BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF036E19

Length=739
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAA64415.1|  lipoxygenase (LOX)                                     310   2e-102   Solanum lycopersicum
ref|NP_001274916.1|  probable linoleate 9S-lipoxygenase 5               328   3e-102   Solanum tuberosum [potatoes]
ref|XP_004244890.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    328   3e-102   Solanum lycopersicum
gb|ACO57136.1|  lipoxygenase 1                                          325   3e-101   Capsicum annuum
ref|XP_010102744.1|  putative linoleate 9S-lipoxygenase 5               325   4e-101   
ref|XP_010041703.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    305   6e-101   Eucalyptus grandis [rose gum]
ref|XP_008245951.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    313   2e-100   Prunus mume [ume]
emb|CAD10740.1|  lipoxygenase                                           323   3e-100   Corylus avellana [European hazelnut]
gb|AGL96414.1|  9-lipoxygenase                                          322   5e-100   Nicotiana benthamiana
gb|AAO12866.1|  lipoxygenase                                            305   7e-100   Vitis vinifera
ref|XP_009610900.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    321   7e-100   Nicotiana tomentosiformis
emb|CAA58859.1|  lipoxygenase                                           321   8e-100   Nicotiana tabacum [American tobacco]
ref|XP_009774053.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    320   2e-99    Nicotiana sylvestris
ref|XP_004309944.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    319   4e-99    Fragaria vesca subsp. vesca
gb|AAZ04411.1|  lipoxygenase                                            318   1e-98    Cynanchum gracillimum
ref|XP_007030817.1|  Lipoxygenase 1                                     318   2e-98    
gb|ABW75772.2|  lipoxygenase                                            318   2e-98    Camellia sinensis [black tea]
ref|XP_009787604.1|  PREDICTED: linoleate 9S-lipoxygenase 6             317   3e-98    Nicotiana sylvestris
emb|CAA64769.1|  lipoxygenase                                           313   4e-98    Solanum tuberosum [potatoes]
ref|XP_006382594.1|  hypothetical protein POPTR_0005s03560g             316   7e-98    Populus trichocarpa [western balsam poplar]
ref|XP_011023610.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    316   7e-98    Populus euphratica
emb|CDP15504.1|  unnamed protein product                                315   1e-97    Coffea canephora [robusta coffee]
gb|AFU51542.1|  lipoxygenase 3                                          315   1e-97    Capsicum annuum
gb|AAP83134.1|  lipoxygenase                                            315   2e-97    Nicotiana attenuata
ref|XP_006355846.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    312   2e-97    
gb|AAP83135.1|  lipoxygenase                                            315   2e-97    Nicotiana attenuata
ref|XP_006382593.1|  hypothetical protein POPTR_0005s03550g             315   2e-97    
emb|CBI36802.3|  unnamed protein product                                316   2e-97    Vitis vinifera
gb|AGK82779.1|  lipoxygenase                                            317   2e-97    Malus domestica [apple tree]
ref|XP_002319014.2|  lipoxygenase family protein                        314   2e-97    
gb|ABF60001.1|  lipoxygenase 5                                          303   3e-97    Actinidia deliciosa [Chinese gooseberry]
gb|AGU28274.1|  lipoxygenase 1                                          314   3e-97    Vitis vinifera
gb|ACG56281.1|  lipoxygenase                                            314   3e-97    Olea europaea
emb|CDP20620.1|  unnamed protein product                                312   4e-97    Coffea canephora [robusta coffee]
gb|AEZ50135.1|  lipoxygenase                                            305   5e-97    Diospyros kaki [Japanese persimmon]
ref|XP_010659859.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    314   5e-97    Vitis vinifera
gb|AAK50778.4|AF361893_1  bacterial-induced lipoxygenase                313   6e-97    Gossypium hirsutum [American cotton]
sp|P37831.1|LOX11_SOLTU  RecName: Full=Linoleate 9S-lipoxygenase ...    313   9e-97    Solanum tuberosum [potatoes]
sp|O22508.1|LOX18_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    313   9e-97    Solanum tuberosum [potatoes]
ref|NP_001234098.1|  lipoxygenase                                       313   1e-96    Solanum lycopersicum
ref|XP_008246453.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    315   1e-96    
emb|CDP20618.1|  unnamed protein product                                313   1e-96    Coffea canephora [robusta coffee]
sp|Q41238.1|LOX16_SOLTU  RecName: Full=Linoleate 9S-lipoxygenase ...    312   2e-96    Solanum tuberosum [potatoes]
ref|XP_011036799.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    312   2e-96    Populus euphratica
gb|ABF19102.2|  9-lipoxygenase                                          312   2e-96    Capsicum annuum
ref|XP_004302420.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    312   2e-96    Fragaria vesca subsp. vesca
ref|XP_009597615.1|  PREDICTED: linoleate 9S-lipoxygenase 6             312   2e-96    Nicotiana tomentosiformis
ref|NP_001275351.1|  5-lipoxygenase                                     312   3e-96    Solanum tuberosum [potatoes]
ref|NP_001275169.1|  probable linoleate 9S-lipoxygenase 8-like          312   3e-96    Solanum tuberosum [potatoes]
sp|O22507.1|LOX17_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    311   3e-96    Solanum tuberosum [potatoes]
gb|KJB80991.1|  hypothetical protein B456_013G124500                    308   3e-96    Gossypium raimondii
ref|XP_011087404.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    312   3e-96    Sesamum indicum [beniseed]
sp|Q43190.1|LOX14_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    311   3e-96    Solanum tuberosum [potatoes]
ref|NP_001275357.1|  linoleate 9S-lipoxygenase 2                        311   4e-96    Solanum tuberosum [potatoes]
ref|XP_010659819.1|  PREDICTED: lipoxygenase isoform X1                 311   4e-96    
ref|XP_007208098.1|  hypothetical protein PRUPE_ppa001293mg             311   5e-96    Prunus persica
ref|NP_001234856.1|  linoleate 9S-lipoxygenase A                        311   5e-96    Solanum lycopersicum
ref|XP_009365899.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    299   5e-96    Pyrus x bretschneideri [bai li]
sp|Q43189.1|LOX13_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    310   1e-95    Solanum tuberosum [potatoes]
emb|CAA64765.1|  lipoxygenase                                           310   1e-95    Solanum tuberosum [potatoes]
emb|CAD10779.2|  lipoxygenase                                           310   1e-95    Prunus dulcis [sweet almond]
gb|KCW61801.1|  hypothetical protein EUGRSUZ_H044981                    308   1e-95    Eucalyptus grandis [rose gum]
emb|CAB94852.1|  lipoxygenase                                           310   2e-95    Prunus dulcis [sweet almond]
ref|XP_009790810.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    309   3e-95    Nicotiana sylvestris
ref|XP_007208096.1|  hypothetical protein PRUPE_ppa001287mg             309   3e-95    
ref|NP_001268178.1|  lipoxygenase                                       309   4e-95    Vitis vinifera
ref|XP_010025195.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    309   4e-95    Eucalyptus grandis [rose gum]
ref|XP_009376659.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    308   5e-95    Pyrus x bretschneideri [bai li]
ref|XP_010025194.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    309   5e-95    Eucalyptus grandis [rose gum]
ref|XP_007204937.1|  hypothetical protein PRUPE_ppa001311mg             308   5e-95    
ref|NP_001281030.1|  probable linoleate 9S-lipoxygenase 5               308   5e-95    Malus domestica [apple tree]
ref|XP_006344621.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    308   6e-95    Solanum tuberosum [potatoes]
ref|XP_006472029.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    307   7e-95    Citrus sinensis [apfelsine]
gb|KJB80990.1|  hypothetical protein B456_013G124500                    308   9e-95    Gossypium raimondii
ref|XP_009625817.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    307   9e-95    
ref|XP_010094673.1|  putative linoleate 9S-lipoxygenase 5               306   9e-95    
gb|KJB80989.1|  hypothetical protein B456_013G124500                    308   1e-94    Gossypium raimondii
gb|KDO56302.1|  hypothetical protein CISIN_1g002839mg                   308   1e-94    Citrus sinensis [apfelsine]
ref|XP_006433338.1|  hypothetical protein CICLE_v10000236mg             308   1e-94    Citrus clementina [clementine]
gb|AHX56187.1|  lipoxygenase                                            307   2e-94    Diospyros kaki [Japanese persimmon]
ref|XP_011092040.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    307   2e-94    Sesamum indicum [beniseed]
ref|XP_011092039.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    307   2e-94    Sesamum indicum [beniseed]
ref|XP_010256003.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    307   2e-94    Nelumbo nucifera [Indian lotus]
gb|KGN60916.1|  hypothetical protein Csa_2G023340                       297   2e-94    Cucumis sativus [cucumbers]
ref|XP_010025193.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    306   3e-94    Eucalyptus grandis [rose gum]
ref|XP_007034722.1|  PLAT/LH2 domain-containing lipoxygenase fami...    296   3e-94    
ref|XP_008246456.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    307   4e-94    Prunus mume [ume]
ref|XP_011092038.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    306   5e-94    Sesamum indicum [beniseed]
ref|XP_011092037.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    306   5e-94    Sesamum indicum [beniseed]
ref|XP_009621679.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    305   7e-94    Nicotiana tomentosiformis
gb|AES82497.2|  linoleate 9S-lipoxygenase-like protein                  305   7e-94    Medicago truncatula
gb|AGN75068.1|  lipoxygenase 2                                          305   9e-94    Momordica charantia [balsam pear]
ref|XP_009365971.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    296   9e-94    
ref|XP_009779646.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    304   1e-93    Nicotiana sylvestris
ref|XP_009625816.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    304   1e-93    
ref|XP_009779645.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    304   2e-93    Nicotiana sylvestris
ref|XP_002315780.1|  lipoxygenase family protein                        304   3e-93    
emb|CDO99039.1|  unnamed protein product                                304   4e-93    Coffea canephora [robusta coffee]
ref|XP_002512386.1|  lipoxygenase, putative                             304   4e-93    Ricinus communis
ref|XP_010025196.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    303   4e-93    Eucalyptus grandis [rose gum]
emb|CAN62372.1|  hypothetical protein VITISV_036476                     287   5e-93    Vitis vinifera
ref|XP_011021548.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    303   7e-93    Populus euphratica
ref|XP_011021549.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    303   8e-93    Populus euphratica
ref|XP_010094672.1|  putative linoleate 9S-lipoxygenase 5               301   1e-92    
gb|EPS72460.1|  lipoxygenase                                            287   2e-92    Genlisea aurea
ref|XP_009774054.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    301   3e-92    Nicotiana sylvestris
gb|AGI16377.1|  lipoxygenase                                            301   4e-92    Malus domestica [apple tree]
ref|XP_008370478.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    300   5e-92    
ref|XP_003536076.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    301   5e-92    Glycine max [soybeans]
ref|XP_007034721.1|  PLAT/LH2 domain-containing lipoxygenase fami...    296   5e-92    
gb|AGI16382.1|  lipoxygenase                                            300   5e-92    Malus domestica [apple tree]
gb|AGI16379.1|  lipoxygenase                                            300   6e-92    Malus domestica [apple tree]
gb|AGK82798.1|  lipoxygenase                                            300   6e-92    Malus domestica [apple tree]
gb|ABF60002.1|  lipoxygenase 2                                          300   7e-92    Actinidia deliciosa [Chinese gooseberry]
gb|KGN48009.1|  Lipoxygenase                                            293   7e-92    Cucumis sativus [cucumbers]
gb|AGI16380.1|  lipoxygenase                                            300   7e-92    Malus domestica [apple tree]
ref|XP_006344836.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    300   8e-92    Solanum tuberosum [potatoes]
ref|XP_007147045.1|  hypothetical protein PHAVU_006G091400g             300   1e-91    Phaseolus vulgaris [French bean]
ref|XP_010108010.1|  Linoleate 9S-lipoxygenase 5                        300   1e-91    Morus notabilis
ref|XP_009365900.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    300   1e-91    Pyrus x bretschneideri [bai li]
ref|XP_009407551.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    300   1e-91    Musa acuminata subsp. malaccensis [pisang utan]
gb|AGI16378.1|  lipoxygenase                                            299   1e-91    Malus domestica [apple tree]
ref|XP_006838252.1|  hypothetical protein AMTR_s00103p00053060          282   2e-91    
gb|EYU42168.1|  hypothetical protein MIMGU_mgv1a001215mg                299   2e-91    Erythranthe guttata [common monkey flower]
ref|XP_008370477.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    301   2e-91    
gb|KDP40158.1|  hypothetical protein JCGZ_02156                         299   2e-91    Jatropha curcas
ref|XP_004139173.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    298   4e-91    Cucumis sativus [cucumbers]
ref|XP_008454526.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    298   5e-91    
ref|XP_006419898.1|  hypothetical protein CICLE_v10004281mg             298   6e-91    Citrus clementina [clementine]
ref|XP_003626279.1|  Chalcone synthase                                  302   6e-91    
ref|XP_010468375.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    280   7e-91    Camelina sativa [gold-of-pleasure]
ref|XP_008801705.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    297   8e-91    Phoenix dactylifera
gb|KDO74648.1|  hypothetical protein CISIN_1g002776mg                   296   1e-90    Citrus sinensis [apfelsine]
ref|XP_002319015.2|  hypothetical protein POPTR_0013s02310g             296   2e-90    
ref|XP_004156418.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    296   2e-90    
gb|ADN92993.2|  lipoxygenase LOX1                                       296   2e-90    Ipomoea nil [qian niu]
ref|XP_008348093.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    296   2e-90    
ref|XP_004170689.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    283   2e-90    
ref|XP_009626059.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    296   3e-90    Nicotiana tomentosiformis
gb|KDO74647.1|  hypothetical protein CISIN_1g002776mg                   296   3e-90    Citrus sinensis [apfelsine]
ref|XP_010277588.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    292   3e-90    
gb|AGH13205.1|  lipoxygenase                                            295   3e-90    Salvia miltiorrhiza [Chinese salvia]
ref|XP_009626058.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    296   4e-90    Nicotiana tomentosiformis
ref|XP_003591120.1|  Lipoxygenase                                       295   5e-90    Medicago truncatula
gb|KDP23508.1|  hypothetical protein JCGZ_23341                         295   5e-90    Jatropha curcas
ref|XP_004150981.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    280   5e-90    
ref|XP_006359918.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    295   7e-90    Solanum tuberosum [potatoes]
ref|XP_003521704.2|  PREDICTED: probable linoleate 9S-lipoxygenas...    295   8e-90    Glycine max [soybeans]
ref|XP_006359917.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    295   9e-90    Solanum tuberosum [potatoes]
ref|XP_007144726.1|  hypothetical protein PHAVU_007G179600g             295   9e-90    Phaseolus vulgaris [French bean]
gb|KHN03989.1|  Putative linoleate 9S-lipoxygenase 5                    295   9e-90    Glycine soja [wild soybean]
ref|XP_004231274.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    294   1e-89    Solanum lycopersicum
ref|XP_010674736.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    294   1e-89    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010326551.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    294   1e-89    Solanum lycopersicum
emb|CDY70916.1|  BnaCnng70330D                                          285   2e-89    Brassica napus [oilseed rape]
gb|EYU26430.1|  hypothetical protein MIMGU_mgv1a023655mg                295   2e-89    Erythranthe guttata [common monkey flower]
ref|XP_008465603.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    280   2e-89    
ref|XP_009763875.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    294   2e-89    Nicotiana sylvestris
ref|XP_010326548.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    294   2e-89    
ref|XP_011026284.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    294   2e-89    Populus euphratica
ref|XP_002311617.1|  lipoxygenase family protein                        294   3e-89    Populus trichocarpa [western balsam poplar]
ref|XP_009763870.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    294   3e-89    Nicotiana sylvestris
ref|XP_011026291.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    293   3e-89    Populus euphratica
ref|XP_004156417.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    293   3e-89    
ref|XP_004139172.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    293   3e-89    Cucumis sativus [cucumbers]
gb|AGK82783.1|  lipoxygenase                                            293   4e-89    Malus domestica [apple tree]
ref|NP_001280980.1|  probable linoleate 9S-lipoxygenase 5               293   5e-89    Malus domestica [apple tree]
gb|AGK82775.1|  lipoxygenase                                            293   6e-89    Malus domestica [apple tree]
ref|XP_006344623.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    292   7e-89    Solanum tuberosum [potatoes]
gb|AGK82776.1|  lipoxygenase                                            293   7e-89    Malus domestica [apple tree]
ref|XP_009387658.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    292   7e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010277584.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    293   7e-89    Nelumbo nucifera [Indian lotus]
ref|XP_002516771.1|  lipoxygenase, putative                             292   8e-89    
gb|AHI86055.1|  lipoxygenase                                            292   8e-89    Cucumis melo var. makuwa
ref|NP_001267584.1|  probable linoleate 9S-lipoxygenase 5-like          292   9e-89    Cucumis sativus [cucumbers]
ref|XP_008449553.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    292   9e-89    Cucumis melo [Oriental melon]
ref|XP_004494612.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    291   1e-88    Cicer arietinum [garbanzo]
ref|XP_011023611.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    291   1e-88    Populus euphratica
ref|XP_009415714.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    291   2e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008454481.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        291   2e-88    Cucumis melo [Oriental melon]
ref|XP_006589595.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    280   3e-88    Glycine max [soybeans]
gb|AGK82774.1|  lipoxygenase                                            291   4e-88    Malus domestica [apple tree]
gb|ABZ05753.1|  lipoxygenase                                            284   7e-88    Prunus armeniaca
ref|XP_010905215.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    290   8e-88    Elaeis guineensis
gb|KHF98567.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              288   1e-87    Gossypium arboreum [tree cotton]
gb|KHF98566.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              288   1e-87    Gossypium arboreum [tree cotton]
ref|XP_004496744.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    289   1e-87    
ref|XP_002278007.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    288   2e-87    Vitis vinifera
ref|XP_009387657.1|  PREDICTED: linoleate 9S-lipoxygenase A-like        288   3e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010935040.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    288   3e-87    
ref|XP_006392468.1|  hypothetical protein EUTSA_v10023267mg             288   3e-87    Eutrema salsugineum [saltwater cress]
ref|XP_004296897.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    288   3e-87    Fragaria vesca subsp. vesca
ref|XP_006300394.1|  hypothetical protein CARUB_v10019783mg             288   4e-87    Capsella rubella
gb|AEZ50136.1|  lipoxygenase                                            288   4e-87    
gb|AHX56188.1|  lipoxygenase                                            288   4e-87    Diospyros kaki [Japanese persimmon]
ref|XP_010553735.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        287   5e-87    Tarenaya hassleriana [spider flower]
ref|XP_009119596.1|  PREDICTED: linoleate 9S-lipoxygenase 1             287   5e-87    Brassica rapa
ref|XP_009344082.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    288   5e-87    
gb|KCW61799.1|  hypothetical protein EUGRSUZ_H04497                     281   5e-87    Eucalyptus grandis [rose gum]
ref|XP_004139356.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    287   6e-87    Cucumis sativus [cucumbers]
ref|XP_004169780.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    287   7e-87    
gb|KHG03761.1|  Linoleate 9S-lipoxygenase 5, chloroplastic -like ...    287   8e-87    Gossypium arboreum [tree cotton]
ref|XP_011090735.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    287   8e-87    Sesamum indicum [beniseed]
ref|XP_009418148.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    286   1e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011090733.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    286   1e-86    Sesamum indicum [beniseed]
gb|ABV32552.1|  lipoxygenase                                            287   2e-86    Prunus persica
gb|KFK39531.1|  hypothetical protein AALP_AA3G256400                    286   2e-86    Arabis alpina [alpine rockcress]
emb|CAE17327.1|  lipoxygenase                                           286   3e-86    Fragaria x ananassa
gb|KJB38138.1|  hypothetical protein B456_006G238200                    285   3e-86    Gossypium raimondii
ref|XP_006344622.1|  PREDICTED: linoleate 9S-lipoxygenase B-like        285   3e-86    Solanum tuberosum [potatoes]
ref|XP_002891934.1|  hypothetical protein ARALYDRAFT_474776             285   3e-86    
gb|AIC82456.1|  lipoxygenase                                            285   3e-86    Cocos nucifera
ref|XP_010414944.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        285   3e-86    Camelina sativa [gold-of-pleasure]
ref|XP_008340970.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    285   3e-86    
gb|AEQ30071.1|  lipoxygenase                                            285   4e-86    Litchi chinensis [litchi]
gb|KJB38137.1|  hypothetical protein B456_006G238200                    286   4e-86    Gossypium raimondii
gb|KJB28315.1|  hypothetical protein B456_005G041900                    285   5e-86    Gossypium raimondii
ref|XP_010323943.1|  PREDICTED: lipoxygenase isoform X1                 285   5e-86    
ref|XP_010323952.1|  PREDICTED: lipoxygenase isoform X3                 284   5e-86    
ref|XP_004230206.1|  PREDICTED: lipoxygenase isoform X2                 284   6e-86    
ref|XP_010511239.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        284   6e-86    Camelina sativa [gold-of-pleasure]
gb|AAM28285.1|  lipoxygenase I                                          270   7e-86    Ananas comosus
ref|NP_175900.1|  lipoxygenase 1                                        284   7e-86    Arabidopsis thaliana [mouse-ear cress]
gb|AAD09202.1|  lipoxygenase                                            284   7e-86    Solanum tuberosum [potatoes]
gb|KFK35599.1|  hypothetical protein AALP_AA4G012300                    284   7e-86    Arabis alpina [alpine rockcress]
gb|KFK35600.1|  hypothetical protein AALP_AA4G012300                    284   7e-86    Arabis alpina [alpine rockcress]
gb|ACH91370.1|  lipoxygenase LOX-3                                      285   8e-86    Prunus persica
emb|CAP59449.1|  lipoxygenase                                           284   9e-86    Momordica charantia [balsam pear]
ref|XP_009366923.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    284   1e-85    Pyrus x bretschneideri [bai li]
gb|AAO03558.1|  lipoxygenase 1                                          283   1e-85    Brassica napus [oilseed rape]
ref|XP_007208102.1|  hypothetical protein PRUPE_ppa001216mg             283   2e-85    
ref|XP_008454500.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    283   2e-85    Cucumis melo [Oriental melon]
ref|XP_010549787.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        283   2e-85    Tarenaya hassleriana [spider flower]
ref|XP_010480214.1|  PREDICTED: linoleate 9S-lipoxygenase 1             283   2e-85    Camelina sativa [gold-of-pleasure]
ref|XP_004302419.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    283   3e-85    Fragaria vesca subsp. vesca
ref|XP_004495725.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    282   3e-85    Cicer arietinum [garbanzo]
ref|XP_002883361.1|  lipoxygenase                                       282   4e-85    
gb|ACU81176.1|  13S-lipoxygenase                                        282   4e-85    Cucumis melo var. inodorus [casaba melon]
gb|KJB80909.1|  hypothetical protein B456_013G121100                    266   4e-85    Gossypium raimondii
ref|XP_008454470.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        282   5e-85    Cucumis melo [Oriental melon]
ref|NP_001234873.1|  linoleate 9S-lipoxygenase B                        281   7e-85    
gb|AAA74393.1|  lipoxygenase                                            281   7e-85    Solanum lycopersicum
ref|XP_010324011.1|  PREDICTED: linoleate 9S-lipoxygenase B isofo...    281   7e-85    
ref|XP_004230207.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    281   7e-85    Solanum lycopersicum
gb|AJD18612.1|  lipoxygenase                                            271   7e-85    Pyrus ussuriensis [Harbin pear]
emb|CDY43490.1|  BnaA01g21450D                                          285   9e-85    Brassica napus [oilseed rape]
ref|XP_007030815.1|  Lipoxygenase 1                                     281   1e-84    
ref|XP_007225308.1|  hypothetical protein PRUPE_ppa001207mg             281   1e-84    Prunus persica
ref|XP_003597559.1|  Seed lipoxygenase-3                                281   1e-84    Medicago truncatula
gb|ABF19103.2|  9-lipoxygenase                                          281   1e-84    Capsicum annuum
ref|XP_007030813.1|  Lipoxygenase 1                                     280   1e-84    
ref|XP_008246451.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    281   1e-84    Prunus mume [ume]
ref|XP_007150490.1|  hypothetical protein PHAVU_005G157000g             280   2e-84    Phaseolus vulgaris [French bean]
gb|KHN02707.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              280   2e-84    Glycine soja [wild soybean]
ref|XP_007208174.1|  hypothetical protein PRUPE_ppa001016mg             281   2e-84    Prunus persica
ref|XP_006382595.1|  hypothetical protein POPTR_0005s03580g             280   2e-84    Populus trichocarpa [western balsam poplar]
emb|CAC19365.1|  lipoxygenase                                           280   2e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008245950.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    281   3e-84    Prunus mume [ume]
ref|NP_188879.2|  lipoxygenase 5                                        280   3e-84    Arabidopsis thaliana [mouse-ear cress]
sp|P09918.1|LOX3_PEA  RecName: Full=Seed linoleate 9S-lipoxygenas...    280   3e-84    Pisum sativum [garden pea]
ref|XP_010488263.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    280   3e-84    Camelina sativa [gold-of-pleasure]
dbj|BAB01777.1|  lipoxygenase                                           280   3e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010488264.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    280   4e-84    Camelina sativa [gold-of-pleasure]
ref|XP_008777614.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        280   4e-84    Phoenix dactylifera
ref|XP_010511287.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    280   4e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010024349.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    280   5e-84    Eucalyptus grandis [rose gum]
gb|ABB82552.1|  13S-lipoxygenase                                        280   5e-84    Cucumis melo var. inodorus [casaba melon]
gb|ADL41189.1|  lipoxygenase                                            279   5e-84    Camellia sinensis [black tea]
ref|XP_008246454.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    280   5e-84    Prunus mume [ume]
ref|XP_010934565.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    279   8e-84    Elaeis guineensis
gb|KHN32710.1|  Seed linoleate 9S-lipoxygenase-3                        278   8e-84    Glycine soja [wild soybean]
pdb|1ROV|A  Chain A, Lipoxygenase-3 Treated With Cumene Hydropero...    278   9e-84    Glycine max [soybeans]
ref|XP_004247367.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    278   1e-83    Solanum lycopersicum
emb|CAA31664.1|  unnamed protein product                                278   1e-83    Glycine max [soybeans]
ref|NP_001235383.1|  seed linoleate 9S-lipoxygenase-3                   278   1e-83    
sp|P09186.1|LOX3_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...    278   1e-83    Glycine max [soybeans]
gb|ADG03095.1|  lipoxygenase 3                                          278   1e-83    Glycine max [soybeans]
gb|ABX60408.1|  lipoxygenase L-3                                        278   1e-83    Glycine max [soybeans]
prf||1502333A  lipoxygenase 3                                           278   1e-83 
gb|AAA79186.1|  lipoxygenase                                            278   1e-83    
ref|XP_006296682.1|  hypothetical protein CARUB_v10012957mg             278   1e-83    
gb|KHN11255.1|  Linoleate 9S-lipoxygenase                               278   2e-83    
ref|XP_004139170.1|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...    278   2e-83    
ref|XP_006344625.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    278   2e-83    
ref|XP_004156415.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        278   2e-83    
gb|AAC61785.1|  lipoxygenase 1                                          278   2e-83    
ref|XP_008454503.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like ...    278   2e-83    
ref|XP_008454513.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like ...    278   2e-83    
emb|CAA63483.1|  lipoxygenase                                           278   2e-83    
ref|XP_006344624.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    277   2e-83    
dbj|BAH57745.1|  lipoxygenase                                           277   3e-83    
ref|XP_007143238.1|  hypothetical protein PHAVU_007G055800g             277   3e-83    
ref|XP_007030811.1|  Lipoxygenase 1                                     276   4e-83    
ref|XP_009774215.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    277   4e-83    
ref|XP_009376660.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    278   4e-83    
ref|XP_009376680.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    278   4e-83    
ref|XP_009376681.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    278   4e-83    
gb|KHN11257.1|  Linoleate 9S-lipoxygenase                               277   5e-83    
gb|AGI37654.1|  lipoxygenase                                            277   5e-83    
ref|XP_008246455.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    276   5e-83    
ref|XP_009626060.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    276   8e-83    
ref|XP_007143236.1|  hypothetical protein PHAVU_007G055600g             275   1e-82    
ref|XP_011036801.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    275   2e-82    
gb|KFK39529.1|  hypothetical protein AALP_AA3G256200                    273   2e-82    
ref|NP_001237338.1|  lipoxygenase-10                                    275   2e-82    
ref|NP_001281026.1|  probable linoleate 9S-lipoxygenase 5               276   2e-82    
ref|XP_010466519.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    275   2e-82    
ref|XP_008224534.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    275   3e-82    
gb|KJB26430.1|  hypothetical protein B456_004G241100                    274   3e-82    
gb|KHN15782.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              274   3e-82    
ref|XP_003556040.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    274   3e-82    
ref|XP_006406169.1|  hypothetical protein EUTSA_v10020023mg             274   6e-82    
ref|XP_008359870.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    274   7e-82    
ref|XP_010025191.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    273   8e-82    
gb|EPS66868.1|  lipoxygenase                                            257   9e-82    
ref|XP_010530359.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    273   9e-82    
gb|AAB20898.1|  lipoxygenase                                            268   1e-81    
ref|XP_008370473.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    274   1e-81    
ref|NP_001280815.1|  probable linoleate 9S-lipoxygenase 5               273   1e-81    
ref|XP_006850112.1|  hypothetical protein AMTR_s00022p00225940          257   1e-81    
gb|AAD09861.1|  lipoxygenase                                            273   1e-81    
gb|KHN11251.1|  Seed linoleate 9S-lipoxygenase-2                        273   2e-81    
ref|XP_003531596.1|  PREDICTED: seed linoleate 9S-lipoxygenase-3        272   2e-81    
ref|XP_008454430.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        273   2e-81    
gb|ACD43483.1|  lipoxygenase 1                                          272   2e-81    
ref|XP_006359922.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    272   2e-81    
ref|XP_010523550.1|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...    268   4e-81    
ref|XP_009376663.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    271   5e-81    
ref|XP_003531597.1|  PREDICTED: seed linoleate 9S-lipoxygenase-li...    271   5e-81    
gb|KHN01372.1|  Linoleate 9S-lipoxygenase 1                             255   5e-81    
gb|KHN11254.1|  Seed linoleate 9S-lipoxygenase                          271   5e-81    
ref|XP_003531600.2|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...    276   5e-81    
ref|XP_007135504.1|  hypothetical protein PHAVU_010G134700g             270   6e-81    
ref|XP_009376662.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    271   7e-81    
ref|XP_004139169.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    270   7e-81    
ref|XP_007135516.1|  hypothetical protein PHAVU_010G135900g             271   8e-81    
gb|AGS94394.3|  lipoxygenase                                            270   1e-80    
ref|XP_009406047.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        270   1e-80    
ref|XP_009406046.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        270   1e-80    
gb|EPS73035.1|  hypothetical protein M569_01717                         275   1e-80    
ref|XP_010556753.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    268   1e-80    
gb|AFH89626.1|  lipoxygenase                                            260   2e-80    
ref|XP_010667400.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    270   2e-80    
gb|AGI16414.1|  lipoxygenase                                            270   2e-80    
gb|EYU41500.1|  hypothetical protein MIMGU_mgv1a001165mg                270   2e-80    
gb|KHN16119.1|  Putative linoleate 9S-lipoxygenase 5                    269   2e-80    
gb|AGI16415.1|  lipoxygenase                                            270   2e-80    
gb|KHN11253.1|  Seed linoleate 9S-lipoxygenase-2                        269   2e-80    
gb|AAP04432.1|  lipoxygenase 1 protein                                  257   2e-80    
ref|XP_003592410.1|  Lipoxygenase                                       269   3e-80    
ref|XP_007150487.1|  hypothetical protein PHAVU_005G1568001g            259   3e-80    
ref|XP_004156414.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    269   3e-80    
ref|XP_007150489.1|  hypothetical protein PHAVU_005G156900g             268   4e-80    
gb|KHN28545.1|  Linoleate 9S-lipoxygenase-4                             253   5e-80    
gb|AGI16413.1|  lipoxygenase                                            268   5e-80    
ref|NP_001281022.1|  probable linoleate 9S-lipoxygenase 5               268   5e-80    
ref|XP_010674744.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    268   6e-80    
ref|XP_004486857.1|  PREDICTED: seed linoleate 9S-lipoxygenase-3-...    268   6e-80    
gb|KHN39332.1|  Seed linoleate 9S-lipoxygenase                          268   6e-80    
ref|XP_003627173.1|  Seed lipoxygenase-3                                268   7e-80    
ref|XP_004169568.1|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...    268   1e-79    
ref|XP_004150982.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        268   1e-79    
sp|P24095.1|LOXX_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...    267   1e-79    
ref|XP_010470259.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    264   2e-79    
gb|AAV50006.1|  lipoxygenase                                            249   2e-79    
ref|XP_007135515.1|  hypothetical protein PHAVU_010G135800g             267   2e-79    
ref|XP_007030814.1|  Lipoxygenase 1                                     266   2e-79    
gb|AGI16416.1|  lipoxygenase                                            267   2e-79    
gb|AAF15296.2|AF204210_1  lipoxygenase                                  266   3e-79    
gb|ACL54612.1|  unknown                                                 258   3e-79    
gb|AAC49285.1|  lipoxygenase                                            259   4e-79    
emb|CAA97845.1|  lipoxygenase                                           265   6e-79    
ref|XP_008388961.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    266   9e-79    
gb|ADR71860.1|  lipoxygenase-1                                          253   1e-78    
pdb|2IUK|A  Chain A, Crystal Structure Of Soybean Lipoxygenase-D        265   2e-78    
ref|XP_006650442.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        264   2e-78    
ref|NP_001238676.1|  seed linoleate 9S-lipoxygenase                     264   2e-78    
ref|XP_010470260.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    264   2e-78    
gb|KEH18416.1|  seed linoleate 9S-lipoxygenase                          258   3e-78    
ref|XP_007135512.1|  hypothetical protein PHAVU_010G135500g             263   3e-78    
gb|ABF98394.1|  Lipoxygenase 3, putative, expressed                     254   4e-78    
gb|EMS35711.1|  Putative lipoxygenase 3                                 259   4e-78    
gb|AAD32243.1|AF149803_1  lipoxygenase                                  260   5e-78    
ref|XP_009108895.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    263   5e-78    
gb|ACF84705.1|  unknown                                                 247   6e-78    
ref|XP_007135506.1|  hypothetical protein PHAVU_010G134900g             263   6e-78    
ref|XP_002458905.1|  hypothetical protein SORBIDRAFT_03g042440          263   7e-78    
gb|AGV54475.1|  lipoxygenase                                            263   7e-78    
emb|CDY64191.1|  BnaA01g36630D                                          263   8e-78    
gb|AAT07062.1|  lipoxygenase                                            244   9e-78    
emb|CAB76909.1|  lipoxygenase                                           256   1e-77    
gb|AGE44884.1|  lipoxygenase                                            246   1e-77    
ref|XP_010674737.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    263   1e-77    
gb|AGE44756.1|  lipoxygenase                                            245   1e-77    
gb|AGE45032.1|  lipoxygenase                                            247   1e-77    
gb|ADG03092.1|  lipoxygenase 2                                          262   1e-77    
gb|AGE44684.1|  lipoxygenase                                            246   1e-77    
gb|AGE44706.1|  lipoxygenase                                            245   1e-77    
gb|ADG03091.1|  lipoxygenase 2                                          262   1e-77    
emb|CDY46325.1|  BnaC01g31590D                                          262   1e-77    
gb|AGE44869.1|  lipoxygenase                                            245   2e-77    
gb|AGE44648.1|  lipoxygenase                                            245   2e-77    
gb|AGE44911.1|  lipoxygenase                                            246   2e-77    
gb|KHN30069.1|  Linoleate 9S-lipoxygenase-4                             259   2e-77    
ref|XP_006650559.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        261   2e-77    
gb|AGE44646.1|  lipoxygenase                                            245   2e-77    
gb|AGE44649.1|  lipoxygenase                                            245   2e-77    
ref|XP_007150486.1|  hypothetical protein PHAVU_005G156700g             261   2e-77    
ref|XP_003597558.1|  Lipoxygenase                                       261   3e-77    
tpg|DAA50838.1|  TPA: lipoxygenase3                                     258   3e-77    
gb|KJB26432.1|  hypothetical protein B456_004G241300                    261   3e-77    
gb|AGE44874.1|  lipoxygenase                                            244   4e-77    
gb|AES95304.2|  seed linoleate 9S-lipoxygenase                          260   4e-77    
gb|ACE79245.1|  lipoxygenase-1                                          261   4e-77    
gb|ABS72447.1|  lipoxygenase-1                                          261   4e-77    
ref|NP_001050990.1|  Os03g0699700                                       261   4e-77    
gb|EAY91521.1|  hypothetical protein OsI_13155                          261   4e-77    
gb|AGE44758.1|  lipoxygenase                                            244   4e-77    
ref|XP_003612345.1|  Seed lipoxygenase                                  261   4e-77    
dbj|BAK01348.1|  predicted protein                                      257   4e-77    
gb|ABX57825.1|  lipoxygenase-1                                          260   5e-77    
gb|AGE44908.1|  lipoxygenase                                            245   5e-77    
gb|KHG06114.1|  putative linoleate 9S-lipoxygenase 5                    260   5e-77    
gb|ACF79424.1|  unknown                                                 248   5e-77    
gb|KHN30072.1|  Seed linoleate 9S-lipoxygenase-2                        260   5e-77    
gb|ABX60407.1|  lipoxygease L-2                                         260   6e-77    
gb|AGE44916.1|  lipoxygenase                                            245   6e-77    
ref|NP_001237685.1|  seed linoleate 9S-lipoxygenase-2                   260   7e-77    
gb|AFK32352.1|  lipoxygenase-2                                          260   7e-77    
gb|AGE44907.1|  lipoxygenase                                            245   7e-77    
gb|AGE44882.1|  lipoxygenase                                            244   8e-77    
gb|AGE44897.1|  lipoxygenase                                            243   8e-77    
gb|EAZ28259.1|  hypothetical protein OsJ_12231                          261   1e-76    
gb|AGE44972.1|  lipoxygenase                                            244   1e-76    
gb|KHN30070.1|  Linoleate 9S-lipoxygenase-4                             257   1e-76    
ref|NP_001238692.1|  lipoxygenase                                       259   1e-76    
emb|CDY38326.1|  BnaC05g30190D                                          259   2e-76    
gb|AGE44906.1|  lipoxygenase                                            244   2e-76    
gb|AGE44910.1|  lipoxygenase                                            244   2e-76    
gb|AGE44918.1|  lipoxygenase                                            244   2e-76    
gb|AGE44843.1|  lipoxygenase                                            243   2e-76    
ref|XP_003546741.1|  PREDICTED: linoleate 9S-lipoxygenase-4-like ...    259   2e-76    
ref|NP_001235250.1|  lipoxygenase                                       259   2e-76    
gb|AET01678.2|  seed linoleate 9S-lipoxygenase                          258   2e-76    
ref|NP_001238203.1|  lipoxygenase L-5                                   259   2e-76    
gb|AGE44940.1|  lipoxygenase                                            244   2e-76    
gb|AGE44912.1|  lipoxygenase                                            244   2e-76    
gb|AAG61118.1|  lipoxygenase                                            259   2e-76    
dbj|BAD02945.1|  9-lipoxigenase                                         259   2e-76    
ref|NP_001105515.1|  lipoxygenase                                       258   2e-76    
gb|AET01677.2|  seed linoleate 9S-lipoxygenase                          258   3e-76    
gb|AGE44857.1|  lipoxygenase                                            242   3e-76    
gb|KEH18417.1|  seed linoleate 9S-lipoxygenase                          258   3e-76    
ref|XP_009145332.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    259   3e-76    
gb|KJB67981.1|  hypothetical protein B456_010G220400                    243   3e-76    
gb|AGE45046.1|  lipoxygenase                                            243   3e-76    
gb|AGE44855.1|  lipoxygenase                                            242   3e-76    
gb|AHG59315.1|  lipoxygenase                                            258   3e-76    
gb|ADR71858.1|  lipoxygenase-1                                          258   3e-76    
gb|AGE44783.1|  lipoxygenase                                            242   3e-76    
gb|ADR71856.1|  lipoxygenase-1                                          258   4e-76    
gb|AGE45022.1|  lipoxygenase                                            243   4e-76    
gb|AGE44936.1|  lipoxygenase                                            243   4e-76    
gb|AGE45067.1|  lipoxygenase                                            243   4e-76    
sp|P27481.1|LOXB_PHAVU  RecName: Full=Linoleate 9S-lipoxygenase; ...    256   4e-76    
gb|EMT15495.1|  Putative lipoxygenase 3                                 258   4e-76    
gb|AGE44915.1|  lipoxygenase                                            243   4e-76    
gb|AGE44881.1|  lipoxygenase                                            242   5e-76    
gb|AGE44926.1|  lipoxygenase                                            243   5e-76    
gb|AAM28283.1|  lipoxygenase III                                        239   5e-76    
gb|AEI71780.1|  bacterial-induced lipoxygenase                          258   5e-76    
gb|ACF87672.1|  unknown                                                 247   5e-76    
gb|AGE45041.1|  lipoxygenase                                            243   5e-76    
gb|KHG15901.1|  putative linoleate 9S-lipoxygenase 5                    258   5e-76    
sp|P38417.1|LOX4_SOYBN  RecName: Full=Linoleate 9S-lipoxygenase-4...    258   5e-76    
gb|ABX60409.1|  lipoxygease L-4                                         258   5e-76    
gb|ABX60410.1|  lipoxygenase L-5                                        256   6e-76    
gb|AGE44934.1|  lipoxygenase                                            242   7e-76    
gb|AEL03787.1|  lipoxygenase                                            257   7e-76    
gb|AGE44891.1|  lipoxygenase                                            241   7e-76    
gb|KDP23726.1|  hypothetical protein JCGZ_23559                         257   8e-76    
sp|P27480.1|LOXA_PHAVU  RecName: Full=Linoleate 9S-lipoxygenase 1...    257   8e-76    
gb|ACF79478.1|  unknown                                                 243   8e-76    
gb|AGE45011.1|  lipoxygenase                                            242   8e-76    
gb|AGE44953.1|  lipoxygenase                                            242   8e-76    
sp|P29114.2|LOX1_HORVU  RecName: Full=Linoleate 9S-lipoxygenase 1...    257   9e-76    
ref|XP_010674738.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    257   9e-76    
gb|AGE44909.1|  lipoxygenase                                            242   1e-75    
gb|AAG42354.1|  lipoxygenase                                            257   1e-75    
gb|KHN39331.1|  Seed linoleate 9S-lipoxygenase                          256   1e-75    
gb|AGE45002.1|  lipoxygenase                                            242   1e-75    
gb|AGE45065.1|  lipoxygenase                                            242   1e-75    
gb|ACN34715.1|  unknown                                                 247   1e-75    
ref|NP_001235189.1|  lipoxygenase                                       256   1e-75    
sp|P09439.1|LOX2_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...    256   1e-75    
ref|XP_010511294.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    256   2e-75    
ref|XP_008454442.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    256   2e-75    
ref|XP_003528382.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like ...    256   2e-75    
gb|AGE44864.1|  lipoxygenase                                            240   2e-75    
ref|NP_001050995.2|  Os03g0700700                                       255   2e-75    



