BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF036E10

Length=625
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009795844.1|  PREDICTED: uncharacterized protein LOC104242489    107   2e-25   Nicotiana sylvestris
ref|XP_010313363.1|  PREDICTED: uncharacterized protein LOC104644771  95.9    6e-21   Solanum lycopersicum
ref|XP_002312817.2|  hypothetical protein POPTR_0009s16560g           89.0    2e-18   Populus trichocarpa [western balsam poplar]
gb|KJB55629.1|  hypothetical protein B456_009G085900                  87.8    3e-18   Gossypium raimondii
emb|CDP06927.1|  unnamed protein product                              84.7    2e-17   Coffea canephora [robusta coffee]
ref|XP_009347784.1|  PREDICTED: uncharacterized protein LOC103939425  85.5    2e-17   
ref|XP_007015821.1|  Uncharacterized protein TCM_041417               85.5    3e-17   
ref|XP_008351289.1|  PREDICTED: uncharacterized protein LOC103414699  85.1    3e-17   
ref|XP_002523800.1|  conserved hypothetical protein                   85.1    5e-17   
ref|XP_002877881.1|  hypothetical protein ARALYDRAFT_485645           84.0    8e-17   Arabidopsis lyrata subsp. lyrata
emb|CDX95368.1|  BnaC04g27900D                                        82.8    2e-16   
ref|XP_002523801.1|  conserved hypothetical protein                   83.6    2e-16   Ricinus communis
ref|XP_009379801.1|  PREDICTED: uncharacterized protein LOC103968354  82.8    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006384815.1|  hypothetical protein POPTR_0004s21320g           82.8    3e-16   
gb|KFK34522.1|  hypothetical protein AALP_AA5G156800                  82.0    4e-16   Arabis alpina [alpine rockcress]
ref|XP_007206836.1|  hypothetical protein PRUPE_ppa027026mg           80.9    4e-16   
emb|CDY23232.1|  BnaA04g05270D                                        82.0    4e-16   Brassica napus [oilseed rape]
ref|XP_009148738.1|  PREDICTED: uncharacterized protein LOC103872141  82.0    4e-16   Brassica rapa
ref|XP_010515747.1|  PREDICTED: uncharacterized protein LOC104791529  82.0    5e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010507412.1|  PREDICTED: uncharacterized protein LOC104784033  82.0    5e-16   Camelina sativa [gold-of-pleasure]
gb|EYU38632.1|  hypothetical protein MIMGU_mgv1a026837mg              81.3    9e-16   Erythranthe guttata [common monkey flower]
ref|XP_002275909.1|  PREDICTED: uncharacterized protein LOC100246831  80.5    1e-15   Vitis vinifera
ref|XP_006293211.1|  hypothetical protein CARUB_v10019532mg           80.9    1e-15   Capsella rubella
ref|XP_010045208.1|  PREDICTED: uncharacterized protein LOC104433977  81.6    1e-15   Eucalyptus grandis [rose gum]
emb|CAN67239.1|  hypothetical protein VITISV_004804                   85.1    2e-15   Vitis vinifera
ref|XP_008787843.1|  PREDICTED: uncharacterized protein LOC103705767  80.1    3e-15   
ref|XP_008228608.1|  PREDICTED: uncharacterized protein LOC103327996  79.7    3e-15   Prunus mume [ume]
ref|XP_009115970.1|  PREDICTED: uncharacterized protein LOC103841203  79.7    3e-15   Brassica rapa
gb|KDP33126.1|  hypothetical protein JCGZ_13573                       79.7    3e-15   Jatropha curcas
ref|XP_010244926.1|  PREDICTED: uncharacterized protein LOC104588614  80.1    3e-15   Nelumbo nucifera [Indian lotus]
ref|XP_011459330.1|  PREDICTED: uncharacterized protein LOC105349931  79.3    3e-15   Fragaria vesca subsp. vesca
ref|XP_010271656.1|  PREDICTED: uncharacterized protein LOC104607675  80.1    4e-15   Nelumbo nucifera [Indian lotus]
emb|CDX73609.1|  BnaC08g23940D                                        79.0    5e-15   
ref|XP_010101569.1|  hypothetical protein L484_015393                 79.7    5e-15   
emb|CDX78120.1|  BnaA09g33150D                                        78.6    7e-15   
ref|XP_010426895.1|  PREDICTED: uncharacterized protein LOC104711823  78.6    7e-15   Camelina sativa [gold-of-pleasure]
ref|XP_007202690.1|  hypothetical protein PRUPE_ppa012609mg           79.0    9e-15   
ref|XP_008241235.1|  PREDICTED: uncharacterized protein LOC103339680  79.0    1e-14   Prunus mume [ume]
ref|NP_566972.1|  uncharacterized protein                             78.2    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|KJB62152.1|  hypothetical protein B456_009G403000                  78.6    1e-14   Gossypium raimondii
ref|XP_009390031.1|  PREDICTED: uncharacterized protein LOC103976522  77.8    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010507411.1|  PREDICTED: uncharacterized protein LOC104784032  76.6    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006384813.1|  hypothetical protein POPTR_0004s21310g           77.8    2e-14   
ref|XP_006384814.1|  hypothetical protein POPTR_0004s21310g           78.2    2e-14   Populus trichocarpa [western balsam poplar]
ref|XP_007027734.1|  Uncharacterized protein TCM_022582               77.0    4e-14   
ref|XP_010527628.1|  PREDICTED: uncharacterized protein LOC104804934  76.6    6e-14   Tarenaya hassleriana [spider flower]
ref|XP_002312818.1|  hypothetical protein POPTR_0009s16550g           75.9    6e-14   
ref|XP_006379365.1|  hypothetical protein POPTR_0009s16550g           76.3    7e-14   
ref|XP_011000930.1|  PREDICTED: uncharacterized protein LOC105108346  75.9    7e-14   Populus euphratica
ref|XP_010089822.1|  hypothetical protein L484_022338                 75.9    8e-14   Morus notabilis
ref|XP_010912295.1|  PREDICTED: uncharacterized protein LOC105038249  75.1    1e-13   Elaeis guineensis
