaps = 6/166 (4%)
 Frame = -3

Query  708  TATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKF  529
            ++   RT +GL+++ QWN +Q+   +AFL  VYSD+ L +   KI C        ++  F
Sbjct  339  SSNVERTPAGLLYVRQWNNMQYVSTAAFLLTVYSDF-LQTENQKINCQDGIVGHDEILNF  397

Query  528  AMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLEST  364
            A SQ DY+LG NP+ MSYLVGYG  YPK VHHRGASI          GC  G+  W    
Sbjct  398  AKSQVDYILGQNPLNMSYLVGYGPKYPKRVHHRGASIVSYRENKGFIGCTQGYDNWYGVQ  457

Query  363  QPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  226
            +PNPN+ VG LVGGP   + + D RNN +Q E  TYN+A +VG+ +
Sbjct  458  EPNPNILVGALVGGPDNQDNFEDQRNNYVQTEACTYNTAPLVGVFA  503



>ref|XP_009589429.1| PREDICTED: endoglucanase 11-like [Nicotiana tomentosiformis]
Length=515

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 101/168 (60%), Gaps = 6/168 (4%)
 Frame = -3

Query  708  TATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKF  529
            ++   RT +GL+++ QWN +Q+   SAFL  VYSD++  S   KI+C        DL  F
Sbjct  337  SSNVERTPAGLLYVRQWNNMQYVSTSAFLLTVYSDFLQKS-NQKISCSEGIVDHIDLFNF  395

Query  528  AMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGFK-WLEST  364
            A SQ DY+LG NP  MSYLVG+G NYPK VHHRGASI          GC  G+  W    
Sbjct  396  AKSQVDYILGLNPRNMSYLVGFGPNYPKRVHHRGASIVSYRENKGFIGCTQGYDYWYNRD  455

Query  363  QPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            +PNPN+ +G LVGGP   + + D R N +Q E  TYN+A +VG+ + L
Sbjct  456  EPNPNILIGALVGGPDNQDNFEDDRANYVQTEACTYNTAPLVGIFAKL  503



>ref|XP_009802592.1| PREDICTED: endoglucanase 11-like [Nicotiana sylvestris]
Length=519

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 100/168 (60%), Gaps = 6/168 (4%)
 Frame = -3

Query  708  TATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKF  529
            ++   RT  GL+++ QWN +Q+   SAFL  VYSD++  S   KI+C        DL  F
Sbjct  341  SSNVERTPGGLLYVRQWNNMQYVSTSAFLLSVYSDFLQKS-NQKISCSEGIVDHEDLFNF  399

Query  528  AMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGFK-WLEST  364
            A SQ DY+LG NP  MSYLVG+G NYPK VHHRGASI          GC  G+  W    
Sbjct  400  AKSQVDYILGFNPRNMSYLVGFGPNYPKRVHHRGASIVSYRENKGFIGCTQGYDYWYNRD  459

Query  363  QPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            +PNPN+ +G LVGGP   + + D R N +Q E  TYN+A +VG+ + L
Sbjct  460  EPNPNILIGALVGGPDNQDNFEDDRANYVQTEACTYNTAPLVGIFAKL  507



>emb|CBI27137.3| unnamed protein product [Vitis vinifera]
Length=615

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 101/162 (62%), Gaps = 6/162 (4%)
 Frame = -3

Query  690  TDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQAD  511
            T  GLV++ +WN +Q+  ++AFL  VYSDY LS+  A + C      P +L  FA SQAD
Sbjct  332  TPGGLVYLHEWNNMQYASSAAFLLAVYSDY-LSAENAVLKCPDAQVQPYELLNFAKSQAD  390

Query  510  YVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDA----TTGCKDGFK-WLESTQPNPNV  346
            Y+LG NP  MSYLVGYG  YP + HHRG+SI + A    T GC +GF+ W    + NPNV
Sbjct  391  YILGKNPKSMSYLVGYGQKYPVHAHHRGSSIASVAVLHSTVGCVEGFESWYHRPEANPNV  450

Query  345  AVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
              GGLVGGP  N+ + D R+N  Q EPT    A +VGL S L
Sbjct  451  IYGGLVGGPDKNDGFSDDRSNYEQTEPTLSGGAPLVGLFSKL  492