>emb|CAA64415.1| lipoxygenase (LOX) [Solanum lycopersicum]
Length=246

 Score =   310 bits (793),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 169/206 (82%), Gaps = 1/206 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V +D ELQAWW E  ++GH DKK+EPWW KM S Q LI++ T  IWI+SALHAAV
Sbjct  41   KSDDAVQKDAELQAWWKELREEGHGDKKDEPWWPKMQSVQELIDSCTITIWIASALHAAV  100

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSR+FMPEPG+ EYEELK NPD  FL+TIT Q QTL+GISLIE+
Sbjct  101  NFGQYPYAGYLPNRPTLSRKFMPEPGSAEYEELKRNPDNVFLKTITPQLQTLVGISLIEL  160

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMN-DDQKWRNRTGPV  203
            LSRHASD +YLGQR+ PEWT D+  L AFERFGKKL  IEDRI+ MN D+QKW+NR+GPV
Sbjct  161  LSRHASDTLYLGQRDSPEWTKDQEPLSAFERFGKKLGEIEDRIIQMNGDNQKWKNRSGPV  220

Query  202  KVPYTLLFPTSEGGLTGRGIPNSISI  125
            KVPYT LFPTSE GLTG+GIPNS+SI
Sbjct  221  KVPYTFLFPTSEEGLTGKGIPNSVSI  246



>ref|NP_001274916.1| probable linoleate 9S-lipoxygenase 5 [Solanum tuberosum]
 sp|Q43191.1|LOX15_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 5; AltName: 
Full=Leaf lipoxygenase [Solanum tuberosum]
 gb|AAB67865.1| lipoxygenase [Solanum tuberosum]
Length=862

 Score =   328 bits (840),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 176/205 (86%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D +VL+D ELQAWW E  ++GH DKK+EPWW KM +RQ L ++ T IIWI+SALHAAV
Sbjct  658  KSDELVLKDNELQAWWKELREEGHGDKKDEPWWPKMQTRQELKDSCTIIIWIASALHAAV  717

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSRRFMPEPGTPEYEELKTNPDKA+L+TIT Q QTLLGISLIEI
Sbjct  718  NFGQYPYAGYLPNRPTLSRRFMPEPGTPEYEELKTNPDKAYLKTITPQLQTLLGISLIEI  777

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRHASDEIYLGQR+  EWT D+  + AFERFGKKL+ IED+I+ MN D+KW+NR+GPV 
Sbjct  778  LSRHASDEIYLGQRDSSEWTKDQEPIAAFERFGKKLSEIEDQIIQMNGDKKWKNRSGPVN  837

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLLFPTSE GLTG+GIPNS+SI
Sbjct  838  VPYTLLFPTSEQGLTGKGIPNSVSI  862



>ref|XP_004244890.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Solanum lycopersicum]
Length=861

 Score =   328 bits (840),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 176/205 (86%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  +L+D ELQAWW E  ++GH DKK+EPWW KM  RQ LI++ T IIWI+SALHAAV
Sbjct  657  KSDESLLKDNELQAWWKELREEGHGDKKDEPWWPKMQIRQELIDSCTIIIWIASALHAAV  716

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSRRFMPEPGTPEYEELKTNPDKA+L+TIT Q QTLLGISLIEI
Sbjct  717  NFGQYPYAGYLPNRPTLSRRFMPEPGTPEYEELKTNPDKAYLKTITPQLQTLLGISLIEI  776

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRHASDEIYLGQR+  EWT D+  + AFERFGKKL+ IED+I+ MN D++W+NR+GPVK
Sbjct  777  LSRHASDEIYLGQRDSSEWTKDQESIAAFERFGKKLSEIEDQIIQMNGDEQWKNRSGPVK  836

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLLFPTSE GLTG+GIPNS+SI
Sbjct  837  VPYTLLFPTSEQGLTGKGIPNSVSI  861



>gb|ACO57136.1| lipoxygenase 1 [Capsicum annuum]
Length=861

 Score =   325 bits (833),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  VL+D ELQAWW E  ++GH DKK+EPWW KM +RQ LI++ T IIWI+SALHAAV
Sbjct  657  KSDESVLKDDELQAWWKEVREEGHGDKKDEPWWPKMQTRQELIDSCTIIIWIASALHAAV  716

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSRRFMPEPGTPEYEELKTNPD A+L+TIT Q QTLLGISLIEI
Sbjct  717  NFGQYPYAGYLPNRPTLSRRFMPEPGTPEYEELKTNPDLAYLKTITPQLQTLLGISLIEI  776

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH SDE+YLGQR+  EWT D+  L AFERFGKKL+ IED+I+ MN D+ W+NR+GPVK
Sbjct  777  LSRHTSDEVYLGQRDSSEWTKDQEPLAAFERFGKKLSEIEDQIVQMNGDENWKNRSGPVK  836

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLLFPTSE GLTG+GIPNS+SI
Sbjct  837  VPYTLLFPTSEEGLTGKGIPNSVSI  861



>ref|XP_010102744.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXB94013.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=882

 Score =   325 bits (833),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV +D ELQ+WW E  ++GH DKKNEPWW KM +R+ LI++ T IIWI+SALHAAV
Sbjct  678  KSDEMVQKDSELQSWWKELREEGHGDKKNEPWWPKMQTREELIDSCTIIIWIASALHAAV  737

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPE GTPEYEEL+++PDKAFL+TITAQ QTL+GIS+IE+
Sbjct  738  NFGQYPYAGYLPNRPTVSRRFMPEKGTPEYEELQSDPDKAFLKTITAQLQTLIGISIIEL  797

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRHASDE+YLGQR+ PEWT+D + L+AFERFGKKL  IED+I++MN+D++ +NR GPVK
Sbjct  798  LSRHASDEVYLGQRDTPEWTTDTNPLEAFERFGKKLGEIEDKIISMNNDERLKNRVGPVK  857

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTSEGGLTG+GIPNS+SI
Sbjct  858  MPYTLLFPTSEGGLTGKGIPNSVSI  882



>ref|XP_010041703.1| PREDICTED: probable linoleate 9S-lipoxygenase 5, partial [Eucalyptus 
grandis]
Length=224

 Score =   305 bits (781),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V +D+ELQ+WW E V++GH DKK EPWW KM + + L E  T  IWI+SALHAAV
Sbjct  20   KSDQTVQKDEELQSWWRELVEEGHGDKKGEPWWPKMQTVKDLTEICTITIWIASALHAAV  79

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSRR+MPE GTPE+EELK NPDKAFL+TITAQFQTLL ISL+EI
Sbjct  80   NFGQYPYAGYLPNRPTLSRRYMPEEGTPEFEELKQNPDKAFLKTITAQFQTLLVISLMEI  139

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H++DE+YLGQR+ PEWT+D   L+AFERFGKKL  +E+RI+ MN D++WRNR GPV+
Sbjct  140  LSMHSTDEVYLGQRDTPEWTADAEPLEAFERFGKKLGEVEERIMRMNGDKRWRNRVGPVE  199

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPY LL+PTSEGG T +GIPNS+SI
Sbjct  200  VPYMLLYPTSEGGATAKGIPNSVSI  224



>ref|XP_008245951.1| PREDICTED: probable linoleate 9S-lipoxygenase 5, partial [Prunus 
mume]
Length=504

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D ++ +D ELQ+WW E V++GH DKK+EPWW KM +R+ L+ET T IIW +SALHAAV
Sbjct  300  KTDDIIQKDTELQSWWKELVEEGHGDKKDEPWWPKMQTREDLVETCTIIIWTASALHAAV  359

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SR+FMPE GTPEY+EL+++PD  FL+TITAQ Q +LGI+LIEI
Sbjct  360  NFGQYPYAGYLPNRPTISRKFMPEKGTPEYKELESSPDTVFLKTITAQLQIVLGIALIEI  419

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ PEWT+D   L AF++FGKKLA IEDRI +MN+D+K +NR GPVK
Sbjct  420  LSRHSTDEVYLGQRDTPEWTADTEPLKAFDKFGKKLAEIEDRITSMNNDEKLKNRVGPVK  479

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLLFPTSEGGLTGRGIPNS+SI
Sbjct  480  VPYTLLFPTSEGGLTGRGIPNSVSI  504



>emb|CAD10740.1| lipoxygenase [Corylus avellana]
Length=873

 Score =   323 bits (827),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V  D ELQ+WW E  + GH DKK+EPWW KM +R+ L+ET T IIWI+SALHAAV
Sbjct  669  KSDDRVQNDSELQSWWKELREVGHGDKKDEPWWPKMQTREELVETCTIIIWIASALHAAV  728

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT SRRFMPE GTPEY+ELK++PDK FL+TITAQ QTLLG+SLIEI
Sbjct  729  NFGQYPYAGYLPNRPTFSRRFMPEKGTPEYDELKSDPDKVFLKTITAQLQTLLGVSLIEI  788

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H+SDE+YLGQR+ PEWT D   L+AFERFG+KLA IEDRI+ MN+D+KW+NR GPVK
Sbjct  789  LSTHSSDEVYLGQRDTPEWTLDAEALEAFERFGQKLAGIEDRIIKMNNDKKWKNRVGPVK  848

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLL+PTSEGG+TG+GIPNS+SI
Sbjct  849  VPYTLLYPTSEGGITGKGIPNSVSI  873



>gb|AGL96414.1| 9-lipoxygenase, partial [Nicotiana benthamiana]
Length=862

 Score =   322 bits (824),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V +D ELQAWW E  ++GH DKK+EPWW KM + Q LI++ T  IWI+SALHAAV
Sbjct  658  KSDDAVQKDTELQAWWKELREEGHGDKKDEPWWPKMQTVQELIDSCTITIWIASALHAAV  717

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSR+FMPEPG+P YEELKTNPDK FLETIT Q QTLLGISLIEI
Sbjct  718  NFGQYPYAGYLPNRPTLSRKFMPEPGSPAYEELKTNPDKVFLETITPQLQTLLGISLIEI  777

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SD +YLGQRE PEWT D+  L AF RFGKKL+ IED+I+ MN D+KW+NR+GPVK
Sbjct  778  LSRHSSDTLYLGQRESPEWTKDQEPLSAFGRFGKKLSDIEDQIMQMNGDEKWKNRSGPVK  837

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLLFPTSEGGLTG+GIPNS+SI
Sbjct  838  VPYTLLFPTSEGGLTGKGIPNSVSI  862



>gb|AAO12866.1| lipoxygenase [Vitis vinifera]
Length=289

 Score =   305 bits (780),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV +D ELQ WW E  ++GH DKK+EPWW KM + + LI+T T IIW++SALHAAV
Sbjct  85   KTDEMVQKDSELQFWWKEVREEGHGDKKDEPWWPKMRTVKELIQTCTIIIWVASALHAAV  144

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            +FGQY YAGY P RPT+SRRFMPE GTPEYEELK+NPDKAFL+TITAQ QTLLGISLIE+
Sbjct  145  DFGQYPYAGYLPNRPTISRRFMPEEGTPEYEELKSNPDKAFLKTITAQLQTLLGISLIEV  204

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE++LGQR+ PEWT D   L AFE+FG+KLA IE+ I+  N +++++NR GPVK
Sbjct  205  LSRHSSDEVHLGQRDTPEWTLDTTPLKAFEKFGRKLADIEEMIIDRNGNERFKNRVGPVK  264

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+PTSEGGLTG+GIPNS+SI
Sbjct  265  IPYTLLYPTSEGGLTGKGIPNSVSI  289



>ref|XP_009610900.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=862

 Score =   321 bits (823),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V +D ELQAWW E  ++GH DKK+EPWW KM + Q LI++ T  IWI+SALHAAV
Sbjct  658  KSDDAVQKDTELQAWWKELREEGHGDKKDEPWWPKMQTVQELIDSCTITIWIASALHAAV  717

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSR FMPEPG+PEYEELKTNPDK FL+TIT Q QTLLGISLIEI
Sbjct  718  NFGQYPYAGYLPNRPTLSRNFMPEPGSPEYEELKTNPDKVFLKTITPQLQTLLGISLIEI  777

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SD +YLGQRE PEWT D+  L AF RFGKKL+ IED+I+ MN D+KW+NR+GPVK
Sbjct  778  LSRHSSDTLYLGQRESPEWTKDQEPLSAFARFGKKLSDIEDQIMQMNVDEKWKNRSGPVK  837

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLLFPTSEGGLTG+GIPNS+SI
Sbjct  838  VPYTLLFPTSEGGLTGKGIPNSVSI  862



>emb|CAA58859.1| lipoxygenase [Nicotiana tabacum]
Length=862

 Score =   321 bits (823),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V +D ELQAWW E  ++GH DKK+EPWW KM + Q LI++ T  IWI+SALHAAV
Sbjct  658  KSDDAVQKDTELQAWWKELREEGHGDKKDEPWWPKMQTVQELIDSCTITIWIASALHAAV  717

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSR FMPEPG+PEYEELKTNPDK FL+TIT Q QTLLGISLIEI
Sbjct  718  NFGQYPYAGYLPNRPTLSRNFMPEPGSPEYEELKTNPDKVFLKTITPQLQTLLGISLIEI  777

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SD +YLGQRE PEWT D+  L AF RFGKKL+ IED+I+ MN D+KW+NR+GPVK
Sbjct  778  LSRHSSDTLYLGQRESPEWTKDQEPLSAFARFGKKLSDIEDQIMQMNVDEKWKNRSGPVK  837

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLLFPTSEGGLTG+GIPNS+SI
Sbjct  838  VPYTLLFPTSEGGLTGKGIPNSVSI  862



>ref|XP_009774053.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=862

 Score =   320 bits (821),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V +D ELQAWW E  ++GH DKK+EPWW KM + Q LI++ T  IWI+SALHAAV
Sbjct  658  KSDDAVQKDTELQAWWKELREEGHGDKKDEPWWPKMQTVQELIDSCTITIWIASALHAAV  717

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSR FMPEPG+ EYEELKTNPDK FL+TIT Q QTLLGISLIEI
Sbjct  718  NFGQYPYAGYLPNRPTLSRNFMPEPGSTEYEELKTNPDKVFLKTITPQLQTLLGISLIEI  777

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SD +YLGQRE PEWT D+  L AFERFGKKL+ IED+I+ MN D+KW+NR+GPVK
Sbjct  778  LSRHSSDTLYLGQRESPEWTKDQEPLSAFERFGKKLSDIEDQIMEMNGDEKWKNRSGPVK  837

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLLFPTSEGGLTG+GIPNS+SI
Sbjct  838  VPYTLLFPTSEGGLTGKGIPNSVSI  862



>ref|XP_004309944.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=860

 Score =   319 bits (818),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV QD ELQ+WW E V+KGH DKKNEPWW KM +   LIE+ T IIW SSALHAAV
Sbjct  656  KTDYMVQQDIELQSWWKELVEKGHGDKKNEPWWPKMQTLDELIESCTIIIWTSSALHAAV  715

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY +AGY P RPT+SRRFMPE GTPEYEELKTNPD AFL+TITAQ QT++G+SLIEI
Sbjct  716  NFGQYPFAGYLPNRPTVSRRFMPEIGTPEYEELKTNPDLAFLKTITAQLQTVIGVSLIEI  775

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRHASDE+YLGQR+ P WTSD  VL+AFERFGK+LA IED I+ MN+D K +NR GPVK
Sbjct  776  LSRHASDEVYLGQRDTPGWTSDTKVLEAFERFGKRLAEIEDSIICMNNDGKLKNRVGPVK  835

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+PT E GL+G+GIPNSISI
Sbjct  836  MPYTLLYPTGEAGLSGKGIPNSISI  860



>gb|AAZ04411.1| lipoxygenase [Adelostemma gracillimum]
Length=863

 Score =   318 bits (815),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV QD ELQAWW E  ++GH DKK+EPWW KM SR+ LI++ T IIWI+SALHAAV
Sbjct  659  KSDEMVQQDSELQAWWKELREEGHGDKKDEPWWPKMHSREELIDSCTIIIWIASALHAAV  718

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPEPGTPEY+ELKTNPD+ FL TITAQ QTLLG+SLIEI
Sbjct  719  NFGQYPYAGYLPNRPTISRRFMPEPGTPEYDELKTNPDRVFLRTITAQLQTLLGVSLIEI  778

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRHASDE+YLGQR+ PEWT D   L AFE+FGK LA IE RI+ MN+D +W+NR GP +
Sbjct  779  LSRHASDEVYLGQRDTPEWTKDSEPLKAFEKFGKNLAEIEARIVQMNNDSEWKNRLGPAQ  838

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
             PYTLL+PTSE GLT +GIPNS+SI
Sbjct  839  FPYTLLYPTSEPGLTAKGIPNSVSI  863



>ref|XP_007030817.1| Lipoxygenase 1 [Theobroma cacao]
 gb|EOY11319.1| Lipoxygenase 1 [Theobroma cacao]
Length=866

 Score =   318 bits (814),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV QD ELQAWW E  ++GH DKKNEPWW KM +R+ LI+T T IIW++SALHAAV
Sbjct  662  KTDEMVQQDIELQAWWKELREEGHGDKKNEPWWPKMQTREELIDTCTIIIWVASALHAAV  721

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPE GTPEY EL++NPDKA+L+TITAQ QTLLGISLIEI
Sbjct  722  NFGQYPYAGYLPNRPTISRRFMPEKGTPEYAELESNPDKAYLKTITAQLQTLLGISLIEI  781

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR+ PEWTSD   L AFE FGK+L+ IE+RI+ MN D++ +NR GPV 
Sbjct  782  LSRHSSDEVYLGQRDTPEWTSDATPLAAFEEFGKRLSGIEERIVEMNKDEQLKNRVGPVN  841

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+PTSEGGLTG+GIPNS+SI
Sbjct  842  MPYTLLYPTSEGGLTGKGIPNSVSI  866



>gb|ABW75772.2| lipoxygenase [Camellia sinensis]
Length=861

 Score =   318 bits (814),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D MV +D ELQ+WW E  ++GH DKK+EPWW KM +R+ LI++ T +IW++SALHAAV
Sbjct  657  KNDEMVKEDLELQSWWKELREEGHGDKKHEPWWPKMQTRRELIDSCTIVIWVASALHAAV  716

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSRRFMPEPGTPEYEE K++PDKAFL+TITAQ QTLLG+SLIEI
Sbjct  717  NFGQYPYAGYLPNRPTLSRRFMPEPGTPEYEEFKSSPDKAFLKTITAQLQTLLGVSLIEI  776

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR+  +WT+D   L+AF RFGKKL  IE+ I+ MN+D+  RNR GPVK
Sbjct  777  LSRHSSDEVYLGQRDSADWTTDDEPLEAFGRFGKKLGEIEEMIIEMNNDENLRNRVGPVK  836

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLLFPTSEGGLTG+GIPNS+SI
Sbjct  837  VPYTLLFPTSEGGLTGKGIPNSVSI  861



>ref|XP_009787604.1| PREDICTED: linoleate 9S-lipoxygenase 6 [Nicotiana sylvestris]
Length=861

 Score =   317 bits (812),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  +L+D ELQAWW E  ++GH D K+EPWW KM + Q LI++ T IIW SSALHAAV
Sbjct  657  KSDDSILKDNELQAWWKELREEGHGDLKDEPWWPKMENCQELIDSCTIIIWTSSALHAAV  716

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPEPGT EYE LKTNPDKAFL TITAQ QTLLG+SLIEI
Sbjct  717  NFGQYPYAGYLPNRPTVSRRFMPEPGTSEYELLKTNPDKAFLRTITAQLQTLLGVSLIEI  776

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH SDEIYLGQR+ P+WT+D+  L AFERFG KL+ IE+RI+ MN DQ WRNR+GP+K
Sbjct  777  LSRHTSDEIYLGQRDSPKWTNDEVPLAAFERFGNKLSDIENRIIEMNGDQIWRNRSGPIK  836

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
             PYTLLFPTSEGGLTG+GIPNS+SI
Sbjct  837  APYTLLFPTSEGGLTGKGIPNSVSI  861



>emb|CAA64769.1| lipoxygenase [Solanum tuberosum]
Length=697

 Score =   313 bits (802),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D  +L+D ELQAWW E  + GH DKKNEPWW +M + Q LI++ TTIIWI+SALHAAVNF
Sbjct  495  DEEILKDNELQAWWKELREVGHGDKKNEPWWPEMKTPQELIDSCTTIIWIASALHAAVNF  554

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEYEELK NPDKAFL+TITAQ QTLLG+SL+EILS
Sbjct  555  GQYPYAGYVPNRPTVSRRFMPEPGTPEYEELKRNPDKAFLKTITAQLQTLLGVSLVEILS  614

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH +DEIYLGQRE PEWT DK  L AF+RFGKKL  IE +I+  N D    NR+GPV  P
Sbjct  615  RHTTDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDNILTNRSGPVNAP  674

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLLFPTSEGGLTG+GIPNS+SI
Sbjct  675  YTLLFPTSEGGLTGKGIPNSVSI  697



>ref|XP_006382594.1| hypothetical protein POPTR_0005s03560g [Populus trichocarpa]
 gb|ERP60391.1| hypothetical protein POPTR_0005s03560g [Populus trichocarpa]
Length=866

 Score =   316 bits (810),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D M+ +D ELQ+WW E  ++GH D K+ PWW KM +R+ LI++ T IIW++SALHAAV
Sbjct  662  KNDEMIQKDSELQSWWKEVREEGHGDLKDAPWWPKMLTREELIDSCTIIIWVASALHAAV  721

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPE G+PEYEELK+NPDKAFL+TITAQ QTLLGISLIEI
Sbjct  722  NFGQYPYAGYLPNRPTVSRRFMPEEGSPEYEELKSNPDKAFLKTITAQLQTLLGISLIEI  781

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR+  EWT+DK  L+AFE+FGKKLA IED++L MN   KW+NR GPV+
Sbjct  782  LSRHSSDEVYLGQRDTHEWTADKKPLEAFEKFGKKLAEIEDKMLDMNKAGKWKNRVGPVE  841

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLL PTSEGGLTGRGIPNS+S+
Sbjct  842  VPYTLLVPTSEGGLTGRGIPNSVSL  866



>ref|XP_011023610.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=871

 Score =   316 bits (810),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            KDD M+ +D ELQ+WW E  ++GH D K+ PWW KM +R+ LI++ T IIW++SALHAAV
Sbjct  667  KDDDMIQKDSELQSWWKEVREEGHGDLKDAPWWPKMKTREELIDSCTIIIWVASALHAAV  726

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPE G+P+YEELK+NP+KAFL+TITAQ QTLLGISLIEI
Sbjct  727  NFGQYPYAGYLPNRPTISRRFMPEEGSPDYEELKSNPEKAFLKTITAQLQTLLGISLIEI  786

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR+ PEWT+DK  L+AFE+FGKKLA IEDR+  MN D   +NR G VK
Sbjct  787  LSRHSSDEVYLGQRDTPEWTADKEPLEAFEKFGKKLAVIEDRMFDMNKDVNLKNRVGSVK  846

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLL PTSEGGLTGRGIPNS+SI
Sbjct  847  VPYTLLVPTSEGGLTGRGIPNSVSI  871



>emb|CDP15504.1| unnamed protein product [Coffea canephora]
Length=856

 Score =   315 bits (808),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  + +D ELQAWW E  ++GH D K++PWW KM +R+ LIE+ TTIIW++SALHA+V
Sbjct  652  KTDESIQKDSELQAWWKELREEGHGDLKDKPWWPKMQTREELIESCTTIIWVASALHASV  711

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPEPG+PEYEELKTNPDKAFL+TITAQ QTLLG+SLIEI
Sbjct  712  NFGQYPYAGYLPNRPTVSRRFMPEPGSPEYEELKTNPDKAFLKTITAQLQTLLGVSLIEI  771

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRHASDE+YLGQR+ PEWT D + L+AF++FG KLA IE RI+  N D K+RNRTGPVK
Sbjct  772  LSRHASDEVYLGQRDTPEWTIDGNALEAFKKFGSKLAEIEGRIIQSNTDPKYRNRTGPVK  831

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPT + GLTG+GIPNS+SI
Sbjct  832  LPYTLLFPTGDPGLTGKGIPNSVSI  856



>gb|AFU51542.1| lipoxygenase 3 [Capsicum annuum]
Length=859

 Score =   315 bits (808),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K +  +L+D ELQ WW E  + GH DKK+ PWW +M S + LIE+ T IIWI+SALHAAV
Sbjct  655  KSNEDILKDNELQEWWKELREVGHGDKKDAPWWPEMESPEDLIESCTIIIWIASALHAAV  714

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPEPGTPEYEELKTNPDKAFL+TITAQFQTLLG+SLIEI
Sbjct  715  NFGQYPYAGYLPNRPTVSRRFMPEPGTPEYEELKTNPDKAFLKTITAQFQTLLGVSLIEI  774

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH SDEIYLGQRE PEWT DK  L AF+RFGKKL  IE+ I+  N DQ  +NR+GPV 
Sbjct  775  LSRHTSDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTEIENHIIQRNGDQILKNRSGPVN  834

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
             PYTLLFPTSEGGLTG+GIPNS+SI
Sbjct  835  APYTLLFPTSEGGLTGKGIPNSVSI  859



>gb|AAP83134.1| lipoxygenase [Nicotiana attenuata]
 gb|AAP83136.1| lipoxygenase [Nicotiana attenuata]
Length=861

 Score =   315 bits (807),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  +L+D ELQAWW E  ++GH D K+EPWW KM + Q LI++ T IIW +SALHAAV
Sbjct  657  KSDDSILKDNELQAWWKELREEGHGDLKDEPWWPKMENCQELIDSCTIIIWTASALHAAV  716

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPEPGT EYE LKTNPDKAFL TITAQ QTLLG+SLIEI
Sbjct  717  NFGQYPYAGYLPNRPTVSRRFMPEPGTSEYELLKTNPDKAFLRTITAQLQTLLGVSLIEI  776

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH SDEIYLGQR+ P+WT D+  L AF+RFG KL+ IE+RI+ MN DQ WRNR+GPVK
Sbjct  777  LSRHTSDEIYLGQRDSPKWTYDEEPLAAFDRFGNKLSDIENRIIEMNGDQIWRNRSGPVK  836

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
             PYTLLFPTSEGGLTG+G+PNS+SI
Sbjct  837  APYTLLFPTSEGGLTGKGVPNSVSI  861



>ref|XP_006355846.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
8-like [Solanum tuberosum]
Length=737

 Score =   312 bits (800),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D  +L+D ELQAWW E  + GH DKKNEPWW +M + Q LI++ TTIIWI+SALHAAVNF
Sbjct  535  DEEILKDNELQAWWKELREVGHGDKKNEPWWPEMKTPQELIDSCTTIIWIASALHAAVNF  594

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEYEELK NPDKAFL+TITAQ QTLLG+SL+EILS
Sbjct  595  GQYPYAGYLPNRPTVSRRFMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLVEILS  654

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH +DEIYLGQRE PEWT DK  L AF++FGKKL  IE +I+  N D    NR+GPV  P
Sbjct  655  RHTTDEIYLGQRESPEWTKDKEPLAAFDKFGKKLTDIEKQIIQRNGDNILTNRSGPVNAP  714

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLLFPTSEGGLTG+GIPNS+SI
Sbjct  715  YTLLFPTSEGGLTGKGIPNSVSI  737



>gb|AAP83135.1| lipoxygenase [Nicotiana attenuata]
Length=861

 Score =   315 bits (807),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  +L+D ELQAWW E  ++GH D K+EPWW KM + Q LI++ T IIW +SALHAAV
Sbjct  657  KSDDSILKDNELQAWWKELREEGHGDLKDEPWWPKMENCQELIDSCTIIIWTASALHAAV  716

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPEPGT EYE LKTNPDKAFL TITAQ QTLLG+SLIEI
Sbjct  717  NFGQYPYAGYLPNRPTVSRRFMPEPGTSEYELLKTNPDKAFLRTITAQLQTLLGVSLIEI  776

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH SDEIYLGQR+ P+WT D+  L AF+RFG KL+ IE+RI+ MN DQ WRNR+GPVK
Sbjct  777  LSRHTSDEIYLGQRDSPKWTYDEEPLAAFDRFGNKLSDIENRIIEMNGDQIWRNRSGPVK  836

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
             PYTLLFPTSEGGLTG+G+PNS+SI
Sbjct  837  APYTLLFPTSEGGLTGKGVPNSVSI  861



>ref|XP_006382593.1| hypothetical protein POPTR_0005s03550g [Populus trichocarpa]
 gb|ERP60390.1| hypothetical protein POPTR_0005s03550g [Populus trichocarpa]
Length=847

 Score =   315 bits (806),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D M+ +D ELQ+WW E  ++GH D K+ PWW KM +R+ LI++ T IIW++SALHAAV
Sbjct  643  KNDEMIQKDSELQSWWKEVREEGHGDLKDAPWWPKMLTREELIDSCTIIIWVASALHAAV  702

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPE G+P+Y+ELK+NPDKAFL+TITAQ QTLLGISLIEI
Sbjct  703  NFGQYPYAGYLPNRPTVSRRFMPEEGSPDYKELKSNPDKAFLKTITAQLQTLLGISLIEI  762

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR+  EWT+DK  L+AFE+FGKKLA IED++L MN   KW+NR GPV+
Sbjct  763  LSRHSSDEVYLGQRDTHEWTADKKPLEAFEKFGKKLAEIEDKMLYMNKAGKWKNRVGPVE  822

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLL PTSEGGLTGRGIPNS+SI
Sbjct  823  VPYTLLVPTSEGGLTGRGIPNSVSI  847



>emb|CBI36802.3| unnamed protein product [Vitis vinifera]
Length=900

 Score =   316 bits (809),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV +D ELQ+WW E  ++GH DKK+EPWW KM + + LIET T IIW++SALHAAV
Sbjct  696  KTDEMVQKDSELQSWWKEVREEGHGDKKDEPWWPKMHTVKELIETCTIIIWVASALHAAV  755

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPE GTPEYEELK+NPDKAFL+TITAQ QTLLGISLIEI
Sbjct  756  NFGQYPYAGYLPNRPTISRRFMPEEGTPEYEELKSNPDKAFLKTITAQLQTLLGISLIEI  815

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR+ PEWT D   L AFE+FG+KLA IE+RI+  N +++++NR GPVK
Sbjct  816  LSRHSSDEVYLGQRDTPEWTLDTTPLKAFEKFGRKLADIEERIIDRNGNERFKNRVGPVK  875

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+PTSEGGLTG+GIPNS+SI
Sbjct  876  IPYTLLYPTSEGGLTGKGIPNSVSI  900



>gb|AGK82779.1| lipoxygenase [Malus domestica]
Length=952

 Score =   317 bits (811),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D ++ +D ELQ+WW E V++GH DKK+EPWW KM + + L+E  TTIIW +SALHAAV
Sbjct  748  KTDDIIQKDTELQSWWKELVEEGHGDKKDEPWWPKMQTLEELVEICTTIIWTASALHAAV  807

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SR+FMPE GTPEYEEL++NPDK FL+TITAQ QTLLGISLIEI
Sbjct  808  NFGQYPYAGYLPNRPTISRKFMPEKGTPEYEELESNPDKVFLKTITAQLQTLLGISLIEI  867

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ PEWT D   L+AF++FGKKLA IEDRI +MN+D K +NR GPVK
Sbjct  868  LSRHSTDEVYLGQRDTPEWTVDAAQLEAFDKFGKKLAEIEDRITSMNNDAKLKNRVGPVK  927

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLLFPTS GGLTG+GIPNS+SI
Sbjct  928  VPYTLLFPTSGGGLTGKGIPNSVSI  952



>ref|XP_002319014.2| lipoxygenase family protein [Populus trichocarpa]
 gb|EEE94937.2| lipoxygenase family protein [Populus trichocarpa]
Length=836

 Score =   314 bits (805),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            KDD M+ +D ELQ+WW E  ++GH D K+ PWW KM +R+ LI++ T IIW++SALHAAV
Sbjct  632  KDDDMIQKDSELQSWWKEAREEGHGDLKDAPWWPKMKTREELIDSCTIIIWVASALHAAV  691

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRF+PE G+P+YEELK+NP+KAFL+TITAQ QTLLGISLIEI
Sbjct  692  NFGQYPYAGYLPNRPTISRRFLPEEGSPDYEELKSNPEKAFLKTITAQLQTLLGISLIEI  751

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR+ PEWT+DK  L+AFE+FGKKLA IEDR+  MN D   +NR G VK
Sbjct  752  LSRHSSDEVYLGQRDTPEWTADKEPLEAFEKFGKKLAVIEDRMFDMNKDVNLKNRVGSVK  811

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLL PTSEGGLTGRGIPNS+SI
Sbjct  812  VPYTLLVPTSEGGLTGRGIPNSVSI  836



>gb|ABF60001.1| lipoxygenase 5 [Actinidia deliciosa]
Length=450

 Score =   303 bits (777),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D MV +D ELQ+WW E  ++GH DKK+EPWW KM + + LI+T T +IW++SALHAA+
Sbjct  246  KNDKMVREDAELQSWWKELREEGHGDKKDEPWWPKMQTVKELIDTCTIVIWVASALHAAL  305

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSRRFMPE GT EYEELK++P+KA L+TIT Q QTLLGISLIEI
Sbjct  306  NFGQYPYAGYLPNRPTLSRRFMPEEGTSEYEELKSDPEKALLKTITPQLQTLLGISLIEI  365

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR+ PEWT+D   L AF RFG KL  +E++I+ MN+D++ +NR GPV 
Sbjct  366  LSRHSSDEVYLGQRDTPEWTTDAEPLKAFARFGNKLDEVEEKIIDMNNDKELKNRVGPVN  425

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLLFPTSEGGLTG+GIPNS+SI
Sbjct  426  VPYTLLFPTSEGGLTGKGIPNSVSI  450



>gb|AGU28274.1| lipoxygenase 1 [Vitis vinifera]
Length=859

 Score =   314 bits (805),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV +D ELQ+WW E  ++GH DKKNEPWW KM + + LIET T IIW++SALHAAV
Sbjct  655  KTDEMVQKDSELQSWWKEVREEGHGDKKNEPWWPKMRTVKELIETCTIIIWVASALHAAV  714

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPE GTPEYEELK+NPDKAFL+TITAQ QTLLGISLIE+
Sbjct  715  NFGQYPYAGYLPNRPTISRRFMPEEGTPEYEELKSNPDKAFLKTITAQLQTLLGISLIEV  774

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR+ PEWT D   L AFE+FG+KLA IE+ I+  N +++++NR GPVK
Sbjct  775  LSRHSSDEVYLGQRDTPEWTLDTTPLKAFEKFGRKLADIEEMIIDRNGNERFKNRVGPVK  834

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+PTSEGGLTG+GIPNS+SI
Sbjct  835  IPYTLLYPTSEGGLTGKGIPNSVSI  859



>gb|ACG56281.1| lipoxygenase [Olea europaea]
Length=864

 Score =   314 bits (805),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D +V +D ELQ+WWTE  +KGH DKKNEPWW KM +R  L+++ TTIIW++SALHAAVNF
Sbjct  662  DILVQKDAELQSWWTEVREKGHGDKKNEPWWPKMQTRGELVDSCTTIIWMASALHAAVNF  721

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPTLSRRFMPEPG PEY+ELKTNPDK FL+TITA+ QTLLGISLIEILS
Sbjct  722  GQYPYAGYLPVRPTLSRRFMPEPGKPEYDELKTNPDKVFLKTITARLQTLLGISLIEILS  781

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
             H+SDE+YLGQR+  EWT D   L+AF+RFG KL  +E+RI  MN+D+KWRNR GPV VP
Sbjct  782  SHSSDEVYLGQRDALEWTKDVEPLEAFDRFGTKLREVEERIKQMNNDKKWRNRVGPVNVP  841

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLL+PTSE GLTG+GIPNS+SI
Sbjct  842  YTLLYPTSEEGLTGKGIPNSVSI  864



>emb|CDP20620.1| unnamed protein product [Coffea canephora]
Length=772

 Score =   312 bits (799),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D M+ +D ELQ+WW E  +KGH DKK+EPWW +M +   LI++ T IIW+SSALHAA 
Sbjct  568  KSDQMIQEDIELQSWWKEVREKGHADKKDEPWWPRMKTITELIDSCTIIIWLSSALHAAT  627

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQ+ YAGY P RPT SRRFMPEPGTPEYEELK+NPDKAFL+TIT QFQTLLG+S IEI
Sbjct  628  NFGQWPYAGYQPNRPTTSRRFMPEPGTPEYEELKSNPDKAFLKTITPQFQTLLGLSTIEI  687

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH +DE+YLGQRE+P+WT D   L+AF+RFG+ L+ IED+IL MN D KWRNR GPV 
Sbjct  688  LSRHTTDEVYLGQRENPQWTKDTEPLEAFKRFGQTLSEIEDQILQMNGDPKWRNRVGPVN  747

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTS+ G+TGRGIPNSI+I
Sbjct  748  IPYTLLFPTSDSGITGRGIPNSIAI  772



>gb|AEZ50135.1| lipoxygenase, partial [Diospyros kaki]
Length=500

 Score =   305 bits (780),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D+MV  D  LQ+WW E  + GH DKK+EPWW KM +R+ LI++ TTIIW++SALHAAV
Sbjct  296  KNDNMVQDDSGLQSWWNELREVGHGDKKDEPWWPKMQTRKELIDSCTTIIWVASALHAAV  355

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRF+PE G+PEYEELK+ P+KAFL+TITAQ QT+LGISLIE+
Sbjct  356  NFGQYPYAGYLPNRPTISRRFIPELGSPEYEELKSYPEKAFLKTITAQLQTVLGISLIEV  415

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H++DE+YLGQR+  EWT+D   L+AF+RFGKKL  IE+ I+ MN+D+K +NR GPVK
Sbjct  416  LSAHSTDEVYLGQRDTAEWTTDIEPLEAFQRFGKKLGEIEENIIDMNNDEKLKNRVGPVK  475

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLLFPTSEGG+TG+GIPNS+SI
Sbjct  476  VPYTLLFPTSEGGVTGKGIPNSVSI  500



>ref|XP_010659859.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Vitis vinifera]
Length=875

 Score =   314 bits (805),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV +D ELQ+WW E  ++GH DKK+EPWW KM + + LIET T IIW++SALHAAV
Sbjct  671  KTDEMVQKDSELQSWWKEVREEGHGDKKDEPWWPKMHTVKELIETCTIIIWVASALHAAV  730