ref|XP_006403775.1|  hypothetical protein EUTSA_v10010806mg           74.7    2e-13   Eutrema salsugineum [saltwater cress]
ref|XP_011007089.1|  PREDICTED: uncharacterized protein LOC105112...  74.7    2e-13   Populus euphratica
ref|XP_011007079.1|  PREDICTED: uncharacterized protein LOC105112...  74.7    2e-13   Populus euphratica
gb|AFK44733.1|  unknown                                               74.7    3e-13   Lotus japonicus
ref|XP_011466764.1|  PREDICTED: uncharacterized protein LOC105352154  74.7    3e-13   Fragaria vesca subsp. vesca
ref|XP_010558990.1|  PREDICTED: uncharacterized protein LOC104827509  74.7    3e-13   Tarenaya hassleriana [spider flower]
ref|XP_007162900.1|  hypothetical protein PHAVU_001G189900g           74.7    4e-13   Phaseolus vulgaris [French bean]
ref|XP_006404461.1|  hypothetical protein EUTSA_v10011075mg           73.6    4e-13   Eutrema salsugineum [saltwater cress]
gb|EAZ23308.1|  hypothetical protein OsJ_07004                        74.3    6e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002523802.1|  conserved hypothetical protein                   73.2    6e-13   
ref|XP_006430209.1|  hypothetical protein CICLE_v10012842mg           73.9    7e-13   Citrus clementina [clementine]
ref|XP_009374766.1|  PREDICTED: uncharacterized protein LOC103963656  73.2    7e-13   Pyrus x bretschneideri [bai li]
ref|XP_006481780.1|  PREDICTED: uncharacterized protein LOC102625741  73.6    8e-13   Citrus sinensis [apfelsine]
gb|KDO70391.1|  hypothetical protein CISIN_1g042384mg                 71.2    9e-13   Citrus sinensis [apfelsine]
gb|EYU35484.1|  hypothetical protein MIMGU_mgv1a024452mg              72.4    1e-12   Erythranthe guttata [common monkey flower]
ref|XP_010535696.1|  PREDICTED: uncharacterized protein LOC104810919  72.8    1e-12   Tarenaya hassleriana [spider flower]
ref|NP_001239944.1|  uncharacterized protein LOC100792377             72.4    2e-12   Glycine max [soybeans]
ref|XP_006487941.1|  PREDICTED: uncharacterized protein LOC102609694  72.0    2e-12   Citrus sinensis [apfelsine]
ref|XP_007145301.1|  hypothetical protein PHAVU_007G227500g           71.6    2e-12   Phaseolus vulgaris [French bean]
dbj|BAJ89637.1|  predicted protein                                    71.6    2e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002528742.1|  conserved hypothetical protein                   71.6    3e-12   Ricinus communis
ref|XP_008389780.1|  PREDICTED: uncharacterized protein LOC103452045  71.2    4e-12   Malus domestica [apple tree]
ref|NP_001047026.1|  Os02g0532800                                     71.6    4e-12   
gb|EAY86148.1|  hypothetical protein OsI_07521                        71.6    4e-12   Oryza sativa Indica Group [Indian rice]
gb|KFK33881.1|  hypothetical protein AALP_AA5G072300                  70.5    5e-12   Arabis alpina [alpine rockcress]
gb|KHN14999.1|  hypothetical protein glysoja_037126                   71.2    5e-12   Glycine soja [wild soybean]
ref|XP_009366670.1|  PREDICTED: uncharacterized protein LOC103956416  70.9    5e-12   
ref|XP_009150271.1|  PREDICTED: uncharacterized protein LOC103873611  70.5    5e-12   Brassica rapa
ref|XP_008671321.1|  PREDICTED: uncharacterized protein LOC103648675  70.9    6e-12   Zea mays [maize]
ref|XP_003581199.1|  PREDICTED: uncharacterized protein LOC100823432  70.5    6e-12   Brachypodium distachyon [annual false brome]
tpg|DAA37922.1|  TPA: hypothetical protein ZEAMMB73_953930            70.9    6e-12   
ref|XP_003554435.1|  PREDICTED: uncharacterized protein LOC100793...  70.9    8e-12   
emb|CDP15409.1|  unnamed protein product                              70.9    8e-12   Coffea canephora [robusta coffee]
ref|XP_006424244.1|  hypothetical protein CICLE_v10029406mg           70.5    9e-12   Citrus clementina [clementine]
gb|KHN02226.1|  hypothetical protein glysoja_002250                   70.5    1e-11   Glycine soja [wild soybean]
ref|XP_006604638.1|  PREDICTED: uncharacterized protein LOC100793...  70.5    1e-11   
gb|ACU19002.1|  unknown                                               69.7    1e-11   Glycine max [soybeans]
ref|XP_003535631.2|  PREDICTED: uncharacterized protein LOC100815684  70.1    1e-11   Glycine max [soybeans]
ref|XP_006604637.1|  PREDICTED: uncharacterized protein LOC100793...  70.5    1e-11   
ref|XP_010514778.1|  PREDICTED: uncharacterized protein LOC104790697  70.1    1e-11   
ref|XP_009336972.1|  PREDICTED: uncharacterized protein LOC103929487  68.9    2e-11   Pyrus x bretschneideri [bai li]
ref|XP_004149256.1|  PREDICTED: uncharacterized protein LOC101217932  68.6    2e-11   
ref|NP_001143077.1|  uncharacterized protein LOC100275550             69.7    2e-11   Zea mays [maize]
gb|AFW58185.1|  hypothetical protein ZEAMMB73_804767                  69.7    2e-11   
ref|XP_002877340.1|  hypothetical protein ARALYDRAFT_484861           68.2    2e-11   Arabidopsis lyrata subsp. lyrata
ref|XP_010425861.1|  PREDICTED: uncharacterized protein LOC104710906  68.2    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_006576219.1|  PREDICTED: uncharacterized protein LOC100779...  69.3    3e-11   Glycine max [soybeans]
ref|NP_001242227.1|  uncharacterized protein LOC100779351             68.9    3e-11   
ref|XP_006292063.1|  hypothetical protein CARUB_v10018258mg           67.8    3e-11   Capsella rubella
ref|XP_006576217.1|  PREDICTED: uncharacterized protein LOC100779...  68.9    4e-11   Glycine max [soybeans]