>ref|XP_004168441.1| PREDICTED: endoglucanase 13-like, partial [Cucumis sativus]
Length=491

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 100/163 (61%), Gaps = 6/163 (4%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            RT +GL+W   WN LQ+  ++AFLA VYSDY LSS+ A I C      PSDL  FA SQ 
Sbjct  329  RTPAGLLWFQPWNNLQYVTSAAFLATVYSDY-LSSKHASIQCPSARVHPSDLISFAKSQV  387

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT---DAT-TGCKDGFK-WLESTQPNPN  349
            DY+LG NP  MSY+VG+G  YP   HHRGASI +   D T   C  GF  W     PNPN
Sbjct  388  DYILGSNPSGMSYMVGFGSKYPTQPHHRGASIVSIKRDHTPVTCHGGFDLWFNRNGPNPN  447

Query  348  VAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            V  G +VGGP  N+ Y DSR+N   AEP T   A ++G+L+ L
Sbjct  448  VLHGAVVGGPDPNDVYWDSRSNFKTAEPATVTPAPLIGVLARL  490



>ref|XP_002277177.2| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 5 [Vitis vinifera]
Length=611

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 101/162 (62%), Gaps = 6/162 (4%)
 Frame = -3

Query  690  TDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQAD  511
            T  GLV++ +WN +Q+  ++AFL  VYSDY LS+  A + C      P +L  FA SQAD
Sbjct  332  TPGGLVYLHEWNNMQYASSAAFLLAVYSDY-LSAENAVLKCPDAQVQPYELLNFAKSQAD  390

Query  510  YVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDA----TTGCKDGFK-WLESTQPNPNV  346
            Y+LG NP  MSYLVGYG  YP + HHRG+SI + A    T GC +GF+ W    + NPNV
Sbjct  391  YILGKNPKSMSYLVGYGQKYPVHAHHRGSSIASVAVLHSTVGCVEGFESWYHRPEANPNV  450

Query  345  AVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
              GGLVGGP  N+ + D R+N  Q EPT    A +VGL S L
Sbjct  451  IYGGLVGGPDKNDGFSDDRSNYEQTEPTLSGGAPLVGLFSKL  492



>gb|AFW74700.1| hypothetical protein ZEAMMB73_090741 [Zea mays]
Length=398

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 99/158 (63%), Gaps = 4/158 (3%)
 Frame = -3

Query  681  GLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQADYVL  502
            G++W+  WN LQ   ++AF+   +SD++  +  + + C      PS L  FA SQADY+L
Sbjct  237  GVLWLEPWNNLQFVTSAAFVVAAHSDHLAGAAASSLRCGAATLPPSQLLAFARSQADYIL  296

Query  501  GDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT----GCKDGFKWLESTQPNPNVAVGG  334
            G NP +MSY+VGYG  +P+ VHHRGAS+P+  ++     CK GF +     PNPNV VG 
Sbjct  297  GANPERMSYMVGYGARFPEQVHHRGASVPSIKSSPGKITCKGGFAYYSRDTPNPNVLVGA  356

Query  333  LVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            +VGGP  N+ Y DSR N  Q EP+T   A +VG+L+ L
Sbjct  357  IVGGPDGNDRYDDSRPNYKQTEPSTVTVAPMVGVLARL  394



>gb|KGN46280.1| hypothetical protein Csa_6G079740 [Cucumis sativus]
Length=470

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 100/163 (61%), Gaps = 6/163 (4%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            RT +GL+W   WN LQ+  ++AFLA VYSDY LSS+ A I C      PSDL  FA SQ 
Sbjct  308  RTPAGLLWFQPWNNLQYVTSAAFLATVYSDY-LSSKHASIQCPSARVHPSDLISFAKSQV  366

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT---DAT-TGCKDGFK-WLESTQPNPN  349
            DY+LG NP  MSY+VG+G  YP   HHRGASI +   D T   C  GF  W     PNPN
Sbjct  367  DYILGSNPSGMSYMVGFGSKYPTQPHHRGASIVSIKRDHTPVTCHGGFDLWFNRNGPNPN  426