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPE GTPEYEELK+NPDKAFL+TITAQ QTLLGISLIEI
Sbjct  731  NFGQYPYAGYLPNRPTISRRFMPEEGTPEYEELKSNPDKAFLKTITAQLQTLLGISLIEI  790

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR+ PEWT D   L AFE+FG+KLA IE+RI+  N +++++NR GPVK
Sbjct  791  LSRHSSDEVYLGQRDTPEWTLDTTPLKAFEKFGRKLADIEERIIDRNGNERFKNRVGPVK  850

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+PTSEGG+TG+GIPNS+SI
Sbjct  851  IPYTLLYPTSEGGITGKGIPNSVSI  875



>gb|AAK50778.4|AF361893_1 bacterial-induced lipoxygenase [Gossypium hirsutum]
Length=865

 Score =   313 bits (803),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV QD ELQAWW E  ++GH DKK+EPWW KM +R+ LI++ T IIW++SALHAAV
Sbjct  661  KTDEMVQQDPELQAWWKELREEGHGDKKDEPWWPKMQTREELIDSCTIIIWVASALHAAV  720

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPE GTPEY EL++NPDK FL+TITAQ QTLLGISLIEI
Sbjct  721  NFGQYPYAGYLPNRPTISRRFMPEKGTPEYTELESNPDKVFLKTITAQLQTLLGISLIEI  780

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR  PEWTSD+  L AF+ FGK+L  IE+RI+ MN+D++ +NR GPV 
Sbjct  781  LSRHSSDEVYLGQRASPEWTSDETPLAAFDEFGKRLTGIEERIVEMNNDEQLKNRVGPVN  840

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+PTSEGGLTG+GIPNS+SI
Sbjct  841  MPYTLLYPTSEGGLTGKGIPNSVSI  865



>sp|P37831.1|LOX11_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 1; AltName: Full=Lipoxygenase 
1; Short=StLOX1 [Solanum tuberosum]
 emb|CAA55724.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   313 bits (802),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D  +L+D ELQAWW E  + GH DKKNEPWW +M + Q LI++ TTIIWI+SALHAAVNF
Sbjct  659  DEEILKDNELQAWWKELREVGHGDKKNEPWWPEMETPQELIDSCTTIIWIASALHAAVNF  718

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEYEELK NPDKAFL+TITAQ QTLLG+SL+EILS
Sbjct  719  GQYPYAGYLPNRPTVSRRFMPEPGTPEYEELKRNPDKAFLKTITAQLQTLLGVSLVEILS  778

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH +DEIYLGQRE PEWT DK  L AF+RFGKKL  IE +I+  N D    NR+GPV  P
Sbjct  779  RHTTDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDNILTNRSGPVNAP  838

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLLFPTSEGGLTG+GIPNS+SI
Sbjct  839  YTLLFPTSEGGLTGKGIPNSVSI  861



>sp|O22508.1|LOX18_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 8 [Solanum tuberosum]
 gb|AAB81595.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   313 bits (802),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D  +L+D ELQAWW E  + GH DKKNEPWW +M + Q LI++ TTIIWI+SALHAAVNF
Sbjct  659  DEEILKDNELQAWWKELREVGHGDKKNEPWWPEMKTPQELIDSCTTIIWIASALHAAVNF  718

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEYEELK NPDKAFL+TITAQ QTLLG+SL+EILS
Sbjct  719  GQYPYAGYLPNRPTVSRRFMPEPGTPEYEELKRNPDKAFLKTITAQLQTLLGVSLVEILS  778

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH +DEIYLGQRE PEWT DK  L AF+RFGKKL  IE +I+  N D    NR+GPV  P
Sbjct  779  RHTTDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDNILTNRSGPVNAP  838

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLLFPTSEGGLTG+GIPNS+SI
Sbjct  839  YTLLFPTSEGGLTGKGIPNSVSI  861



>ref|NP_001234098.1| lipoxygenase [Solanum lycopersicum]
 gb|AAG21691.1| lipoxygenase [Solanum lycopersicum]
Length=862

 Score =   313 bits (801),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 170/206 (83%), Gaps = 1/206 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V +D ELQAWW E  ++GH DKK+EPWW KM S Q LI++ T  IWI+SALHAAV
Sbjct  657  KSDDAVQKDAELQAWWKELREEGHGDKKDEPWWPKMQSVQELIDSCTITIWIASALHAAV  716

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSR+FMPEPG+ EYEELK NPD  FL+TIT Q QTL+GISLIE+
Sbjct  717  NFGQYPYAGYLPNRPTLSRKFMPEPGSAEYEELKRNPDNVFLKTITPQLQTLVGISLIEL  776

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMN-DDQKWRNRTGPV  203
            LSRHASD +YLGQR+ PEWT D+  L AFERFGKKL  IEDRI+ MN D+QKW+NR+GPV
Sbjct  777  LSRHASDTLYLGQRDSPEWTKDQEPLSAFERFGKKLGEIEDRIIQMNGDNQKWKNRSGPV  836

Query  202  KVPYTLLFPTSEGGLTGRGIPNSISI  125
            KVPYTLLFPTSE GLTG+GIPNS+SI
Sbjct  837  KVPYTLLFPTSEEGLTGKGIPNSVSI  862



>ref|XP_008246453.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=947

 Score =   315 bits (806),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D ++ +D ELQ+WW E V++GH DKK+EPWW KM +R+ L+ET T IIW +SALHAAV
Sbjct  743  KTDDIIQKDTELQSWWKELVEEGHGDKKDEPWWPKMQTREDLVETCTIIIWTASALHAAV  802

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SR+FMPE GTPEY+EL+++PD  FL+TITAQ Q +LGI+LIEI
Sbjct  803  NFGQYPYAGYLPNRPTISRKFMPEKGTPEYKELESSPDTVFLKTITAQLQIVLGIALIEI  862

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ PEWT+D   L AF++FGKKLA IEDRI +MN+D+K +NR GPVK
Sbjct  863  LSRHSTDEVYLGQRDTPEWTADTEPLKAFDKFGKKLAEIEDRITSMNNDEKLKNRVGPVK  922

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLLFPTSEGGLTGRGIPNS+SI
Sbjct  923  VPYTLLFPTSEGGLTGRGIPNSVSI  947



>emb|CDP20618.1| unnamed protein product [Coffea canephora]
Length=857

 Score =   313 bits (801),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV +D ELQ+WW E  +KGH DKK+EPWW +M +   LI++ T IIW+SSALHA+ 
Sbjct  653  KSDQMVQEDTELQSWWKEVREKGHADKKDEPWWPRMKTLTELIDSCTIIIWVSSALHAST  712

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQ+ YAGY P RPT+SRRFMPEPGTPEYEELK+NPDKAFL+TIT QFQTLLG+S IEI
Sbjct  713  NFGQWPYAGYAPNRPTISRRFMPEPGTPEYEELKSNPDKAFLKTITPQFQTLLGLSTIEI  772

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH +DE+YLGQRE+P+WT D   L+AF+RFG+ L+ IED+IL MN D KWRNR GP  
Sbjct  773  LSRHTTDEVYLGQRENPQWTKDTEPLEAFKRFGQTLSEIEDQILQMNGDPKWRNRVGPAN  832

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTS+ G+TGRGIPNSI+I
Sbjct  833  IPYTLLFPTSDSGITGRGIPNSIAI  857



>sp|Q41238.1|LOX16_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 6; AltName: Full=Lipoxygenase 
1-5; Short=StLOX1; Short=lox1:St:3, partial [Solanum 
tuberosum]
 gb|AAB31252.1| linoleate:oxygen oxidoreductase, partial [Solanum tuberosum]
Length=857

 Score =   312 bits (800),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D  +L+D ELQAWW E  + GH DKKNEPWW +M + Q LI++ TTIIWI+SALHAAVNF
Sbjct  655  DEEILKDNELQAWWKELREVGHGDKKNEPWWPEMETPQELIDSCTTIIWIASALHAAVNF  714

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEYEELK NPDKAFL+TITAQ QTLLG+SLIEILS
Sbjct  715  GQYPYAGYLPNRPTVSRRFMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLIEILS  774

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH +DEIYLGQRE PEWT DK  L AF++FGKKL  IE +I+  N D    NR+GPV  P
Sbjct  775  RHTTDEIYLGQRESPEWTKDKEPLAAFDKFGKKLTDIEKQIIQRNGDNILTNRSGPVNAP  834

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLLFPTSEGGLTG+GIPNS+SI
Sbjct  835  YTLLFPTSEGGLTGKGIPNSVSI  857



>ref|XP_011036799.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=866

 Score =   312 bits (800),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D M+ +D ELQ+WW E  ++GH D K+  WW KM +R+ LI++ T IIW++SALHAAV
Sbjct  662  KNDEMIQKDSELQSWWKEVREEGHGDLKDATWWPKMQTREELIDSCTIIIWVASALHAAV  721

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPE G+PEYEELK+NPDK FL+TITAQ QTLLGISLIEI
Sbjct  722  NFGQYPYAGYLPNRPTVSRRFMPEEGSPEYEELKSNPDKVFLKTITAQLQTLLGISLIEI  781

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR+  EWT+DK  L+AFERFGKKLA IED++  MN   KW+NR GPV+
Sbjct  782  LSRHSSDEVYLGQRDTHEWTADKKPLEAFERFGKKLAEIEDKMFDMNKAGKWKNRVGPVE  841

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLL PTSEGGLTGRGIPNS+SI
Sbjct  842  VPYTLLVPTSEGGLTGRGIPNSVSI  866



>gb|ABF19102.2| 9-lipoxygenase [Capsicum annuum]
Length=862

 Score =   312 bits (800),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 171/206 (83%), Gaps = 1/206 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V +D ELQAWW E  ++GH DKK+EPWW KM +RQ LI++ T  IWI+SALHAAV
Sbjct  657  KSDDAVQKDAELQAWWKELREEGHGDKKDEPWWPKMQTRQELIDSCTITIWIASALHAAV  716

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSR FMPEPG+ EYEELKTNPDK FL+TIT Q QTLLGISLIEI
Sbjct  717  NFGQYPYAGYLPNRPTLSRNFMPEPGSAEYEELKTNPDKVFLKTITPQLQTLLGISLIEI  776

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDD-QKWRNRTGPV  203
            LSRHASD +YLGQR+ PEWT D+  L AFERFG+KL+ IE +IL MN D +KW+NR+GPV
Sbjct  777  LSRHASDTLYLGQRDSPEWTKDQEPLSAFERFGQKLSDIEAQILQMNGDHEKWKNRSGPV  836

Query  202  KVPYTLLFPTSEGGLTGRGIPNSISI  125
            KVPYTLLFPTSE GLTG+GIPNS+SI
Sbjct  837  KVPYTLLFPTSEEGLTGKGIPNSVSI  862



>ref|XP_004302420.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=863

 Score =   312 bits (800),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D++V +D ELQ+WW E V++GH DKK+EPWW KM +R+ LIE  T IIW SSALHAAV
Sbjct  659  KSDNIVQKDTELQSWWKELVEEGHGDKKDEPWWPKMQTREELIEACTIIIWTSSALHAAV  718

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY PCRPT+SRRFMPE GTPEY+EL++NPDKAFL+TITAQFQT+LGI+LIEI
Sbjct  719  NFGQYPYAGYLPCRPTVSRRFMPEKGTPEYDELESNPDKAFLKTITAQFQTVLGIALIEI  778

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ P WT+D   L AF RFGKKLA IE++I  MN+D+  +NR G V+
Sbjct  779  LSRHSTDEVYLGQRDTPNWTADAEALQAFNRFGKKLAEIEEKITNMNNDENLKNRVGKVE  838

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLL+PT E G+ G+GIPNS+SI
Sbjct  839  VPYTLLYPTGESGIAGKGIPNSVSI  863



>ref|XP_009597615.1| PREDICTED: linoleate 9S-lipoxygenase 6 [Nicotiana tomentosiformis]
Length=861

 Score =   312 bits (800),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  +++D ELQAWW E  ++GH D K+EPWW KM + Q LI++ T IIW +SALHAAV
Sbjct  657  KSDDSIVKDNELQAWWKELREEGHGDLKDEPWWPKMENCQELIDSCTIIIWTASALHAAV  716

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPEPGT EYE LKTNPDKAFL TITAQ QTLLG+SLIEI
Sbjct  717  NFGQYPYAGYLPNRPTVSRRFMPEPGTSEYEVLKTNPDKAFLRTITAQLQTLLGVSLIEI  776

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH SDEIYLGQR+ P+WT+D+  L AFERFG KL+ IE+RI+ MN DQ WRNR GP+K
Sbjct  777  LSRHTSDEIYLGQRDSPKWTNDEEPLAAFERFGNKLSDIENRIIEMNGDQIWRNRLGPIK  836

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
             PYTLLFPTS+GGLT +GIPNS+SI
Sbjct  837  APYTLLFPTSQGGLTAKGIPNSVSI  861



>ref|NP_001275351.1| 5-lipoxygenase [Solanum tuberosum]
 gb|AAD04258.1| 5-lipoxygenase [Solanum tuberosum]
Length=864

 Score =   312 bits (799),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D  +L+D ELQAWW E  + GH DKKNEPWW +M + Q LI++ TTIIWI+SALHAAVNF
Sbjct  662  DEEILKDNELQAWWKELREVGHGDKKNEPWWPEMETPQELIDSCTTIIWIASALHAAVNF  721

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEYEELK NPDKAFL+TITAQ QTLLG+SL+EILS
Sbjct  722  GQYPYAGYLPNRPTVSRRFMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLVEILS  781

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH +DEIYLGQRE PEWT DK  L AF++FGKKL  IE +I+  N D    NR+GPV  P
Sbjct  782  RHTTDEIYLGQRESPEWTKDKEPLAAFDKFGKKLTDIEKQIIQRNGDNILTNRSGPVNAP  841

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLLFPTSEGGLTG+GIPNS+SI
Sbjct  842  YTLLFPTSEGGLTGKGIPNSVSI  864



>ref|NP_001275169.1| probable linoleate 9S-lipoxygenase 8-like [Solanum tuberosum]
 emb|CAB65460.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   312 bits (799),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D  +L+D ELQAWW E  + GH DKKNEPWW +M + Q LI++ TTIIWI+SALHAAVNF
Sbjct  659  DEEILKDNELQAWWKELREVGHGDKKNEPWWPEMKTPQELIDSCTTIIWIASALHAAVNF  718

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTP+YEELK NPDKAFL+TITAQ QTLLG+SL+EILS
Sbjct  719  GQYPYAGYLPNRPTVSRRFMPEPGTPDYEELKRNPDKAFLKTITAQLQTLLGVSLVEILS  778

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH +DEIYLGQRE PEWT DK  L AF+RFGKKL  IE +I+  N D    NR+GPV  P
Sbjct  779  RHTTDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDNILTNRSGPVNAP  838

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLLFPTSEGGLTG+GIPNS+SI
Sbjct  839  YTLLFPTSEGGLTGKGIPNSVSI  861



>sp|O22507.1|LOX17_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 7 [Solanum tuberosum]
 gb|AAB81594.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   311 bits (798),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D  +L+D ELQAWW E  + GH DKKNEPWW +M + Q LI++ TTIIWI+SALHAAVNF
Sbjct  659  DEEILKDNELQAWWKELREVGHGDKKNEPWWPEMKTPQELIDSCTTIIWIASALHAAVNF  718

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTP+YEELK NPDKAFL+TITAQ QTLLG+SL+EILS
Sbjct  719  GQYPYAGYLPNRPTVSRRFMPEPGTPDYEELKRNPDKAFLKTITAQLQTLLGVSLVEILS  778

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH +DEIYLGQRE PEWT DK  L AF+RFGKKL  IE +I+  N D    NR+GPV  P
Sbjct  779  RHTTDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDNILTNRSGPVNAP  838

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLLFPTSEGGLTG+GIPNS+SI
Sbjct  839  YTLLFPTSEGGLTGKGIPNSVSI  861



>gb|KJB80991.1| hypothetical protein B456_013G124500 [Gossypium raimondii]
Length=693

 Score =   308 bits (788),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV QD ELQAWW E  ++ H DKK+EPWW KM +R+ LI + T IIW++SALHAAV
Sbjct  489  KTDEMVQQDPELQAWWKELREEAHGDKKDEPWWPKMQTREELINSCTIIIWVASALHAAV  548

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPE GT EY EL++NPDK FL+TITAQ QTLLGISLIEI
Sbjct  549  NFGQYPYAGYLPNRPTISRRFMPEKGTSEYTELESNPDKVFLKTITAQLQTLLGISLIEI  608

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR  PEWTSD+  L AF+ FGK+L  IE+RI+ MN+D++ +NR GPV 
Sbjct  609  LSRHSSDEVYLGQRASPEWTSDETPLAAFDEFGKRLTGIEERIVEMNNDEQLKNRVGPVN  668

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+PTSEGGLTG+GIPNS+SI
Sbjct  669  MPYTLLYPTSEGGLTGKGIPNSVSI  693



>ref|XP_011087404.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Sesamum indicum]
Length=867

 Score =   312 bits (799),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D MV  D+ELQ+WW E  +KGH DKKNE WW KM + + LI++ T IIW++SALHAAVNF
Sbjct  665  DDMVQNDRELQSWWKELREKGHADKKNESWWPKMQTLKELIDSCTIIIWVASALHAAVNF  724

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGT EY+EL+TNPDK FL TITA+ QTL+GI+LIEILS
Sbjct  725  GQYHYAGYMPNRPTISRRFMPEPGTKEYDELRTNPDKVFLRTITARLQTLVGIALIEILS  784

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH+SDEIYLGQR+ PEWT+D  VL+AF++FGKKL  IE+ I+ MN+D KW+NR G VKVP
Sbjct  785  RHSSDEIYLGQRDTPEWTADAQVLEAFDKFGKKLGEIEEGIVKMNNDGKWKNRVGAVKVP  844

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLL+PTSE GLTG+GIPNS+SI
Sbjct  845  YTLLYPTSEDGLTGKGIPNSVSI  867



>sp|Q43190.1|LOX14_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 4; AltName: 
Full=Root lipoxygenase [Solanum tuberosum]
 gb|AAB67860.1| lipoxygenase [Solanum tuberosum]
Length=860

 Score =   311 bits (798),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D  +L+D ELQAWW E  + GH DKKNEPWW +M + Q LI++ TTIIWI+SALHAAVNF
Sbjct  658  DEEILKDNELQAWWKELREVGHGDKKNEPWWPEMETPQELIDSCTTIIWIASALHAAVNF  717

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEYEELK NPDKAFL+TITAQ QTLLG+SLIEILS
Sbjct  718  GQYPYAGYLPNRPTVSRRFMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLIEILS  777

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH +DEIYLGQRE PEWT DK  L AF++FGKKL  IE +I+  N D    NR+GPV  P
Sbjct  778  RHTTDEIYLGQRESPEWTKDKEPLAAFDKFGKKLTDIEKQIIQRNGDNILINRSGPVNAP  837

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLLFPTSEGGLTG+GIPNS+SI
Sbjct  838  YTLLFPTSEGGLTGKGIPNSVSI  860



>ref|NP_001275357.1| linoleate 9S-lipoxygenase 2 [Solanum tuberosum]
 sp|O24379.1|LOX12_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 2; AltName: Full=Lipoxygenase 
1-2 [Solanum tuberosum]
 emb|CAA64766.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   311 bits (798),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D  +L+D ELQAWW E  + GH DKKNEPWW +M   Q LI++ TTIIWI+SALHAAVNF
Sbjct  659  DEEILKDNELQAWWKELREVGHGDKKNEPWWPEMERPQELIDSCTTIIWIASALHAAVNF  718

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEYEELK NPDKAFL+TITAQ QTLLG+SLIEILS
Sbjct  719  GQYPYAGYLPNRPTVSRRFMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLIEILS  778

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH +DEIYLGQRE PEWT DK  L AF++FGKKL  IE +I+  N D    NR+GPV  P
Sbjct  779  RHTTDEIYLGQRESPEWTKDKEPLAAFDKFGKKLTDIEKQIIQRNGDNILTNRSGPVNAP  838

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLLFPTSEGGLTG+GIPNS+SI
Sbjct  839  YTLLFPTSEGGLTGKGIPNSVSI  861



>ref|XP_010659819.1| PREDICTED: lipoxygenase isoform X1 [Vitis vinifera]
Length=859

 Score =   311 bits (797),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV +D ELQ+WW E  ++GH DKK+EPWW KM + + LIET T IIW++SALHAAV
Sbjct  655  KTDEMVQKDSELQSWWKEVREEGHGDKKDEPWWPKMRTVKELIETCTIIIWVASALHAAV  714

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRF+PE GTPEYEELK+NPDKAFL+TITAQ QTLLGISLIE+
Sbjct  715  NFGQYPYAGYLPNRPTISRRFIPEEGTPEYEELKSNPDKAFLKTITAQLQTLLGISLIEV  774

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR+ PEWT D   L AFE+FG+KLA IE+ I+  N D++++NR GP+K
Sbjct  775  LSRHSSDEVYLGQRDTPEWTLDTTPLKAFEKFGRKLADIEEMIIERNGDERFKNRVGPLK  834

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+PTSEGGLTG+GIPNS+SI
Sbjct  835  IPYTLLYPTSEGGLTGKGIPNSVSI  859



>ref|XP_007208098.1| hypothetical protein PRUPE_ppa001293mg [Prunus persica]
 gb|EMJ09297.1| hypothetical protein PRUPE_ppa001293mg [Prunus persica]
Length=862

 Score =   311 bits (797),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D ++ +D ELQ+WW E V++GH DKK+EPWW KM +R+ L+ET T IIW +SALHAAV
Sbjct  658  KTDDIIQKDIELQSWWKELVEEGHGDKKDEPWWPKMQTREDLVETCTIIIWTASALHAAV  717

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SR+FMPE GTPEY+EL+++PD  FL+TITAQ QT+LGI+LIEI
Sbjct  718  NFGQYPYAGYLPNRPTISRKFMPEKGTPEYKELESSPDTVFLKTITAQLQTVLGIALIEI  777

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ PEWT+D   L AF++FG+KLA IEDRI  MN+D+K +NR GPVK
Sbjct  778  LSRHSTDEVYLGQRDTPEWTADTEPLKAFDKFGRKLAEIEDRITRMNNDEKLKNRVGPVK  837

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTSEGGLTGRGIPNS+SI
Sbjct  838  MPYTLLFPTSEGGLTGRGIPNSVSI  862



>ref|NP_001234856.1| linoleate 9S-lipoxygenase A [Solanum lycopersicum]
 sp|P38415.1|LOXA_SOLLC RecName: Full=Linoleate 9S-lipoxygenase A; AltName: Full=Lipoxygenase 
A [Solanum lycopersicum]
 gb|AAA53184.1| lipoxygenase [Solanum lycopersicum]
Length=860

 Score =   311 bits (797),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = -1

Query  724  VLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNFGQY  545
            +L+D ELQAWW E  + GH DKKNEPWW +M + Q LI++ TTIIWI+SALHAAVNFGQY
Sbjct  661  ILKDNELQAWWKEVREVGHGDKKNEPWWAEMETPQELIDSCTTIIWIASALHAAVNFGQY  720

Query  544  SYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHA  365
             YAGY P RPT+SR+FMPEPGTPEYEELK NPDKAFL+TITAQ QTLLG+SLIEILSRH 
Sbjct  721  PYAGYLPNRPTVSRKFMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLIEILSRHT  780

Query  364  SDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTL  185
            +DEIYLGQRE PEWT DK  L AFERFG KL  IE +I+  N +    NRTGPV  PYTL
Sbjct  781  TDEIYLGQRESPEWTKDKEPLAAFERFGNKLTDIEKQIMQRNGNNILTNRTGPVNAPYTL  840

Query  184  LFPTSEGGLTGRGIPNSISI  125
            LFPTSEGGLTG+GIPNS+SI
Sbjct  841  LFPTSEGGLTGKGIPNSVSI  860



>ref|XP_009365899.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=424

 Score =   299 bits (766),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K + ++  D ELQ+WW E V++GH D K+EPWW KM + + L+ET T +IW +SALHAA+
Sbjct  220  KTNDIIQTDVELQSWWKELVEEGHGDIKDEPWWPKMQTFEELVETCTILIWTASALHAAL  279

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQ+SYAGY P RPT+SR+FMPE GTPEYEEL+ +PD  FL+TITAQ QT+LGI+ IEI
Sbjct  280  NFGQFSYAGYLPNRPTISRKFMPEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEI  339

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ P+WTSD   L+AFE+FGKKLA IEDRI +MN+D K +NR G VK
Sbjct  340  LSRHSTDEVYLGQRDTPDWTSDIAALEAFEKFGKKLAEIEDRITSMNNDDKLKNRVGSVK  399

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTSEGG+TG+GIPNS+SI
Sbjct  400  IPYTLLFPTSEGGITGKGIPNSVSI  424



>sp|Q43189.1|LOX13_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 3 [Solanum tuberosum]
 gb|AAB67858.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   310 bits (794),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D  +L+D ELQAWW E  + GH DKKNEPWW +M + Q LI++ TTIIWI+SALHAAVNF
Sbjct  659  DEEILKDNELQAWWKELREVGHGDKKNEPWWPEMETPQELIDSCTTIIWIASALHAAVNF  718

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P R T+SRRFMPEPGTPEYEELK NPDKAFL+TITAQ QTLLG+SL+EILS
Sbjct  719  GQYPYAGYLPNRATVSRRFMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLVEILS  778

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH +DEIYLGQRE PEWT DK  L AF+RFGKKL  IE +I+  N D    NR+GPV  P
Sbjct  779  RHTTDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDNILTNRSGPVNAP  838

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLLFPTSEGGLTG+GIPNS+SI
Sbjct  839  YTLLFPTSEGGLTGKGIPNSVSI  861



>emb|CAA64765.1| lipoxygenase [Solanum tuberosum]
Length=844

 Score =   310 bits (793),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D  +L+D ELQAWW E  + GH DKKNEPWW +M + Q LI++ TTIIWI+SALHAAVNF
Sbjct  642  DEEILKDNELQAWWKELREVGHGDKKNEPWWPEMETPQELIDSCTTIIWIASALHAAVNF  701

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P R T+SRRFMPEPGTPEYEELK NPDKAFL+TITAQ QTLLG+SL+EILS
Sbjct  702  GQYPYAGYLPNRATVSRRFMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLVEILS  761

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH +DEIYLGQRE PEWT DK  L AF+RFGKKL  IE +I+  N D    NR+GPV  P
Sbjct  762  RHTTDEIYLGQRESPEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDNILTNRSGPVNAP  821

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLLFPTSEGGLTG+GIPNS+SI
Sbjct  822  YTLLFPTSEGGLTGKGIPNSVSI  844



>emb|CAD10779.2| lipoxygenase [Prunus dulcis]
 gb|AGT02046.1| lipoxygenase [synthetic construct]
Length=862

 Score =   310 bits (794),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D ++ +D ELQ+WW E V++GH DKK+EPWW KM +R+ L+ET T IIW +SALHAAV
Sbjct  658  KTDDIIQEDTELQSWWKELVEEGHGDKKDEPWWPKMQTREDLVETCTIIIWTASALHAAV  717

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQ+ YAGY P RPTLSR+FMPE GTPEY+EL+++PD  FL+TITAQ QT+LGI+LIEI
Sbjct  718  NFGQFPYAGYLPNRPTLSRKFMPEKGTPEYKELESSPDTVFLKTITAQLQTVLGIALIEI  777

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ PEWT+D   L AF++FG+KLA IEDRI +MN+D+K +NR GPVK
Sbjct  778  LSRHSTDEVYLGQRDTPEWTADTEPLKAFDKFGRKLAKIEDRITSMNNDEKLKNRVGPVK  837

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTS GGLTGRGIPNS+SI
Sbjct  838  MPYTLLFPTSGGGLTGRGIPNSVSI  862



>gb|KCW61801.1| hypothetical protein EUGRSUZ_H044981, partial [Eucalyptus grandis]
Length=795

 Score =   308 bits (790),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V +D+ELQ+WW E V++GH DKK EPWW KM + + L ET T  IWI+SALHAAV
Sbjct  591  KSDETVQKDEELQSWWRELVEEGHGDKKGEPWWPKMQTVKDLTETCTITIWIASALHAAV  650

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSRR+MPE GTPE+EELK NPDKAFL+TITAQ QTLLGISLIEI
Sbjct  651  NFGQYPYAGYLPNRPTLSRRYMPEEGTPEFEELKQNPDKAFLKTITAQLQTLLGISLIEI  710

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H++DE+YLGQR+ PEWT+D   L+AFERFGKKL  +E+RI+ MN D++W NR GPV+
Sbjct  711  LSSHSTDEVYLGQRDTPEWTADAEPLEAFERFGKKLGEVEERIMRMNGDKRWMNRVGPVE  770

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPY LL+PTSEGG+T +GIPNS+SI
Sbjct  771  VPYMLLYPTSEGGVTAKGIPNSVSI  795



>emb|CAB94852.1| lipoxygenase [Prunus dulcis]
Length=862

 Score =   310 bits (793),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D ++ +D ELQ+WW E V++GH DKK+EPWW KM +R+ L+ET T IIW +SALHAAV
Sbjct  658  KTDDIIQKDIELQSWWKELVEEGHGDKKDEPWWPKMQTRKDLVETCTIIIWTASALHAAV  717

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SR+FMPE GTPEY+EL+++PD  FL+TITAQ QT+LGI+LIEI
Sbjct  718  NFGQYPYAGYLPNRPTISRKFMPEKGTPEYKELESSPDTVFLKTITAQLQTVLGIALIEI  777

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ PEWT+D   L AF +FG KLA IEDRI  MN+D+K +NR GPVK
Sbjct  778  LSRHSTDEVYLGQRDTPEWTADTEPLKAFAKFGSKLAEIEDRITRMNNDEKLKNRVGPVK  837

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTSEGGLTGRGIPNS+SI
Sbjct  838  MPYTLLFPTSEGGLTGRGIPNSVSI  862



>ref|XP_009790810.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=853

 Score =   309 bits (792),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D M+  D ELQAWW E  +KGH DKK+EPWW KM +   LI++ T +IWI+SALHAAV
Sbjct  649  KSDDMIQGDAELQAWWKELREKGHGDKKDEPWWPKMQTVLELIDSCTIVIWIASALHAAV  708

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSRRFMPEPGTPEYEEL TNP+KAFL+TIT Q QTLLGISLIE+
Sbjct  709  NFGQYPYAGYLPNRPTLSRRFMPEPGTPEYEELNTNPEKAFLKTITPQMQTLLGISLIEM  768

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH +DE+YLG R+ PEWT+D+  L AFERFGK+L  IE+RI  MN D+KW+NR+GPVK
Sbjct  769  LSRHTADEVYLGLRDTPEWTNDQEPLQAFERFGKRLREIEERITQMNCDEKWKNRSGPVK  828

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYT  +P+SE GLTG+GIPNS+SI
Sbjct  829  VPYTSFYPSSEMGLTGKGIPNSVSI  853



>ref|XP_007208096.1| hypothetical protein PRUPE_ppa001287mg [Prunus persica]
 gb|EMJ09295.1| hypothetical protein PRUPE_ppa001287mg [Prunus persica]
Length=862

 Score =   309 bits (792),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D ++ +D ELQ+WW E V++GH DKK+EPWW KM +R+ L+ET T IIW +SALHAAV
Sbjct  658  KTDDIIQKDTELQSWWKELVEEGHGDKKDEPWWPKMQTREDLVETCTIIIWTASALHAAV  717

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSR+FMPE GTPEY+EL+++PD  FL+TITAQ QT+LGI+LIEI
Sbjct  718  NFGQYPYAGYLPNRPTLSRKFMPEKGTPEYKELESSPDTVFLKTITAQLQTVLGIALIEI  777

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ PEWT+D   L  F++FG+KLA IEDRI +MN+D+K +NR GPVK
Sbjct  778  LSRHSTDEVYLGQRDTPEWTADTEPLKVFDKFGRKLAEIEDRIESMNNDEKLKNRVGPVK  837

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTS GGLTGRGIPNS+SI
Sbjct  838  MPYTLLFPTSGGGLTGRGIPNSVSI  862



>ref|NP_001268178.1| lipoxygenase [Vitis vinifera]
 gb|ACZ17392.1| lipoxygenase [Vitis vinifera]
Length=859

 Score =   309 bits (791),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV +D ELQ WW E  ++GH DKK+EPWW KM + + L++T T IIW++SALHAAV
Sbjct  655  KTDEMVQKDSELQFWWKEVREEGHGDKKDEPWWPKMRTVKELMQTCTIIIWVASALHAAV  714

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPE GTPEYEELK+NPDKAFL+TITAQ QTLLGISLIE+
Sbjct  715  NFGQYPYAGYLPNRPTISRRFMPEEGTPEYEELKSNPDKAFLKTITAQLQTLLGISLIEV  774

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR+ PEWT D   L AFE+FG+KLA IE+ I+  N +++++NR GPVK
Sbjct  775  LSRHSSDEVYLGQRDTPEWTLDTTPLKAFEKFGRKLADIEEMIIDRNGNERFKNRVGPVK  834

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+PTSEGGLTG+GIPNS+SI
Sbjct  835  IPYTLLYPTSEGGLTGKGIPNSVSI  859



>ref|XP_010025195.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61798.1| hypothetical protein EUGRSUZ_H04496 [Eucalyptus grandis]
Length=871

 Score =   309 bits (791),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V +D+ELQ+WW E V++GH DKK EPWW KM + + L E  T  IWI+SALHAAV
Sbjct  667  KSDQTVQEDEELQSWWRELVEEGHGDKKGEPWWPKMQTVKDLTEICTITIWIASALHAAV  726

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSRR+MPE GTPE+EEL+ NPDKAFL+TITAQ QTLLGISLIEI
Sbjct  727  NFGQYPYAGYLPNRPTLSRRYMPEEGTPEFEELRQNPDKAFLKTITAQLQTLLGISLIEI  786

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H++DE+YLGQR+ PEWT+D   L+AFERFGKKL  +E+RI+ MN D++WRNR GPV+
Sbjct  787  LSTHSTDEVYLGQRDTPEWTADAEPLEAFERFGKKLGEVEERIMRMNGDKRWRNRVGPVE  846

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPY LL+PTSEGG+T +GIPNS+SI
Sbjct  847  VPYMLLYPTSEGGVTAKGIPNSVSI  871



>ref|XP_009376659.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
 ref|XP_009376682.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=862

 Score =   308 bits (790),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D ++ +D ELQ+WW E V++GH DKK+EPWW K+ + + L+E  TTIIW +SALHAAV
Sbjct  658  KTDDIIQKDAELQSWWKELVEEGHGDKKDEPWWPKLQTLEELVEICTTIIWTASALHAAV  717

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SR+FMP  GT EYEELK+NPDK FL+TITAQ QTLLGISLIEI
Sbjct  718  NFGQYPYAGYLPNRPTISRKFMPVKGTAEYEELKSNPDKVFLKTITAQLQTLLGISLIEI  777

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ PEWT+D   L+AF++FGKKL  IE+RI +MN+D+K +NR GPVK
Sbjct  778  LSRHSTDEVYLGQRDTPEWTADAAPLEAFDKFGKKLEEIEERITSMNNDEKLKNRVGPVK  837

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLLFPTS GGLTG+GIPNS+SI
Sbjct  838  VPYTLLFPTSGGGLTGKGIPNSVSI  862



>ref|XP_010025194.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
Length=871

 Score =   309 bits (791),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V +D+ELQ+WW E V++GH DKK EPWW KM + + L ET T  IWI+SALHAAV
Sbjct  667  KSDETVQKDEELQSWWRELVEEGHGDKKGEPWWPKMQTVKDLTETCTITIWIASALHAAV  726

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSRR+MPE GTPE+EELK NPDKAFL+TITAQ QTLLGISLIEI
Sbjct  727  NFGQYPYAGYLPNRPTLSRRYMPEEGTPEFEELKQNPDKAFLKTITAQLQTLLGISLIEI  786

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H++DE+YLGQR+ PEWT+D   L+AFERFGKKL  +E+RI+ MN D++W NR GPV+
Sbjct  787  LSSHSTDEVYLGQRDTPEWTADAEPLEAFERFGKKLGEVEERIMRMNGDKRWMNRVGPVE  846

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPY LL+PTSEGG+T +GIPNS+SI
Sbjct  847  VPYMLLYPTSEGGVTAKGIPNSVSI  871



>ref|XP_007204937.1| hypothetical protein PRUPE_ppa001311mg [Prunus persica]
 gb|EMJ06136.1| hypothetical protein PRUPE_ppa001311mg [Prunus persica]
Length=856

 Score =   308 bits (790),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 175/205 (85%), Gaps = 1/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D ++ +D ELQ+WW E V++GH DKK+EPWW KM +R+ L+ET T IIW +SALHAAV
Sbjct  653  KTDDIIQKDTELQSWWKELVEEGHGDKKDEPWWPKMQTREDLVETCTIIIWTASALHAAV  712

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SR+FMPE GTPEY+EL+++PD  FL+TITAQ QT+LGI+LIEI
Sbjct  713  NFGQYPYAGYLPNRPTISRKFMPEKGTPEYKELESSPDTVFLKTITAQLQTVLGIALIEI  772

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ PEWT+D   L AF++FGKKLA IEDRI +MN+D+K +NR GPVK
Sbjct  773  LSRHSTDEVYLGQRDTPEWTADTEPLKAFDKFGKKLAEIEDRITSMNNDEKLKNRVGPVK  832

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLLFPTSE GLTGRGIPNS+SI
Sbjct  833  VPYTLLFPTSE-GLTGRGIPNSVSI  856



>ref|NP_001281030.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82778.1| lipoxygenase [Malus domestica]
Length=862

 Score =   308 bits (790),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D ++ +D ELQ+WW E V++GH DKK+EPWW K+ + +VL+E  TTIIW +SALHAAV
Sbjct  658  KTDDIIQKDAELQSWWKELVEEGHGDKKDEPWWPKLQTLEVLVEICTTIIWTASALHAAV  717

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SR+FMP  GT EYEELK+NPDK FL+TITAQ QTLLGISLIEI
Sbjct  718  NFGQYPYAGYLPNRPTISRKFMPVKGTAEYEELKSNPDKVFLKTITAQLQTLLGISLIEI  777

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ PEWT+D   L+AF++FGKKL  IE+RI +MN+ +K +NR GPVK
Sbjct  778  LSRHSTDEVYLGQRDTPEWTADTAPLEAFDKFGKKLEEIEERITSMNNGEKLKNRVGPVK  837

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLLFPTS GGLTG+GIPNS+SI
Sbjct  838  VPYTLLFPTSGGGLTGKGIPNSVSI  862



>ref|XP_006344621.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=862

 Score =   308 bits (790),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 170/206 (83%), Gaps = 1/206 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V +D ELQAWW E  ++GH DKK+EPWW KM + Q LI++ T  IWI+SALHAAV
Sbjct  657  KSDDAVQKDTELQAWWKELREEGHGDKKDEPWWPKMQTVQELIDSCTITIWIASALHAAV  716

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSR+FMPEPG+ EYEELKTNPD  FL+TIT Q QTL+GISLIE+
Sbjct  717  NFGQYPYAGYLPNRPTLSRKFMPEPGSAEYEELKTNPDNVFLKTITPQLQTLVGISLIEL  776

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDD-QKWRNRTGPV  203
            LSRH+SD +YLGQ + PEWT D+  L AFERFGKKL+ IEDRI+ MN D +KW+NR+GPV
Sbjct  777  LSRHSSDTLYLGQNDSPEWTKDQEPLSAFERFGKKLSDIEDRIMQMNGDPEKWKNRSGPV  836

Query  202  KVPYTLLFPTSEGGLTGRGIPNSISI  125
            KVPYTLLFPTSE GLTG+GIPNS+SI
Sbjct  837  KVPYTLLFPTSEEGLTGKGIPNSVSI  862



>ref|XP_006472029.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X2 [Citrus sinensis]
Length=808

 Score =   307 bits (786),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D MV +D ELQ+WW E  ++GH DKK+EPWW KM +R+ LI++ T IIW++SALHAA+
Sbjct  604  KNDDMVKEDSELQSWWKELREEGHGDKKDEPWWPKMQNREELIDSCTIIIWVASALHAAI  663

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPE GTPEY+EL++NPDK FL+TITAQ QT+LGISLIEI
Sbjct  664  NFGQYPYAGYLPNRPTISRRFMPEEGTPEYDELESNPDKVFLKTITAQLQTILGISLIEI  723

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ PEWTSD+  L AF+ FGKKLA +E++I++ N ++  +NR GPVK
Sbjct  724  LSRHSTDEVYLGQRDTPEWTSDEAPLQAFDEFGKKLAEVEEKIISRNHNKNLKNRVGPVK  783

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL PTSEGGLTG+GIPNS+SI
Sbjct  784  MPYTLLVPTSEGGLTGKGIPNSVSI  808



>gb|KJB80990.1| hypothetical protein B456_013G124500 [Gossypium raimondii]
Length=860