gb|KHN18769.1|  hypothetical protein glysoja_021520                   68.6    4e-11   Glycine soja [wild soybean]
ref|XP_003625814.1|  hypothetical protein MTR_7g104540                68.6    4e-11   
ref|XP_004954965.1|  PREDICTED: uncharacterized protein LOC101759245  67.0    5e-11   Setaria italica
gb|KDP42745.1|  hypothetical protein JCGZ_23685                       68.9    5e-11   Jatropha curcas
emb|CAN69280.1|  hypothetical protein VITISV_023275                   68.2    5e-11   Vitis vinifera
emb|CDY30933.1|  BnaA06g19800D                                        67.4    6e-11   Brassica napus [oilseed rape]
ref|XP_006576216.1|  PREDICTED: uncharacterized protein LOC100779...  68.6    6e-11   Glycine max [soybeans]
ref|XP_003575071.1|  PREDICTED: uncharacterized protein LOC100845821  67.4    6e-11   Brachypodium distachyon [annual false brome]
ref|XP_010661366.1|  PREDICTED: uncharacterized protein LOC104881801  68.2    6e-11   Vitis vinifera
ref|XP_010503097.1|  PREDICTED: uncharacterized protein LOC104780294  67.0    6e-11   Camelina sativa [gold-of-pleasure]
emb|CAN80332.1|  hypothetical protein VITISV_018276                   68.2    7e-11   Vitis vinifera
ref|XP_006826648.1|  hypothetical protein AMTR_s00139p00102470        67.0    9e-11   Amborella trichopoda
ref|XP_010654082.1|  PREDICTED: uncharacterized protein LOC104880149  67.4    1e-10   
ref|XP_008784230.1|  PREDICTED: pentatricopeptide repeat-containi...  70.9    1e-10   
ref|XP_009617401.1|  PREDICTED: uncharacterized protein LOC104109751  67.0    1e-10   Nicotiana tomentosiformis
ref|XP_006576215.1|  PREDICTED: uncharacterized protein LOC100779...  67.8    1e-10   
ref|NP_190031.1|  uncharacterized protein                             65.9    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002446410.1|  hypothetical protein SORBIDRAFT_06g015560        67.4    1e-10   
ref|XP_008442840.1|  PREDICTED: uncharacterized protein LOC103486607  66.6    1e-10   Cucumis melo [Oriental melon]
gb|KJB16115.1|  hypothetical protein B456_002G240200                  65.9    2e-10   Gossypium raimondii
ref|XP_008809927.1|  PREDICTED: uncharacterized protein LOC103721474  65.5    2e-10   
ref|XP_008458586.1|  PREDICTED: uncharacterized protein LOC103497945  65.1    3e-10   Cucumis melo [Oriental melon]
ref|XP_006341142.1|  PREDICTED: uncharacterized protein LOC102585102  65.9    3e-10   
ref|XP_009796861.1|  PREDICTED: uncharacterized protein LOC104243376  65.9    3e-10   Nicotiana sylvestris
ref|XP_004161241.1|  PREDICTED: uncharacterized protein LOC101223869  64.3    3e-10   
gb|KGN59130.1|  hypothetical protein Csa_3G776900                     65.9    3e-10   
ref|XP_008809941.1|  PREDICTED: uncharacterized protein LOC103721477  64.7    4e-10   Phoenix dactylifera
gb|ACA35272.1|  unknown protein                                       66.2    4e-10   Cucumis sativus [cucumbers]
ref|XP_004487496.1|  PREDICTED: uncharacterized protein LOC101505815  65.1    4e-10   Cicer arietinum [garbanzo]
ref|XP_010036690.1|  PREDICTED: uncharacterized protein LOC104425646  65.1    6e-10   Eucalyptus grandis [rose gum]
ref|XP_004975560.1|  PREDICTED: uncharacterized protein LOC101762913  65.1    7e-10   Setaria italica
ref|XP_002452201.1|  hypothetical protein SORBIDRAFT_04g021680        64.7    9e-10   Sorghum bicolor [broomcorn]
ref|XP_011077929.1|  PREDICTED: proline-rich transmembrane protei...  64.3    1e-09   Sesamum indicum [beniseed]
ref|XP_007150069.1|  hypothetical protein PHAVU_005G123800g           63.5    1e-09   Phaseolus vulgaris [French bean]
emb|CAH67161.1|  H0717B12.8                                           64.3    1e-09   Oryza sativa [red rice]
gb|EAY94030.1|  hypothetical protein OsI_15808                        64.3    1e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_004246546.1|  PREDICTED: uncharacterized protein LOC101264052  63.5    1e-09   
gb|KCW74171.1|  hypothetical protein EUGRSUZ_E02817                   63.9    2e-09   Eucalyptus grandis [rose gum]
ref|NP_001052737.1|  Os04g0412100                                     64.3    2e-09   
gb|EAZ30668.1|  hypothetical protein OsJ_14724                        63.9    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010907937.1|  PREDICTED: uncharacterized protein LOC105034456  62.8    2e-09   
gb|KEH42025.1|  hypothetical protein MTR_1g059990                     61.6    5e-09   Medicago truncatula
ref|NP_001241197.1|  uncharacterized protein LOC100810928             61.2    8e-09   Glycine max [soybeans]
ref|XP_004494175.1|  PREDICTED: uncharacterized protein LOC101508...  62.4    8e-09   Cicer arietinum [garbanzo]
ref|XP_004494053.1|  PREDICTED: uncharacterized protein LOC101497497  60.8    9e-09   
emb|CCH47172.1|  hypothetical protein                                 60.8    1e-08   Lupinus angustifolius
ref|XP_003596820.1|  Soft fertilization envelope protein              62.8    2e-08   
ref|NP_001238535.1|  uncharacterized protein LOC100500466             58.5    7e-08   Glycine max [soybeans]
ref|NP_001142972.1|  uncharacterized protein LOC100275425             58.2    2e-07   
ref|NP_001142587.1|  uncharacterized protein LOC100274851             58.2    2e-07   Zea mays [maize]
ref|XP_008681577.1|  PREDICTED: uncharacterized protein LOC100274...  57.4    8e-07   
gb|KGN48263.1|  hypothetical protein Csa_6G452640                     54.7    1e-06   Cucumis sativus [cucumbers]
gb|EPS58384.1|  hypothetical protein M569_16431                       50.1    3e-05   Genlisea aurea