Query  348  VAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            V  G +VGGP  N+ Y DSR+N   AEP T   A ++G+L+ L
Sbjct  427  VLHGAVVGGPDPNDVYWDSRSNFKTAEPATVTPAPLIGVLARL  469



>ref|XP_006843615.1| hypothetical protein AMTR_s00007p00145080 [Amborella trichopoda]
 gb|ERN05290.1| hypothetical protein AMTR_s00007p00145080 [Amborella trichopoda]
Length=215

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 110/170 (65%), Gaps = 7/170 (4%)
 Frame = -3

Query  708  TATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTA--KITCDGKYYTPSDLR  535
            T+ +  T  GL+W++ W  LQ+   ++FL  VYSD++ ++R     + C      PS+L 
Sbjct  42   TSNARTTPGGLLWLNPWINLQYISTASFLLTVYSDFLSTARGGPRSLMCPAGQVQPSELL  101

Query  534  KFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT---DAT-TGCKDGFK-WLE  370
             FA SQ DY+LG NP  +SY+VGYG +YP +VHHRGASI +   D T  GC+DG K W +
Sbjct  102  SFARSQVDYILGTNPKAVSYMVGYGSSYPWHVHHRGASIVSVKKDPTPVGCEDGLKIWFD  161

Query  369  STQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            +T P+PNV  GG+VGGP  N+ + D+R+   Q++P  Y +A +VG+L+ L
Sbjct  162  NTGPDPNVIDGGVVGGPDENDAFGDNRSLMAQSQPAIYTTAPLVGVLAKL  211



>ref|XP_006452448.1| hypothetical protein CICLE_v10007984mg [Citrus clementina]
 gb|ESR65688.1| hypothetical protein CICLE_v10007984mg [Citrus clementina]
Length=529

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 98/163 (60%), Gaps = 6/163 (4%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            RT  GL++I QWN +Q+   +AFL  VY DY L S    + CD    TP +L  FA SQ 
Sbjct  350  RTPGGLLYIRQWNNMQYVSTAAFLLTVYGDY-LQSTNQTLKCDRGTLTPQELFDFAKSQV  408

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDGF-KWLESTQPNPN  349
            DY+LG NPM +SYLVGYG  +P+ +HHRG S  +        GC  G+  W +   PNPN
Sbjct  409  DYILGSNPMAVSYLVGYGSKFPQRMHHRGGSTVSYKQDQGFIGCTQGYDDWFKRLDPNPN  468

Query  348  VAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            V VG LVGGP   + + D R+N +Q E  TYN+A +VG+ + L
Sbjct  469  VVVGALVGGPDEKDQFRDERSNFVQTEACTYNTATLVGVFAKL  511



>ref|XP_006447630.1| hypothetical protein CICLE_v10014884mg [Citrus clementina]
 ref|XP_006469628.1| PREDICTED: endoglucanase 11-like [Citrus sinensis]
 gb|ESR60870.1| hypothetical protein CICLE_v10014884mg [Citrus clementina]
 gb|KDO54286.1| hypothetical protein CISIN_1g009690mg [Citrus sinensis]
Length=528

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 97/163 (60%), Gaps = 6/163 (4%)
 Frame = -3

Query  693  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  514
            RT  GL++I  WN +Q+   +AFL  +YSD +L S    + C+G+     ++  FA SQ 
Sbjct  350  RTRGGLLYIRPWNNMQYVSTAAFLLTIYSDLLLDSNQP-LNCNGEIVGHQEILSFAKSQV  408

Query  513  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKDGF-KWLESTQPNPN  349
            DY+LG NPM MSYLVGYG  YP  VHHRGASI          GC  G+  W      NPN
Sbjct  409  DYILGSNPMNMSYLVGYGPKYPTRVHHRGASIVSYRENKGFIGCTQGYDNWYSRVDQNPN  468

Query  348  VAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  220
            V VG LVGGP   + ++D RNN MQ E  TYN+A +VG+ + L
Sbjct  469  VIVGALVGGPDWRDNFMDQRNNYMQTEACTYNTAPLVGVFAKL  511



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1233376381380