 Score =   308 bits (788),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV QD ELQAWW E  ++ H DKK+EPWW KM +R+ LI + T IIW++SALHAAV
Sbjct  656  KTDEMVQQDPELQAWWKELREEAHGDKKDEPWWPKMQTREELINSCTIIIWVASALHAAV  715

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPE GT EY EL++NPDK FL+TITAQ QTLLGISLIEI
Sbjct  716  NFGQYPYAGYLPNRPTISRRFMPEKGTSEYTELESNPDKVFLKTITAQLQTLLGISLIEI  775

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR  PEWTSD+  L AF+ FGK+L  IE+RI+ MN+D++ +NR GPV 
Sbjct  776  LSRHSSDEVYLGQRASPEWTSDETPLAAFDEFGKRLTGIEERIVEMNNDEQLKNRVGPVN  835

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+PTSEGGLTG+GIPNS+SI
Sbjct  836  MPYTLLYPTSEGGLTGKGIPNSVSI  860



>ref|XP_009625817.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=844

 Score =   307 bits (787),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D M+ +D ELQAWW E  + GH DKK+EPWW KM + + LI++ TTIIWI+SALHAA+
Sbjct  640  KTDDMIQKDTELQAWWKEVREDGHGDKKSEPWWPKMQALKELIDSCTTIIWIASALHAAI  699

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y GY P RP++SRRFMPEPG+PEYEELKTNP+K +L TIT Q QTL+GIS IEI
Sbjct  700  NFGQYPYGGYLPNRPSMSRRFMPEPGSPEYEELKTNPEKGYLRTITPQLQTLIGISAIEI  759

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H+SDEIYLGQR+ PEWT DK  + A ERFGKKLA IE++I+ MN+D+K +NR GPVK
Sbjct  760  LSTHSSDEIYLGQRDTPEWTKDKEPIQALERFGKKLAEIEEKIIKMNNDKKLKNRMGPVK  819

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+PTSE GLTG+GIPNS+SI
Sbjct  820  MPYTLLYPTSEPGLTGKGIPNSVSI  844



>ref|XP_010094673.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXB56581.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=764

 Score =   306 bits (783),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D +V +D ELQAWW E  + GH DKK+EPWW  M +R+ L ET TT+IWI+SALHAAV
Sbjct  560  KTDDIVQKDVELQAWWKELREVGHGDKKDEPWWPTMQTRKDLTETCTTVIWIASALHAAV  619

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPE GTPEYEEL TNPD AFL+TITAQ QT+LG+SLIEI
Sbjct  620  NFGQYPYAGYLPNRPTVSRRFMPEEGTPEYEELMTNPDMAFLKTITAQEQTILGVSLIEI  679

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRHASDE+YLGQR+ PEWT+D     AFERFG+KLA IEDRI++ N+D+  +NR GPVK
Sbjct  680  LSRHASDEVYLGQRDTPEWTADAEPTKAFERFGEKLAQIEDRIMSRNNDKTLKNRVGPVK  739

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
             PYTLL P+SE GLT RGIPNSISI
Sbjct  740  FPYTLLCPSSEEGLTARGIPNSISI  764



>gb|KJB80989.1| hypothetical protein B456_013G124500 [Gossypium raimondii]
Length=865

 Score =   308 bits (788),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV QD ELQAWW E  ++ H DKK+EPWW KM +R+ LI + T IIW++SALHAAV
Sbjct  661  KTDEMVQQDPELQAWWKELREEAHGDKKDEPWWPKMQTREELINSCTIIIWVASALHAAV  720

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPE GT EY EL++NPDK FL+TITAQ QTLLGISLIEI
Sbjct  721  NFGQYPYAGYLPNRPTISRRFMPEKGTSEYTELESNPDKVFLKTITAQLQTLLGISLIEI  780

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR  PEWTSD+  L AF+ FGK+L  IE+RI+ MN+D++ +NR GPV 
Sbjct  781  LSRHSSDEVYLGQRASPEWTSDETPLAAFDEFGKRLTGIEERIVEMNNDEQLKNRVGPVN  840

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+PTSEGGLTG+GIPNS+SI
Sbjct  841  MPYTLLYPTSEGGLTGKGIPNSVSI  865



>gb|KDO56302.1| hypothetical protein CISIN_1g002839mg [Citrus sinensis]
Length=874

 Score =   308 bits (788),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D MV +D ELQ+WW E  ++GH DKK+EPWW KM +R+ LI++ T IIW++SALHAA+
Sbjct  670  KNDDMVKEDSELQSWWKELREEGHGDKKDEPWWPKMQNREELIDSCTIIIWVASALHAAI  729

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPE GTPEY+EL++NPDK FL+TITAQ QT+LGISLIEI
Sbjct  730  NFGQYPYAGYLPNRPTISRRFMPEEGTPEYDELESNPDKVFLKTITAQLQTILGISLIEI  789

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ PEWTSD+  L AF+ FGKKLA +E++I++ N ++  +NR GPVK
Sbjct  790  LSRHSTDEVYLGQRDTPEWTSDEAPLQAFDEFGKKLAEVEEKIISRNHNKNLKNRVGPVK  849

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL PTSEGGLTG+GIPNS+SI
Sbjct  850  MPYTLLVPTSEGGLTGKGIPNSVSI  874



>ref|XP_006433338.1| hypothetical protein CICLE_v10000236mg [Citrus clementina]
 ref|XP_006472028.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X1 [Citrus sinensis]
 gb|ESR46578.1| hypothetical protein CICLE_v10000236mg [Citrus clementina]
Length=874

 Score =   308 bits (788),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D MV +D ELQ+WW E  ++GH DKK+EPWW KM +R+ LI++ T IIW++SALHAA+
Sbjct  670  KNDDMVKEDSELQSWWKELREEGHGDKKDEPWWPKMQNREELIDSCTIIIWVASALHAAI  729

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPE GTPEY+EL++NPDK FL+TITAQ QT+LGISLIEI
Sbjct  730  NFGQYPYAGYLPNRPTISRRFMPEEGTPEYDELESNPDKVFLKTITAQLQTILGISLIEI  789

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ PEWTSD+  L AF+ FGKKLA +E++I++ N ++  +NR GPVK
Sbjct  790  LSRHSTDEVYLGQRDTPEWTSDEAPLQAFDEFGKKLAEVEEKIISRNHNKNLKNRVGPVK  849

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL PTSEGGLTG+GIPNS+SI
Sbjct  850  MPYTLLVPTSEGGLTGKGIPNSVSI  874



>gb|AHX56187.1| lipoxygenase [Diospyros kaki]
Length=872

 Score =   307 bits (787),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D+MV +D ELQ+WW E  + GH DKK+EPWW KM +R+ LI + TTIIW++SALHAAV
Sbjct  668  KNDNMVQEDSELQSWWNELREVGHGDKKDEPWWPKMQTRKELIYSCTTIIWVASALHAAV  727

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRF+PE G+PEYEELK+ P+KAFL+TITAQ QTLLGISLIE+
Sbjct  728  NFGQYPYAGYLPNRPTISRRFIPELGSPEYEELKSYPEKAFLKTITAQLQTLLGISLIEV  787

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H++DE+YLGQR+  EWT+D   L+AF+RFGKKL  IE+ I+ MN+D+K +NR GPVK
Sbjct  788  LSAHSTDEVYLGQRDTAEWTTDIEPLEAFQRFGKKLGEIEENIIDMNNDEKLKNRVGPVK  847

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLLFPTSEGG+TG+GIPNS+SI
Sbjct  848  VPYTLLFPTSEGGVTGKGIPNSVSI  872



>ref|XP_011092040.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X4 [Sesamum 
indicum]
Length=866

 Score =   307 bits (787),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D MV  D ELQ+WW E  +KGH DK NEPWW KM +R+ LI++ T +IW++SALHAAVNF
Sbjct  664  DDMVENDIELQSWWKELREKGHADKTNEPWWPKMKTRKELIDSCTIVIWVASALHAAVNF  723

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY Y GY P RP+ SRRF+PEPGTPEYEELK+NP+KAFL+TIT+Q Q++LGISL+EILS
Sbjct  724  GQYPYGGYLPNRPSTSRRFIPEPGTPEYEELKSNPEKAFLKTITSQLQSVLGISLVEILS  783

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH+SDEI+LGQRE PEWTSD   L AFE FG +L  IE RI+ MN+D +W+NR GPVK+P
Sbjct  784  RHSSDEIFLGQRESPEWTSDAGALKAFEMFGNRLVEIEKRIMEMNNDGRWKNRFGPVKMP  843

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLL+P+S+ GLTGRGIPNS+SI
Sbjct  844  YTLLYPSSDIGLTGRGIPNSVSI  866



>ref|XP_011092039.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X3 [Sesamum 
indicum]
Length=867

 Score =   307 bits (787),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D MV  D ELQ+WW E  +KGH DK NEPWW KM +R+ LI++ T +IW++SALHAAVNF
Sbjct  665  DDMVENDIELQSWWKELREKGHADKTNEPWWPKMKTRKELIDSCTIVIWVASALHAAVNF  724

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY Y GY P RP+ SRRF+PEPGTPEYEELK+NP+KAFL+TIT+Q Q++LGISL+EILS
Sbjct  725  GQYPYGGYLPNRPSTSRRFIPEPGTPEYEELKSNPEKAFLKTITSQLQSVLGISLVEILS  784

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH+SDEI+LGQRE PEWTSD   L AFE FG +L  IE RI+ MN+D +W+NR GPVK+P
Sbjct  785  RHSSDEIFLGQRESPEWTSDAGALKAFEMFGNRLVEIEKRIMEMNNDGRWKNRFGPVKMP  844

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLL+P+S+ GLTGRGIPNS+SI
Sbjct  845  YTLLYPSSDIGLTGRGIPNSVSI  867



>ref|XP_010256003.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
 ref|XP_010256004.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
 ref|XP_010256005.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
Length=874

 Score =   307 bits (786),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 168/209 (80%), Gaps = 5/209 (2%)
 Frame = -1

Query  736  DDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVN  557
            +D ++  D ELQ WWTE    GH DKK+EPWW KM +   L +T T IIW++SA HAAVN
Sbjct  666  NDDLIQGDSELQCWWTELRNVGHGDKKDEPWWPKMQTLSDLTQTCTIIIWVASAFHAAVN  725

Query  556  FGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEIL  377
            FGQY YAGY P RPT+SRRFMPEPGTP+Y EL++NPDK +L+TITAQ QTLLG+SLIEIL
Sbjct  726  FGQYPYAGYLPNRPTISRRFMPEPGTPDYAELESNPDKVYLKTITAQLQTLLGVSLIEIL  785

Query  376  SRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKV  197
            SRH+SDE+YLGQRE PEWTSD   L+AFERFGKKL  IE+RI+ MN+D++W+NR GPVKV
Sbjct  786  SRHSSDEVYLGQRESPEWTSDAAALEAFERFGKKLVEIENRIIEMNNDKRWKNRVGPVKV  845

Query  196  PYTLLFP-----TSEGGLTGRGIPNSISI  125
            PY LL+P     T  GGLTGRG+PNSISI
Sbjct  846  PYMLLYPDTSNYTGVGGLTGRGVPNSISI  874



>gb|KGN60916.1| hypothetical protein Csa_2G023340 [Cucumis sativus]
Length=485

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V  D ELQ+WW E  ++GH DKK+EPWW KM + + LI+T   IIWI+SALHAAV
Sbjct  281  KTDEAVRNDPELQSWWKELREEGHGDKKDEPWWPKMQNIEELIDTCAIIIWIASALHAAV  340

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SR+FMPE GTPEY+EL+TNP+KAFL TITAQ QTLLGI+ IEI
Sbjct  341  NFGQYPYAGYLPNRPTISRKFMPEEGTPEYKELETNPEKAFLRTITAQLQTLLGIASIEI  400

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR+ P+WT+DK  LDAFE+FGKKLA IED I   N+D   RNR GPV 
Sbjct  401  LSRHSSDEVYLGQRDSPKWTADKEALDAFEKFGKKLAEIEDGITKRNEDLTLRNRVGPVF  460

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+P+SE GLTG+GIPNS+SI
Sbjct  461  MPYTLLYPSSEEGLTGKGIPNSVSI  485



>ref|XP_010025193.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61802.1| hypothetical protein EUGRSUZ_H04499 [Eucalyptus grandis]
Length=871

 Score =   306 bits (785),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V +D+ELQ+WW E V++GH DKK EPWW KM + + L E  T  IWI+SALHAAV
Sbjct  667  KSDQTVQKDEELQSWWRELVEEGHGDKKGEPWWPKMQTVKDLTEICTITIWIASALHAAV  726

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSRR+MPE GTPE+EELK NPDKAFL+TITAQFQTLL ISL+EI
Sbjct  727  NFGQYPYAGYLPNRPTLSRRYMPEEGTPEFEELKQNPDKAFLKTITAQFQTLLVISLMEI  786

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H++DE+YLGQR+ PEWT+D   L+AFERFGKKL  +E+RI+ MN D++WRNR GPV+
Sbjct  787  LSMHSTDEVYLGQRDTPEWTADAEPLEAFERFGKKLGEVEERIMRMNGDKRWRNRVGPVE  846

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPY LL+PTSEGG T +GIPNS+SI
Sbjct  847  VPYMLLYPTSEGGATAKGIPNSVSI  871



>ref|XP_007034722.1| PLAT/LH2 domain-containing lipoxygenase family protein isoform 
2 [Theobroma cacao]
 ref|XP_007034723.1| PLAT/LH2 domain-containing lipoxygenase family protein isoform 
2 [Theobroma cacao]
 gb|EOY05648.1| PLAT/LH2 domain-containing lipoxygenase family protein isoform 
2 [Theobroma cacao]
 gb|EOY05649.1| PLAT/LH2 domain-containing lipoxygenase family protein isoform 
2 [Theobroma cacao]
Length=453

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 167/208 (80%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D +V +D E+Q+WW E   +GH D K+EPWW ++ +R  LIE  T IIW++SA HAAVNF
Sbjct  246  DEVVKEDNEIQSWWAEIRTEGHGDLKDEPWWPEIKTRAELIEACTIIIWVASAFHAAVNF  305

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEY EL+ +PD AFL+TITAQFQTLLG+SLIE+LS
Sbjct  306  GQYPYAGYLPNRPTVSRRFMPEPGTPEYAELEKDPDLAFLKTITAQFQTLLGVSLIEVLS  365

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH++DEIYLGQR+ PEWTSD   L AFERFGKKL  IE RI+  N+D + +NRTGPVK+P
Sbjct  366  RHSADEIYLGQRDSPEWTSDAEPLAAFERFGKKLIEIESRIMDRNNDSRLKNRTGPVKMP  425

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLL+P +     EGGLTG+GIPNSISI
Sbjct  426  YTLLYPNTSDYSREGGLTGKGIPNSISI  453



>ref|XP_008246456.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=915

 Score =   307 bits (787),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D ++ +D ELQ+WW E V++GH DKK+EPWW  M +R+ L+ET T IIW +SALHAAV
Sbjct  711  KTDDIIQKDTELQSWWKELVEEGHGDKKDEPWWPNMQTREDLVETCTIIIWTASALHAAV  770

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSR+FMPE GTPEY+EL+++PD  FL+TITAQ Q +LGI+LIEI
Sbjct  771  NFGQYPYAGYLPNRPTLSRKFMPEKGTPEYKELESSPDTVFLKTITAQLQIVLGIALIEI  830

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLG+R+ PEWT+D+  L AF++FG+KLA IEDRI +MN+D+K +NR GPVK
Sbjct  831  LSRHSTDEVYLGKRDTPEWTADREPLKAFDKFGRKLAEIEDRITSMNNDEKLKNRVGPVK  890

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTS GGLTGRGIPNS+SI
Sbjct  891  MPYTLLFPTSGGGLTGRGIPNSVSI  915



>ref|XP_011092038.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Sesamum 
indicum]
Length=906

 Score =   306 bits (785),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D MV  D ELQ+WW E  +KGH DK NEPWW KM +R+ LI++ T +IW++SALHAAVNF
Sbjct  704  DDMVENDIELQSWWKELREKGHADKTNEPWWPKMKTRKELIDSCTIVIWVASALHAAVNF  763

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY Y GY P RP+ SRRF+PEPGTPEYEELK+NP+KAFL+TIT+Q Q++LGISL+EILS
Sbjct  764  GQYPYGGYLPNRPSTSRRFIPEPGTPEYEELKSNPEKAFLKTITSQLQSVLGISLVEILS  823

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH+SDEI+LGQRE PEWTSD   L AFE FG +L  IE RI+ MN+D +W+NR GPVK+P
Sbjct  824  RHSSDEIFLGQRESPEWTSDAGALKAFEMFGNRLVEIEKRIMEMNNDGRWKNRFGPVKMP  883

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLL+P+S+ GLTGRGIPNS+SI
Sbjct  884  YTLLYPSSDIGLTGRGIPNSVSI  906



>ref|XP_011092037.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Sesamum 
indicum]
Length=907

 Score =   306 bits (785),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D MV  D ELQ+WW E  +KGH DK NEPWW KM +R+ LI++ T +IW++SALHAAVNF
Sbjct  705  DDMVENDIELQSWWKELREKGHADKTNEPWWPKMKTRKELIDSCTIVIWVASALHAAVNF  764

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY Y GY P RP+ SRRF+PEPGTPEYEELK+NP+KAFL+TIT+Q Q++LGISL+EILS
Sbjct  765  GQYPYGGYLPNRPSTSRRFIPEPGTPEYEELKSNPEKAFLKTITSQLQSVLGISLVEILS  824

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH+SDEI+LGQRE PEWTSD   L AFE FG +L  IE RI+ MN+D +W+NR GPVK+P
Sbjct  825  RHSSDEIFLGQRESPEWTSDAGALKAFEMFGNRLVEIEKRIMEMNNDGRWKNRFGPVKMP  884

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLL+P+S+ GLTGRGIPNS+SI
Sbjct  885  YTLLYPSSDIGLTGRGIPNSVSI  907



>ref|XP_009621679.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=822

 Score =   305 bits (780),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D M+ +D ELQAWW E  + GH DKK+EPWW KM +RQ LI+++T IIW++SALHAAV
Sbjct  618  KSDDMLQKDTELQAWWKELREVGHGDKKDEPWWPKMQTRQELIDSVTIIIWMASALHAAV  677

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y GY P RP +SRR +PEPGTPEYEELK NP K +L+TIT QF TL+GIS +E+
Sbjct  678  NFGQYPYGGYAPNRPGMSRRLIPEPGTPEYEELKLNPVKGYLKTITPQFHTLIGISALEV  737

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H SDEIYLGQR+  EWT DK  L AFERFGKKLA IE+ I  MN+D+KWRNRTGPVK
Sbjct  738  LSTHTSDEIYLGQRDSAEWTKDKEALLAFERFGKKLAQIEENITKMNNDKKWRNRTGPVK  797

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+PTSE GLT +GIPNSISI
Sbjct  798  MPYTLLYPTSEPGLTAKGIPNSISI  822



>gb|AES82497.2| linoleate 9S-lipoxygenase-like protein [Medicago truncatula]
Length=867

 Score =   305 bits (782),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D  V +D ELQ+WW E +Q+GH DKKNEPWW KM + + L ET T IIWI+SALHAAV
Sbjct  663  KNDDTVKKDAELQSWWKELIQEGHGDKKNEPWWPKMQTVEELTETCTIIIWIASALHAAV  722

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY +AGY+P RPT+SRRFMPE GT EY+EL TNPDKAFL+TITAQ QTL+GISLIEI
Sbjct  723  NFGQYPFAGYSPNRPTISRRFMPEKGTIEYDELVTNPDKAFLKTITAQLQTLVGISLIEI  782

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H+SDE+YLGQR+   WT D   L+AF+RFGKKL  IE+RI+AMNDD   +NR GPVK
Sbjct  783  LSTHSSDEVYLGQRDSMHWTCDAEPLEAFDRFGKKLKEIEERIVAMNDDVNLKNRVGPVK  842

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+P SE GLTG GIPNS+SI
Sbjct  843  MPYTLLYPRSEAGLTGAGIPNSVSI  867



>gb|AGN75068.1| lipoxygenase 2 [Momordica charantia]
Length=845

 Score =   305 bits (781),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V  D ELQ+WW E  +KGH DKK+EPWW KM + + LIET T +IWI+SALHAAV
Sbjct  641  KTDETVQNDLELQSWWKELREKGHGDKKDEPWWPKMQNVEELIETCTIVIWIASALHAAV  700

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SR+FMPE GTPEYEEL++NP+KAFL TITAQ QTLLG+SLIEI
Sbjct  701  NFGQYPYAGYLPNRPTISRKFMPEKGTPEYEELESNPEKAFLRTITAQLQTLLGVSLIEI  760

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR+ PEWT+DK  L+AFE+FGKKLA IED I+  N D + +NR GPV 
Sbjct  761  LSRHSSDEVYLGQRDSPEWTTDKEPLEAFEKFGKKLAEIEDGIIKRNGDLRLKNRVGPVV  820

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLL+PT E GL+G+GIPNS+SI
Sbjct  821  VPYTLLYPTGEEGLSGKGIPNSVSI  845



>ref|XP_009365971.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=506

 Score =   296 bits (758),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K + ++  D ELQ+WW E V++GH D K+EPWW KM + + L+ET T +IW +SALHAA+
Sbjct  302  KTNDIIQTDVELQSWWKELVEEGHGDIKDEPWWPKMQTFEELVETCTILIWTASALHAAL  361

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQ+SYAGY P RPT+SR+FM E GTPEYEEL+ +PD  FL+TITAQ QT+LGI+ IEI
Sbjct  362  NFGQFSYAGYLPNRPTISRKFMLEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEI  421

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ P+WTSD   L+AFE+FGKKLA IEDRI +MN+D K +NR G VK
Sbjct  422  LSRHSTDEVYLGQRDTPDWTSDIAALEAFEKFGKKLAEIEDRITSMNNDDKLKNRVGSVK  481

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTSEGG+TG+GIPNS+SI
Sbjct  482  IPYTLLFPTSEGGITGKGIPNSVSI  506



>ref|XP_009779646.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nicotiana 
sylvestris]
Length=822

 Score =   304 bits (778),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D M+  D ELQAWW E  + GH DKK+EPWW KM +RQ LI+++T IIW++SALHAAV
Sbjct  618  KSDDMLQVDTELQAWWKELREVGHGDKKDEPWWPKMQTRQELIDSVTIIIWMASALHAAV  677

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y G+ P RP +SRR +PEPGTPEYEELK NP K +L+TIT QFQTL+GIS +E+
Sbjct  678  NFGQYPYGGFAPNRPGMSRRLIPEPGTPEYEELKVNPVKGYLKTITPQFQTLIGISALEV  737

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H SDEIYLGQR+  EWT DK  L AFERFGKKLA IE+ I  MN+D+KW+NRTGPVK
Sbjct  738  LSTHTSDEIYLGQRDSAEWTKDKEALQAFERFGKKLAEIEENITKMNNDKKWKNRTGPVK  797

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+PTSE GLT +GIPNSISI
Sbjct  798  MPYTLLYPTSEPGLTAKGIPNSISI  822



>ref|XP_009625816.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=832

 Score =   304 bits (778),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D M+  D ELQAWW E  +KGH DKK+EPWW KM + Q LI + T +IWI+SALHAAV
Sbjct  628  KSDDMIQGDTELQAWWKELREKGHGDKKDEPWWPKMQTVQELINSCTIVIWIASALHAAV  687

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSRRFMPEPGT EYEEL TNP+ AFL+TIT Q QTLLGISLIE+
Sbjct  688  NFGQYPYAGYLPNRPTLSRRFMPEPGTQEYEELNTNPENAFLKTITPQMQTLLGISLIEM  747

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH +DE+YLGQR+ PEWT+D+  L AFERFGK+L  IE RI  MN D+KW+NR+GPVK
Sbjct  748  LSRHTADEVYLGQRDTPEWTNDQEPLQAFERFGKRLREIEKRITQMNCDEKWKNRSGPVK  807

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYT  + +SE GLTG+GIPNS+SI
Sbjct  808  VPYTSFYASSEMGLTGKGIPNSVSI  832



>ref|XP_009779645.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nicotiana 
sylvestris]
Length=849

 Score =   304 bits (779),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D M+  D ELQAWW E  + GH DKK+EPWW KM +RQ LI+++T IIW++SALHAAV
Sbjct  645  KSDDMLQVDTELQAWWKELREVGHGDKKDEPWWPKMQTRQELIDSVTIIIWMASALHAAV  704

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y G+ P RP +SRR +PEPGTPEYEELK NP K +L+TIT QFQTL+GIS +E+
Sbjct  705  NFGQYPYGGFAPNRPGMSRRLIPEPGTPEYEELKVNPVKGYLKTITPQFQTLIGISALEV  764

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H SDEIYLGQR+  EWT DK  L AFERFGKKLA IE+ I  MN+D+KW+NRTGPVK
Sbjct  765  LSTHTSDEIYLGQRDSAEWTKDKEALQAFERFGKKLAEIEENITKMNNDKKWKNRTGPVK  824

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+PTSE GLT +GIPNSISI
Sbjct  825  MPYTLLYPTSEPGLTAKGIPNSISI  849



>ref|XP_002315780.1| lipoxygenase family protein [Populus trichocarpa]
 gb|EEF01951.1| lipoxygenase family protein [Populus trichocarpa]
Length=880

 Score =   304 bits (779),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 169/208 (81%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D ++  D ELQ+WWTE    GH DKK+EPWW +M +   + +T T IIWI+SALHAAVNF
Sbjct  673  DDLIQGDSELQSWWTEIRNVGHGDKKDEPWWPEMQTLADVTQTCTVIIWIASALHAAVNF  732

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEY+EL  NPD AFL+TITAQ QTLLG+SLIEILS
Sbjct  733  GQYPYAGYLPNRPTISRRFMPEPGTPEYDELAKNPDVAFLKTITAQLQTLLGVSLIEILS  792

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH++DE+YLGQR+ PEWTSD  +L AFERFG+KL  IE++I+ MN+D +W+NR GPV+VP
Sbjct  793  RHSTDEVYLGQRDTPEWTSDSELLAAFERFGRKLVEIENKIMDMNNDNRWKNRVGPVQVP  852

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLLFP +     EGGLTG+GIPNS+SI
Sbjct  853  YTLLFPNTTDYSREGGLTGKGIPNSVSI  880



>emb|CDO99039.1| unnamed protein product [Coffea canephora]
Length=882

 Score =   304 bits (778),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 168/209 (80%), Gaps = 5/209 (2%)
 Frame = -1

Query  736  DDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVN  557
            +D MV  D ELQ+WWTE    GH D K+EPWW +M +R  L++  T IIWI+SALHAAVN
Sbjct  674  NDGMVQGDSELQSWWTELRNVGHGDLKDEPWWPQMQTRDELVQACTIIIWIASALHAAVN  733

Query  556  FGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEIL  377
            FGQY YAGY P RPT+SRRFMPEPGTPEY EL +NPD AFL+TITAQFQTLLG+SLIEIL
Sbjct  734  FGQYPYAGYLPNRPTVSRRFMPEPGTPEYAELASNPDLAFLKTITAQFQTLLGVSLIEIL  793

Query  376  SRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKV  197
            SRH+SDEIYLGQR++PEWTSD    DAF RFG KL  IE+ ILA N+D+K++NRTGPVK+
Sbjct  794  SRHSSDEIYLGQRDNPEWTSDTIPRDAFTRFGAKLVEIENHILARNNDKKYKNRTGPVKM  853

Query  196  PYTLLFPTSE-----GGLTGRGIPNSISI  125
            PYTLL P S      GGLTG+GIPNSISI
Sbjct  854  PYTLLIPNSSDYSKVGGLTGKGIPNSISI  882



>ref|XP_002512386.1| lipoxygenase, putative [Ricinus communis]
 gb|EEF49838.1| lipoxygenase, putative [Ricinus communis]
Length=871

 Score =   304 bits (778),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 168/203 (83%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D MV +D ELQ+WW E  + GH DKK+EPWW KM +R+ LIE+ T IIW +SALHAA+NF
Sbjct  669  DDMVKKDPELQSWWKELREVGHGDKKHEPWWPKMQTREELIESCTIIIWTASALHAAINF  728

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY Y GY P RP++SRRFMPE GTPEYEELKTNPDKAF +T+TAQ QT+LGISLIEILS
Sbjct  729  GQYPYGGYLPNRPSISRRFMPEKGTPEYEELKTNPDKAFFKTVTAQLQTVLGISLIEILS  788

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH+SDE+YLGQR+ PEWT+D   L+AF++FGKKL  IEDRI+ MN D + +NR GPV VP
Sbjct  789  RHSSDEVYLGQRDTPEWTTDSKPLEAFKKFGKKLEKIEDRIIEMNKDVELKNRIGPVLVP  848

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLL P+S+ GLTGRGIPNS+SI
Sbjct  849  YTLLVPSSDVGLTGRGIPNSVSI  871



>ref|XP_010025196.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61795.1| hypothetical protein EUGRSUZ_H04495 [Eucalyptus grandis]
Length=864

 Score =   303 bits (777),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V +D+ELQ+WW E V++GH DKK+EPWW KM + + L ET T  IWI+SALHAAV
Sbjct  660  KSDETVQKDEELQSWWKELVEEGHGDKKDEPWWPKMQTVKDLTETCTITIWIASALHAAV  719

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSRR+MPE GTPE+EEL+ NPDKAFL+TITAQ QTLLGIS+IEI
Sbjct  720  NFGQYPYAGYLPNRPTLSRRYMPEEGTPEFEELRQNPDKAFLKTITAQLQTLLGISIIEI  779

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H++DE+YLGQR+  EWT+D   L+AFERFGKKL  +E+ I+ MN D++WRNR GPV+
Sbjct  780  LSMHSTDEVYLGQRDTREWTADAEPLEAFERFGKKLGEVEETIIRMNGDKRWRNRVGPVE  839

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PY LL+PTSEGG+T +GIPNS+SI
Sbjct  840  IPYMLLYPTSEGGVTAKGIPNSVSI  864



>emb|CAN62372.1| hypothetical protein VITISV_036476 [Vitis vinifera]
Length=289

 Score =   287 bits (734),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 163/208 (78%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D ++  D ELQ+WW E   KGH DKK+EPWW +M +   L +T T IIW++SALHAAVNF
Sbjct  82   DDLIQXDTELQSWWMELRNKGHGDKKDEPWWSEMQTLVDLTKTCTIIIWVASALHAAVNF  141

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEY+EL+ NPD AFL+TITAQ QTLLG+SLIEILS
Sbjct  142  GQYPYAGYLPNRPTISRRFMPEPGTPEYQELERNPDLAFLKTITAQLQTLLGVSLIEILS  201

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH++DEIYLGQR+ PEWTSD   L AFERFG +L  IE RI  MN D++W NR GPV++ 
Sbjct  202  RHSTDEIYLGQRDTPEWTSDAEPLAAFERFGSRLRGIETRINQMNQDRRWNNRFGPVEMQ  261

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLL+P +     +GGL G+GIPNS+SI
Sbjct  262  YTLLYPNTSDYSRQGGLAGKGIPNSVSI  289



>ref|XP_011021548.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Populus 
euphratica]
Length=881

 Score =   303 bits (776),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 169/208 (81%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D ++  D ELQ+WW E    GH DKK+EPWW +M +   + +T T IIWI+SALHAAVNF
Sbjct  674  DDLIQGDSELQSWWAEIRNVGHGDKKDEPWWPEMQTLADVTQTCTVIIWIASALHAAVNF  733

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEY+EL  NPD AFL+TITAQ QTLLG+SLIEILS
Sbjct  734  GQYPYAGYLPNRPTISRRFMPEPGTPEYDELAKNPDAAFLKTITAQLQTLLGVSLIEILS  793

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH++DE+YLGQR+ PEWTSD  +L AFERFG+KL  IE++I+ MN+D++W+NR GPV+VP
Sbjct  794  RHSTDEVYLGQRDTPEWTSDSELLAAFERFGRKLVEIENKIMDMNNDKRWKNRVGPVQVP  853

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLLFP +     EGGLTG+GIPNS+SI
Sbjct  854  YTLLFPNTTDYSREGGLTGKGIPNSVSI  881



>ref|XP_011021549.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Populus 
euphratica]
Length=880

 Score =   303 bits (776),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 169/208 (81%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D ++  D ELQ+WW E    GH DKK+EPWW +M +   + +T T IIWI+SALHAAVNF
Sbjct  673  DDLIQGDSELQSWWAEIRNVGHGDKKDEPWWPEMQTLADVTQTCTVIIWIASALHAAVNF  732

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEY+EL  NPD AFL+TITAQ QTLLG+SLIEILS
Sbjct  733  GQYPYAGYLPNRPTISRRFMPEPGTPEYDELAKNPDAAFLKTITAQLQTLLGVSLIEILS  792

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH++DE+YLGQR+ PEWTSD  +L AFERFG+KL  IE++I+ MN+D++W+NR GPV+VP
Sbjct  793  RHSTDEVYLGQRDTPEWTSDSELLAAFERFGRKLVEIENKIMDMNNDKRWKNRVGPVQVP  852

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLLFP +     EGGLTG+GIPNS+SI
Sbjct  853  YTLLFPNTTDYSREGGLTGKGIPNSVSI  880



>ref|XP_010094672.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXB56580.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=792

 Score =   301 bits (770),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K +  V  D ELQ+WW E  + GH DKK+EPWW K+ + + LIET TTIIWI+SALHAA+
Sbjct  588  KTNETVQNDNELQSWWKELREVGHGDKKDEPWWSKLQTLEELIETCTTIIWIASALHAAI  647

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y GY P RP++SRRF+PE GTPEYEELKT+P+KAFL+TIT Q  ++LGI+L+EI
Sbjct  648  NFGQYPYGGYPPNRPSMSRRFIPEEGTPEYEELKTDPEKAFLKTITGQLLSVLGIALVEI  707

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR+ PEWT+D  VL+AFERFGKKL  IE++I+ MN D+K +NR GP K
Sbjct  708  LSRHSSDEVYLGQRDTPEWTTDGEVLEAFERFGKKLREIEEKIVRMNKDEKLKNRVGPAK  767

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+P+SEGGLTG+GIPNS+SI
Sbjct  768  MPYTLLYPSSEGGLTGKGIPNSVSI  792



>gb|EPS72460.1| lipoxygenase, partial [Genlisea aurea]
Length=338

 Score =   287 bits (735),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D +V +D+ELQ+WW E  +KGH DK++E WW +M +   L+++ + IIW++SALHAAV
Sbjct  134  KTDDVVREDEELQSWWKEVREKGHGDKRDETWWPRMETCDELVDSCSIIIWVASALHAAV  193

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y GY P RP+ SRR +PE GTP+YEELK+ P+K FL+TIT+Q Q++LGISLIEI
Sbjct  194  NFGQYPYGGYLPNRPSTSRRLIPEAGTPDYEELKSEPEKTFLKTITSQLQSVLGISLIEI  253

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE++LGQRE PEWT+D   + AF RFGKKL  IE +I  MNDD +W+NR GPVK
Sbjct  254  LSRHSSDEVFLGQRESPEWTADSEAITAFGRFGKKLEDIEKKISEMNDDSRWKNRYGPVK  313

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLL+P+S+ GLTG+GIPNSISI
Sbjct  314  VPYTLLYPSSDVGLTGKGIPNSISI  338



>ref|XP_009774054.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=844

 Score =   301 bits (770),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D M+ +D ELQAWW E  + GH D+K+EPWW KM + + LI++   IIWI+SALHAA+
Sbjct  640  KTDDMIKKDTELQAWWKEVREDGHGDRKSEPWWPKMQTLKELIDSCNIIIWIASALHAAI  699

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y GY P RP++SRRFMPEPG+PEYE+LKTNP+K +L TIT Q QTL+GIS IEI
Sbjct  700  NFGQYPYGGYLPNRPSMSRRFMPEPGSPEYEDLKTNPEKGYLRTITPQLQTLIGISAIEI  759

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H+SDEIYLGQR+ PEWT DK  L A ERFGKKLA IE++I+ MN+D K +NR GPVK
Sbjct  760  LSIHSSDEIYLGQRDTPEWTKDKEPLQALERFGKKLAEIEEKIMKMNNDTKLKNRIGPVK  819

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+PTSE GLTG+GIPNS+SI
Sbjct  820  MPYTLLYPTSEPGLTGKGIPNSVSI  844



>gb|AGI16377.1| lipoxygenase [Malus domestica]
Length=863

 Score =   301 bits (770),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K + ++  D ELQ+WW E V++GH D K+EPWW KM + + L+ET T +IW +SALHAA+
Sbjct  659  KTNDIIQTDVELQSWWKELVEEGHGDIKDEPWWPKMQTFEELVETCTILIWTASALHAAL  718

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQ+SYAGY P RPT+SR+FMPE GTPEYEEL+ +PD  FL+TITAQ QT+LGI+ IEI
Sbjct  719  NFGQFSYAGYLPNRPTISRKFMPEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEI  778

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ P+WTSD   L+AFE+FGKKLA IEDRI +MN+D+K +NR G VK
Sbjct  779  LSRHSTDEVYLGQRDTPDWTSDTAALEAFEKFGKKLAEIEDRITSMNNDEKLKNRVGSVK  838

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTSEGG+TG+GIPNS+SI
Sbjct  839  IPYTLLFPTSEGGITGKGIPNSVSI  863



>ref|XP_008370478.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Malus 
domestica]
Length=835

 Score =   300 bits (768),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D ++ +D ELQ+WW E V++GH DKK+EPWW K+ + + L+E  T IIW +SALHAAV
Sbjct  631  KTDDIIQKDAELQSWWKELVEEGHGDKKDEPWWPKLQTXEXLVEICTXIIWTASALHAAV  690

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SR+FMP  GT EYEELK+NPDK FL+T TAQ QTLLGISLIEI
Sbjct  691  NFGQYPYAGYLPNRPTISRKFMPVKGTAEYEELKSNPDKVFLKTXTAQLQTLLGISLIEI  750

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLG+R+ PEWT+D   L+AF +FGKKL  IE+RI++MN+D+K +NR G VK
Sbjct  751  LSRHSTDEVYLGKRDTPEWTADAAPLEAFNKFGKKLEEIEERIISMNNDEKLKNRVGLVK  810

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLLFPTS GGLTG+GIPNS+SI
Sbjct  811  VPYTLLFPTSGGGLTGKGIPNSVSI  835



>ref|XP_003536076.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Glycine 
max]
Length=865

 Score =   301 bits (770),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D  + +D ELQ+WW E  + GH DKK+EPWW KM + + LI+T T IIWI+SALHAA+
Sbjct  661  KEDDTIKKDTELQSWWKEIREVGHGDKKDEPWWPKMQTCEELIQTCTIIIWIASALHAAI  720

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y G+ P RP +SRRFMPE GTPEY+EL  NPDKA+L+T+T+QF  +LGISL+EI
Sbjct  721  NFGQYPYGGFPPSRPAISRRFMPEKGTPEYDELVANPDKAYLKTVTSQFLAVLGISLVEI  780

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS+H+SDE+YLGQR+ P+WTSD   L AFE+FGKKLA IE+RIL MN D+K+RNR GPVK
Sbjct  781  LSKHSSDEVYLGQRDTPDWTSDAEPLQAFEKFGKKLADIEERILRMNSDEKFRNRYGPVK  840

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+P+S+GGLTG G+PNSISI
Sbjct  841  MPYTLLYPSSKGGLTGMGVPNSISI  865



>ref|XP_007034721.1| PLAT/LH2 domain-containing lipoxygenase family protein isoform 
1 [Theobroma cacao]
 gb|EOY05647.1| PLAT/LH2 domain-containing lipoxygenase family protein isoform 
1 [Theobroma cacao]
Length=677

 Score =   296 bits (759),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 167/208 (80%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D +V +D E+Q+WW E   +GH D K+EPWW ++ +R  LIE  T IIW++SA HAAVNF
Sbjct  470  DEVVKEDNEIQSWWAEIRTEGHGDLKDEPWWPEIKTRAELIEACTIIIWVASAFHAAVNF  529

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEY EL+ +PD AFL+TITAQFQTLLG+SLIE+LS
Sbjct  530  GQYPYAGYLPNRPTVSRRFMPEPGTPEYAELEKDPDLAFLKTITAQFQTLLGVSLIEVLS  589

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH++DEIYLGQR+ PEWTSD   L AFERFGKKL  IE RI+  N+D + +NRTGPVK+P
Sbjct  590  RHSADEIYLGQRDSPEWTSDAEPLAAFERFGKKLIEIESRIMDRNNDSRLKNRTGPVKMP  649

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLL+P +     EGGLTG+GIPNSISI
Sbjct  650  YTLLYPNTSDYSREGGLTGKGIPNSISI  677