>ref|XP_009795844.1| PREDICTED: uncharacterized protein LOC104242489 [Nicotiana sylvestris]
Length=138

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 59/78 (76%), Gaps = 3/78 (4%)
 Frame = -3

Query  317  PENVAAAPEKE--HSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPK  144
            PE +A   E+    SGREKLKRHWT+V GRV VP EKWGQEG LREWMDYSSFD  LAPK
Sbjct  48   PEKLARGQEEGPLLSGREKLKRHWTKVGGRVFVP-EKWGQEGNLREWMDYSSFDTLLAPK  106

Query  143  GLLSAREDLISQAKRVCS  90
            GL SARE LISQ KR  S
Sbjct  107  GLNSAREALISQGKRAPS  124



>ref|XP_010313363.1| PREDICTED: uncharacterized protein LOC104644771 [Solanum lycopersicum]
Length=168

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            SGREKLKRHW EV GRV VP ++WG EG LREWMD SSFD  LAPKGL SARE L+SQ K
Sbjct  94   SGREKLKRHWREVGGRVFVP-DRWGHEGSLREWMDCSSFDNILAPKGLKSAREALMSQGK  152

Query  101  RVCS  90
            R  S
Sbjct  153  RARS  156



>ref|XP_002312817.2| hypothetical protein POPTR_0009s16560g [Populus trichocarpa]
 gb|EEE86772.2| hypothetical protein POPTR_0009s16560g [Populus trichocarpa]
Length=159

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            +GRE+LKRH  EV+G+V++P E WGQE LL +W+DYSSFD  LAP G+ SARE LI++ +
Sbjct  90   TGRERLKRHREEVSGKVMIP-ETWGQEDLLTDWIDYSSFDKLLAPDGITSAREALIAEGR  148

Query  101  RVCST  87
            R C++
Sbjct  149  RACTS  153



>gb|KJB55629.1| hypothetical protein B456_009G085900 [Gossypium raimondii]
Length=143

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            SGRE+LKRH  EVAGRVLVP +KWG+E LL++WMDYSSFD+ LAP GL SAR+ L+++ +
Sbjct  71   SGRERLKRHREEVAGRVLVP-DKWGKEELLKDWMDYSSFDSLLAPTGLASARKALMTEGR  129

Query  101  RVCS  90
            R  S
Sbjct  130  RSSS  133



>emb|CDP06927.1| unnamed protein product [Coffea canephora]
Length=108

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = -3

Query  293  EKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLI  114
            ++E SGREKL RHW EVAGRV +P E WGQE  L +WMD S FD+ LAPKG +SARE LI
Sbjct  7    QQEESGREKLFRHWNEVAGRVCIP-EIWGQEASLNDWMDCSLFDSLLAPKGAVSAREALI  65

Query  113  SQAKR  99
            ++ KR
Sbjct  66   AERKR  70



>ref|XP_009347784.1| PREDICTED: uncharacterized protein LOC103939425 [Pyrus x bretschneideri]
Length=137

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = -3

Query  305  AAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAR  126
             + P+  +SGRE+LKRH  EVAG V++P + WGQE LL++W+DYS FDA L PKGL SAR
Sbjct  56   VSNPQTGNSGRERLKRHQEEVAGHVVIP-DSWGQEELLKDWIDYSPFDALLVPKGLTSAR  114

Query  125  EDLISQAKRVCST  87
            E L  + +R  ++
Sbjct  115  EALAMEGRRATTS  127



>ref|XP_007015821.1| Uncharacterized protein TCM_041417 [Theobroma cacao]
 gb|EOY33440.1| Uncharacterized protein TCM_041417 [Theobroma cacao]
Length=155

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 61/93 (66%), Gaps = 1/93 (1%)
 Frame = -3

Query  350  SPVAATRDVAMPENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYS  171
            S V   R  A   N A    ++ SGRE+LKRH  EVAGRVL+P +KWG+E LL++W+DY 
Sbjct  61   SSVLVPRGHASDGNDAVEALQKDSGRERLKRHREEVAGRVLIP-DKWGKEELLKDWIDYP  119

Query  170  SFDACLAPKGLLSAREDLISQAKRVCSTVFKSQ  72
            SFD+ LAP GL SAR+ L+ + +R  S   + Q
Sbjct  120  SFDSLLAPNGLASARKALMMEGRRNGSQRLRIQ  152



>ref|XP_008351289.1| PREDICTED: uncharacterized protein LOC103414699 [Malus domestica]
Length=137

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = -3

Query  305  AAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAR  126
             + P+  +SGRE+LKRH  EVAG V++P + WGQE LL++W+DYS FDA L PKGL SAR
Sbjct  56   VSNPQMGNSGRERLKRHQEEVAGHVVIP-DSWGQEELLKDWIDYSPFDALLVPKGLTSAR  114

Query  125  EDLISQAKRVCST  87
            E L  + +R  ++
Sbjct  115  EALAMEGRRATTS  127



>ref|XP_002523800.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38526.1| conserved hypothetical protein [Ricinus communis]
Length=166

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            +GRE+LKRH  EVAG V +P +KW QE LLR+WMDYSSFD  LAPKGL  ARE LI++A 
Sbjct  91   NGRERLKRHREEVAGEVRIP-DKWSQESLLRDWMDYSSFDKLLAPKGLSLAREALIAEAH  149

Query  101  RVCST  87
            R  S+
Sbjct  150  RGGSS  154



>ref|XP_002877881.1| hypothetical protein ARALYDRAFT_485645 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54140.1| hypothetical protein ARALYDRAFT_485645 [Arabidopsis lyrata subsp. 
lyrata]
Length=138

 Score = 84.0 bits (206),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 62/92 (67%), Gaps = 3/92 (3%)
 Frame = -3

Query  359  ECDSPVAATRDVAMPENVAAAPEKEH--SGREKLKRHWTEVAGRVLVPPEKWGQEGLLRE  186
            E  S V+  +D+A+PE      E+E   +GRE+LK+H  E+AGRV +P E WGQE LL++
Sbjct  35   EAASYVSDKKDLALPEEKPKQNEEERVDTGRERLKKHRREIAGRVWIP-EIWGQEELLKD  93

Query  185  WMDYSSFDACLAPKGLLSAREDLISQAKRVCS  90
            W+D S+FD CL P G+ SAR  L+ +A+R  S
Sbjct  94   WIDCSTFDTCLVPAGISSARAALVEEARRAAS  125



>emb|CDX95368.1| BnaC04g27900D [Brassica napus]
Length=134

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = -3

Query  344  VAATRDVAMPENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSF  165
            V+  +D A+PE      ++   GR+KLK+H  E+AGRV +P E+WGQE LL++W+D S F
Sbjct  38   VSDKKDQALPEEKPKQNQEAIIGRDKLKQHRREMAGRVWIP-ERWGQEDLLKDWIDCSKF  96

Query  164  DACLAPKGLLSAREDLISQAKRVCS  90
            D CL P G+ SAR  L+ +A+R  S
Sbjct  97   DTCLVPNGISSARSALVEEARRAAS  121



>ref|XP_002523801.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38527.1| conserved hypothetical protein [Ricinus communis]
Length=168

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 1/61 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            +GRE+LKRH  EVAG V +P +KW QE LLR+WMDYSSFD  LAP+GL  ARE LI++A+
Sbjct  89   NGRERLKRHREEVAGEVRIP-DKWSQESLLRDWMDYSSFDKLLAPEGLGLAREALITEAR  147

Query  101  R  99
            R
Sbjct  148  R  148



>ref|XP_009379801.1| PREDICTED: uncharacterized protein LOC103968354 [Musa acuminata 
subsp. malaccensis]
Length=133

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = -3

Query  287  EHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQ  108
            E SGRE+LKRH TE+AGRV +P E WGQE LL++W+D S FD  L PKGL+SARE L+ +
Sbjct  60   EESGRERLKRHRTEMAGRVWIP-EIWGQESLLKDWIDSSVFDRPLVPKGLVSAREALVEE  118

Query  107  AKRVCS  90
             +R  S
Sbjct  119  CRRTSS  124



>ref|XP_006384815.1| hypothetical protein POPTR_0004s21320g [Populus trichocarpa]
 gb|ERP62612.1| hypothetical protein POPTR_0004s21320g [Populus trichocarpa]
Length=159

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 49/60 (82%), Gaps = 1/60 (2%)
 Frame = -3

Query  278  GREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAKR  99
            GRE+LKRH  EV+G+V++P + WGQE LL +W+DYSSFD  LAPKG+ SARE L+++ +R
Sbjct  87   GRERLKRHREEVSGKVMIP-DTWGQENLLTDWIDYSSFDKLLAPKGITSAREALVAEGRR  145



>gb|KFK34522.1| hypothetical protein AALP_AA5G156800 [Arabis alpina]
Length=139

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = -3

Query  287  EHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQ  108
            EH+GRE+LK+H  E+AGRV +P E WGQE LL++W+D S+FD CL P G+ SAR  L+ +
Sbjct  62   EHTGRERLKKHRREIAGRVWIP-EIWGQEELLKDWIDCSTFDTCLVPAGISSARAALVEE  120

Query  107  AKRVCS  90
            A+R  S
Sbjct  121  ARRAAS  126



>ref|XP_007206836.1| hypothetical protein PRUPE_ppa027026mg [Prunus persica]
 gb|EMJ08035.1| hypothetical protein PRUPE_ppa027026mg [Prunus persica]
Length=91

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = -3

Query  302  AAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSARE  123
             A  +  SGRE+LKRH  EVAGRV +P + W QE LL++W+DYS FDA L PKGL SARE
Sbjct  11   GADHQVQSGRERLKRHQEEVAGRVTIP-DSWDQEELLKDWIDYSPFDALLVPKGLTSARE  69

Query  122  DLISQAKRVCST  87
             L  + +R  S+
Sbjct  70   ALAMEGRRASSS  81



>emb|CDY23232.1| BnaA04g05270D [Brassica napus]
Length=137

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 65/104 (63%), Gaps = 4/104 (4%)
 Frame = -3

Query  392  SPRAQKAAAMMECDSPVAATRDVAMPE---NVAAAPEKEHSGREKLKRHWTEVAGRVLVP  222
            S ++Q+  ++    S V+  +D A+PE         E+  +GREKLK H  E+AGRV +P
Sbjct  22   SDQSQQEPSLTNEASSVSDKKDQALPEEKPKQNQENERAVTGREKLKHHRREMAGRVWIP  81

Query  221  PEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAKRVCS  90
             E WGQE LL++W+D S+FD CL P G+ SAR  L+ +A+R  S
Sbjct  82   -EIWGQEELLKDWIDCSTFDTCLVPNGISSARAALVEEARRAAS  124



>ref|XP_009148738.1| PREDICTED: uncharacterized protein LOC103872141 [Brassica rapa]
Length=137

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 65/104 (63%), Gaps = 4/104 (4%)
 Frame = -3

Query  392  SPRAQKAAAMMECDSPVAATRDVAMPE---NVAAAPEKEHSGREKLKRHWTEVAGRVLVP  222
            S ++Q+  ++    S V+  +D A+PE         E+  +GREKLK H  E+AGRV +P
Sbjct  22   SDQSQQEPSLTNEASSVSDKKDQALPEEKPKQNQENERAVTGREKLKHHRREMAGRVWIP  81

Query  221  PEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAKRVCS  90
             E WGQE LL++W+D S+FD CL P G+ SAR  L+ +A+R  S
Sbjct  82   -EIWGQEELLKDWIDCSTFDTCLVPNGISSARAALVEEARRAAS  124



>ref|XP_010515747.1| PREDICTED: uncharacterized protein LOC104791529 [Camelina sativa]
Length=146

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 60/94 (64%), Gaps = 5/94 (5%)
 Frame = -3