>gb|AGI16382.1| lipoxygenase [Malus domestica]
Length=863

 Score =   300 bits (769),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K + ++  D ELQ+WW E V++GH D K+EPWW KM + + L+ET T +IW +SALHAA+
Sbjct  659  KTNDIIKTDVELQSWWKELVEEGHGDIKDEPWWPKMQTFEELVETCTILIWTASALHAAL  718

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQ+SYAGY P RPT+SR+FMPE GTPEYEEL+ +PD  FL+TITAQ QT+LGI+ IEI
Sbjct  719  NFGQFSYAGYLPNRPTISRKFMPEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEI  778

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ P+WTSD   L+AFE+FGKKLA IEDRI +MN+D+K +NR G VK
Sbjct  779  LSRHSTDEVYLGQRDTPDWTSDTAALEAFEKFGKKLAEIEDRITSMNNDEKLKNRVGSVK  838

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTSEGG+TG+GIPNS+SI
Sbjct  839  IPYTLLFPTSEGGITGKGIPNSVSI  863



>gb|AGI16379.1| lipoxygenase [Malus domestica]
 gb|AGK82797.1| lipoxygenase [Malus domestica]
Length=863

 Score =   300 bits (769),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K + ++  D ELQ+WW E V++GH D K+EPWW KM + + L+ET T ++W +SALHAA+
Sbjct  659  KTNDIIQTDVELQSWWKELVEEGHGDIKDEPWWPKMQTFEELVETCTILVWTASALHAAL  718

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQ+SYAGY P RPT+SR+FMPE GTPEYEEL+ +PD  FL+TITAQ QT+LGI+ IEI
Sbjct  719  NFGQFSYAGYLPNRPTISRKFMPEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEI  778

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ P+WTSD   L+AFE+FGKKLA IEDRI +MN+D+K +NR G VK
Sbjct  779  LSRHSTDEVYLGQRDTPDWTSDTAALEAFEKFGKKLAEIEDRITSMNNDEKLKNRVGSVK  838

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTSEGG+TG+GIPNS+SI
Sbjct  839  IPYTLLFPTSEGGITGKGIPNSVSI  863



>gb|AGK82798.1| lipoxygenase [Malus domestica]
Length=864

 Score =   300 bits (769),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K + ++  D ELQ+WW E V++GH D K+EPWW KM + + L+ET T ++W +SALHAA+
Sbjct  660  KTNDIIQTDVELQSWWKELVEEGHGDIKDEPWWPKMQTFEELVETCTILVWTASALHAAL  719

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQ+SYAGY P RPT+SR+FMPE GTPEYEEL+ +PD  FL+TITAQ QT+LGI+ IEI
Sbjct  720  NFGQFSYAGYLPNRPTISRKFMPEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEI  779

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ P+WTSD   L+AFE+FGKKLA IEDRI +MN+D+K +NR G VK
Sbjct  780  LSRHSTDEVYLGQRDTPDWTSDTAALEAFEKFGKKLAEIEDRITSMNNDEKLKNRVGSVK  839

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTSEGG+TG+GIPNS+SI
Sbjct  840  IPYTLLFPTSEGGITGKGIPNSVSI  864



>gb|ABF60002.1| lipoxygenase 2 [Actinidia deliciosa]
Length=865

 Score =   300 bits (769),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D ++ +D ELQ+WW E  +KGH DKK+EPWW KM + + L+ET TTIIW++SALHAAV
Sbjct  661  KTDDIIQEDLELQSWWNELREKGHGDKKDEPWWPKMQTHKELVETCTTIIWVASALHAAV  720

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y GY P RP +SRRF+PE  TP+Y EL++NP+KAFL+T+T Q  ++LGISLIEI
Sbjct  721  NFGQYPYGGYLPNRPAMSRRFIPERDTPDYAELESNPEKAFLKTVTPQMLSILGISLIEI  780

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH +DE++LGQR+ PEWT+DK  L AFERFG+KL  IEDRI  MN+D+K RNRTGP K
Sbjct  781  LSRHTADEVFLGQRDTPEWTTDKEALKAFERFGEKLTEIEDRITRMNNDEKLRNRTGPAK  840

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTSE GLTG+GIPNS+SI
Sbjct  841  MPYTLLFPTSEVGLTGKGIPNSVSI  865



>gb|KGN48009.1| Lipoxygenase [Cucumis sativus]
Length=555

 Score =   293 bits (749),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 167/210 (80%), Gaps = 5/210 (2%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV +D E+Q+WWTE    GH D K+EPWW KM +R+ L+++ T IIWI+SALHAAV
Sbjct  346  KSDEMVQKDTEIQSWWTEIRTVGHGDLKDEPWWPKMNTREDLVQSCTIIIWIASALHAAV  405

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPEPGTPE+ EL+T+P+ A+L+TITAQ QT+LG+SLIE 
Sbjct  406  NFGQYPYAGYLPNRPTVSRRFMPEPGTPEFRELETDPELAYLKTITAQLQTILGVSLIES  465

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+ DEIYLGQR+ PEWT D+  L AFERFG +L  IE++I+ MN+++KWRNR GPVK
Sbjct  466  LSRHSVDEIYLGQRDTPEWTKDEEALAAFERFGDRLREIEEKIMRMNNEEKWRNRVGPVK  525

Query  199  VPYTLLFPTS-----EGGLTGRGIPNSISI  125
            +PYT LFP +     E GL  RGIPNSISI
Sbjct  526  MPYTFLFPNTSNYYEEEGLNARGIPNSISI  555



>gb|AGI16380.1| lipoxygenase [Malus domestica]
Length=863

 Score =   300 bits (768),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K + ++  D ELQ+WW E V++GH D K+EPWW KM + + L+ET T ++W +SALHAA+
Sbjct  659  KTNEIIQTDVELQSWWKELVEEGHGDIKDEPWWPKMQTFEELVETCTILVWTASALHAAL  718

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQ+SYAGY P RPT+SR+FMPE GTPEYEEL+ +PD  FL+TITAQ QT+LGI+ IEI
Sbjct  719  NFGQFSYAGYLPNRPTISRKFMPEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEI  778

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ P+WTSD   L+AFE+FGKKLA IEDRI +MN+D+K +NR G VK
Sbjct  779  LSRHSTDEVYLGQRDTPDWTSDTAALEAFEKFGKKLAEIEDRITSMNNDEKLKNRVGSVK  838

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTSEGG+TG+GIPNS+SI
Sbjct  839  IPYTLLFPTSEGGITGKGIPNSVSI  863



>ref|XP_006344836.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=845

 Score =   300 bits (767),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D M+ +D ELQAWW E  ++GH DKK+EPWW KM + + L ++ T IIWI+SALHAA+
Sbjct  641  KTDDMIQKDTELQAWWKELQEEGHGDKKDEPWWPKMQTLKELTDSCTIIIWIASALHAAI  700

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y GY P RP++SR+ MPEPG+PEYEELKTNP+K +L TIT Q QTL+GIS IEI
Sbjct  701  NFGQYPYGGYLPNRPSMSRKLMPEPGSPEYEELKTNPEKGYLSTITPQLQTLIGISAIEI  760

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H+SDEIYLGQR+ P+WT+DK  L A ERFGKKL  IE++I+ MN+D+KW+NR GP+K
Sbjct  761  LSTHSSDEIYLGQRDTPKWTNDKEPLQALERFGKKLTEIEEKIIKMNNDKKWKNRMGPIK  820

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+P SE GLTG+GIPNS+SI
Sbjct  821  MPYTLLYPISEPGLTGKGIPNSVSI  845



>ref|XP_007147045.1| hypothetical protein PHAVU_006G091400g [Phaseolus vulgaris]
 gb|ESW19039.1| hypothetical protein PHAVU_006G091400g [Phaseolus vulgaris]
Length=863

 Score =   300 bits (767),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D  V +D ELQ+WW E  ++GH DKKNEPWW KM +R+ LIE  T IIW++SALHA+ 
Sbjct  659  KEDDTVKKDPELQSWWKELREEGHGDKKNEPWWPKMQTREDLIEVCTIIIWVASALHAST  718

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAG+ P RPT+SRR MPE GTPEY+EL  NP+KAFL+TITAQ QTL+G+SLIEI
Sbjct  719  NFGQYPYAGFLPNRPTVSRRLMPEEGTPEYDELVNNPEKAFLKTITAQLQTLIGLSLIEI  778

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS+H+SDE+YLGQR+ P WTSD   L+AFERFGKKLA IE+RI+ MN+D K +NR GPV 
Sbjct  779  LSKHSSDEVYLGQRDTPNWTSDVEPLEAFERFGKKLAQIEERIVTMNNDGKHKNRVGPVN  838

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+P+S+ GLTG GIPNS++I
Sbjct  839  MPYTLLYPSSKAGLTGMGIPNSVAI  863



>ref|XP_010108010.1| Linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXC17575.1| Linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=884

 Score =   300 bits (768),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 169/208 (81%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            DS V  D ELQ WWTE  + GH DKK+EPWW +M++   L+ + TTIIW++SALHAAVNF
Sbjct  677  DSAVAADPELQFWWTEIRKVGHGDKKDEPWWPQMSTIADLVNSATTIIWVASALHAAVNF  736

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAG+ P RPT+SRRFMPEPGTPE+ EL+++PD AFL+TITAQFQ LLG+SLIEILS
Sbjct  737  GQYPYAGFLPNRPTVSRRFMPEPGTPEFAELESDPDAAFLKTITAQFQALLGVSLIEILS  796

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH++DE+YLGQR+ PEWT D   ++AFERFGK+L  IE+RIL  N D++ RNR GPVKVP
Sbjct  797  RHSTDEVYLGQRDTPEWTDDGEAIEAFERFGKRLVEIEERILERNRDERLRNRVGPVKVP  856

Query  193  YTLLFP-----TSEGGLTGRGIPNSISI  125
            YTLLFP     T EGGLTG+GIPNSISI
Sbjct  857  YTLLFPGTSDFTREGGLTGKGIPNSISI  884



>ref|XP_009365900.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=863

 Score =   300 bits (767),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K + ++  D ELQ+WW E V++GH D K+EPWW KM + + L+ET T +IW +SALHAA+
Sbjct  659  KTNDIIQTDVELQSWWKELVEEGHGDIKDEPWWPKMQTFEELVETCTILIWTASALHAAL  718

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQ+SYAGY P RPT+SR+FMPE GTPEYEEL+ +PD  FL+TITAQ QT+LGI+ IEI
Sbjct  719  NFGQFSYAGYLPNRPTISRKFMPEKGTPEYEELEASPDAVFLKTITAQLQTVLGIATIEI  778

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ P+WTSD   L+AFE+FGKKLA IEDRI +MN+D K +NR G VK
Sbjct  779  LSRHSTDEVYLGQRDTPDWTSDIAALEAFEKFGKKLAEIEDRITSMNNDDKLKNRVGSVK  838

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTSEGG+TG+GIPNS+SI
Sbjct  839  IPYTLLFPTSEGGITGKGIPNSVSI  863



>ref|XP_009407551.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Musa acuminata 
subsp. malaccensis]
Length=872

 Score =   300 bits (767),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 168/209 (80%), Gaps = 5/209 (2%)
 Frame = -1

Query  736  DDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVN  557
            +D+ +  D ELQAWW E  + GH DKK+E WW KM +   L +T TTIIW++SALHAAVN
Sbjct  664  NDAAIRADVELQAWWKEVREVGHGDKKDEDWWPKMQTLAELAKTCTTIIWVASALHAAVN  723

Query  556  FGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEIL  377
            FGQY YAGY P RPT+SRRFMPEPGTPEY EL+ NPD AFL+TIT+QFQT+LG+SLIE+L
Sbjct  724  FGQYPYAGYLPNRPTISRRFMPEPGTPEYHELEKNPDLAFLKTITSQFQTILGVSLIEVL  783

Query  376  SRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKV  197
            SRH+SDE+YLGQR+ PEWT+D+  L+AFERF  KL  IE+RI++MN D   RNRTGPVK+
Sbjct  784  SRHSSDEVYLGQRDSPEWTTDRSALEAFERFSHKLIEIENRIISMNQDASLRNRTGPVKM  843

Query  196  PYTLLFP-----TSEGGLTGRGIPNSISI  125
            PYTLL+P     T  GGLTGRGIPNS+SI
Sbjct  844  PYTLLYPNVSDLTGVGGLTGRGIPNSVSI  872



>gb|AGI16378.1| lipoxygenase [Malus domestica]
 gb|AGI16381.1| lipoxygenase [Malus domestica]
 gb|AGK82777.1| lipoxygenase [Malus domestica]
 gb|AGK82799.1| lipoxygenase [Malus domestica]
Length=863

 Score =   299 bits (766),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K + ++  D ELQ+WW E V++GH D K+EPWW KM + + L+ET T +IW +SALHAA+
Sbjct  659  KTNEIIQTDVELQSWWKELVEEGHGDIKDEPWWPKMQTFEELVETCTILIWTASALHAAL  718

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQ+SYAGY P RPT+SR+FMPE GTPEYEEL+ +PD  FL+TITAQ QT+LGI+ IEI
Sbjct  719  NFGQFSYAGYLPNRPTISRKFMPEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEI  778

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ P+WTSD   L+AF++FGKKLA IEDRI +MN+D+K +NR G VK
Sbjct  779  LSRHSTDEVYLGQRDTPDWTSDTAALEAFDKFGKKLAEIEDRITSMNNDEKLKNRVGSVK  838

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTSEGG+TG+GIPNS+SI
Sbjct  839  IPYTLLFPTSEGGITGKGIPNSVSI  863



>ref|XP_006838252.1| hypothetical protein AMTR_s00103p00053060 [Amborella trichopoda]
 gb|ERN00821.1| hypothetical protein AMTR_s00103p00053060 [Amborella trichopoda]
Length=254

 Score =   282 bits (721),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 163/208 (78%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            DS V  D ELQ+WW E    GH DK++EPWW +M++   L +T+ T+IW++SALHAAVNF
Sbjct  47   DSAVASDTELQSWWAEVRNVGHGDKRSEPWWPQMSTIHELTDTIITLIWVASALHAAVNF  106

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY+YAGY P RPT+SRRFMPEPGT +YE+L+++PD  FL TIT Q  TLLG+SLIEILS
Sbjct  107  GQYTYAGYMPNRPTISRRFMPEPGTTDYEKLESDPDGYFLSTITNQPLTLLGVSLIEILS  166

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH+SDE+YLGQRE  EWT+D   L+AFERFGK+L  IE +I+  N D ++RNR GPVKVP
Sbjct  167  RHSSDELYLGQRESSEWTADAQALEAFERFGKRLEEIEQQIMTRNSDHQFRNRVGPVKVP  226

Query  193  YTLLFPTSE-----GGLTGRGIPNSISI  125
            YTLL+P +      GGLTGRGIPNS+SI
Sbjct  227  YTLLYPGTSDIGTAGGLTGRGIPNSVSI  254



>gb|EYU42168.1| hypothetical protein MIMGU_mgv1a001215mg [Erythranthe guttata]
Length=864

 Score =   299 bits (765),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV +D ELQ+WW E  +KGH DKK+EPWW KM +R+ LI++ T I+W++SALHAAV
Sbjct  660  KTDDMVQKDIELQSWWKEVREKGHGDKKDEPWWPKMQTRKELIDSCTIIVWVASALHAAV  719

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y GY P RP+ SRRF+P+ GTPEY+ELKT+P+KAFL+TIT+Q Q++LGISLIEI
Sbjct  720  NFGQYPYGGYLPNRPSTSRRFIPDKGTPEYDELKTDPEKAFLKTITSQLQSVLGISLIEI  779

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ PEWT+D   + AFE FG++L  IE RI+ MN D +W+NR+GPVK
Sbjct  780  LSRHSADEVYLGQRDSPEWTTDTEAIKAFEMFGERLVKIEKRIIEMNKDGRWKNRSGPVK  839

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL P+S+ GLTGRGIPNSIS+
Sbjct  840  MPYTLLCPSSDIGLTGRGIPNSISM  864



>ref|XP_008370477.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Malus 
domestica]
Length=963

 Score =   301 bits (770),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D ++ +D ELQ+WW E V++GH DKK+EPWW K+ + + L+E  T IIW +SALHAAV
Sbjct  759  KTDDIIQKDAELQSWWKELVEEGHGDKKDEPWWPKLQTXEXLVEICTXIIWTASALHAAV  818

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SR+FMP  GT EYEELK+NPDK FL+T TAQ QTLLGISLIEI
Sbjct  819  NFGQYPYAGYLPNRPTISRKFMPVKGTAEYEELKSNPDKVFLKTXTAQLQTLLGISLIEI  878

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLG+R+ PEWT+D   L+AF +FGKKL  IE+RI++MN+D+K +NR G VK
Sbjct  879  LSRHSTDEVYLGKRDTPEWTADAAPLEAFNKFGKKLEEIEERIISMNNDEKLKNRVGLVK  938

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLLFPTS GGLTG+GIPNS+SI
Sbjct  939  VPYTLLFPTSGGGLTGKGIPNSVSI  963



>gb|KDP40158.1| hypothetical protein JCGZ_02156 [Jatropha curcas]
Length=867

 Score =   299 bits (765),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 169/208 (81%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            + +V  D ELQ+WWTE    GH DKK+EPWW +M +R  L +T T IIWI+SALHAAVNF
Sbjct  660  NDLVRNDSELQSWWTEIRNVGHGDKKDEPWWPEMQTRADLKQTCTIIIWIASALHAAVNF  719

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGT EY EL+ +P+  FL+TITAQ QTLLG+SLIEILS
Sbjct  720  GQYPYAGYLPNRPTVSRRFMPEPGTSEYAELEKDPELGFLKTITAQLQTLLGVSLIEILS  779

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH++DE+YLGQR+ PEWTSD+  L AFERF K+L+ IE++I+ MN+D+KW+NR GPVKVP
Sbjct  780  RHSTDEVYLGQRDTPEWTSDREPLAAFERFAKRLSVIENKIMEMNNDEKWKNRNGPVKVP  839

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLLFP +     EGGLTG+GIPNSISI
Sbjct  840  YTLLFPNTSDKSREGGLTGKGIPNSISI  867



>ref|XP_004139173.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=852

 Score =   298 bits (762),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V  D ELQ+WW E  ++GH DKK+EPWW KM + + LI+T   IIWI+SALHAAV
Sbjct  648  KTDEAVRNDPELQSWWKELREEGHGDKKDEPWWPKMQNIEELIDTCAIIIWIASALHAAV  707

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SR+FMPE GTPEY+EL+TNP+KAFL TITAQ QTLLGI+ IEI
Sbjct  708  NFGQYPYAGYLPNRPTISRKFMPEEGTPEYKELETNPEKAFLRTITAQLQTLLGIASIEI  767

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR+ P+WT+DK  LDAFE+FGKKLA IED I   N+D   RNR GPV 
Sbjct  768  LSRHSSDEVYLGQRDSPKWTADKEALDAFEKFGKKLAEIEDGITKRNEDLTLRNRVGPVF  827

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+P+SE GLTG+GIPNS+SI
Sbjct  828  MPYTLLYPSSEEGLTGKGIPNSVSI  852



>ref|XP_008454526.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis melo]
Length=852

 Score =   298 bits (762),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V  D ELQ+WW E  ++GH DKK+EPWW KM + + LI+T   IIWI+SALHAAV
Sbjct  648  KTDEAVRNDPELQSWWKELREEGHGDKKDEPWWPKMQNIEDLIDTCAIIIWIASALHAAV  707

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SR+FMPE GTPEY+EL+TNP+K FL TITAQ QTLLGI+ IEI
Sbjct  708  NFGQYPYAGYLPNRPTISRKFMPEEGTPEYKELETNPEKVFLRTITAQLQTLLGIASIEI  767

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR+ P+WT+DK VLDAFE+FGKKLA IED I   N+D   RNR GPV 
Sbjct  768  LSRHSSDEVYLGQRDSPKWTADKEVLDAFEKFGKKLAEIEDGITKRNEDLTLRNRVGPVF  827

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+P+SE GLTG+GIPNS+SI
Sbjct  828  MPYTLLYPSSEEGLTGKGIPNSVSI  852



>ref|XP_006419898.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
 ref|XP_006489365.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Citrus 
sinensis]
 gb|ESR33138.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
Length=882

 Score =   298 bits (763),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 167/208 (80%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D ++  D ELQ+WW E    GH DK++EPWW +M +R  L++T T IIW++SALHAAVNF
Sbjct  675  DHLIQGDNELQSWWEELRNVGHGDKRDEPWWPEMQTRAELVQTCTIIIWVASALHAAVNF  734

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEY EL+ NPD AFL+TITAQ QTLLG+SLIEILS
Sbjct  735  GQYPYAGYLPNRPTVSRRFMPEPGTPEYAELEKNPDLAFLKTITAQLQTLLGVSLIEILS  794

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH++DE+YLGQR+ PEWT D   L AFERFG +L  IE+RIL MN+D++W+NR G VKVP
Sbjct  795  RHSTDEVYLGQRDTPEWTLDNEPLAAFERFGNRLLEIENRILEMNNDKRWKNRVGAVKVP  854

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLL+P +     EGGLTG+GIPNS+SI
Sbjct  855  YTLLYPNTSDYSREGGLTGKGIPNSVSI  882



>ref|XP_003626279.1| Chalcone synthase [Medicago truncatula]
Length=1317

 Score =   302 bits (774),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D  V +D ELQ+WW E +Q+GH DKKNEPWW KM + + L ET T IIWI+SALHAAV
Sbjct  681  KNDDTVKKDAELQSWWKELIQEGHGDKKNEPWWPKMQTVEELTETCTIIIWIASALHAAV  740

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY +AGY+P RPT+SRRFMPE GT EY+EL TNPDKAFL+TITAQ QTL+GISLIEI
Sbjct  741  NFGQYPFAGYSPNRPTISRRFMPEKGTIEYDELVTNPDKAFLKTITAQLQTLVGISLIEI  800

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H+SDE+YLGQR+   WT D   L+AF+RFGKKL  IE+RI+AMNDD   +NR GPVK
Sbjct  801  LSTHSSDEVYLGQRDSMHWTCDAEPLEAFDRFGKKLKEIEERIVAMNDDVNLKNRVGPVK  860

Query  199  VPYTLLFPTSEGGLTGRGIPNSI  131
            +PYTLL+P SE GLTG GIPNS+
Sbjct  861  MPYTLLYPRSEAGLTGAGIPNSV  883


 Score = 98.2 bits (243),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 66/108 (61%), Gaps = 20/108 (19%)
 Frame = -1

Query  592  IWISSALHAAVNFGQYSYAGYNPCRP-TLSRRFMPEPGTPEYEELKTNPDKAFLETITAQ  416
            IWI+SALHAAV FGQY YA Y+      + RR                    FL+T+ AQ
Sbjct  888  IWIASALHAAVKFGQYPYASYSIMNLWQILRRL-------------------FLKTVAAQ  928

Query  415  FQTLLGISLIEILSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKL  272
             Q L+G+SLIEILS H+SDE+YLG+R+   W  D   L+AF++FGKKL
Sbjct  929  LQILVGVSLIEILSAHSSDEVYLGERDTKHWIYDAEPLEAFDKFGKKL  976



>ref|XP_010468375.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Camelina 
sativa]
Length=246

 Score =   280 bits (717),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 164/210 (78%), Gaps = 5/210 (2%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            KDD  V  D E+Q+WWTE   KGH DK++E WW  M +R  LIE+ T IIWI+SALHAAV
Sbjct  37   KDDKTVQTDIEIQSWWTELRTKGHGDKQHESWWPSMQTRDDLIESCTIIIWIASALHAAV  96

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAG+ P RPT+SRRFMPEPGT EY EL  + D AFL+TIT Q QTLLGIS+IE 
Sbjct  97   NFGQYPYAGFLPNRPTVSRRFMPEPGTVEYTELAEDTDVAFLKTITPQLQTLLGISIIET  156

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS+H++DE+YLGQRE P WT+D   L+AF+RFGK+L  IE+ I+  N+D++++NRTGPV 
Sbjct  157  LSQHSTDEVYLGQRESPNWTADDEALEAFKRFGKELELIENNIIRRNNDKRFKNRTGPVN  216

Query  199  VPYTLLFP-----TSEGGLTGRGIPNSISI  125
            +PYTLL+P     T EGGLTG+GIPNS+SI
Sbjct  217  IPYTLLYPNTTDYTREGGLTGKGIPNSVSI  246



>ref|XP_008801705.1| PREDICTED: probable linoleate 9S-lipoxygenase 4 [Phoenix dactylifera]
Length=867

 Score =   297 bits (761),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 169/208 (81%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D+ V  D ELQAWW E  + GH DKK+E WW KM + + L +T +TIIW++SALHAAVNF
Sbjct  660  DAAVRADVELQAWWKEVREVGHGDKKDETWWPKMQTFRELTKTCSTIIWVASALHAAVNF  719

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTP YE+L+ NPD  FLETIT+QFQT+LG+SLIEILS
Sbjct  720  GQYPYAGYLPNRPTISRRFMPEPGTPAYEKLENNPDGVFLETITSQFQTILGVSLIEILS  779

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH+SDE+YLGQR+ PEWT+D+  LDAF+RFG+ L  IE+RIL MN D++ +NR GPVK+P
Sbjct  780  RHSSDEVYLGQRDTPEWTTDRKALDAFKRFGEHLVEIENRILRMNQDKRLKNRNGPVKMP  839

Query  193  YTLLFPTSE-----GGLTGRGIPNSISI  125
            YTLL+P++      GGLTGRGIPNS+SI
Sbjct  840  YTLLYPSTSDFSGVGGLTGRGIPNSVSI  867



>gb|KDO74648.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=803

 Score =   296 bits (757),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 167/208 (80%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D ++  D ELQ+WW E    GH DK++EPWW +M ++  L++T T IIW++SALHAAVNF
Sbjct  596  DHLIQGDNELQSWWEELRNVGHGDKRDEPWWPEMQTQAELVQTCTIIIWVASALHAAVNF  655

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEY EL+ NPD AFL+TITAQ QTLLG+SLIEILS
Sbjct  656  GQYPYAGYLPNRPTVSRRFMPEPGTPEYAELEKNPDLAFLKTITAQLQTLLGVSLIEILS  715

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH++DE+YLGQR+ PEWT D   L AFERFG +L  IE+RIL MN+D++W+NR G VKVP
Sbjct  716  RHSTDEVYLGQRDTPEWTLDNEPLAAFERFGNRLLEIENRILEMNNDKRWKNRVGAVKVP  775

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLL+P +     EGGLTG+GIPNS+SI
Sbjct  776  YTLLYPNTSDYSREGGLTGKGIPNSVSI  803



>ref|XP_002319015.2| hypothetical protein POPTR_0013s02310g [Populus trichocarpa]
 gb|EEE94938.2| hypothetical protein POPTR_0013s02310g [Populus trichocarpa]
Length=862

 Score =   296 bits (759),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV  D E+Q+WW E  + GH D+K+ PWW KM +R+ LI++ T IIW+ SALHAAV
Sbjct  658  KTDEMVQNDTEIQSWWKEVREVGHGDQKDAPWWPKMQTREELIQSCTIIIWVGSALHAAV  717

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y GY   RP+ SRRFMP+ G+PEYEELK+NPDK FL TITAQ QTLLGISLIEI
Sbjct  718  NFGQYPYGGYLLNRPSTSRRFMPQKGSPEYEELKSNPDKFFLGTITAQLQTLLGISLIEI  777

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR+  EWT++K  ++AF++FG+KLA IEDRIL MN + +++NR GPVK
Sbjct  778  LSRHSSDEVYLGQRDILEWTAEKEPIEAFKKFGRKLAVIEDRILDMNREARYKNRVGPVK  837

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLL PTSE GLTGRGIPNS+SI
Sbjct  838  VPYTLLVPTSEAGLTGRGIPNSVSI  862



>ref|XP_004156418.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=852

 Score =   296 bits (758),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V  D ELQ+WW E  ++GH DKK++PWW KM + + LI+T   IIWI+SALHAAV
Sbjct  648  KTDEAVRNDPELQSWWKELREEGHGDKKDKPWWPKMQNIEELIDTCAIIIWIASALHAAV  707

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SR+FMPE GTPEY+EL+TNP+KAFL TITAQ QTLLGI+ IEI
Sbjct  708  NFGQYPYAGYLPNRPTISRKFMPEEGTPEYKELETNPEKAFLRTITAQLQTLLGIASIEI  767

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR+ P+WT+DK  LDAFE+FGKKLA IED I   N+D   RNR GPV 
Sbjct  768  LSRHSSDEVYLGQRDSPKWTADKEALDAFEKFGKKLAEIEDGITKRNEDLTLRNRVGPVF  827

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+P+SE GLTG+GIPNS+SI
Sbjct  828  MPYTLLYPSSEEGLTGKGIPNSVSI  852



>gb|ADN92993.2| lipoxygenase LOX1 [Ipomoea nil]
Length=857

 Score =   296 bits (758),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D +V +D ELQAWW E  ++GH D K++PWW  M + Q LI++ T IIWI+SALHAAV
Sbjct  653  KSDDVVQKDTELQAWWKELREQGHGDLKDKPWWPTMQTVQELIDSCTIIIWIASALHAAV  712

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSRRFMPEPGT +Y+EL+ +PDK FL+TITAQ QTLLG+SLIEI
Sbjct  713  NFGQYPYAGYLPNRPTLSRRFMPEPGTDDYKELEADPDKVFLKTITAQLQTLLGVSLIEI  772

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRHASDE+YLG+RE PEWT+D+  LDAF +FG+ L+ IE  I  MN   K +NRTGPV+
Sbjct  773  LSRHASDEVYLGKREFPEWTNDQEALDAFAQFGRNLSKIEVNIKRMNTVGKLKNRTGPVE  832

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLLFPTSE GLTG+GIPNS+SI
Sbjct  833  VPYTLLFPTSEVGLTGKGIPNSVSI  857



>ref|XP_008348093.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=863

 Score =   296 bits (758),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K + ++  D ELQ+WW E V++GH D K+EPWW KM + + L+ET T + W +SALHAA+
Sbjct  659  KTNEIIQTDVELQSWWKELVEEGHGDIKDEPWWPKMQTFEELVETCTILXWTASALHAAL  718

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQ+SYAGY P RPT+SR+FMPE GTPEYEEL+ +PD  FL+TITAQ QT+LGI+ IEI
Sbjct  719  NFGQFSYAGYLPNRPTISRKFMPEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEI  778

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ P+WTSD   L+AF +FGKKLA IEDRI +MN+D+K +NR G VK
Sbjct  779  LSRHSTDEVYLGQRDTPDWTSDTAALEAFXKFGKKLAEIEDRITSMNNDEKLKNRVGSVK  838

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTSEGG+TG+GIPNS+SI
Sbjct  839  IPYTLLFPTSEGGITGKGIPNSVSI  863



>ref|XP_004170689.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like, partial 
[Cucumis sativus]
Length=372

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 160/205 (78%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            KDDS +  D ELQ+WW E  +KGH DKKNE WW K+ + + L+ET TTIIWISSALHAAV
Sbjct  168  KDDSAIQNDVELQSWWKEVREKGHVDKKNETWWPKLQNFKELVETCTTIIWISSALHAAV  227

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y G+ P RPT+SRR MPE G+ EY+EL++ P+KA+L+T+ +  QTLLG+SLIEI
Sbjct  228  NFGQYPYGGFMPNRPTISRRLMPEVGSAEYKELESKPEKAYLKTVNSMLQTLLGVSLIEI  287

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRHASDE+YLGQR   EWTSDK  ++ FE FGKK+  +E RI+  N D   +NR+GPV 
Sbjct  288  LSRHASDEVYLGQRASIEWTSDKAAVEVFENFGKKVFEVESRIIERNKDVNLKNRSGPVN  347

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLL P+S  GLTGRGIPNSISI
Sbjct  348  VPYTLLLPSSTEGLTGRGIPNSISI  372



>ref|XP_009626059.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nicotiana 
tomentosiformis]
Length=876

 Score =   296 bits (758),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 165/208 (79%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D M+  D ELQ+WWTE   +GH D K+EPWW +M +R  L +  T IIW++SALHAAVNF
Sbjct  669  DDMIQDDTELQSWWTEVRNEGHGDLKDEPWWPQMQTRAELAKACTIIIWVASALHAAVNF  728

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEY EL++NPD AFL+TITAQFQTLLG+SLIEILS
Sbjct  729  GQYPYAGYLPNRPTVSRRFMPEPGTPEYAELESNPDLAFLKTITAQFQTLLGVSLIEILS  788

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH+SDEIYLGQR+ PEWTSD     AF+RF  +L  +E+RI+ MN+D +W+NR GPVKVP
Sbjct  789  RHSSDEIYLGQRDTPEWTSDIQPRQAFQRFHDRLVEVENRIVKMNNDSRWKNRNGPVKVP  848

Query  193  YTLLFP-----TSEGGLTGRGIPNSISI  125
            Y LL+P      SE GLTG+GIPNS+SI
Sbjct  849  YMLLYPNASGDNSESGLTGKGIPNSVSI  876



>gb|KDO74647.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=882

 Score =   296 bits (758),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 167/208 (80%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D ++  D ELQ+WW E    GH DK++EPWW +M ++  L++T T IIW++SALHAAVNF
Sbjct  675  DHLIQGDNELQSWWEELRNVGHGDKRDEPWWPEMQTQAELVQTCTIIIWVASALHAAVNF  734

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEY EL+ NPD AFL+TITAQ QTLLG+SLIEILS
Sbjct  735  GQYPYAGYLPNRPTVSRRFMPEPGTPEYAELEKNPDLAFLKTITAQLQTLLGVSLIEILS  794

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH++DE+YLGQR+ PEWT D   L AFERFG +L  IE+RIL MN+D++W+NR G VKVP
Sbjct  795  RHSTDEVYLGQRDTPEWTLDNEPLAAFERFGNRLLEIENRILEMNNDKRWKNRVGAVKVP  854

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLL+P +     EGGLTG+GIPNS+SI
Sbjct  855  YTLLYPNTSDYSREGGLTGKGIPNSVSI  882



>ref|XP_010277588.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nelumbo 
nucifera]
Length=703

 Score =   292 bits (748),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 165/209 (79%), Gaps = 5/209 (2%)
 Frame = -1

Query  736  DDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVN  557
            +D ++  D ELQ+WW+E    GH DKK+EPWW KM +   L +T T IIW++SALHAAVN
Sbjct  495  NDDLIQGDSELQSWWSELRNVGHGDKKDEPWWPKMQTLSELTQTCTIIIWVASALHAAVN  554

Query  556  FGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEIL  377
            FGQY YAGY P RPT+SRRFMPEPGTPEY EL++NPD  +L TITAQ QTLLG+SLIEIL
Sbjct  555  FGQYPYAGYLPNRPTISRRFMPEPGTPEYAELESNPDTFYLRTITAQLQTLLGVSLIEIL  614

Query  376  SRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKV  197
            SRH+SDE+YLGQR+ PEWT+D   L+AFERF +KL  IE+RI  MN D++ +NR GPVKV
Sbjct  615  SRHSSDEVYLGQRDTPEWTTDAAPLEAFERFREKLVEIENRIREMNLDKRLKNRVGPVKV  674

Query  196  PYTLLFPTSE-----GGLTGRGIPNSISI  125
            PYTLLFP +      GGLTGRGIPNSISI
Sbjct  675  PYTLLFPDTSNVYGVGGLTGRGIPNSISI  703



>gb|AGH13205.1| lipoxygenase [Salvia miltiorrhiza]
Length=856

 Score =   295 bits (756),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV +D ELQAWWTE  +KGH DKK+EPWW  M S + LIE+ TTIIW++SALHAA+
Sbjct  652  KSDEMVQEDPELQAWWTEIREKGHGDKKDEPWWPTMQSCEELIESCTTIIWVASALHAAL  711

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y GY P RP  SRRF+P+ GTP YEE+K NP+KA+L+TIT Q Q +LGISL+EI
Sbjct  712  NFGQYPYGGYLPNRPATSRRFIPDIGTPAYEEMKLNPEKAYLKTITPQMQGVLGISLVEI  771

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDEIYLGQR+ PEWT+D     AFERFG +L   E + + +N+D++WRNR+GPVK
Sbjct  772  LSRHSSDEIYLGQRDSPEWTADTEARKAFERFGDRLRETEQKFIDLNNDKRWRNRSGPVK  831

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+P+SE GLTGRGIPNSISI
Sbjct  832  MPYTLLYPSSEIGLTGRGIPNSISI  856



>ref|XP_009626058.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nicotiana 
tomentosiformis]
Length=886

 Score =   296 bits (758),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 165/208 (79%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D M+  D ELQ+WWTE   +GH D K+EPWW +M +R  L +  T IIW++SALHAAVNF
Sbjct  679  DDMIQDDTELQSWWTEVRNEGHGDLKDEPWWPQMQTRAELAKACTIIIWVASALHAAVNF  738

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEY EL++NPD AFL+TITAQFQTLLG+SLIEILS
Sbjct  739  GQYPYAGYLPNRPTVSRRFMPEPGTPEYAELESNPDLAFLKTITAQFQTLLGVSLIEILS  798

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH+SDEIYLGQR+ PEWTSD     AF+RF  +L  +E+RI+ MN+D +W+NR GPVKVP
Sbjct  799  RHSSDEIYLGQRDTPEWTSDIQPRQAFQRFHDRLVEVENRIVKMNNDSRWKNRNGPVKVP  858

Query  193  YTLLFP-----TSEGGLTGRGIPNSISI  125
            Y LL+P      SE GLTG+GIPNS+SI
Sbjct  859  YMLLYPNASGDNSESGLTGKGIPNSVSI  886



>ref|XP_003591120.1| Lipoxygenase [Medicago truncatula]
 gb|AES61371.1| linoleate 9S-lipoxygenase-like protein [Medicago truncatula]
Length=858

 Score =   295 bits (756),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 165/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            KD+  + +D ELQ+WW E  ++GH DKK+EPWW KM + + LIET T IIWI+SALHAAV
Sbjct  654  KDEDSIKKDSELQSWWKEIREEGHGDKKDEPWWPKMHTLEELIETCTIIIWIASALHAAV  713

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y GY P RP++SRR MPE GT EY EL  NPDKAFL+TIT+QFQ +LG+SL+EI
Sbjct  714  NFGQYPYGGYPPSRPSMSRRLMPEKGTQEYNELLENPDKAFLKTITSQFQAVLGLSLVEI  773

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRHASDE+YLGQR+ P+WTSD   L+AFE+FG KL  IE RI  MN+D+K +NR GPVK
Sbjct  774  LSRHASDEVYLGQRDTPDWTSDIKALEAFEKFGNKLVEIEKRIGIMNNDEKLKNRFGPVK  833

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            + YTLL PTSEGGLTG GIPNSISI
Sbjct  834  MSYTLLKPTSEGGLTGMGIPNSISI  858



>gb|KDP23508.1| hypothetical protein JCGZ_23341 [Jatropha curcas]
Length=870

 Score =   295 bits (756),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 168/203 (83%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D MV++D ELQ+WW E  + GH DKK EPWW KM +R+ LIE+ T IIWI+SALHAA+NF
Sbjct  668  DDMVIKDPELQSWWKEIREVGHGDKKEEPWWPKMHTREELIESCTIIIWIASALHAAINF  727

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY Y GY P RP++SRRF+PE  TPEYEELK+NP+KAFL+TITAQ QT+LGISLIEILS
Sbjct  728  GQYPYGGYLPNRPSISRRFLPEKDTPEYEELKSNPEKAFLKTITAQLQTVLGISLIEILS  787

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RHASDE+YLGQR+ PEWT+D+  L+AF++FGKKL  IE+ I+ MN D + +NR GPV + 
Sbjct  788  RHASDEVYLGQRDTPEWTTDEKPLEAFKQFGKKLEKIEEGIIEMNKDVQLKNRVGPVLMT  847

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLL P+SE GLTGRGIPNS+SI
Sbjct  848  YTLLVPSSEVGLTGRGIPNSVSI  870



>ref|XP_004150981.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=303

 Score =   280 bits (716),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 158/205 (77%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+DS +  D ELQ+WW E  +KGH DKKNE WW K+ +   L+ET TTIIWISSALHAAV
Sbjct  99   KNDSAIQNDVELQSWWKEVREKGHVDKKNETWWPKLQNFNELVETCTTIIWISSALHAAV  158

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y G+ P RPT+SRR MPE G+ EY+EL++ P+KA+L+T+ +  QTLLG+SLIEI
Sbjct  159  NFGQYPYGGFMPNRPTISRRHMPEVGSAEYKELESKPEKAYLKTVNSMLQTLLGVSLIEI  218

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRHASDE+YLGQR   EWTSDK  L+ FE FGK++  +E RI+  N D   +NR GPV 
Sbjct  219  LSRHASDEVYLGQRASIEWTSDKAALEVFENFGKQVFEVESRIIERNKDVNLKNRNGPVN  278

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLL P+S  GLTGRGIPNSISI
Sbjct  279  VPYTLLLPSSTEGLTGRGIPNSISI  303