Query  359  ECDSPVAATRDVAMPENVAAAPEKEH----SGREKLKRHWTEVAGRVLVPPEKWGQEGLL  192
            E  S V+  +D+ +PE       +E     SGRE+LK+H  E+AGRV +P E WGQE LL
Sbjct  38   EAASSVSEEKDLTLPEEKKPKQNQEEERVDSGRERLKKHRKEIAGRVWIP-EIWGQEELL  96

Query  191  REWMDYSSFDACLAPKGLLSAREDLISQAKRVCS  90
            ++W+D S+FD CL P G+ SAR  L+ +A+R  +
Sbjct  97   KDWIDCSTFDTCLVPAGISSARAALVEEARRAAT  130



>ref|XP_010507412.1| PREDICTED: uncharacterized protein LOC104784033, partial [Camelina 
sativa]
Length=144

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 60/94 (64%), Gaps = 5/94 (5%)
 Frame = -3

Query  359  ECDSPVAATRDVAMPENVAAAPEKEH----SGREKLKRHWTEVAGRVLVPPEKWGQEGLL  192
            E  S V+  +D+A PE       +E     SGRE+LK+H  E+AGRV +P E WGQE LL
Sbjct  38   EAASSVSDKKDLASPEEKKPKQNQEEERVDSGRERLKKHRKEIAGRVWIP-EIWGQEELL  96

Query  191  REWMDYSSFDACLAPKGLLSAREDLISQAKRVCS  90
            ++W+D S+FD CL P G+ SAR  L+ +A+R  +
Sbjct  97   KDWIDCSTFDTCLVPAGISSARAALVEEARRAAT  130



>gb|EYU38632.1| hypothetical protein MIMGU_mgv1a026837mg [Erythranthe guttata]
Length=147

 Score = 81.3 bits (199),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 62/109 (57%), Gaps = 9/109 (8%)
 Frame = -3

Query  383  AQKAAAMMECDSPVAATRDVAMPENVAAAPEKEH--------SGREKLKRHWTEVAGRVL  228
            AQK +   + D  +A     ++P +   AP K          SGREKL++H  EVAGRV 
Sbjct  34   AQKGSKNSKSDEDLAQRNSSSLPTSSITAPTKSEGTVEGSNSSGREKLRKHRVEVAGRVW  93

Query  227  VPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAKRVCSTVF  81
            +P E WGQE  L++W+D + FD+ LA   ++SAR  L+ + +R  ST F
Sbjct  94   IP-EMWGQEAFLKDWIDSTVFDSKLANSSIMSARVSLVEEGRRPNSTAF  141



>ref|XP_002275909.1| PREDICTED: uncharacterized protein LOC100246831 [Vitis vinifera]
Length=127

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 53/67 (79%), Gaps = 2/67 (3%)
 Frame = -3

Query  287  EHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQ  108
            + S R++L+RHW+EV G+VL+P +KWG+E LL+EW+DYSSFDA LAP G+  ARE L++ 
Sbjct  54   QDSVRQRLRRHWSEVGGKVLIP-DKWGKEDLLKEWIDYSSFDALLAPNGIGVAREALVA-  111

Query  107  AKRVCST  87
            A R  ST
Sbjct  112  AGRGAST  118



>ref|XP_006293211.1| hypothetical protein CARUB_v10019532mg [Capsella rubella]
 gb|EOA26109.1| hypothetical protein CARUB_v10019532mg [Capsella rubella]
Length=151

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 59/94 (63%), Gaps = 8/94 (9%)
 Frame = -3

Query  350  SPVAATRDVAMPENVAAAPEKEH-------SGREKLKRHWTEVAGRVLVPPEKWGQEGLL  192
            S V+  +D A+P+     P +         SGRE+LK+H  E+AGRV +P E WGQE LL
Sbjct  43   SSVSDKKDPALPQEEKPKPRQNQEEERVVDSGRERLKKHRREIAGRVWIP-EIWGQEELL  101

Query  191  REWMDYSSFDACLAPKGLLSAREDLISQAKRVCS  90
            ++W+D S+FD CL P G+ SAR  L+ +A+R  S
Sbjct  102  KDWIDCSTFDTCLVPAGISSARAALVEEARRAAS  135



>ref|XP_010045208.1| PREDICTED: uncharacterized protein LOC104433977 [Eucalyptus grandis]
 gb|KCW87372.1| hypothetical protein EUGRSUZ_B03851 [Eucalyptus grandis]
Length=176

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            SGREKLKRH  EVAGRV +P + WGQE  L++WMDYS+FD  LAP+G+  ARE L+++ +
Sbjct  100  SGREKLKRHRDEVAGRVPIP-DSWGQESFLKDWMDYSAFDTLLAPRGIAPAREALMAEGR  158

Query  101  R  99
            R
Sbjct  159  R  159



>emb|CAN67239.1| hypothetical protein VITISV_004804 [Vitis vinifera]
Length=920

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 56/78 (72%), Gaps = 8/78 (10%)
 Frame = -3

Query  287  EHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLI--  114
            + S R++L+RHW+EV G+VL+P +KWG+E LL+EW+DYSSFDA LAP G+  ARE L+  
Sbjct  715  QDSVRQRLRRHWSEVGGKVLIP-DKWGKEDLLKEWIDYSSFDALLAPNGIGVAREALVAA  773

Query  113  -----SQAKRVCSTVFKS  75
                 +Q  R+ S+  +S
Sbjct  774  GRGASTQGLRISSSKLQS  791



>ref|XP_008787843.1| PREDICTED: uncharacterized protein LOC103705767 [Phoenix dactylifera]
Length=151

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = -3

Query  362  MECDSPVAATRDVAMPENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREW  183
            +EC +   +++     E  +  P  E  GREKLKRH  E+AGRV +P EKWGQE LL++W
Sbjct  53   IECYNNPESSQSEIPTEASSKGPSVEDCGREKLKRHRMEMAGRVWIP-EKWGQESLLKDW  111

Query  182  MDYSSFDACLAPKGLLSAREDLISQAKRVCSTVFK  78
             D ++FD  L PKGL  ARE L+ + +RV S   +
Sbjct  112  ADCAAFDRSLVPKGLTLAREALMDERRRVNSGQLR  146



>ref|XP_008228608.1| PREDICTED: uncharacterized protein LOC103327996 [Prunus mume]
Length=138

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            SGRE+LK+H  EVAGRV +P + W QE LL++W+DYS FDA L PKGL SARE L  + +
Sbjct  65   SGRERLKKHQEEVAGRVAIP-DSWDQEELLKDWIDYSPFDALLVPKGLTSAREALAMEGR  123

Query  101  RVCST  87
            R  S+
Sbjct  124  RASSS  128



>ref|XP_009115970.1| PREDICTED: uncharacterized protein LOC103841203 [Brassica rapa]
Length=138

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 55/83 (66%), Gaps = 4/83 (5%)
 Frame = -3

Query  329  DVAMPENVAAAPEKEH---SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDA  159
            D A PE      ++E    +GREKLK+H  +VAGRV +P + WGQE LL++W+D S+FD 
Sbjct  44   DQAFPEETPKQNQEEERVDTGREKLKKHRRDVAGRVWIP-DIWGQEELLKDWIDCSTFDT  102

Query  158  CLAPKGLLSAREDLISQAKRVCS  90
            CL P G+ SAR  L+ +A+R  S
Sbjct  103  CLVPAGISSARAALVDEARRAAS  125



>gb|KDP33126.1| hypothetical protein JCGZ_13573 [Jatropha curcas]
Length=141

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 54/86 (63%), Gaps = 1/86 (1%)
 Frame = -3

Query  350  SPVAATRDVAMPENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYS  171
            S  ++ R      N   A  K+  GRE+LKRH  EVAG+V +P E W QE  L++W+DYS
Sbjct  56   SSFSSPRRHVHQSNDNEASRKDFVGRERLKRHREEVAGQVSIP-ETWSQENFLKDWVDYS  114

Query  170  SFDACLAPKGLLSAREDLISQAKRVC  93
            SFD  LAP G+ SAR+ L+++ +R  
Sbjct  115  SFDNLLAPNGIASARQALMAEGRRAS  140



>ref|XP_010244926.1| PREDICTED: uncharacterized protein LOC104588614 [Nelumbo nucifera]
Length=160

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 60/97 (62%), Gaps = 3/97 (3%)
 Frame = -3

Query  377  KAAAMMECDSPVAATRDVAMPENVAAAPE-KEHSGREKLKRHWTEVAGRVLVPPEKWGQE  201
            +  A  +C SP A   +V   E V   P   E SGRE+LKRH  E+AGRV +P E WGQE
Sbjct  30   RPVAESQCPSPTAVV-NVVQKEPVNVDPSVPEVSGRERLKRHRIEMAGRVWIP-EIWGQE  87

Query  200  GLLREWMDYSSFDACLAPKGLLSAREDLISQAKRVCS  90
              L++W+D S+F++ L P GL+SAR  LI ++ R  S
Sbjct  88   DFLKDWIDSSAFNSSLVPNGLMSARAALIEESHRANS  124



>ref|XP_011459330.1| PREDICTED: uncharacterized protein LOC105349931 [Fragaria vesca 
subsp. vesca]
Length=128

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 4/76 (5%)
 Frame = -3

Query  314  ENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLL  135
            +N++AA   E SGRE+LKRH  EVAG V +P + WGQE LL++W+DYS FDA L P GL 
Sbjct  44   QNMSAA---ECSGRERLKRHQEEVAGHVTIP-DSWGQEELLKDWIDYSPFDALLVPTGLS  99

Query  134  SAREDLISQAKRVCST  87
            SARE L  + +R  S 
Sbjct  100  SAREALAMEGRRRASN  115



>ref|XP_010271656.1| PREDICTED: uncharacterized protein LOC104607675 [Nelumbo nucifera]
Length=177

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 57/91 (63%), Gaps = 2/91 (2%)
 Frame = -3

Query  362  MECDSPVAATRDVAMPENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREW  183
            M+  SP   T  V   E +      E SGRE+LKRH TEVAG V VP + WGQE LL++W
Sbjct  80   MQGPSPTTTTIGVKT-ETINTCASMEVSGRERLKRHRTEVAGHVWVP-DIWGQEDLLKDW  137

Query  182  MDYSSFDACLAPKGLLSAREDLISQAKRVCS  90
            +D S+F++ L P GL+SAR  LI + +R  S
Sbjct  138  IDCSAFNSSLVPNGLMSARAALIEENRRANS  168



>emb|CDX73609.1| BnaC08g23940D [Brassica napus]
Length=138

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 61/100 (61%), Gaps = 4/100 (4%)
 Frame = -3

Query  380  QKAAAMMECDSPVAATRDVAMPENVAAAPEKEH---SGREKLKRHWTEVAGRVLVPPEKW  210
            Q  ++  E  S      D A+PE      ++E    +GREKLK+H  +VAGRV +P + W
Sbjct  27   QDPSSPNEASSVTDKKEDQALPEEKPKQNQEEERVDTGREKLKKHRRDVAGRVWIP-DIW  85

Query  209  GQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAKRVCS  90
            GQE LL++W+D S+FD CL P G+ SAR  L+ +A+R  S
Sbjct  86   GQEELLKDWIDCSTFDTCLVPAGISSARAALVDEARRAAS  125



>ref|XP_010101569.1| hypothetical protein L484_015393 [Morus notabilis]
 gb|EXB88708.1| hypothetical protein L484_015393 [Morus notabilis]
Length=164

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = -3

Query  290  KEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLIS  111
            +E + RE+LKRH  EVAGRV +P + WGQE LL++W+D S+FDACL PK ++SARE L+ 
Sbjct  90   EEDNERERLKRHRIEVAGRVWIP-DIWGQEDLLKDWIDCSAFDACLVPKEIMSAREALVE  148

Query  110  QAKRVCSTVFK  78
            + +R  S   +
Sbjct  149  EGRRATSGRLR  159



>emb|CDX78120.1| BnaA09g33150D [Brassica napus]
Length=138

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 55/83 (66%), Gaps = 4/83 (5%)
 Frame = -3