>ref|XP_006359918.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006359919.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X3 [Solanum tuberosum]
 ref|XP_006359920.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X4 [Solanum tuberosum]
 ref|XP_006359921.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X5 [Solanum tuberosum]
Length=877

 Score =   295 bits (755),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 165/208 (79%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D M+  D ELQ+WW E   +GH D K+EPWW +M +R  L+E  T IIW++SALHAAVNF
Sbjct  670  DDMIRDDTELQSWWMEVRNEGHGDLKDEPWWPQMQTRAELVEACTIIIWVASALHAAVNF  729

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEY EL++NPD A+L+TITAQFQTLLG+SLIEILS
Sbjct  730  GQYPYAGYLPNRPTVSRRFMPEPGTPEYAELESNPDVAYLKTITAQFQTLLGVSLIEILS  789

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RHASDEIYLGQRE+PEWTSD     +F+RF  +L  +E+RI+  N+D +W+NR GPVKVP
Sbjct  790  RHASDEIYLGQRENPEWTSDVEPRQSFQRFHDRLVDVENRIVERNNDSRWKNRNGPVKVP  849

Query  193  YTLLFP-----TSEGGLTGRGIPNSISI  125
            Y LL+P      SE GLTG+GIPNS+SI
Sbjct  850  YMLLYPNASGDNSESGLTGKGIPNSVSI  877



>ref|XP_003521704.2| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Glycine 
max]
Length=858

 Score =   295 bits (754),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D  V +D ELQ+WW E  ++GH DKKNEPWW KM +R+ LIE  T IIW++SALHA+ 
Sbjct  654  KEDDTVKKDSELQSWWKELREEGHGDKKNEPWWPKMQTREDLIEVCTIIIWVASALHAST  713

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAG+ P RPT+SRRFMPE GT EY+EL  NPDK FL+TITAQ QTL+GISLIEI
Sbjct  714  NFGQYPYAGFLPNRPTISRRFMPEEGTSEYDELVNNPDKVFLKTITAQLQTLIGISLIEI  773

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE++LGQR+ P WT D   L+AF+ FGKKL  IE+RI+A+N+D K +NR GPV 
Sbjct  774  LSRHSSDELHLGQRDTPNWTCDVEPLEAFDEFGKKLVEIEERIMALNNDGKHKNRVGPVN  833

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFP+S+ GLTG GIPNS++I
Sbjct  834  MPYTLLFPSSKAGLTGMGIPNSVAI  858



>ref|XP_006359917.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X1 [Solanum tuberosum]
Length=887

 Score =   295 bits (755),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 165/208 (79%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D M+  D ELQ+WW E   +GH D K+EPWW +M +R  L+E  T IIW++SALHAAVNF
Sbjct  680  DDMIRDDTELQSWWMEVRNEGHGDLKDEPWWPQMQTRAELVEACTIIIWVASALHAAVNF  739

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEY EL++NPD A+L+TITAQFQTLLG+SLIEILS
Sbjct  740  GQYPYAGYLPNRPTVSRRFMPEPGTPEYAELESNPDVAYLKTITAQFQTLLGVSLIEILS  799

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RHASDEIYLGQRE+PEWTSD     +F+RF  +L  +E+RI+  N+D +W+NR GPVKVP
Sbjct  800  RHASDEIYLGQRENPEWTSDVEPRQSFQRFHDRLVDVENRIVERNNDSRWKNRNGPVKVP  859

Query  193  YTLLFP-----TSEGGLTGRGIPNSISI  125
            Y LL+P      SE GLTG+GIPNS+SI
Sbjct  860  YMLLYPNASGDNSESGLTGKGIPNSVSI  887



>ref|XP_007144726.1| hypothetical protein PHAVU_007G179600g [Phaseolus vulgaris]
 gb|ESW16720.1| hypothetical protein PHAVU_007G179600g [Phaseolus vulgaris]
Length=861

 Score =   295 bits (754),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+   V +D ELQ+WW E  + GH DKKNEPWW KM + + LI+T T +IWI+SALHAA+
Sbjct  657  KEGDTVKKDTELQSWWKEIREVGHGDKKNEPWWPKMETSEDLIQTCTILIWIASALHAAI  716

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY + G+ P RP +SRRFMPE GTPEY+EL  +P KA+L+TI++QFQ +LGISL+EI
Sbjct  717  NFGQYPFGGFPPSRPAISRRFMPEEGTPEYDELVADPAKAYLKTISSQFQAVLGISLVEI  776

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS+H+SDE+YLGQR+ P+WTSD   L AFE+FGK LA+IE+RIL MN D+K RNR GPVK
Sbjct  777  LSKHSSDEVYLGQRDTPDWTSDAEPLQAFEKFGKTLASIEERILRMNSDEKLRNRFGPVK  836

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+PTS+GGLTG G+PNSISI
Sbjct  837  MPYTLLYPTSKGGLTGMGVPNSISI  861



>gb|KHN03989.1| Putative linoleate 9S-lipoxygenase 5 [Glycine soja]
Length=855

 Score =   295 bits (754),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D  V +D ELQ+WW E  ++GH DKKNEPWW KM +R+ LIE  T IIW++SALHA+ 
Sbjct  651  KEDDTVKKDSELQSWWKELREEGHGDKKNEPWWPKMQTREDLIEVCTIIIWVASALHAST  710

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAG+ P RPT+SRRFMPE GT EY+EL  NPDK FL+TITAQ QTL+GISLIEI
Sbjct  711  NFGQYPYAGFLPNRPTISRRFMPEEGTSEYDELVNNPDKVFLKTITAQLQTLIGISLIEI  770

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE++LGQR+ P WT D   L+AF+ FGKKL  IE+RI+A+N+D K +NR GPV 
Sbjct  771  LSRHSSDELHLGQRDTPNWTCDVEPLEAFDEFGKKLVEIEERIMALNNDGKHKNRVGPVN  830

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFP+S+ GLTG GIPNS++I
Sbjct  831  MPYTLLFPSSKAGLTGMGIPNSVAI  855



>ref|XP_004231274.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Solanum lycopersicum]
Length=841

 Score =   294 bits (753),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 165/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D M+ +D ELQAWW E  ++GH DKK+EPWW KM + + L ++ T IIWI+SALHAA+
Sbjct  637  KTDDMIQKDTELQAWWKELQEEGHGDKKDEPWWPKMQTLKELTDSCTIIIWIASALHAAI  696

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y GY P RP++SRR MPEPG+PEYEELK NP+K +L TIT Q QTL+GIS IEI
Sbjct  697  NFGQYPYGGYLPNRPSMSRRLMPEPGSPEYEELKRNPEKVYLRTITPQLQTLIGISAIEI  756

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H+SDEIYLGQR+ PEWT+DK  L A ERFGKKLA I ++I+ MN+D+KW+NR GP K
Sbjct  757  LSTHSSDEIYLGQRDTPEWTNDKAPLQALERFGKKLAEIAEKIIKMNNDKKWKNRMGPTK  816

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+  SE GLTG+GIPNS+SI
Sbjct  817  MPYTLLYHISEPGLTGKGIPNSVSI  841



>ref|XP_010674736.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Beta vulgaris 
subsp. vulgaris]
Length=861

 Score =   294 bits (753),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 165/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D M+  D ELQ+WW E  +KGH DKK+E WW ++ +   LIET TTIIW++SALHAAV
Sbjct  657  KSDDMITNDIELQSWWKEIREKGHGDKKDEKWWPELKTFDELIETCTTIIWVASALHAAV  716

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY+P RPT+SRR MPEP TPEYEEL+ NPD  FL TI+++ Q++LGISLIE+
Sbjct  717  NFGQYPYAGYHPNRPTISRRLMPEPNTPEYEELEKNPDTIFLRTISSKLQSVLGISLIEL  776

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH +DE+YLGQRE  EWT+D   L+AFERFGKK+  IED+I+  N D +W+NR GPVK
Sbjct  777  LSRHPTDEVYLGQRETREWTADSAPLEAFERFGKKVEEIEDKIVERNKDGRWKNRVGPVK  836

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+P+SE GLTGRGIPNS S+
Sbjct  837  LPYTLLYPSSEAGLTGRGIPNSTSV  861



>ref|XP_010326551.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010326552.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Solanum 
lycopersicum]
Length=874

 Score =   294 bits (753),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 166/208 (80%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D ++  D ELQ+WW E   +GH D K+EPWW +M +R  LIET TTIIW++SALHAAVNF
Sbjct  667  DEVIRDDTELQSWWMEVRNEGHGDLKDEPWWPQMQTRSELIETCTTIIWVASALHAAVNF  726

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEY EL++NPD A+L+TITAQFQTLLG+SLIEILS
Sbjct  727  GQYPYAGYLPNRPTVSRRFMPEPGTPEYAELESNPDVAYLKTITAQFQTLLGVSLIEILS  786

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH+S+EIYLGQRE+PEWTSD     +F+RF  +L  IE+RI+  N D +W+NR GPVKVP
Sbjct  787  RHSSEEIYLGQRENPEWTSDVEPRQSFQRFHDRLVDIENRIVERNSDSRWKNRNGPVKVP  846

Query  193  YTLLFP-----TSEGGLTGRGIPNSISI  125
            Y LL+P      SE GLTG+GIPNS+SI
Sbjct  847  YMLLYPNASGDNSESGLTGKGIPNSVSI  874



>emb|CDY70916.1| BnaCnng70330D, partial [Brassica napus]
Length=504

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 164/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V  D ELQAWW E  ++GH DKK+EPWW KM +R+ LI++ T IIW++SALHAAV
Sbjct  300  KTDEDVQNDTELQAWWKEVREEGHGDKKSEPWWPKMQTRKELIDSCTIIIWVASALHAAV  359

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY  AGY P RPT+SR+FMP+  TPE+EEL+ NPDK FL++ITAQ QTLLGISLIEI
Sbjct  360  NFGQYPIAGYLPNRPTISRQFMPKENTPEFEELEKNPDKVFLKSITAQLQTLLGISLIEI  419

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H+SDE+YLGQR+  EW ++K  L+AFE+FG K+  IE +I   N D+  +NRTGPVK
Sbjct  420  LSTHSSDEVYLGQRDSKEWAAEKEALEAFEKFGDKVKEIEKKIDERNLDENLKNRTGPVK  479

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYT LFPTSEGG+TGRGIPNS+SI
Sbjct  480  MPYTSLFPTSEGGVTGRGIPNSVSI  504



>gb|EYU26430.1| hypothetical protein MIMGU_mgv1a023655mg [Erythranthe guttata]
Length=963

 Score =   295 bits (756),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV +D ELQ+WW E  +KGH D K+EPWW KM +R+ LI++ T I+W++SALHAAV
Sbjct  759  KTDDMVQKDTELQSWWKEVREKGHGDMKDEPWWPKMQTRKELIDSCTIIVWVASALHAAV  818

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y GY P RP+ SR F+P+ GTPEY+ELKT+P+KAFL+TIT+Q Q++LGISLIEI
Sbjct  819  NFGQYPYGGYLPNRPSTSRHFIPDKGTPEYDELKTDPEKAFLKTITSQLQSVLGISLIEI  878

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ PEWT+D   + AFE FG++L  IE+RI+ MN D +W+NR+GPVK
Sbjct  879  LSRHSADEVYLGQRDSPEWTTDTEAIKAFEMFGERLVQIENRIIEMNKDGRWKNRSGPVK  938

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL P+S+ GLTGRGIPNSIS+
Sbjct  939  MPYTLLCPSSDIGLTGRGIPNSISM  963



>ref|XP_008465603.1| PREDICTED: probable linoleate 9S-lipoxygenase 5, partial [Cucumis 
melo]
Length=341

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 159/205 (78%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            KDDS +  D ELQ+WW E  +KGH DKKNE WW K+ +   L+ET TTIIWISSALHAAV
Sbjct  137  KDDSAIQNDVELQSWWKEVREKGHADKKNETWWPKLQNFNELVETCTTIIWISSALHAAV  196

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y G+ P RPT+SRR MPE G+ EY+EL++ P+KA+L+ I +  QTLLG+SLIEI
Sbjct  197  NFGQYPYGGFIPNRPTISRRHMPEVGSVEYKELESKPEKAYLKIINSMLQTLLGVSLIEI  256

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRHASDE+YLGQR   EWTSDK  ++ FE FGK+++ +E RI+  N D   +NR+GPV 
Sbjct  257  LSRHASDEVYLGQRASIEWTSDKAAVELFEYFGKEVSEVESRIIERNKDVNLKNRSGPVN  316

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLL P+S  GLTGRGIPNSISI
Sbjct  317  VPYTLLLPSSSEGLTGRGIPNSISI  341



>ref|XP_009763875.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nicotiana 
sylvestris]
Length=873

 Score =   294 bits (752),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 163/208 (78%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D M+  D ELQ+WWTE   +GH D K+EPWW +M +R  L E  T IIW++SALHAAVNF
Sbjct  666  DDMIRDDTELQSWWTEVRNEGHGDLKDEPWWPQMQTRAELAEACTIIIWVASALHAAVNF  725

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEY EL++NPD AFL+TITAQFQTLLG+SLIEILS
Sbjct  726  GQYPYAGYLPNRPTVSRRFMPEPGTPEYAELESNPDLAFLKTITAQFQTLLGVSLIEILS  785

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH+SDEIYLGQR+ PEWTSD     AF+RF  +L  +E+RI+  N+D +W NR GPVKVP
Sbjct  786  RHSSDEIYLGQRDTPEWTSDIQPRQAFQRFHDRLVEVENRIVERNNDSRWMNRNGPVKVP  845

Query  193  YTLLFP-----TSEGGLTGRGIPNSISI  125
            Y LL+P      SE GLTG+GIPNS+SI
Sbjct  846  YMLLYPNASGDNSESGLTGKGIPNSVSI  873



>ref|XP_010326548.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326549.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326550.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
Length=891

 Score =   294 bits (752),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 166/208 (80%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D ++  D ELQ+WW E   +GH D K+EPWW +M +R  LIET TTIIW++SALHAAVNF
Sbjct  684  DEVIRDDTELQSWWMEVRNEGHGDLKDEPWWPQMQTRSELIETCTTIIWVASALHAAVNF  743

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEY EL++NPD A+L+TITAQFQTLLG+SLIEILS
Sbjct  744  GQYPYAGYLPNRPTVSRRFMPEPGTPEYAELESNPDVAYLKTITAQFQTLLGVSLIEILS  803

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH+S+EIYLGQRE+PEWTSD     +F+RF  +L  IE+RI+  N D +W+NR GPVKVP
Sbjct  804  RHSSEEIYLGQRENPEWTSDVEPRQSFQRFHDRLVDIENRIVERNSDSRWKNRNGPVKVP  863

Query  193  YTLLFP-----TSEGGLTGRGIPNSISI  125
            Y LL+P      SE GLTG+GIPNS+SI
Sbjct  864  YMLLYPNASGDNSESGLTGKGIPNSVSI  891



>ref|XP_011026284.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Populus 
euphratica]
Length=881

 Score =   294 bits (752),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 166/208 (80%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D ++  D ELQ+WWTE    GH DKK+EPWW +M +   + +T T IIWI+SALHAAVNF
Sbjct  674  DDLIQGDSELQSWWTEICNVGHGDKKDEPWWPEMQTLVDVTQTCTIIIWIASALHAAVNF  733

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RP+LSRRFMPEPGTPEY EL+ NPD A+L+TITAQ QTLLGISLIEILS
Sbjct  734  GQYPYAGYLPNRPSLSRRFMPEPGTPEYAELEKNPDVAYLKTITAQLQTLLGISLIEILS  793

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH++DE+YLGQR+  EWT D   L AFERF +KL  IE++I+ MN+D++W+NR GPV+VP
Sbjct  794  RHSTDEVYLGQRDTTEWTLDSEPLAAFERFRRKLIEIENKIMDMNNDKRWKNRVGPVEVP  853

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLLFP +     EGGLTGRGIPNSISI
Sbjct  854  YTLLFPNTTDYSREGGLTGRGIPNSISI  881



>ref|XP_002311617.1| lipoxygenase family protein [Populus trichocarpa]
 gb|EEE88984.1| lipoxygenase family protein [Populus trichocarpa]
Length=880

 Score =   294 bits (752),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 166/208 (80%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D ++  D ELQ+WWTE    GH DKK+EPWW +M +   + +T T IIWI+SALHAAVNF
Sbjct  673  DDLIQGDSELQSWWTEICNVGHGDKKDEPWWPEMQTLVDVTQTCTIIIWIASALHAAVNF  732

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RP+LSRRFMPEPGTPEY EL+ NPD A+L+TITAQ QTLLG+SLIEILS
Sbjct  733  GQYPYAGYLPNRPSLSRRFMPEPGTPEYAELEKNPDVAYLKTITAQLQTLLGVSLIEILS  792

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH++DE+YLGQR+  EWT D   L AFERF +KL  IE++I+ MN+D++W+NR GPV+VP
Sbjct  793  RHSTDEVYLGQRDTAEWTLDSEPLAAFERFRRKLVEIENKIMDMNNDKRWKNRVGPVEVP  852

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLLFP +     EGGLTGRGIPNSISI
Sbjct  853  YTLLFPNTTDYSREGGLTGRGIPNSISI  880



>ref|XP_009763870.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nicotiana 
sylvestris]
Length=883

 Score =   294 bits (752),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 163/208 (78%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D M+  D ELQ+WWTE   +GH D K+EPWW +M +R  L E  T IIW++SALHAAVNF
Sbjct  676  DDMIRDDTELQSWWTEVRNEGHGDLKDEPWWPQMQTRAELAEACTIIIWVASALHAAVNF  735

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEY EL++NPD AFL+TITAQFQTLLG+SLIEILS
Sbjct  736  GQYPYAGYLPNRPTVSRRFMPEPGTPEYAELESNPDLAFLKTITAQFQTLLGVSLIEILS  795

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH+SDEIYLGQR+ PEWTSD     AF+RF  +L  +E+RI+  N+D +W NR GPVKVP
Sbjct  796  RHSSDEIYLGQRDTPEWTSDIQPRQAFQRFHDRLVEVENRIVERNNDSRWMNRNGPVKVP  855

Query  193  YTLLFP-----TSEGGLTGRGIPNSISI  125
            Y LL+P      SE GLTG+GIPNS+SI
Sbjct  856  YMLLYPNASGDNSESGLTGKGIPNSVSI  883



>ref|XP_011026291.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Populus 
euphratica]
Length=880

 Score =   293 bits (751),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 166/208 (80%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D ++  D ELQ+WWTE    GH DKK+EPWW +M +   + +T T IIWI+SALHAAVNF
Sbjct  673  DDLIQGDSELQSWWTEICNVGHGDKKDEPWWPEMQTLVDVTQTCTIIIWIASALHAAVNF  732

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RP+LSRRFMPEPGTPEY EL+ NPD A+L+TITAQ QTLLGISLIEILS
Sbjct  733  GQYPYAGYLPNRPSLSRRFMPEPGTPEYAELEKNPDVAYLKTITAQLQTLLGISLIEILS  792

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH++DE+YLGQR+  EWT D   L AFERF +KL  IE++I+ MN+D++W+NR GPV+VP
Sbjct  793  RHSTDEVYLGQRDTTEWTLDSEPLAAFERFRRKLIEIENKIMDMNNDKRWKNRVGPVEVP  852

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLLFP +     EGGLTGRGIPNSISI
Sbjct  853  YTLLFPNTTDYSREGGLTGRGIPNSISI  880



>ref|XP_004156417.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5-like [Cucumis sativus]
Length=864

 Score =   293 bits (750),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 163/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            KDD  +  D ELQ+WW E  +KGH DKK+EPWW +M S   LIET T IIWISSALHAAV
Sbjct  660  KDDQTLRNDTELQSWWKELREKGHADKKDEPWWPRMDSLHDLIETCTIIIWISSALHAAV  719

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y G+ P RP+ SRRF+PE GTP+Y+EL++NP+KAFL TIT+Q Q L+G+S+IEI
Sbjct  720  NFGQYPYGGFAPNRPSTSRRFLPESGTPDYKELESNPEKAFLRTITSQLQALVGVSVIEI  779

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR +PEWT DK  L+AFE+FG+KL  IE +I   N D + +NR GPV 
Sbjct  780  LSRHSSDEVYLGQRSNPEWTLDKEALEAFEKFGEKLGEIEKKIAMRNKDPQLKNRVGPVD  839

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTS  GLTGRGIPNSISI
Sbjct  840  MPYTLLFPTSSEGLTGRGIPNSISI  864



>ref|XP_004139172.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=864

 Score =   293 bits (750),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 163/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            KDD  +  D ELQ+WW E  +KGH DKK+EPWW +M S   LIET T IIWISSALHAAV
Sbjct  660  KDDQTLRNDTELQSWWKELREKGHADKKDEPWWPRMDSLHDLIETCTIIIWISSALHAAV  719

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y G+ P RP+ SRRF+PE GTP+Y+EL++NP+KAFL TIT+Q Q L+G+S+IEI
Sbjct  720  NFGQYPYGGFAPNRPSTSRRFLPESGTPDYKELESNPEKAFLRTITSQLQALVGVSVIEI  779

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR +PEWT DK  L+AFE+FG+KL  IE +I   N D + +NR GPV 
Sbjct  780  LSRHSSDEVYLGQRSNPEWTLDKEALEAFEKFGEKLGEIEKKIAMRNKDPQLKNRVGPVD  839

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTS  GLTGRGIPNSISI
Sbjct  840  MPYTLLFPTSSEGLTGRGIPNSISI  864



>gb|AGK82783.1| lipoxygenase [Malus domestica]
Length=879

 Score =   293 bits (750),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 163/210 (78%), Gaps = 5/210 (2%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            + D +V  D ELQ WWTE    GH DKKNEPWW KM +R  LIE+ T IIW++SALHAAV
Sbjct  670  QSDDVVQGDSELQNWWTELRNIGHGDKKNEPWWPKMQTRAELIESCTIIIWVASALHAAV  729

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQYSYAGY P RPT+SRRFMPEPGT EY EL ++PD AFL+TITAQFQTLLG+SLIEI
Sbjct  730  NFGQYSYAGYLPNRPTVSRRFMPEPGTAEYYELVSSPDTAFLKTITAQFQTLLGVSLIEI  789

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQ + PEWTSD   L AF RFG+KL  IE RI A N D + +NR GPV 
Sbjct  790  LSRHSTDEVYLGQNDTPEWTSDAEALAAFARFGEKLMDIEKRIDARNKDNRLKNRVGPVD  849

Query  199  VPYTLLFPTS-----EGGLTGRGIPNSISI  125
            VPYTLL P +     EGGLTG+GIPNS+SI
Sbjct  850  VPYTLLHPNTSDKSREGGLTGKGIPNSVSI  879



>ref|NP_001280980.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82784.1| lipoxygenase [Malus domestica]
Length=879

 Score =   293 bits (750),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 163/210 (78%), Gaps = 5/210 (2%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            + D +V  D ELQ WWTE    GH DKKNEPWW KM +R  LIE+ T IIW++SALHAAV
Sbjct  670  QSDDVVEGDSELQNWWTELRNIGHGDKKNEPWWPKMQTRAELIESCTIIIWVASALHAAV  729

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQYSYAGY P RPT+SRRFMPEPGT EY EL ++PD AFL+TITAQFQTLLG+SLIEI
Sbjct  730  NFGQYSYAGYLPNRPTVSRRFMPEPGTAEYYELVSSPDTAFLKTITAQFQTLLGVSLIEI  789

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQ + PEWTSD   L AF RFG+KL  IE RI A N D + +NR GPV 
Sbjct  790  LSRHSTDEVYLGQNDTPEWTSDAEALAAFARFGEKLMDIEKRIDARNKDNRLKNRVGPVD  849

Query  199  VPYTLLFPTS-----EGGLTGRGIPNSISI  125
            VPYTLL P +     EGGLTG+GIPNS+SI
Sbjct  850  VPYTLLHPNTSDKSREGGLTGKGIPNSVSI  879



>gb|AGK82775.1| lipoxygenase [Malus domestica]
Length=900

 Score =   293 bits (750),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 163/210 (78%), Gaps = 5/210 (2%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            + D +V  D ELQ WWTE    GH DKKNEPWW KM +R  LIE+ T IIW++SALHAAV
Sbjct  691  QSDDVVQGDSELQNWWTELRNIGHGDKKNEPWWPKMQTRAELIESCTIIIWVASALHAAV  750

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQYSYAGY P RPT+SRRFMPEPGT EY EL ++PD AFL+TITAQFQTLLG+SLIEI
Sbjct  751  NFGQYSYAGYLPNRPTVSRRFMPEPGTAEYYELVSSPDTAFLKTITAQFQTLLGVSLIEI  810

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQ + PEWTSD   L AF RFG+KL  IE RI A N D + +NR GPV 
Sbjct  811  LSRHSTDEVYLGQNDTPEWTSDAEALAAFARFGEKLMDIEKRIDARNKDNRLKNRVGPVD  870

Query  199  VPYTLLFPTS-----EGGLTGRGIPNSISI  125
            VPYTLL P +     EGGLTG+GIPNS+SI
Sbjct  871  VPYTLLHPNTSDKSREGGLTGKGIPNSVSI  900



>ref|XP_006344623.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=864

 Score =   292 bits (748),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 164/206 (80%), Gaps = 1/206 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V +D ELQAWW E  ++GH DKK+EPWW KM +RQ LIE+ T  IWI+SALHAAV
Sbjct  659  KSDDTVQKDSELQAWWKELREEGHGDKKDEPWWPKMQTRQELIESCTITIWIASALHAAV  718

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY   RP+LSR FMPEPG+PEYEELK NPDK FL+T     QTLL IS++E+
Sbjct  719  NFGQYPYAGYLVNRPSLSRMFMPEPGSPEYEELKKNPDKVFLKTTVPPLQTLLEISVLEV  778

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDD-QKWRNRTGPV  203
            LS HASD +YLGQR+ PEWT D+  + AFER GKKL+ IED+I+ MN D QKW+NR+GP 
Sbjct  779  LSTHASDTLYLGQRDSPEWTKDQEPILAFERVGKKLSDIEDQIMQMNSDHQKWKNRSGPA  838

Query  202  KVPYTLLFPTSEGGLTGRGIPNSISI  125
            KVPYTLLFPTSE GLTG+GIPNSI+I
Sbjct  839  KVPYTLLFPTSEEGLTGKGIPNSINI  864



>gb|AGK82776.1| lipoxygenase [Malus domestica]
Length=900

 Score =   293 bits (750),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 163/210 (78%), Gaps = 5/210 (2%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            + D +V  D ELQ WWTE    GH DKKNEPWW KM +R  LIE+ T IIW++SALHAAV
Sbjct  691  QSDDVVQGDSELQNWWTELRNIGHGDKKNEPWWPKMQTRAELIESCTIIIWVASALHAAV  750

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQYSYAGY P RPT+SRRFMPEPGT EY EL ++PD AFL+TITAQFQTLLG+SLIEI
Sbjct  751  NFGQYSYAGYLPNRPTVSRRFMPEPGTAEYYELVSSPDTAFLKTITAQFQTLLGVSLIEI  810

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQ + PEWTSD   L AF RFG+KL  IE RI A N D + +NR GPV 
Sbjct  811  LSRHSTDEVYLGQNDTPEWTSDAEALAAFARFGEKLMDIEKRIDARNKDNRLKNRVGPVD  870

Query  199  VPYTLLFPTS-----EGGLTGRGIPNSISI  125
            VPYTLL P +     EGGLTG+GIPNS+SI
Sbjct  871  VPYTLLHPNTSDKSREGGLTGKGIPNSVSI  900



>ref|XP_009387658.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Musa acuminata 
subsp. malaccensis]
Length=847

 Score =   292 bits (747),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 160/203 (79%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D +V  D ELQAWW E  + GH DKK+E WW  M +   LIET TTI+WI SALHAA+NF
Sbjct  645  DDVVKADAELQAWWKEVREVGHGDKKDEHWWPAMQTTSELIETCTTIVWIGSALHAAINF  704

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEYEELK NPDK FL+TIT+Q  T+LG++ IEILS
Sbjct  705  GQYPYAGYLPNRPTMSRRFMPEPGTPEYEELKKNPDKVFLKTITSQLLTMLGLNTIEILS  764

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
             HASDE+YLGQR+ PEWTSD+  + AFERFG++L AIE  I+  N D   +NR GPVK+P
Sbjct  765  NHASDEVYLGQRDTPEWTSDERAVKAFERFGQRLKAIEAEIMKRNGDPSLKNRNGPVKMP  824

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLLFP+S  G+TGRGIPNSISI
Sbjct  825  YTLLFPSSGVGVTGRGIPNSISI  847



>ref|XP_010277584.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nelumbo 
nucifera]
Length=883

 Score =   293 bits (749),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 165/209 (79%), Gaps = 5/209 (2%)
 Frame = -1

Query  736  DDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVN  557
            +D ++  D ELQ+WW+E    GH DKK+EPWW KM +   L +T T IIW++SALHAAVN
Sbjct  675  NDDLIQGDSELQSWWSELRNVGHGDKKDEPWWPKMQTLSELTQTCTIIIWVASALHAAVN  734

Query  556  FGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEIL  377
            FGQY YAGY P RPT+SRRFMPEPGTPEY EL++NPD  +L TITAQ QTLLG+SLIEIL
Sbjct  735  FGQYPYAGYLPNRPTISRRFMPEPGTPEYAELESNPDTFYLRTITAQLQTLLGVSLIEIL  794

Query  376  SRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKV  197
            SRH+SDE+YLGQR+ PEWT+D   L+AFERF +KL  IE+RI  MN D++ +NR GPVKV
Sbjct  795  SRHSSDEVYLGQRDTPEWTTDAAPLEAFERFREKLVEIENRIREMNLDKRLKNRVGPVKV  854

Query  196  PYTLLFPTSE-----GGLTGRGIPNSISI  125
            PYTLLFP +      GGLTGRGIPNSISI
Sbjct  855  PYTLLFPDTSNVYGVGGLTGRGIPNSISI  883



>ref|XP_002516771.1| lipoxygenase, putative [Ricinus communis]
 gb|EEF45385.1| lipoxygenase, putative [Ricinus communis]
Length=868

 Score =   292 bits (748),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 166/208 (80%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D +V  D ELQ+WW E   +GH DKK+EPWW +M +R  L +T T IIWI+SALHAAVNF
Sbjct  661  DDLVRDDTELQSWWAEIRNEGHGDKKDEPWWPEMQTRADLTQTCTIIIWIASALHAAVNF  720

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEY EL+ +P+ AFL+TITAQ QTLLG+SLIEILS
Sbjct  721  GQYPYAGYLPNRPTVSRRFMPEPGTPEYTELEKDPNLAFLKTITAQLQTLLGVSLIEILS  780

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH +DE+YLGQR+  EWTSD+  L AFERF ++L  IE++I+ MN D K++NR GPVKVP
Sbjct  781  RHPTDEVYLGQRDTAEWTSDREPLAAFERFSERLKEIENKIMDMNSDNKYKNRIGPVKVP  840

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLLFP +     +GGLTG+GIPNSISI
Sbjct  841  YTLLFPNTSDESRQGGLTGKGIPNSISI  868



>gb|AHI86055.1| lipoxygenase, partial [Cucumis melo var. makuwa]
Length=880

 Score =   292 bits (748),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 167/210 (80%), Gaps = 5/210 (2%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV +D E+Q+WWTE    GH D K+EPWW KM +R+ L+++ T IIWI+SALHAAV
Sbjct  671  KSDEMVQEDTEIQSWWTEIRTVGHGDLKDEPWWPKMNTREDLVQSCTIIIWIASALHAAV  730

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPEPGTPE+ EL+T+P+ A+L+TITAQ QT+LG+SLIE 
Sbjct  731  NFGQYPYAGYLPNRPTVSRRFMPEPGTPEFRELETDPELAYLKTITAQLQTILGVSLIES  790

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+ DEIYLGQR+ PEWT D+  L AFERFG +L  IE++I+ MN+++KWRNR GPVK
Sbjct  791  LSRHSVDEIYLGQRDTPEWTKDEEALAAFERFGDRLREIEEKIMRMNNEEKWRNRVGPVK  850

Query  199  VPYTLLFPTS-----EGGLTGRGIPNSISI  125
            +PYT LFP +     E GL  RGIPNSISI
Sbjct  851  MPYTFLFPNTSNYYEEEGLNARGIPNSISI  880



>ref|NP_001267584.1| probable linoleate 9S-lipoxygenase 5-like [Cucumis sativus]
 emb|CAB83038.1| lipoxygenase-9 [Cucumis sativus]
Length=881

 Score =   292 bits (748),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 167/210 (80%), Gaps = 5/210 (2%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV +D E+Q+WWTE    GH D K+EPWW KM +R+ L+++ T IIWI+SALHAAV
Sbjct  672  KSDEMVQKDTEIQSWWTEIRTVGHGDLKDEPWWPKMNTREDLVQSCTIIIWIASALHAAV  731

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPEPGTPE+ EL+T+P+ A+L+TITAQ QT+LG+SLIE 
Sbjct  732  NFGQYPYAGYLPNRPTVSRRFMPEPGTPEFRELETDPELAYLKTITAQLQTILGVSLIES  791

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+ DEIYLGQR+ PEWT D+  L AFERFG +L  IE++I+ MN+++KWRNR GPVK
Sbjct  792  LSRHSVDEIYLGQRDTPEWTKDEEALAAFERFGDRLREIEEKIMRMNNEEKWRNRVGPVK  851

Query  199  VPYTLLFPTS-----EGGLTGRGIPNSISI  125
            +PYT LFP +     E GL  RGIPNSISI
Sbjct  852  MPYTFLFPNTSNYYEEEGLNARGIPNSISI  881



>ref|XP_008449553.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis melo]
Length=881

 Score =   292 bits (748),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 167/210 (80%), Gaps = 5/210 (2%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV +D E+Q+WWTE    GH D K+EPWW KM +R+ L+++ T IIWI+SALHAAV
Sbjct  672  KSDEMVQEDTEIQSWWTEIRTVGHGDLKDEPWWPKMNTREDLVQSCTIIIWIASALHAAV  731

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPEPGTPE+ EL+T+P+ A+L+TITAQ QT+LG+SLIE 
Sbjct  732  NFGQYPYAGYLPNRPTVSRRFMPEPGTPEFRELETDPELAYLKTITAQLQTILGVSLIES  791

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+ DEIYLGQR+ PEWT D+  L AFERFG +L  IE++I+ MN+++KWRNR GPVK
Sbjct  792  LSRHSVDEIYLGQRDTPEWTKDEEALAAFERFGDRLREIEEKIMRMNNEEKWRNRVGPVK  851

Query  199  VPYTLLFPTS-----EGGLTGRGIPNSISI  125
            +PYT LFP +     E GL  RGIPNSISI
Sbjct  852  MPYTFLFPNTSNYYEEEGLNARGIPNSISI  881



>ref|XP_004494612.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cicer arietinum]
Length=863

 Score =   291 bits (746),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 165/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D  V +D+ELQ+WW E  ++GH DKK+EPWW KM + + LIE+ T IIWI+SALHAAV
Sbjct  659  KNDDTVKKDEELQSWWKELREEGHGDKKDEPWWPKMQTLEELIESCTIIIWIASALHAAV  718

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPT+SRRFMPE GT EY+EL +NPDK FL+TITAQ QTL+GISLIEI
Sbjct  719  NFGQYPYAGYLPNRPTISRRFMPEIGTAEYDELVSNPDKVFLKTITAQLQTLIGISLIEI  778

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H+SDE+YLGQR+   WT D   L+AFERFGKKL  IE +I+AMNDD + +NR G VK
Sbjct  779  LSTHSSDEVYLGQRDTVHWTYDAEPLEAFERFGKKLREIEGKIVAMNDDVRLKNRVGVVK  838

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+PT E GL G GIPNS+SI
Sbjct  839  MPYTLLYPTGESGLAGTGIPNSVSI  863



>ref|XP_011023611.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=861

 Score =   291 bits (745),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 164/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV  D E+Q+WW E  + GH D+K+ PWW KM +R+ LIE+ T IIW+ SALHAAV
Sbjct  657  KTDEMVQNDTEIQSWWKEVREVGHGDQKDAPWWPKMRTREELIESCTIIIWVGSALHAAV  716

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y GY P RP+ SRRFMP+  +P+YEELK+NPDK FLETITAQ QTLLGISLIEI
Sbjct  717  NFGQYPYGGYLPNRPSTSRRFMPQKDSPQYEELKSNPDKFFLETITAQLQTLLGISLIEI  776

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR+  EWT+DK   +AF++FG+KLA IEDRIL MN + +++NR GPVK
Sbjct  777  LSRHSSDEVYLGQRDILEWTADKEPTEAFKKFGRKLAVIEDRILDMNREARYKNRVGPVK  836

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            V YTLL PTS  GLT RGIPNS+SI
Sbjct  837  VSYTLLVPTSGPGLTARGIPNSVSI  861



>ref|XP_009415714.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Musa acuminata 
subsp. malaccensis]
Length=847

 Score =   291 bits (744),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 160/203 (79%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D +V  D ELQAWW E  + GH DKK+E WW  M +   LIET T IIWI SALHAA+NF
Sbjct  645  DDVVKADAELQAWWKEVREVGHGDKKDEHWWPAMHTTSELIETCTIIIWIGSALHAAINF  704

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEYEELK NPDK FL+TIT+Q  T+LG++ IEILS
Sbjct  705  GQYPYAGYLPNRPTMSRRFMPEPGTPEYEELKKNPDKVFLKTITSQLLTVLGLNTIEILS  764

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
             HASDE+YLGQR+ PEWTSD   + AFERFGK+L AIE  I+  N+D + +NR GPVK+P
Sbjct  765  NHASDEVYLGQRDTPEWTSDDRAVKAFERFGKRLKAIEAEIMKKNEDPRLKNRNGPVKMP  824

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLLFP+S  G+TG+GIPNSISI
Sbjct  825  YTLLFPSSGVGITGKGIPNSISI  847



>ref|XP_008454481.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Cucumis melo]
Length=863

 Score =   291 bits (744),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 163/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            KDD  +  D ELQ+WW E  +KGH DKK+EPWW +M S Q L+ET T IIWISSALHAAV
Sbjct  659  KDDQTLHNDTELQSWWKELREKGHADKKDEPWWPRMDSLQDLVETCTIIIWISSALHAAV  718

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y G+ P RP+ SRRF+PE GT +Y+EL++NP+KAFL TIT+Q Q L+G+S+IEI
Sbjct  719  NFGQYPYGGFAPNRPSTSRRFLPESGTSDYKELESNPEKAFLRTITSQLQVLVGVSVIEI  778

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR +PEWT DK  L+AFE+FG+KL  IE +I   N D + +NR GPV 
Sbjct  779  LSRHSSDEVYLGQRSNPEWTLDKEALEAFEKFGEKLGEIERKIAMRNKDPQLKNRVGPVD  838

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTS  GLTGRGIPNSISI
Sbjct  839  MPYTLLFPTSSEGLTGRGIPNSISI  863



>ref|XP_006589595.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Glycine 
max]
Length=448

 Score =   280 bits (716),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 164/208 (79%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            + MV  D ELQ+WW E   +GH D K+  WW +M +++ LI++ T IIW++SA HAAVNF
Sbjct  241  NDMVEDDSELQSWWKEVRNEGHGDLKDRHWWPEMKTKEELIQSCTIIIWLASAFHAAVNF  300

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY +AGY P RPT+SRRFMPEPGTPEYEELK++PD AFL+TITAQFQTLLG+SLIE+LS
Sbjct  301  GQYPFAGYLPNRPTVSRRFMPEPGTPEYEELKSDPDLAFLKTITAQFQTLLGVSLIEVLS  360

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH+++E+YLGQ E+PEWT D   L AFERF +KL  IE  I+  N D++ +NR GPVK+P
Sbjct  361  RHSTEEVYLGQCENPEWTLDAEPLAAFERFRQKLLEIESNIIERNKDKRLKNRNGPVKMP  420

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLLFP +     EGGLTG+GIPNSISI
Sbjct  421  YTLLFPNTSDYSREGGLTGKGIPNSISI  448



>gb|AGK82774.1| lipoxygenase [Malus domestica]
Length=900

 Score =   291 bits (744),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 162/210 (77%), Gaps = 5/210 (2%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            + D +V  D ELQ WWTE    GH DKKNEPWW KM +R  LIE+ T IIW++SALH AV
Sbjct  691  QSDDVVQGDSELQNWWTELRNIGHGDKKNEPWWPKMQTRAELIESCTIIIWVASALHEAV  750

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQYSYAGY P RPT+SRRFMPEPGT EY EL ++PD AFL+TITAQFQTLLG+SLIEI
Sbjct  751  NFGQYSYAGYLPNRPTVSRRFMPEPGTAEYYELVSSPDTAFLKTITAQFQTLLGVSLIEI  810

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQ + PEWTSD   L AF RFG+KL  IE RI A N D + +NR GPV 
Sbjct  811  LSRHSTDEVYLGQNDTPEWTSDAEALAAFARFGEKLMDIEKRIDARNKDNRLKNRVGPVD  870

Query  199  VPYTLLFPTS-----EGGLTGRGIPNSISI  125
            VPYTLL P +     EGGLTG+GIPNS+SI
Sbjct  871  VPYTLLHPNTSDKSREGGLTGKGIPNSVSI  900



>gb|ABZ05753.1| lipoxygenase [Prunus armeniaca]
Length=603

 Score =   284 bits (726),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 160/205 (78%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D MV  D ELQ+WW E  ++GH DKK+EPWW KM + + LIE+ T IIW+SSA HAA+
Sbjct  399  KNDEMVQNDSELQSWWKELREEGHGDKKDEPWWPKMQTCEELIESCTIIIWLSSAYHAAI  458

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            N+GQYS  GY P RPT+S  FMPE GTPEYEELKTNPDKAFL+T T Q QTLLG++ IEI
Sbjct  459  NYGQYSIGGYVPNRPTISLHFMPEEGTPEYEELKTNPDKAFLKTFTPQLQTLLGMASIEI  518

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH  DE+YLGQR  PEWT+D  +L A E F KKL  IE RI+ MN D+K +NR GP K
Sbjct  519  LSRHPVDELYLGQRGTPEWTTDADMLQASEDFRKKLEGIEKRIIKMNKDEKLKNRVGPAK  578

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+P+SE GLTG+GIPNS++I
Sbjct  579  IPYTLLYPSSEPGLTGKGIPNSVNI  603



>ref|XP_010905215.1| PREDICTED: probable linoleate 9S-lipoxygenase 4 [Elaeis guineensis]
Length=866

 Score =   290 bits (741),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 164/208 (79%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D+ V  D ELQAWW E  + GH DKK E WW  M + + L +T +TIIW++SALHAAVNF
Sbjct  659  DAAVRGDVELQAWWKEVREVGHGDKKKETWWPNMRTFRELTKTCSTIIWVASALHAAVNF  718

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTP YEEL+ NP+  FL+TIT+QFQT+LG+SLIEILS
Sbjct  719  GQYPYAGYLPNRPTISRRFMPEPGTPAYEELEKNPEGVFLKTITSQFQTILGVSLIEILS  778

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH+SDE+YLGQR+ PEWT+D+  LDAF+RFG  L  IE RIL MN+D + +NR GPVK+P
Sbjct  779  RHSSDEVYLGQRDTPEWTTDRKALDAFKRFGDNLVEIEKRILTMNEDTRIKNRNGPVKMP  838

Query  193  YTLLFPTSE-----GGLTGRGIPNSISI  125
            YTLL+P +      GGLTG+GIPNS+SI
Sbjct  839  YTLLYPNTSDFSRVGGLTGKGIPNSVSI  866



>gb|KHF98567.1| Linoleate 9S-lipoxygenase 5, chloroplastic [Gossypium arboreum]
Length=832

 Score =   288 bits (738),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 163/208 (78%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D ++ +D E+Q+WWTE   +GH D K+EPWW +M +R  LI+  T IIWI+SALHAAVNF
Sbjct  625  DEVLKEDTEIQSWWTEIRNEGHGDLKHEPWWPEMKTRAELIQACTIIIWIASALHAAVNF  684

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGT EY EL+ +PD AFL+TIT QFQTLLG+SLIEILS
Sbjct  685  GQYPYAGYLPNRPTVSRRFMPEPGTDEYTELEKDPDLAFLKTITPQFQTLLGVSLIEILS  744

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH +DEIYLGQR+ PEWTSD   L AFERFGKKL  IE  +   N+D + +NR GPVKVP
Sbjct  745  RHTTDEIYLGQRDTPEWTSDNEPLAAFERFGKKLVEIEKTVTERNNDGRLKNRIGPVKVP  804

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLLFP +     EGGLTG+GIPNSISI
Sbjct  805  YTLLFPNTSDYSKEGGLTGKGIPNSISI  832



>gb|KHF98566.1| Linoleate 9S-lipoxygenase 5, chloroplastic [Gossypium arboreum]
Length=845

 Score =   288 bits (738),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 163/208 (78%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D ++ +D E+Q+WWTE   +GH D K+EPWW +M +R  LI+  T IIWI+SALHAAVNF
Sbjct  638  DEVLKEDTEIQSWWTEIRNEGHGDLKHEPWWPEMKTRAELIQACTIIIWIASALHAAVNF  697

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGT EY EL+ +PD AFL+TIT QFQTLLG+SLIEILS
Sbjct  698  GQYPYAGYLPNRPTVSRRFMPEPGTDEYTELEKDPDLAFLKTITPQFQTLLGVSLIEILS  757

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH +DEIYLGQR+ PEWTSD   L AFERFGKKL  IE  +   N+D + +NR GPVKVP
Sbjct  758  RHTTDEIYLGQRDTPEWTSDNEPLAAFERFGKKLVEIEKTVTERNNDGRLKNRIGPVKVP  817

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLLFP +     EGGLTG+GIPNSISI
Sbjct  818  YTLLFPNTSDYSKEGGLTGKGIPNSISI  845



>ref|XP_004496744.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X1 [Cicer arietinum]
 ref|XP_004496745.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X2 [Cicer arietinum]
 ref|XP_004496746.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X3 [Cicer arietinum]
Length=858

 Score =   289 bits (739),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 163/208 (78%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D MV  D ELQ WW E   +GH D K++ WW +M +R  LI++ T IIW++SA HAAVNF
Sbjct  651  DDMVENDNELQCWWKEVRTEGHGDLKDKSWWPQMKTRVELIQSCTIIIWVASAFHAAVNF  710

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEYEELKT+P+ AFL+TITAQFQTLLG+SLIE+LS
Sbjct  711  GQYPYAGYLPNRPTVSRRFMPEPGTPEYEELKTDPELAFLKTITAQFQTLLGVSLIEVLS  770

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH+++EIYLGQRE+P+WT D   L AFERF +KL  IED I+  N D   +NR GPVK+P
Sbjct  771  RHSTEEIYLGQRENPDWTLDAEPLAAFERFSQKLLKIEDNIMKRNKDPSLKNRNGPVKLP  830

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLLFP +     EGGLTG+GIPNSISI
Sbjct  831  YTLLFPNTSDYSREGGLTGKGIPNSISI  858



>ref|XP_002278007.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Vitis vinifera]
Length=876

 Score =   288 bits (738),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 163/208 (78%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D ++  D ELQ+WW E   KGH DKK+EPWW +M +   L +T T IIW++SALHAAVNF
Sbjct  669  DDLIQCDTELQSWWMELRNKGHGDKKDEPWWSEMQTLVDLTKTCTIIIWVASALHAAVNF  728

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEY+EL+ NPD AFL+TITAQ QTLLG+SLIEILS
Sbjct  729  GQYPYAGYLPNRPTISRRFMPEPGTPEYQELERNPDLAFLKTITAQLQTLLGVSLIEILS  788

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH++DEIYLGQR+ PEWTSD   L AFERFG +L  IE RI  MN D++W NR GPV++ 
Sbjct  789  RHSTDEIYLGQRDTPEWTSDAEPLAAFERFGSRLRGIETRINQMNQDRRWNNRFGPVEMQ  848

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLL+P +     +GGL G+GIPNS+SI
Sbjct  849  YTLLYPNTSDYSRQGGLAGKGIPNSVSI  876



>ref|XP_009387657.1| PREDICTED: linoleate 9S-lipoxygenase A-like [Musa acuminata subsp. 
malaccensis]
Length=861

 Score =   288 bits (736),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 158/203 (78%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            + +V  D ELQAWW E  + GH DKK+EPWW  M +   LIE  TTIIWI SALHAA+NF
Sbjct  659  NDVVKADAELQAWWKEVREVGHGDKKDEPWWPAMLTTSELIEACTTIIWIGSALHAAINF  718

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGTPEYEELK NPDK FL+TIT+Q  T+LG+S IEILS
Sbjct  719  GQYPYAGYLPNRPTMSRRFMPEPGTPEYEELKKNPDKVFLKTITSQLLTVLGLSTIEILS  778

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
             HASDE+YLGQR+ PEWTSD+  + AFE FG++L AIE  I+  N D   +NR GP K+P
Sbjct  779  NHASDEVYLGQRDTPEWTSDETAVKAFEGFGERLKAIEAEIMKRNGDPSLKNRNGPAKMP  838

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLLFP+S  G+TGRGIPNSISI
Sbjct  839  YTLLFPSSGVGITGRGIPNSISI  861



>ref|XP_010935040.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5 [Elaeis guineensis]
Length=851

 Score =   288 bits (736),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 135/209 (65%), Positives = 163/209 (78%), Gaps = 5/209 (2%)
 Frame = -1

Query  736  DDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVN  557
            +D+ V  D ELQAWW E    GH DKK+EPWW KM S   L +T T IIW++SALHAAVN
Sbjct  643  NDAAVKDDVELQAWWKEVRDVGHGDKKDEPWWPKMDSLSELTKTCTIIIWVASALHAAVN  702

Query  556  FGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEIL  377
            FGQY YAGY P RPT+SRRFMPEP TPEY+ELK NPD+ FL TIT+Q QT+LG+SLIEIL
Sbjct  703  FGQYPYAGYLPNRPTISRRFMPEPNTPEYDELKRNPDQVFLSTITSQLQTILGVSLIEIL  762

Query  376  SRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKV  197
            SRH+SDE+YLGQR+  EWT+D+  L+AF++FG KL  IE++I+ MN D+  +NR GPVKV
Sbjct  763  SRHSSDEVYLGQRDTHEWTADEKALEAFKKFGDKLVEIENKIVDMNQDKSLKNRNGPVKV  822

Query  196  PYTLLFPTSE-----GGLTGRGIPNSISI  125
             YTLL+P +      GGLTGRGIPNS+SI
Sbjct  823  SYTLLYPNTSDLSHVGGLTGRGIPNSVSI  851



>ref|XP_006392468.1| hypothetical protein EUTSA_v10023267mg [Eutrema salsugineum]
 gb|ESQ29754.1| hypothetical protein EUTSA_v10023267mg [Eutrema salsugineum]
Length=856

 Score =   288 bits (736),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 165/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V  D ELQAWW E  ++GH DKK+EPWW KM +R+ L E+ T IIW++SALHAAV
Sbjct  652  KTDEDVQIDTELQAWWKEVREEGHGDKKSEPWWPKMQTREELTESCTIIIWVASALHAAV  711

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY  AGY P RPT+SR+FMP+  TPE+EEL+ NPDK FL+TITAQ QTLLGISLIEI
Sbjct  712  NFGQYPIAGYLPNRPTISRQFMPKENTPEFEELEKNPDKVFLKTITAQLQTLLGISLIEI  771

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H+SDE+YLGQR+  EW ++K  L+AFE+FG+K+  IE +I   N+D+  +NRTGPVK
Sbjct  772  LSTHSSDEVYLGQRDSKEWAAEKEALEAFEKFGEKVKEIEKKIDERNEDENLKNRTGPVK  831

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYT LFPTSEGG+TGRGIPNS+SI
Sbjct  832  MPYTSLFPTSEGGVTGRGIPNSVSI  856



>ref|XP_004296897.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=884

 Score =   288 bits (737),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 165/208 (79%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D++V  D ELQ WW E   +GH DKK EPWW +M +R  LI++ T IIW++SALHAAVNF
Sbjct  677  DNVVRSDTELQKWWEELRNEGHGDKKAEPWWPEMHTRAELIQSCTIIIWVASALHAAVNF  736

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQ+ YAGY P RPT+SRRFMPEPGT EY EL+TNPD AFL+TIT+Q QTLLG+SLIE+LS
Sbjct  737  GQWPYAGYLPNRPTISRRFMPEPGTAEYAELETNPDVAFLKTITSQLQTLLGVSLIEVLS  796

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RHA+DEIYLGQR+ PEWTSD   L AF RFG+KL  IE RI   N D++ +NR GP+K+P
Sbjct  797  RHATDEIYLGQRDTPEWTSDGEALAAFGRFGEKLIEIEKRITERNRDERLKNRVGPIKMP  856

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLL+P++     EGGLTG+GIPNSISI
Sbjct  857  YTLLYPSTSDYSREGGLTGKGIPNSISI  884



>ref|XP_006300394.1| hypothetical protein CARUB_v10019783mg [Capsella rubella]
 gb|EOA33292.1| hypothetical protein CARUB_v10019783mg [Capsella rubella]
Length=859

 Score =   288 bits (736),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 164/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  +  D ELQAWW E  ++GH DK +EPWW KM +R+ LIE+ T IIW++SALHAAV
Sbjct  655  KKDEDIQNDTELQAWWKEVREEGHGDKNSEPWWPKMQNREELIESCTIIIWVASALHAAV  714

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY  AGY P RPT+SR+F+P+  TPE+EEL+ NPDK FL+TITAQ QTLLGISLIEI
Sbjct  715  NFGQYPIAGYLPNRPTISRQFIPKQNTPEFEELEKNPDKVFLKTITAQLQTLLGISLIEI  774

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H+SDE+YLGQR+  EW ++K  LDAFE+FG+K+  IE  I   NDD+  +NRTG VK
Sbjct  775  LSTHSSDEVYLGQRDSKEWAAEKEALDAFEKFGEKVKEIEKNIDERNDDKSLKNRTGLVK  834

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTSEGG+TGRGIPNS+SI
Sbjct  835  MPYTLLFPTSEGGVTGRGIPNSVSI  859



>gb|AEZ50136.1| lipoxygenase [Diospyros kaki]
Length=901

 Score =   288 bits (738),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D  +L+D ELQ WW E  +KGH DKK+EPWW +M +R+ L+ET T IIW++SALHAA+NF
Sbjct  699  DDKLLEDSELQTWWKELREKGHADKKDEPWWPEMQTRKELVETCTIIIWVASALHAALNF  758

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY Y GY P RP +SRRF+P+ GTPEY+EL+++P+KAFL+T+T Q  ++LGISL+EILS
Sbjct  759  GQYPYGGYLPNRPAMSRRFIPKQGTPEYDELESDPEKAFLKTVTPQMLSILGISLVEILS  818

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH SDE++LG+R+  EWT+D+  + AF +FG+KLA IEDRI+ MN D++WRNR GP K+P
Sbjct  819  RHTSDEVFLGKRDTAEWTADEEAVKAFGKFGEKLAGIEDRIIRMNSDEEWRNRVGPAKMP  878

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLL PTS  GLTGRGIPNS+SI
Sbjct  879  YTLLIPTSGVGLTGRGIPNSVSI  901



>gb|AHX56188.1| lipoxygenase [Diospyros kaki]
Length=876

 Score =   288 bits (736),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 163/208 (78%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D  V  D ELQ WW E   +GH DKK+E WW +M  R  LI+T T IIW++SALHAAVNF
Sbjct  669  DESVQGDSELQLWWIELRNEGHGDKKDEAWWPEMQGRAQLIQTCTIIIWVASALHAAVNF  728

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGT EY EL++NP+ AFL+TITAQFQTLLG+SLIEILS
Sbjct  729  GQYPYAGYLPNRPTISRRFMPEPGTREYAELESNPESAFLKTITAQFQTLLGVSLIEILS  788

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RHA+DEIYLGQRE P+WTSD   L+AFERF  +L  IE RI+  N+D++W+NR GPVKVP
Sbjct  789  RHATDEIYLGQRESPDWTSDAQPLEAFERFRMQLVQIEHRIVQRNNDKRWKNRFGPVKVP  848

Query  193  YTLLFPTSE-----GGLTGRGIPNSISI  125
            YTLL+P++       GL+G GIPNS+SI
Sbjct  849  YTLLYPSTSDSIRASGLSGMGIPNSVSI  876



>ref|XP_010553735.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Tarenaya hassleriana]
Length=859

 Score =   287 bits (735),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 164/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V  D ELQ WW E  ++GH DKK+E WW KM +R+ LI++ T IIWI+SALHA+V
Sbjct  655  KTDDDVRNDTELQTWWKEIREEGHGDKKSELWWPKMQTRKELIDSCTIIIWIASALHASV  714

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY  AGY P RPT+SR+FMPE GT E+EEL+ NPDK FL TITAQ QTLLGIS+IEI
Sbjct  715  NFGQYPIAGYMPNRPTISRQFMPEKGTREFEELEKNPDKVFLRTITAQIQTLLGISIIEI  774

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR+  EWT++   L+AF RFG++LA IE +I+  NDD   +NR GPVK
Sbjct  775  LSRHSSDEVYLGQRDSNEWTTENEALEAFSRFGERLAEIERKIVERNDDVSLKNRNGPVK  834

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTL+FPTSEGG+TG+GIPNS+SI
Sbjct  835  MPYTLMFPTSEGGITGKGIPNSVSI  859



>ref|XP_009119596.1| PREDICTED: linoleate 9S-lipoxygenase 1 [Brassica rapa]
Length=857

 Score =   287 bits (735),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 164/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V  D ELQAWW E  ++GH DKK+EPWW KM +R+ LI++ T IIW++SALHAAV
Sbjct  653  KSDEDVQNDTELQAWWKEVREEGHGDKKSEPWWPKMQTRKELIDSCTIIIWVASALHAAV  712

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY  AGY P RPT+SR+FMP+  TPE+EEL+ NPDK FL+TITAQ QTLLGISLIEI
Sbjct  713  NFGQYPIAGYLPNRPTISRQFMPKENTPEFEELEKNPDKVFLKTITAQLQTLLGISLIEI  772

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H+SDE+YLGQR+  EW ++K  L+AFE+FG K+  IE +I   N D+  +NRTGPVK
Sbjct  773  LSTHSSDEVYLGQRDSKEWAAEKEALEAFEKFGDKVKEIEKKIDERNLDENLKNRTGPVK  832

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYT LFPTSEGG+TGRGIPNS+SI
Sbjct  833  MPYTSLFPTSEGGVTGRGIPNSVSI  857



>ref|XP_009344082.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=894

 Score =   288 bits (736),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 161/210 (77%), Gaps = 5/210 (2%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            + D  V  D ELQ WWTE    GH DKKNEPWW KM +R  LIE+ T IIW++SALHAAV
Sbjct  685  QSDDGVQGDSELQNWWTELRNIGHGDKKNEPWWPKMQTRAELIESCTIIIWVASALHAAV  744

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQYSYAGY P RPT+SRRFMPEPGT EY EL ++PD AFL+TITAQFQTLLG+SLIEI
Sbjct  745  NFGQYSYAGYLPNRPTVSRRFMPEPGTAEYYELVSSPDTAFLKTITAQFQTLLGVSLIEI  804

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQ + PEWTSD   L AF RF +KL  IE RI A N D + +NR GPV 
Sbjct  805  LSRHSTDEVYLGQNDTPEWTSDAEALIAFARFREKLMDIEKRIDARNKDNRLKNRVGPVD  864

Query  199  VPYTLLFPTS-----EGGLTGRGIPNSISI  125
            VPYTLL P +     EGGLTG+GIPNS+SI
Sbjct  865  VPYTLLHPNTSDKSREGGLTGKGIPNSVSI  894



>gb|KCW61799.1| hypothetical protein EUGRSUZ_H04497 [Eucalyptus grandis]
Length=598

 Score =   281 bits (720),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 158/205 (77%), Gaps = 11/205 (5%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V  DKELQ+WW E V++GH DKK EPWW KM + + L ET T  IWI+SALHAAV
Sbjct  405  KSDQTVQNDKELQSWWKELVEEGHGDKKGEPWWPKMQTVKDLTETCTITIWIASALHAAV  464

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY P RPTLSRR+MPE GTPE+EELK NPDKAFL+TITAQ QTLLGISLIEI
Sbjct  465  NFGQYPYAGYLPNRPTLSRRYMPEEGTPEFEELKQNPDKAFLKTITAQLQTLLGISLIEI  524

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
                         R+ PEWT+D   L+AFERFGKKL  +E+RI+ MN D++WRNR GPV+
Sbjct  525  -----------PFRDTPEWTADAEPLEAFERFGKKLGEVEERIMRMNRDKRWRNRVGPVE  573

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPY LL+PTSEGG+T +GIPNS+SI
Sbjct  574  VPYMLLYPTSEGGVTAKGIPNSVSI  598



>ref|XP_004139356.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=860

 Score =   287 bits (734),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 162/205 (79%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            KDD MV  D ELQ+WW E  +KGH D K++PWW KM + +VLIET T IIWISSALHAAV
Sbjct  656  KDDIMVHDDVELQSWWKELKEKGHVDLKDKPWWPKMETLEVLIETCTIIIWISSALHAAV  715

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y GY P RPT+SRRFMPE GTP+Y EL+++P+K FL TI +Q QTLLGISL+EI
Sbjct  716  NFGQYPYGGYLPNRPTISRRFMPEKGTPQYIELESDPEKGFLRTINSQVQTLLGISLVEI  775

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDEIYLG+RE  EW SD+  L+AFE+FGK+L  IE  I+  N D K +NR GP+ 
Sbjct  776  LSRHSSDEIYLGKRESLEWISDQPALEAFEKFGKRLEEIEYEIVKRNRDPKMKNRVGPIN  835

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYT L+PTS  GLTG+GIPNSISI
Sbjct  836  VPYTSLYPTSNEGLTGKGIPNSISI  860



>ref|XP_004169780.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5-like [Cucumis sativus]
Length=860

 Score =   287 bits (734),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 162/205 (79%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            KDD MV  D ELQ+WW E  +KGH D K++PWW KM + +VLIET T IIWISSALHAAV
Sbjct  656  KDDIMVHDDVELQSWWKELKEKGHVDLKDKPWWPKMETLEVLIETCTIIIWISSALHAAV  715

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y GY P RPT+SRRFMPE GTP+Y EL+++P+K FL TI +Q QTLLGISL+EI
Sbjct  716  NFGQYPYGGYLPNRPTISRRFMPEKGTPQYIELESDPEKGFLRTINSQVQTLLGISLVEI  775

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDEIYLG+RE  EW SD+  L+AFE+FGK+L  IE  I+  N D K +NR GP+ 
Sbjct  776  LSRHSSDEIYLGKRESLEWISDQPALEAFEKFGKRLEEIEYEIVKRNRDPKMKNRVGPIN  835

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYT L+PTS  GLTG+GIPNSISI
Sbjct  836  VPYTSLYPTSNEGLTGKGIPNSISI  860



>gb|KHG03761.1| Linoleate 9S-lipoxygenase 5, chloroplastic -like protein [Gossypium 
arboreum]
 gb|KHG17470.1| Linoleate 9S-lipoxygenase 5, chloroplastic -like protein [Gossypium 
arboreum]
Length=873

 Score =   287 bits (734),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 162/208 (78%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D  V  D E+Q+WW+E   +GH D +NEPWW +M +   L +  T IIWI+SA HAAVNF
Sbjct  666  DETVKNDTEIQSWWSEVKNEGHGDLRNEPWWPEMNTLADLTQACTIIIWIASAFHAAVNF  725

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGT EY+EL+ +PD AFL+TITAQFQTLLG+SLIE+LS
Sbjct  726  GQYPYAGYLPNRPTVSRRFMPEPGTKEYDELENDPDLAFLKTITAQFQTLLGVSLIEVLS  785

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH++DEIYLGQR+  EWT+D   L AFERFGKKL  IE RI+  N+D K +NR GPVKVP
Sbjct  786  RHSTDEIYLGQRDTAEWTTDDEPLAAFERFGKKLLEIESRIMERNNDSKLKNRVGPVKVP  845

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLL+P +     EGGLTG+GIPNSISI
Sbjct  846  YTLLYPNTSDYSREGGLTGKGIPNSISI  873



>ref|XP_011090735.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Sesamum 
indicum]
Length=870

 Score =   287 bits (734),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 161/208 (77%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D  +  D ELQ+WWTE  + GH D ++EPWW  M +R  LI   T IIWI+SALHAAVNF
Sbjct  663  DEKIQGDSELQSWWTELREVGHGDLRDEPWWPNMQTRAELIHACTIIIWIASALHAAVNF  722

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMP+PGTPEY EL++NPD AFL+TITAQFQTLLG+SLIEILS
Sbjct  723  GQYPYAGYLPNRPTVSRRFMPKPGTPEYAELESNPDSAFLKTITAQFQTLLGVSLIEILS  782

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH++DEIYLGQ+E P+WT+D H  +AFERF   L  IE RI   N D + RNR+GPVK+P
Sbjct  783  RHSTDEIYLGQQESPDWTADAHPREAFERFSAALVEIESRITDRNKDGRLRNRSGPVKMP  842

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            Y LL+P +     EGGLTG+GIPNSISI
Sbjct  843  YMLLYPNTSDNSKEGGLTGKGIPNSISI  870



>ref|XP_009418148.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Musa acuminata 
subsp. malaccensis]
Length=855

 Score =   286 bits (732),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 160/204 (78%), Gaps = 0/204 (0%)
 Frame = -1

Query  736  DDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVN  557
            +D+++  D ELQAWW E  + GH DKK+E WW +M +   L +  TTIIW++SALHAA+N
Sbjct  652  NDAVLQADVELQAWWKEVREVGHGDKKDEAWWPQMQTVSELTQACTTIIWVASALHAALN  711

Query  556  FGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEIL  377
            FGQY YAGY P RPT+SRRFMP PGTPEYEELK +PDKAFL TIT+Q QT+LG+SLIEIL
Sbjct  712  FGQYPYAGYLPNRPTISRRFMPAPGTPEYEELKAHPDKAFLMTITSQLQTILGVSLIEIL  771

Query  376  SRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKV  197
            S H+SDE+YLGQR+ PEWT+D+  L AF RFG  L  IED I+  N D+  +NR G  +V
Sbjct  772  SMHSSDEVYLGQRDTPEWTTDQRALVAFNRFGSTLKRIEDEIIGRNGDESLKNRNGAAQV  831

Query  196  PYTLLFPTSEGGLTGRGIPNSISI  125
            PYTLLFPTSE GLTG+GIPNS+SI
Sbjct  832  PYTLLFPTSERGLTGKGIPNSVSI  855



>ref|XP_011090733.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Sesamum 
indicum]
Length=881

 Score =   286 bits (733),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 161/208 (77%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D  +  D ELQ+WWTE  + GH D ++EPWW  M +R  LI   T IIWI+SALHAAVNF
Sbjct  674  DEKIQGDSELQSWWTELREVGHGDLRDEPWWPNMQTRAELIHACTIIIWIASALHAAVNF  733

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMP+PGTPEY EL++NPD AFL+TITAQFQTLLG+SLIEILS
Sbjct  734  GQYPYAGYLPNRPTVSRRFMPKPGTPEYAELESNPDSAFLKTITAQFQTLLGVSLIEILS  793

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH++DEIYLGQ+E P+WT+D H  +AFERF   L  IE RI   N D + RNR+GPVK+P
Sbjct  794  RHSTDEIYLGQQESPDWTADAHPREAFERFSAALVEIESRITDRNKDGRLRNRSGPVKMP  853

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            Y LL+P +     EGGLTG+GIPNSISI
Sbjct  854  YMLLYPNTSDNSKEGGLTGKGIPNSISI  881



>gb|ABV32552.1| lipoxygenase [Prunus persica]
Length=933

 Score =   287 bits (734),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 162/205 (79%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D MV  D ELQ+WW E  ++GH DKK+EPWW KM + + LIE+ T IIW+SSA HAA+
Sbjct  729  KNDEMVQNDSELQSWWKELREEGHGDKKDEPWWPKMQTCEELIESCTIIIWLSSAYHAAI  788

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            N+GQYS  GY P RP++S  FMPE GTPEYEELKTNPDKAFL+T T Q QTLLG++ IEI
Sbjct  789  NYGQYSIGGYVPNRPSISLHFMPEEGTPEYEELKTNPDKAFLKTFTPQLQTLLGMASIEI  848

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH  DE+YLGQR  PEWT+D ++L AFE F KKL  IE RI+ MN D+K +NR GP K
Sbjct  849  LSRHPVDELYLGQRGTPEWTTDANMLQAFEDFRKKLEGIEKRIIKMNKDEKLKNRVGPAK  908

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+P+SE GLTG+GIPNS++I
Sbjct  909  IPYTLLYPSSEPGLTGKGIPNSVNI  933



>gb|KFK39531.1| hypothetical protein AALP_AA3G256400 [Arabis alpina]
Length=882

 Score =   286 bits (732),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 165/210 (79%), Gaps = 5/210 (2%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D  V  D E+Q+WWTE   +GH DK++E WW  M +R  LIET TTIIWI+SALHAAV
Sbjct  673  KNDKTVQNDTEIQSWWTELRTEGHGDKQHEAWWPLMQTRDDLIETCTTIIWIASALHAAV  732

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQYSYAG+ P RPT+SRRFMPEPGT EY EL  N D AFL+TIT Q QTLLGIS+IEI
Sbjct  733  NFGQYSYAGFLPNRPTVSRRFMPEPGTDEYTELSENVDLAFLKTITPQLQTLLGISIIEI  792

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H++DEIYLGQR+ P WT+D   L+AF+RFGK L  IE+ I+  N+D++++NRTGPV 
Sbjct  793  LSMHSTDEIYLGQRDSPNWTADDEALEAFKRFGKNLELIENNIIRRNNDKRFKNRTGPVN  852

Query  199  VPYTLLFP-----TSEGGLTGRGIPNSISI  125
            +PYTLL+P     T EGGLTG+GIPNS+SI
Sbjct  853  IPYTLLYPNTTDFTREGGLTGKGIPNSVSI  882



>emb|CAE17327.1| lipoxygenase [Fragaria x ananassa]
Length=884

 Score =   286 bits (731),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 164/208 (79%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D++V  D ELQ WW E   +GH DKK EPWW +M +R  LI++ T IIW++SALHAAVNF
Sbjct  677  DNVVRSDTELQKWWEELRNEGHGDKKAEPWWPEMHTRAELIQSCTIIIWVASALHAAVNF  736

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQ+ YAGY P RPT+SRRFMPEPGT EY EL+TNPD AFL+TIT+Q QTLLG+SLIE+LS
Sbjct  737  GQWPYAGYLPNRPTISRRFMPEPGTAEYAELETNPDVAFLKTITSQLQTLLGVSLIEVLS  796

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RHA+DEIYLGQR+ PEWTSD   L AF RFG+KL  IE RI     D++ +NR GP+K+P
Sbjct  797  RHATDEIYLGQRDTPEWTSDGEALAAFGRFGEKLIEIEKRITERTRDERLKNRVGPIKMP  856

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLL+P++     EGGLTG+GIPNSISI
Sbjct  857  YTLLYPSTSDYSREGGLTGKGIPNSISI  884



>gb|KJB38138.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=869

 Score =   285 bits (730),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 162/208 (78%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D  V  D E+Q+WW+E   +GH D + EPWW +M +   L +  T IIWI+SA HAAVNF
Sbjct  662  DETVKNDTEIQSWWSEVKNEGHGDLRKEPWWPEMNTLADLTQACTIIIWIASAFHAAVNF  721

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGT EY+EL+ +PD AFL+TITAQFQTLLG+SLIE+LS
Sbjct  722  GQYPYAGYLPNRPTVSRRFMPEPGTKEYDELENDPDLAFLKTITAQFQTLLGVSLIEVLS  781

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH++DEIYLGQR+  EWT+D   L AFERFGKKL  IE RI+  N+D K +NR GPVKVP
Sbjct  782  RHSTDEIYLGQRDTAEWTTDDEPLAAFERFGKKLVEIESRIMERNNDSKLKNRVGPVKVP  841

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLL+P++     EGGLTG+GIPNSISI
Sbjct  842  YTLLYPSTSDYSREGGLTGKGIPNSISI  869



>ref|XP_006344622.1| PREDICTED: linoleate 9S-lipoxygenase B-like [Solanum tuberosum]
Length=860

 Score =   285 bits (729),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 159/205 (78%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V +D ELQAWW E  ++GH DKK+E WW KM +RQ LI+  T IIWI+SALHAAV
Sbjct  656  KSDETVQKDTELQAWWKELREEGHGDKKDEAWWPKMQTRQELIDCCTIIIWIASALHAAV  715

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFG YSYAG+ P RP+LS   MPEPG+ EYEELKTNPDK FL+T   Q QTLL +S+ E+
Sbjct  716  NFGLYSYAGFLPNRPSLSWNLMPEPGSAEYEELKTNPDKVFLKTFVPQLQTLLEMSIFEV  775

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH SDE+YLGQR+ PEWT DK  L AFERF K L  IE+RI+ MN  + W+NR+GPVK
Sbjct  776  LSRHDSDEVYLGQRDSPEWTKDKEPLVAFERFVKMLNDIENRIMIMNSHKSWKNRSGPVK  835

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLLFP S+ GLTG+GIPNS+SI
Sbjct  836  VPYTLLFPKSQEGLTGKGIPNSVSI  860



>ref|XP_002891934.1| hypothetical protein ARALYDRAFT_474776 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68193.1| hypothetical protein ARALYDRAFT_474776 [Arabidopsis lyrata subsp. 
lyrata]
Length=857

 Score =   285 bits (729),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 164/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K +  +  D ELQAWW E  ++GH DKK+EPWW KM +R+ L+E+ T IIW++SALHAAV
Sbjct  653  KTEEDIQSDTELQAWWKEVREEGHGDKKSEPWWPKMQTREELVESCTIIIWVASALHAAV  712

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY  AGY P RPT+SR+FMP+  TPE+EEL+ NPDK FL+TITAQ QTLLGISLIEI
Sbjct  713  NFGQYPVAGYLPNRPTISRQFMPKENTPEFEELEKNPDKVFLKTITAQLQTLLGISLIEI  772

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H+SDE+YLGQR+  EW ++K  L+AF +FG+K+  IE  I   NDD+  +NRTG VK
Sbjct  773  LSTHSSDEVYLGQRDSKEWAAEKEALEAFAKFGEKVKEIEKNIDERNDDETLKNRTGLVK  832

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTSEGG+TGRGIPNS+SI
Sbjct  833  MPYTLLFPTSEGGVTGRGIPNSVSI  857



>gb|AIC82456.1| lipoxygenase [Cocos nucifera]
Length=852

 Score =   285 bits (729),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 163/209 (78%), Gaps = 5/209 (2%)
 Frame = -1

Query  736  DDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVN  557
            +D+ V  D ELQAWW E    GH DKK+EPWW KM S   L +T T IIW++SALHAAVN
Sbjct  644  NDAAVKDDVELQAWWKEVRDVGHGDKKDEPWWPKMDSLSELTKTCTIIIWVASALHAAVN  703

Query  556  FGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEIL  377
            FGQY YAGY P RPT+SRRFMPEP +PEY+ELK NPD+ FL TIT+Q QT+LG+SLIEIL
Sbjct  704  FGQYPYAGYLPNRPTISRRFMPEPNSPEYDELKRNPDRVFLSTITSQLQTILGVSLIEIL  763

Query  376  SRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKV  197
            SRH+SDE+YLGQR+  EWT+D+  L+AF++FG KL  IE++I+ MN D+  +NR GPV+V
Sbjct  764  SRHSSDEVYLGQRDTHEWTADEKALEAFKKFGDKLVEIENKIVDMNQDKSLKNRNGPVEV  823

Query  196  PYTLLFPTSE-----GGLTGRGIPNSISI  125
             YTLL+P +      GGLTGRGIPNS+SI
Sbjct  824  SYTLLYPNTSDFSQVGGLTGRGIPNSVSI  852



>ref|XP_010414944.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Camelina sativa]
Length=860

 Score =   285 bits (729),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 163/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  + +D ELQAWW E  ++GH DKK+EPWW KM +R+ L+E+ T IIW++SALHAAV
Sbjct  656  KTDEDIQRDTELQAWWKEVREEGHGDKKSEPWWPKMQNREELVESCTIIIWVASALHAAV  715

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY  AGY P RPT+SR+FMP+  TPE+ EL+ NPDK F +TITAQ QTLLGISLIEI
Sbjct  716  NFGQYPIAGYLPNRPTISRQFMPKENTPEFAELEKNPDKVFFKTITAQLQTLLGISLIEI  775

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H+SDE+YLGQR+  EW ++K  LDAFE+FG+K+  IE  +   NDD   +NRTG VK
Sbjct  776  LSTHSSDEVYLGQRDSKEWAAEKEALDAFEKFGEKVKEIEKNMDERNDDVNLKNRTGLVK  835

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTSEGG+TGRGIPNS+SI
Sbjct  836  MPYTLLFPTSEGGVTGRGIPNSVSI  860



>ref|XP_008340970.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Malus 
domestica]
Length=850

 Score =   285 bits (728),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 160/210 (76%), Gaps = 5/210 (2%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            + D  V  D ELQ WWTE    GH DKKNEPWW KM +R  LIE+ T IIW++SALHAAV
Sbjct  641  ESDDAVQVDSELQDWWTELRNVGHGDKKNEPWWPKMQTRDELIESCTIIIWVASALHAAV  700

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQYSYAGY P RPT+SRRFMPE GT EY EL++NPD AFL+TITAQ QTLLG+SLIE+
Sbjct  701  NFGQYSYAGYLPNRPTVSRRFMPEAGTAEYAELESNPDAAFLKTITAQLQTLLGVSLIEV  760

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQ + PEWTSD   L AF RFG+KL  IE  I   N D + +NR GPV 
Sbjct  761  LSRHSTDEVYLGQNDTPEWTSDAEALAAFARFGEKLMDIEKGINERNKDMRLKNRVGPVD  820

Query  199  VPYTLLFPTS-----EGGLTGRGIPNSISI  125
            +PYTLL+P +     EGGLTG+GIPNS+SI
Sbjct  821  MPYTLLYPNTSDTSREGGLTGKGIPNSVSI  850



>gb|AEQ30071.1| lipoxygenase [Litchi chinensis]
Length=872

 Score =   285 bits (729),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 164/203 (81%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D MV +D ELQ WW E  ++GH DKKNEPWW KM +R+ LI++ T IIW++SALHAAVNF
Sbjct  670  DEMVQKDAELQNWWRELREEGHGDKKNEPWWPKMHARKELIDSCTIIIWVASALHAAVNF  729

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SR+FMPE GTPEY  L+ NPDKAFL TITAQ Q LLGISLIEILS
Sbjct  730  GQYPYAGYLPNRPTMSRKFMPEEGTPEYAGLEKNPDKAFLRTITAQLQALLGISLIEILS  789

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH++DE+YLGQR  PEWT D   L AF+ FG  LA IE+RIL +N+++  +NR GPVK+P
Sbjct  790  RHSTDEVYLGQRATPEWTLDDQPLQAFQEFGNTLAKIEERILKLNNNENLKNRVGPVKMP  849

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLL+PTS GGLTG+GIPNS+SI
Sbjct  850  YTLLYPTSGGGLTGKGIPNSVSI  872



>gb|KJB38137.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=900

 Score =   286 bits (731),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 162/208 (78%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D  V  D E+Q+WW+E   +GH D + EPWW +M +   L +  T IIWI+SA HAAVNF
Sbjct  693  DETVKNDTEIQSWWSEVKNEGHGDLRKEPWWPEMNTLADLTQACTIIIWIASAFHAAVNF  752

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGT EY+EL+ +PD AFL+TITAQFQTLLG+SLIE+LS
Sbjct  753  GQYPYAGYLPNRPTVSRRFMPEPGTKEYDELENDPDLAFLKTITAQFQTLLGVSLIEVLS  812

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH++DEIYLGQR+  EWT+D   L AFERFGKKL  IE RI+  N+D K +NR GPVKVP
Sbjct  813  RHSTDEIYLGQRDTAEWTTDDEPLAAFERFGKKLVEIESRIMERNNDSKLKNRVGPVKVP  872

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLL+P++     EGGLTG+GIPNSISI
Sbjct  873  YTLLYPSTSDYSREGGLTGKGIPNSISI  900



>gb|KJB28315.1| hypothetical protein B456_005G041900 [Gossypium raimondii]
Length=877

 Score =   285 bits (729),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 162/208 (78%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D ++ +D E+Q+WWTE   +GH D K+E WW +M +R  LI+  T IIWI+SALHAAVNF
Sbjct  670  DEVLKEDTEIQSWWTEIRNEGHGDLKHELWWPEMKTRAELIQACTIIIWIASALHAAVNF  729

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGT EY EL+ +PD AFL+TIT QFQTLLG+SLIEILS
Sbjct  730  GQYPYAGYLPNRPTVSRRFMPEPGTDEYAELEKDPDLAFLKTITPQFQTLLGVSLIEILS  789

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH +DEIYLGQR+ PEWTSD   L AFERFGKKL  IE R+   N+D + +NR G VKVP
Sbjct  790  RHTTDEIYLGQRDTPEWTSDNEPLAAFERFGKKLVEIEKRVTERNNDGRLKNRIGAVKVP  849

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLLFP +     EGGLTG+GIPNSISI
Sbjct  850  YTLLFPNTSDYSKEGGLTGKGIPNSISI  877



>ref|XP_010323943.1| PREDICTED: lipoxygenase isoform X1 [Solanum lycopersicum]
Length=862

 Score =   285 bits (728),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 161/206 (78%), Gaps = 1/206 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V +D ELQAWW E  ++GH DKK+EPWW KM +RQ LIE+ T  IWI+SALHAAV
Sbjct  657  KSDDTVKKDSELQAWWKELREEGHGDKKDEPWWPKMQTRQELIESCTITIWIASALHAAV  716

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY   RP+LSR  MPEPG+PEYEELKTNPDK FL+T     QTLL IS+++I
Sbjct  717  NFGQYPYAGYLVNRPSLSRMLMPEPGSPEYEELKTNPDKVFLKTTVPPLQTLLEISVLKI  776

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDD-QKWRNRTGPV  203
            LSRH SD +YLGQR+ PEWT D+  L AFERFGKKL+ I ++IL MN D +KW+NR GPV
Sbjct  777  LSRHGSDTLYLGQRDSPEWTKDQEPLLAFERFGKKLSDIGNQILQMNGDHEKWKNRLGPV  836

Query  202  KVPYTLLFPTSEGGLTGRGIPNSISI  125
            KVPY  LFPTS  GLTG+GIPNS+SI
Sbjct  837  KVPYISLFPTSGEGLTGKGIPNSVSI  862



>ref|XP_010323952.1| PREDICTED: lipoxygenase isoform X3 [Solanum lycopersicum]
Length=853

 Score =   284 bits (727),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 161/206 (78%), Gaps = 1/206 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V +D ELQAWW E  ++GH DKK+EPWW KM +RQ LIE+ T  IWI+SALHAAV
Sbjct  648  KSDDTVKKDSELQAWWKELREEGHGDKKDEPWWPKMQTRQELIESCTITIWIASALHAAV  707

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY   RP+LSR  MPEPG+PEYEELKTNPDK FL+T     QTLL IS+++I
Sbjct  708  NFGQYPYAGYLVNRPSLSRMLMPEPGSPEYEELKTNPDKVFLKTTVPPLQTLLEISVLKI  767

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDD-QKWRNRTGPV  203
            LSRH SD +YLGQR+ PEWT D+  L AFERFGKKL+ I ++IL MN D +KW+NR GPV
Sbjct  768  LSRHGSDTLYLGQRDSPEWTKDQEPLLAFERFGKKLSDIGNQILQMNGDHEKWKNRLGPV  827

Query  202  KVPYTLLFPTSEGGLTGRGIPNSISI  125
            KVPY  LFPTS  GLTG+GIPNS+SI
Sbjct  828  KVPYISLFPTSGEGLTGKGIPNSVSI  853



>ref|XP_004230206.1| PREDICTED: lipoxygenase isoform X2 [Solanum lycopersicum]
Length=854

 Score =   284 bits (727),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 161/206 (78%), Gaps = 1/206 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V +D ELQAWW E  ++GH DKK+EPWW KM +RQ LIE+ T  IWI+SALHAAV
Sbjct  649  KSDDTVKKDSELQAWWKELREEGHGDKKDEPWWPKMQTRQELIESCTITIWIASALHAAV  708

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAGY   RP+LSR  MPEPG+PEYEELKTNPDK FL+T     QTLL IS+++I
Sbjct  709  NFGQYPYAGYLVNRPSLSRMLMPEPGSPEYEELKTNPDKVFLKTTVPPLQTLLEISVLKI  768

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDD-QKWRNRTGPV  203
            LSRH SD +YLGQR+ PEWT D+  L AFERFGKKL+ I ++IL MN D +KW+NR GPV
Sbjct  769  LSRHGSDTLYLGQRDSPEWTKDQEPLLAFERFGKKLSDIGNQILQMNGDHEKWKNRLGPV  828

Query  202  KVPYTLLFPTSEGGLTGRGIPNSISI  125
            KVPY  LFPTS  GLTG+GIPNS+SI
Sbjct  829  KVPYISLFPTSGEGLTGKGIPNSVSI  854



>ref|XP_010511239.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Camelina sativa]
Length=860

 Score =   284 bits (727),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 163/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  + +D ELQAWW E  ++GH DKK+EPWW KM +R+ L+E+ T IIW++SALHAAV
Sbjct  656  KTDEDIQRDSELQAWWKEVREEGHGDKKSEPWWPKMQNREELVESCTIIIWVASALHAAV  715

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY  AGY P RPT+SR+FMP+  TPE+ +L+ NPDK F +TITAQ QTLLGISLIEI
Sbjct  716  NFGQYPIAGYLPNRPTISRQFMPKENTPEFAQLEKNPDKVFFKTITAQLQTLLGISLIEI  775

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H+SDE+YLGQR+  EW ++K  LDAFE+FG+K+  IE  +   NDD   +NRTG VK
Sbjct  776  LSTHSSDEVYLGQRDSKEWAAEKEALDAFEKFGEKVKEIEKNMDERNDDVNLKNRTGLVK  835

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTSEGG+TGRGIPNS+SI
Sbjct  836  MPYTLLFPTSEGGVTGRGIPNSVSI  860



>gb|AAM28285.1| lipoxygenase I, partial [Ananas comosus]
Length=331

 Score =   270 bits (691),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 151/203 (74%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D+ V  D ELQAWWTE  + GH DKK+EPWW +M +   L    TTIIW++SALHAAVNF
Sbjct  129  DAAVQADAELQAWWTEVREVGHGDKKDEPWWPEMQAVSELTHACTTIIWVASALHAAVNF  188

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P  PT+SRRFMP PGT EY+ELKTNPDKAF+ T T   QT+L +SLIEILS
Sbjct  189  GQYPYAGYMPNGPTISRRFMPAPGTVEYDELKTNPDKAFVRTTTGMLQTILVLSLIEILS  248

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
             H SDE YLGQR+ PEWT+D+  L AFERF   LA IE  I+  N D   +NR GPVK+P
Sbjct  249  THTSDEKYLGQRDTPEWTTDQSALRAFERFNAALAQIEADIVKRNRDPSLKNRNGPVKMP  308

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLL+ TSE G+T +GIPNS+SI
Sbjct  309  YTLLYRTSEAGITAKGIPNSVSI  331



>ref|NP_175900.1| lipoxygenase 1 [Arabidopsis thaliana]
 sp|Q06327.1|LOX1_ARATH RecName: Full=Linoleate 9S-lipoxygenase 1; AltName: Full=Lipoxygenase 
1; Short=AtLOX1 [Arabidopsis thaliana]
 gb|AAG51123.1|AC069144_20 lipoxygenase, putative [Arabidopsis thaliana]
 gb|AAA32827.1| lipoxygenase [Arabidopsis thaliana]
 gb|AAA17036.1| lipoxygenase 1 [Arabidopsis thaliana]
 gb|AAM13103.1| lipoxygenase, putative [Arabidopsis thaliana]
 gb|AAQ56801.1| At1g55020 [Arabidopsis thaliana]
 gb|AEE33175.1| lipoxygenase 1 [Arabidopsis thaliana]
Length=859

 Score =   284 bits (727),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 162/197 (82%), Gaps = 0/197 (0%)
 Frame = -1

Query  715  DKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNFGQYSYA  536
            D ELQAWW E  ++GH DKK+EPWW KM +R+ L+E+ T IIW++SALHAAVNFGQY  A
Sbjct  663  DTELQAWWKEVREEGHGDKKSEPWWPKMQTREELVESCTIIIWVASALHAAVNFGQYPVA  722

Query  535  GYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILSRHASDE  356
            GY P RPT+SR++MP+  TPE+EEL+ NPDK FL+TITAQ QTLLGISLIEILS H+SDE
Sbjct  723  GYLPNRPTISRQYMPKENTPEFEELEKNPDKVFLKTITAQLQTLLGISLIEILSTHSSDE  782

Query  355  IYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVPYTLLFP  176
            +YLGQR+  EW ++K  L+AFE+FG+K+  IE  I   NDD+  +NRTG VK+PYTLLFP
Sbjct  783  VYLGQRDSKEWAAEKEALEAFEKFGEKVKEIEKNIDERNDDETLKNRTGLVKMPYTLLFP  842

Query  175  TSEGGLTGRGIPNSISI  125
            +SEGG+TGRGIPNS+SI
Sbjct  843  SSEGGVTGRGIPNSVSI  859



>gb|AAD09202.1| lipoxygenase [Solanum tuberosum]
Length=876

 Score =   284 bits (727),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 162/208 (78%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D M+  D ELQ+WW E   +GH D K+EPWW +M +R  L+E  T IIW++SALHAAVNF
Sbjct  669  DDMIRDDTELQSWWMEVRNEGHGDLKDEPWWPQMQTRAELVEACTIIIWVASALHAAVNF  728

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY Y+G    RPT+SRRFMPEPGTPEY EL++NPD A+L+TITAQFQTLLG+SLIEILS
Sbjct  729  GQYPYSGLTSNRPTVSRRFMPEPGTPEYAELESNPDVAYLKTITAQFQTLLGVSLIEILS  788

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            R ASDEIYLGQRE+PEWTSD     +F+RF  KL  +E++I+  N+D +W+NR GPVKVP
Sbjct  789  RTASDEIYLGQRENPEWTSDVEPRQSFQRFHDKLVDVENKIVERNNDSRWKNRNGPVKVP  848

Query  193  YTLLFP-----TSEGGLTGRGIPNSISI  125
            Y LL+P      SE GLTG+GIPNS+SI
Sbjct  849  YMLLYPNASGDNSESGLTGKGIPNSVSI  876



>gb|KFK35599.1| hypothetical protein AALP_AA4G012300 [Arabis alpina]
Length=856

 Score =   284 bits (726),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 163/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V  D ELQAWW E  ++GH DKK+EPWW KM +R+ L+E+ T IIW++SALHAAV
Sbjct  652  KTDEDVQNDTELQAWWKEVREEGHGDKKSEPWWPKMKTREELMESCTIIIWVASALHAAV  711

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY  AGY P RPT+SR+FMP+  TPE+EEL+ NP+K FL+TITAQ QTLLGISLIEI
Sbjct  712  NFGQYPIAGYLPNRPTISRQFMPKENTPEFEELEKNPEKVFLKTITAQLQTLLGISLIEI  771

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H+SDE+YLGQR+  EW +DK  L+AFE+FG+K+  IE +I   N D+  +NR GPVK
Sbjct  772  LSTHSSDEVYLGQRDDKEWAADKEALEAFEKFGEKVKEIEKKIDERNVDENLKNRNGPVK  831

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYT LFPTSEGG+T RGIPNS+SI
Sbjct  832  MPYTALFPTSEGGVTNRGIPNSVSI  856



>gb|KFK35600.1| hypothetical protein AALP_AA4G012300 [Arabis alpina]
Length=857

 Score =   284 bits (726),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 163/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V  D ELQAWW E  ++GH DKK+EPWW KM +R+ L+E+ T IIW++SALHAAV
Sbjct  653  KTDEDVQNDTELQAWWKEVREEGHGDKKSEPWWPKMKTREELMESCTIIIWVASALHAAV  712

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY  AGY P RPT+SR+FMP+  TPE+EEL+ NP+K FL+TITAQ QTLLGISLIEI
Sbjct  713  NFGQYPIAGYLPNRPTISRQFMPKENTPEFEELEKNPEKVFLKTITAQLQTLLGISLIEI  772

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H+SDE+YLGQR+  EW +DK  L+AFE+FG+K+  IE +I   N D+  +NR GPVK
Sbjct  773  LSTHSSDEVYLGQRDDKEWAADKEALEAFEKFGEKVKEIEKKIDERNVDENLKNRNGPVK  832

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYT LFPTSEGG+T RGIPNS+SI
Sbjct  833  MPYTALFPTSEGGVTNRGIPNSVSI  857



>gb|ACH91370.1| lipoxygenase LOX-3 [Prunus persica]
Length=933

 Score =   285 bits (729),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 165/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV +D ELQ+WW E  ++GH DKK+EPWW KM + + LIE+ T IIWI+SA HAA+
Sbjct  729  KTDEMVQKDSELQSWWKELREEGHGDKKDEPWWPKMQTCEELIESCTIIIWIASAHHAAI  788

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY + GY P RP++S +FMPE GTPEYEELKTNP+KAFL+TIT Q QTLLG++ IEI
Sbjct  789  NFGQYPFGGYPPNRPSISLQFMPEEGTPEYEELKTNPEKAFLKTITPQLQTLLGMASIEI  848

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+ PEWT+D  +L AF++F KKL  IE+ +  MN D+K +NR GP K
Sbjct  849  LSRHSADELYLGQRDAPEWTADNDILQAFKKFRKKLEEIEENMKRMNKDEKLKNRVGPAK  908

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL P+SE GLTG+GIPNS+SI
Sbjct  909  MPYTLLHPSSEAGLTGKGIPNSVSI  933



>emb|CAP59449.1| lipoxygenase [Momordica charantia]
Length=880

 Score =   284 bits (727),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 160/205 (78%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            KDD  +  D ELQ+WW E  +KGH DKK+EPWW KM +   LIE+ T IIWISSALHAAV
Sbjct  676  KDDDAIRNDVELQSWWKELREKGHTDKKDEPWWPKMQTFSELIESCTIIIWISSALHAAV  735

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y GY P RPT SRRFMPE GT EY+E+++NP+KAFL TI++Q   LLG+S+IEI
Sbjct  736  NFGQYPYGGYVPNRPTTSRRFMPEVGTAEYKEVESNPEKAFLRTISSQIVALLGLSIIEI  795

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS+HASDE+YLGQR   EWTSDK  ++AFE+FGK+L  +EDRI+  N D   +NR GPV 
Sbjct  796  LSKHASDEVYLGQRASIEWTSDKSAIEAFEKFGKELFEVEDRIMRRNQDVNLKNRAGPVN  855

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL P+S  GLTGRGIPNSISI
Sbjct  856  MPYTLLVPSSTEGLTGRGIPNSISI  880



>ref|XP_009366923.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=884

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 159/210 (76%), Gaps = 5/210 (2%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V  D ELQ WW E    GH DKKNEPWW +M +R  LIE+ T IIW++SALHAAV
Sbjct  675  KSDDAVQGDFELQDWWAELRNVGHGDKKNEPWWPQMQTRDELIESCTIIIWVASALHAAV  734

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQYSYAGY P RPT+SRRFMPE GT EY EL++NPD AFL+TITAQ QTLLG+SLIEI
Sbjct  735  NFGQYSYAGYLPNRPTVSRRFMPEAGTAEYAELESNPDAAFLKTITAQLQTLLGVSLIEI  794

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQ + PEWTSD   L AF RFG+KL  IE  I   N D + +NR GPV 
Sbjct  795  LSRHSTDEVYLGQNDTPEWTSDAEALAAFARFGEKLMDIEKNINERNKDMRLKNRVGPVD  854

Query  199  VPYTLLFPTS-----EGGLTGRGIPNSISI  125
            +PYTLL+P +     EGGLTG+GIPNS+SI
Sbjct  855  MPYTLLYPNTSDKSREGGLTGKGIPNSVSI  884



>gb|AAO03558.1| lipoxygenase 1 [Brassica napus]
Length=857

 Score =   283 bits (725),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 164/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V  D ELQAWW E  ++GH DKK+EPWW KM +R+ LI++ T IIW++SALHAAV
Sbjct  653  KTDEDVQNDTELQAWWKEVREEGHGDKKSEPWWPKMQTRKELIDSCTIIIWVASALHAAV  712

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            +FGQY  AGY P RPT+SR+FMP+  TPE+EEL+ NPDK FL++ITAQ QTLLGISLIEI
Sbjct  713  SFGQYPIAGYLPNRPTISRQFMPKENTPEFEELEKNPDKVFLKSITAQLQTLLGISLIEI  772

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H+SDE+YLGQR+  EW ++K  L+AFE+FG K+  IE +I   N D+  +NRTGPVK
Sbjct  773  LSTHSSDEVYLGQRDSKEWAAEKEALEAFEKFGDKVKEIEKKIDERNLDENLKNRTGPVK  832

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYT LFPTSEGG+TGRGIPNS+SI
Sbjct  833  MPYTSLFPTSEGGVTGRGIPNSVSI  857



>ref|XP_007208102.1| hypothetical protein PRUPE_ppa001216mg [Prunus persica]
 gb|EMJ09301.1| hypothetical protein PRUPE_ppa001216mg [Prunus persica]
Length=879

 Score =   283 bits (725),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 161/205 (79%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D MV  D ELQ+WW E  ++GH DKK+EPWW KM + + LIE+ T IIW+SSA HAA+
Sbjct  675  KNDEMVQNDSELQSWWKELREEGHGDKKDEPWWPKMQTCEELIESCTIIIWLSSAYHAAI  734

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            N+GQYS  GY P RP++S  FMPE GTPEYEELKTNPDKAFL+T T Q QTLLG++ IEI
Sbjct  735  NYGQYSIGGYVPNRPSISLHFMPEEGTPEYEELKTNPDKAFLKTFTPQLQTLLGMASIEI  794

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH  DE+YLGQR  PEWT+D ++L A E F KKL  IE RI+ MN D+K +NR GP K
Sbjct  795  LSRHPVDELYLGQRGTPEWTTDANMLQASEDFRKKLEGIEKRIIKMNKDEKLKNRVGPAK  854

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+P+SE GLTG+GIPNS++I
Sbjct  855  IPYTLLYPSSEPGLTGKGIPNSVNI  879



>ref|XP_008454500.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis melo]
Length=858

 Score =   283 bits (724),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 161/205 (79%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D MV  D ELQ+WW E  +KGH D K++PWW KM + + LIET T IIWISSALHAAV
Sbjct  654  KNDIMVHDDIELQSWWKELKEKGHVDLKDKPWWPKMETLEELIETCTIIIWISSALHAAV  713

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y GY P RPT+SRRFMPE GTP+Y EL+++P+K FL TI +Q QTLLGISLIEI
Sbjct  714  NFGQYPYGGYLPNRPTISRRFMPEKGTPQYVELESDPEKGFLRTINSQVQTLLGISLIEI  773

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDEIYLG+RE  EW SD+  L+AFE+FGK+L  IE  I+  N D K +NR GP+ 
Sbjct  774  LSRHSSDEIYLGKRESLEWISDQPALEAFEKFGKRLEEIEYEIVKRNRDPKMKNRVGPIN  833

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYT L+PTS  GLTG+GIPNSISI
Sbjct  834  VPYTSLYPTSNEGLTGKGIPNSISI  858



>ref|XP_010549787.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Tarenaya hassleriana]
Length=861

 Score =   283 bits (723),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 164/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K +  VL D ELQ+WW E  ++GH DKK+EPWW KM + + LI++ T IIWI+SALHAAV
Sbjct  657  KTNEDVLNDTELQSWWKEVREEGHGDKKSEPWWPKMQTCEELIDSCTIIIWIASALHAAV  716

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY  AGY P RPT+SRRFMP  G+ E+EEL+ NP+K FL TITAQ QTLLG+S+IE+
Sbjct  717  NFGQYPIAGYLPNRPTVSRRFMPRKGSKEFEELEKNPEKVFLRTITAQIQTLLGVSIIEV  776

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQR+  EWT++   L+AF RFG++L  IE +I+  N+D   +NR GPVK
Sbjct  777  LSRHSTDEVYLGQRDSKEWTAENEALEAFSRFGERLVEIEKKIVERNEDVSLKNRNGPVK  836

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTSEGG+TG+GIPNS+SI
Sbjct  837  MPYTLLFPTSEGGITGKGIPNSVSI  861



>ref|XP_010480214.1| PREDICTED: linoleate 9S-lipoxygenase 1 [Camelina sativa]
Length=860

 Score =   283 bits (723),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 162/205 (79%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  + +D ELQAWW E  ++GH DKK+EPWW KM +R+ L+E+ T IIW++SALHAAV
Sbjct  656  KTDEDIQRDTELQAWWKEVREEGHGDKKSEPWWPKMQNREELVESCTIIIWVASALHAAV  715

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY  AGY P RPT+SR+FMP+  TPE+ EL+ NPDK F +TITAQ QTLLGISLIEI
Sbjct  716  NFGQYPIAGYLPNRPTISRQFMPKENTPEFAELEKNPDKVFFKTITAQLQTLLGISLIEI  775

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H+SDE+YLGQR+  EW ++K   DAFE+FG+K+  IE  +   NDD   +NRTG VK
Sbjct  776  LSTHSSDEVYLGQRDSKEWAAEKEASDAFEKFGEKIKEIEKNMDERNDDVNLKNRTGLVK  835

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLLFPTSEGG+TGRGIPNS+SI
Sbjct  836  MPYTLLFPTSEGGVTGRGIPNSVSI  860



>ref|XP_004302419.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=919

 Score =   283 bits (725),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 162/205 (79%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV +D ELQ+WW E  ++GH DKK+EPWW KM + + LIE+ T IIW +SA HAA+
Sbjct  715  KTDEMVQKDSELQSWWKELREEGHGDKKDEPWWPKMQTVEELIESCTIIIWTASAYHAAI  774

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y GY   RP++SRRFMP+ GTPEYE+LK NP+KAFLETIT Q QTLLG++ IEI
Sbjct  775  NFGQYPYGGYPANRPSISRRFMPKIGTPEYEQLKKNPEKAFLETITPQLQTLLGMASIEI  834

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DEIYLGQRE  EWT+D  VL+A E F  KL A+ +R+  MN D K +NRTGP K
Sbjct  835  LSRHSADEIYLGQRESQEWTADTKVLEASENFRSKLKAVGERVTKMNKDDKLKNRTGPAK  894

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+P+SE GLTG+GIPNS+SI
Sbjct  895  MPYTLLYPSSEPGLTGKGIPNSVSI  919



>ref|XP_004495725.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cicer arietinum]
Length=858

 Score =   282 bits (722),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 163/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D  + +D ELQ+WW E  +KGH DKK+E WW KM + + LIET T IIWI+SALHAAV
Sbjct  654  KEDDSIKKDSELQSWWKEIREKGHGDKKDELWWTKMHTLEELIETCTIIIWIASALHAAV  713

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQYSY G+ P RP++SRR MP+ GT EY EL  NPDKAFL+TIT+QFQ +LGISL+EI
Sbjct  714  NFGQYSYGGFPPSRPSMSRRLMPKEGTQEYNELVENPDKAFLKTITSQFQAVLGISLVEI  773

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH+SDE+YLGQR+ P WTSD+  L+AF +F KKL  IE+RI   N+D+K  NR G VK
Sbjct  774  LSRHSSDEVYLGQRDTPYWTSDEKALEAFMKFDKKLVEIEERIEIRNNDEKLINRFGSVK  833

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+ TSE GLTG+GIPNSISI
Sbjct  834  MPYTLLYRTSESGLTGKGIPNSISI  858



>ref|XP_002883361.1| lipoxygenase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59620.1| lipoxygenase [Arabidopsis lyrata subsp. lyrata]
Length=838

 Score =   282 bits (721),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 164/210 (78%), Gaps = 5/210 (2%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D  V  D E+Q+WWTE   KGH DK++E WW  M +R  LIET T IIWI+SALHAAV
Sbjct  629  KNDKTVQTDTEIQSWWTELRTKGHGDKQHESWWPSMQTRDDLIETCTIIIWIASALHAAV  688

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAG+ P RPT+SRRFMPEPGT EY EL  + D AFL+TIT Q QTLLGIS+IEI
Sbjct  689  NFGQYPYAGFLPNRPTVSRRFMPEPGTDEYAELAEDADVAFLKTITPQLQTLLGISIIEI  748

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H++DEIYLGQR+ P WT+D   L+AF+RFGK+L  IE+ I+  N+D++++NRTGPV 
Sbjct  749  LSMHSTDEIYLGQRDSPNWTADDEPLEAFKRFGKELELIENNIIRRNNDKRFKNRTGPVN  808

Query  199  VPYTLLFP-----TSEGGLTGRGIPNSISI  125
            +PYTLL+P     T EGGLTG+GIPNS+SI
Sbjct  809  IPYTLLYPNTSDYTREGGLTGKGIPNSVSI  838



>gb|ACU81176.1| 13S-lipoxygenase [Cucumis melo var. inodorus]
Length=877

 Score =   282 bits (722),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 161/205 (79%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            KDD+ +  D ELQ+WW E  +KGH DKKNE WW K+ S   L+ET TTIIWISSALHAAV
Sbjct  673  KDDNAIQNDVELQSWWKEAREKGHADKKNETWWPKLQSFNELVETCTTIIWISSALHAAV  732

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y G+ P RPT+SRR MPE G+ EY+EL++ P+KA+L+TI +  QTLLG+SLIEI
Sbjct  733  NFGQYPYGGFIPNRPTISRRHMPEVGSAEYKELESKPEKAYLKTINSMLQTLLGVSLIEI  792

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRHASDE+YLGQR   EWTSD+  L+ FE FGK+++ +E+RI+  N D   +NR+GPV 
Sbjct  793  LSRHASDEVYLGQRASIEWTSDRAALEVFENFGKEVSEVENRIIQRNKDVSLKNRSGPVN  852

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLL P+S  GLTGRGIPNSISI
Sbjct  853  VPYTLLLPSSTEGLTGRGIPNSISI  877



>gb|KJB80909.1| hypothetical protein B456_013G121100 [Gossypium raimondii]
Length=254

 Score =   266 bits (679),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 155/208 (75%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D  V  D E+Q+WW+E   +GH++ + EPWW +M +   + +  T IIWI+SA H AVNF
Sbjct  47   DETVKNDTEIQSWWSEVKNEGHDNLRKEPWWPEMNTLAEITQAYTIIIWIASAFHVAVNF  106

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY Y GY P RPT+S RFMPEPGT EY++L+ NPD AFL+TITAQFQTLLG+SLIE+LS
Sbjct  107  GQYLYIGYLPNRPTVSHRFMPEPGTKEYDKLENNPDLAFLKTITAQFQTLLGVSLIEVLS  166

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RHA+DEIYLG+R+  EWT D   L  FERFGKKL  I+ RI+  N+D   +NR G +KVP
Sbjct  167  RHATDEIYLGKRDTAEWTIDDEPLATFERFGKKLVEIDSRIMETNNDINLKNRVGSMKVP  226

Query  193  YTLLFPTS-----EGGLTGRGIPNSISI  125
            YTLL+P +     EGGLTG+GIPNSISI
Sbjct  227  YTLLYPNTSDYSREGGLTGKGIPNSISI  254



>ref|XP_008454470.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Cucumis melo]
Length=877

 Score =   282 bits (722),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 161/205 (79%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            KDD+ +  D ELQ+WW E  +KGH DKKNE WW K+ S   L+ET TTIIWISSALHAAV
Sbjct  673  KDDNAIQNDVELQSWWKEAREKGHADKKNETWWPKLQSFNELVETCTTIIWISSALHAAV  732

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y G+ P RPT+SRR MPE G+ EY+EL++ P+KA+L+TI +  QTLLG+SLIEI
Sbjct  733  NFGQYPYGGFIPNRPTISRRHMPEVGSAEYKELESKPEKAYLKTINSMLQTLLGVSLIEI  792

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRHASDE+YLGQR   EWTSD+  L+ FE FGK+++ +E+RI+  N D   +NR+GPV 
Sbjct  793  LSRHASDEVYLGQRASIEWTSDRAALEVFENFGKEVSEVENRIIQRNKDVSLKNRSGPVN  852

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLL P+S  GLTGRGIPNSISI
Sbjct  853  VPYTLLLPSSTEGLTGRGIPNSISI  877



>ref|NP_001234873.1| linoleate 9S-lipoxygenase B [Solanum lycopersicum]
 sp|P38416.1|LOXB_SOLLC RecName: Full=Linoleate 9S-lipoxygenase B; AltName: Full=Lipoxygenase 
B [Solanum lycopersicum]
 gb|AAA53183.1| lipoxygenase [Solanum lycopersicum]
Length=859

 Score =   281 bits (720),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 159/205 (78%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V +D ELQAWW E  ++GH DKK+E WW K+ +RQ L +  T IIWI+SALHAA+
Sbjct  655  KSDETVEKDTELQAWWKELREEGHGDKKDEAWWPKLQTRQELRDCCTIIIWIASALHAAL  714

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            +FG YSYAGY P RPTLS   MPEPG+ EYEELKTNPDK FL+T   Q Q+LL IS+ E+
Sbjct  715  HFGLYSYAGYLPNRPTLSCNLMPEPGSVEYEELKTNPDKVFLKTFVPQLQSLLEISIFEV  774

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
             SRHASDE+YLGQR+  EWT DK  L AFERFGK L+ IE+RI+ MN  + W+NR+GPV 
Sbjct  775  SSRHASDEVYLGQRDSIEWTKDKEPLVAFERFGKMLSDIENRIMIMNSHKSWKNRSGPVN  834

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLLFPTSE GLTG+GIPNS+SI
Sbjct  835  VPYTLLFPTSEEGLTGKGIPNSVSI  859



>gb|AAA74393.1| lipoxygenase [Solanum lycopersicum]
Length=859

 Score =   281 bits (720),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 159/205 (78%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V +D ELQAWW E  ++GH DKK+E WW K+ +RQ L +  T IIWI+SALHAA+
Sbjct  655  KSDETVEKDTELQAWWKELREEGHGDKKDEAWWPKLQTRQELRDCCTIIIWIASALHAAL  714

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            +FG YSYAGY P RPTLS   MPEPG+ EYEELKTNPDK FL+T   Q Q+LL IS+ E+
Sbjct  715  HFGLYSYAGYLPNRPTLSCNLMPEPGSVEYEELKTNPDKVFLKTFVPQLQSLLEISIFEV  774

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
             SRHASDE+YLGQR+  EWT DK  L AFERFGK L+ IE+RI+ MN  + W+NR+GPV 
Sbjct  775  SSRHASDEVYLGQRDSIEWTKDKEPLVAFERFGKMLSDIENRIMIMNSHKSWKNRSGPVN  834

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLLFPTSE GLTG+GIPNS+SI
Sbjct  835  VPYTLLFPTSEEGLTGKGIPNSVSI  859



>ref|XP_010324011.1| PREDICTED: linoleate 9S-lipoxygenase B isoform X1 [Solanum lycopersicum]
Length=859

 Score =   281 bits (720),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 159/205 (78%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V +D ELQAWW E  ++GH DKK+E WW K+ +RQ L +  T IIWI+SALHAA+
Sbjct  655  KSDETVEKDTELQAWWKELREEGHGDKKDEAWWPKLQTRQELRDCCTIIIWIASALHAAL  714

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            +FG YSYAGY P RPTLS   MPEPG+ EYEELKTNPDK FL+T   Q Q+LL IS+ E+
Sbjct  715  HFGLYSYAGYLPNRPTLSCNLMPEPGSVEYEELKTNPDKVFLKTFVPQLQSLLEISIFEV  774

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
             SRHASDE+YLGQR+  EWT DK  L AFERFGK L+ IE+RI+ MN  + W+NR+GPV 
Sbjct  775  SSRHASDEVYLGQRDSIEWTKDKEPLVAFERFGKMLSDIENRIMIMNSHKSWKNRSGPVN  834

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLLFPTSE GLTG+GIPNS+SI
Sbjct  835  VPYTLLFPTSEEGLTGKGIPNSVSI  859



>ref|XP_004230207.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Solanum lycopersicum]
Length=863

 Score =   281 bits (720),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 159/205 (78%), Gaps = 1/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV  D ELQ WW E  +KGH DKK +PWW KM +R+ LI+  T IIWI+SALHAA+
Sbjct  660  KTDEMVKIDTELQCWWKEAREKGHGDKKEQPWWPKMQTREELIDCCTIIIWIASALHAAI  719

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY Y GY P RP++SRRFMPEP T EYEELK+NP+KAFL+TIT   Q++LGISLIE 
Sbjct  720  NFGQYPYGGYPPNRPSMSRRFMPEPETSEYEELKSNPEKAFLKTITPLPQSILGISLIEA  779

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS H SDE++LG+R  PEWT+D+  L AFERFGKKL  IE +I+ MNDD   +NR GP  
Sbjct  780  LSLHTSDEVFLGKRA-PEWTTDEEPLQAFERFGKKLEEIEQKIIKMNDDPNLKNRVGPAN  838

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL P+SE GLTGRGIPNS+SI
Sbjct  839  IPYTLLCPSSELGLTGRGIPNSVSI  863



>gb|AJD18612.1| lipoxygenase, partial [Pyrus ussuriensis]
Length=423

 Score =   271 bits (692),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 158/205 (77%), Gaps = 0/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K+D MV  D ELQ+WW E  + GH DKK+EPWW KM +R  LIE+ TTII+I+SA HAA+
Sbjct  219  KNDQMVQNDSELQSWWKELREVGHGDKKDEPWWPKMQTRDELIESCTTIIYIASAHHAAI  278

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            N+GQ+S  G+ P RPTLSRRFMPE GTPEYEEL+TNPDKAFL+T   Q  TLLG++ +EI
Sbjct  279  NYGQFSIGGFVPNRPTLSRRFMPEEGTPEYEELRTNPDKAFLKTFAPQLPTLLGMATVEI  338

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH +DE+YLGQR+  EWT+D  +L A E F K L AIE +I  MN D++ +NR GP K
Sbjct  339  LSRHPTDELYLGQRDTAEWTTDADILQASEDFKKNLEAIEAKIEKMNKDERLKNRFGPAK  398

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            +PYTLL+P+SE GLT +G+P SI+I
Sbjct  399  IPYTLLYPSSEPGLTNKGVPTSINI  423



>emb|CDY43490.1| BnaA01g21450D [Brassica napus]
Length=1203

 Score =   285 bits (728),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 164/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  739   KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
             K D  V  D ELQAWW E  ++GH DKK+EPWW K+ +R+ LI++ T IIW++SALHAAV
Sbjct  999   KSDEDVQNDTELQAWWKEVREEGHGDKKSEPWWPKLQTRKELIDSCTIIIWVASALHAAV  1058

Query  559   NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
             NFGQY  AGY P RPT+SR+FMP+  TPE+E+L+ NPDK FL+TITAQ QTLLGISLIEI
Sbjct  1059  NFGQYPIAGYLPNRPTISRQFMPKENTPEFEQLEKNPDKVFLKTITAQLQTLLGISLIEI  1118

Query  379   LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
             LS H+SDE+YLGQR+  EW ++K  L+AFE+FG K+  IE +I   N D+  +NRTGPVK
Sbjct  1119  LSTHSSDEVYLGQRDSKEWAAEKEALEAFEKFGDKVKEIEKKIDERNLDENLKNRTGPVK  1178

Query  199   VPYTLLFPTSEGGLTGRGIPNSISI  125
             +PYT LFPTSEGG+TGRGIPNS+SI
Sbjct  1179  MPYTSLFPTSEGGVTGRGIPNSVSI  1203



>ref|XP_007030815.1| Lipoxygenase 1 [Theobroma cacao]
 gb|EOY11317.1| Lipoxygenase 1 [Theobroma cacao]
Length=863

 Score =   281 bits (719),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 159/205 (78%), Gaps = 1/205 (0%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D MV QD E+QAWW E  + GH DKK+EPWW KM +R+ LIE+ T IIWI+SALHAAV
Sbjct  660  KTDEMVQQDAEVQAWWKELREVGHGDKKDEPWWPKMQTREELIESCTIIIWIASALHAAV  719

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY+Y GY+P RPTLSRRFMPE GTPEY EL+ NP+KAF  TIT+Q QTL G+S+IE+
Sbjct  720  NFGQYAYGGYSPNRPTLSRRFMPEKGTPEYAELEKNPEKAFFRTITSQLQTLSGMSVIEV  779

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LS+H SDE+YLG R  PEWT+D   L AFE F  +L  IE+ +  MN D+K +NR GPV 
Sbjct  780  LSKHPSDEVYLGNRT-PEWTTDVMPLAAFEDFHNRLVQIEEEMKNMNTDEKLKNRVGPVN  838

Query  199  VPYTLLFPTSEGGLTGRGIPNSISI  125
            VPYTLL+P  E GL+G+GIPNSISI
Sbjct  839  VPYTLLYPNGEVGLSGKGIPNSISI  863



>ref|XP_007225308.1| hypothetical protein PRUPE_ppa001207mg [Prunus persica]
 gb|ACH90245.1| lipoxygenase LOX-2 [Prunus persica]
 gb|EMJ26507.1| hypothetical protein PRUPE_ppa001207mg [Prunus persica]
Length=881

 Score =   281 bits (719),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 165/210 (79%), Gaps = 5/210 (2%)
 Frame = -1

Query  739  KDDSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAV  560
            K D  V  D EL++WWTE   +GH DKK+EPWW +M +R  LI++ T IIW++SALHAAV
Sbjct  672  KTDDEVHSDTELKSWWTELRNEGHGDKKDEPWWPEMKTRDELIQSCTIIIWVASALHAAV  731

Query  559  NFGQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEI  380
            NFGQY YAG+ P RPT+SRRFMPE GT EY EL++NPD AFL+TIT+QF TLLGISLIEI
Sbjct  732  NFGQYPYAGFLPNRPTVSRRFMPEAGTDEYAELESNPDLAFLKTITSQFNTLLGISLIEI  791

Query  379  LSRHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVK  200
            LSRH++DE+YLGQ ++PEW SD     AF++FG  L  IE RI   N+D+K++NR GPVK
Sbjct  792  LSRHSTDEVYLGQTDNPEWISDDKPRAAFKKFGDTLMEIEKRIDERNNDEKYKNRVGPVK  851

Query  199  VPYTLLFPTS-----EGGLTGRGIPNSISI  125
            VPYTLL+P++     EGGLTGRGIPNS+SI
Sbjct  852  VPYTLLYPSTSDTKREGGLTGRGIPNSVSI  881



>ref|XP_003597559.1| Seed lipoxygenase-3 [Medicago truncatula]
 gb|AES67810.1| seed linoleate 9S-lipoxygenase [Medicago truncatula]
Length=861

 Score =   281 bits (719),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 162/203 (80%), Gaps = 0/203 (0%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D ++ QD ELQAWW E V+ GH DKKNEPWW KM +R+ L+E  TT+IWI+SALHAAVNF
Sbjct  659  DDILRQDSELQAWWKELVEVGHGDKKNEPWWPKMQAREELVEVCTTVIWIASALHAAVNF  718

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQYSY G    RPTLSRRFMPE G+ EY EL  +P KA+L+TIT +FQTL+ +S+IEILS
Sbjct  719  GQYSYGGLILNRPTLSRRFMPEKGSAEYNELVKSPQKAYLKTITPKFQTLIDLSVIEILS  778

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RHASDE+YLG+R++P WTSD   L+AF++FG KLA IE  +   N+D+K R+R GPV++P
Sbjct  779  RHASDEVYLGERDNPNWTSDTRALEAFKKFGNKLAEIEKNLAQRNNDEKLRHRLGPVQMP  838

Query  193  YTLLFPTSEGGLTGRGIPNSISI  125
            YTLL P+SE GLT RGIPNSISI
Sbjct  839  YTLLHPSSEEGLTFRGIPNSISI  861



>gb|ABF19103.2| 9-lipoxygenase [Capsicum annuum]
Length=876

 Score =   281 bits (719),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 161/208 (77%), Gaps = 5/208 (2%)
 Frame = -1

Query  733  DSMVLQDKELQAWWTETVQKGHEDKKNEPWWXKMTSRQVLIETLTTIIWISSALHAAVNF  554
            D M+  D ELQ+WW E   +GH D K+EPWW +M +R  L++  T IIW +SALHAAVNF
Sbjct  669  DDMIRGDSELQSWWKEVRDEGHGDLKDEPWWPQMQTRAELVQACTIIIWTASALHAAVNF  728

Query  553  GQYSYAGYNPCRPTLSRRFMPEPGTPEYEELKTNPDKAFLETITAQFQTLLGISLIEILS  374
            GQY YAGY P RPT+SRRFMPEPGT EY EL++NPD A+L+TITAQFQTLLG+SLIEILS
Sbjct  729  GQYPYAGYLPNRPTVSRRFMPEPGTAEYAELESNPDLAYLKTITAQFQTLLGVSLIEILS  788

Query  373  RHASDEIYLGQREHPEWTSDKHVLDAFERFGKKLAAIEDRILAMNDDQKWRNRTGPVKVP  194
            RH+SDEIYLGQR++PEWTSD     +F+RF  +L  +E +I+  N+D +W+NR GPVKVP
Sbjct  789  RHSSDEIYLGQRDNPEWTSDIQPRQSFQRFHDRLVDVEKKIVERNNDSRWKNRNGPVKVP  848

Query  193  YTLLFP-----TSEGGLTGRGIPNSISI  125
            Y LL+P      SE GLT +GIPNS+SI
Sbjct  849  YMLLYPNASGDNSESGLTVKGIPNSVSI  876



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1354032766515