Query  329  DVAMPENVAAAPEKEH---SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDA  159
            D A PE      ++E    +GREKLK+H  +VAGRV +P + WGQE LL++W+D S+FD 
Sbjct  44   DQAFPEEKPKQNQEEERVDTGREKLKKHRRDVAGRVWIP-DIWGQEELLKDWIDCSTFDT  102

Query  158  CLAPKGLLSAREDLISQAKRVCS  90
            CL P G+ SAR  L+ +A+R  S
Sbjct  103  CLVPAGISSARAALVDEARRAAS  125



>ref|XP_010426895.1| PREDICTED: uncharacterized protein LOC104711823 [Camelina sativa]
Length=146

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = -3

Query  293  EKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLI  114
            E+  SGRE+LK+H  E+AGRV +P E WGQE LL++W+D S+FD CL P G+ SAR  L+
Sbjct  64   ERLDSGRERLKKHRKEIAGRVWIP-EIWGQEELLKDWIDCSTFDTCLVPAGISSARAALV  122

Query  113  SQAKRVCS  90
             +A+R  +
Sbjct  123  EEARRAAT  130



>ref|XP_007202690.1| hypothetical protein PRUPE_ppa012609mg [Prunus persica]
 gb|EMJ03889.1| hypothetical protein PRUPE_ppa012609mg [Prunus persica]
Length=161

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 52/73 (71%), Gaps = 5/73 (7%)
 Frame = -3

Query  317  PENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGL  138
            P NVA     E SGRE+LK+H  EVAG+V +P + WGQE LL++WMD S+FDA L P G+
Sbjct  82   PSNVA----DEDSGRERLKKHRVEVAGQVWIP-DIWGQEELLKDWMDCSAFDASLFPSGI  136

Query  137  LSAREDLISQAKR  99
            +SAR  LI + +R
Sbjct  137  MSARSALIEEGRR  149



>ref|XP_008241235.1| PREDICTED: uncharacterized protein LOC103339680 [Prunus mume]
Length=171

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 5/76 (7%)
 Frame = -3

Query  317  PENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGL  138
            P NVA     E SGRE+LK+H  EVAGRV +P + WGQE LL++W+D S+FDA L P G+
Sbjct  82   PSNVA----DEDSGRERLKKHRVEVAGRVWIP-DIWGQEELLQDWIDCSAFDASLFPSGI  136

Query  137  LSAREDLISQAKRVCS  90
            +SAR  LI + +R  S
Sbjct  137  MSARSALIEEGRRQNS  152



>ref|NP_566972.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL38610.1|AF446877_1 AT3g52740/F3C22_140 [Arabidopsis thaliana]
 emb|CAB89235.1| putative protein [Arabidopsis thaliana]
 gb|AAK96599.1| AT3g52740/F3C22_140 [Arabidopsis thaliana]
 gb|AEE78988.1| uncharacterized protein AT3G52740 [Arabidopsis thaliana]
Length=140

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 58/87 (67%), Gaps = 4/87 (5%)
 Frame = -3

Query  341  AATRDVAMPENVAAAPEKEH---SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYS  171
            A  +D+A+ E      ++E    +GRE+LK+H  E+AGRV +P E WGQE LL++W+D S
Sbjct  42   ADKKDLALLEEKPKQSQEEDRVDTGRERLKKHRREIAGRVWIP-EIWGQEELLKDWIDCS  100

Query  170  SFDACLAPKGLLSAREDLISQAKRVCS  90
            +FD CL P G+ SAR  L+ +A+R  S
Sbjct  101  TFDTCLVPAGISSARTALVEEARRAAS  127



>gb|KJB62152.1| hypothetical protein B456_009G403000 [Gossypium raimondii]
Length=174

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = -3

Query  344  VAATRDVAMPENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSF  165
            V A  +V   E + A   +E +GREKLKRH  EVAG V +P + WGQE LL++W+D S+F
Sbjct  52   VGADHEVKEEEAMRADESEEDNGREKLKRHRIEVAGNVWIP-DIWGQEELLKDWIDCSAF  110

Query  164  DACLAPKGLLSAREDLISQAKRVCSTVFK  78
            +  L P G++SAR  L+ + +R  S  F+
Sbjct  111  NDSLVPHGIMSARAALVEEGRRANSGGFR  139



>ref|XP_009390031.1| PREDICTED: uncharacterized protein LOC103976522 [Musa acuminata 
subsp. malaccensis]
Length=145

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 57/84 (68%), Gaps = 3/84 (4%)
 Frame = -3

Query  341  AATRDVAMPENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFD  162
            A + +VAM E V A   +E SGRE+LKRH  E+AGRV +P E WGQE  L++W+D S FD
Sbjct  56   ACSTEVAM-ERVGAHAAEE-SGRERLKRHRMEMAGRVWIP-ETWGQENRLKDWIDSSVFD  112

Query  161  ACLAPKGLLSAREDLISQAKRVCS  90
              L PKGL+SARE L+   +R  S
Sbjct  113  RPLVPKGLVSAREALVEACRRTSS  136



>ref|XP_010507411.1| PREDICTED: uncharacterized protein LOC104784032, partial [Camelina 
sativa]
Length=95

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = -3

Query  293  EKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLI  114
            E+  SGRE+LK+H  E+AGRV +P E WGQE LL++W+D S+FD CL P G+ SAR  L+
Sbjct  13   ERVDSGRERLKKHRKEIAGRVWIP-EIWGQEELLKDWIDCSTFDTCLVPAGISSARAALV  71

Query  113  SQAKRVCS  90
             +A+R  +
Sbjct  72   EEARRAAT  79



>ref|XP_006384813.1| hypothetical protein POPTR_0004s21310g [Populus trichocarpa]
 gb|ERP62610.1| hypothetical protein POPTR_0004s21310g [Populus trichocarpa]
Length=147

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -3

Query  278  GREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAKR  99
            GRE+LKRH  EVAGRV++P + WGQE LL++W+D S+FD  LAPK + SARE L+++ +R
Sbjct  79   GRERLKRHREEVAGRVMIP-DTWGQENLLKDWIDCSTFDELLAPKEISSAREALVAEERR  137



>ref|XP_006384814.1| hypothetical protein POPTR_0004s21310g [Populus trichocarpa]
 gb|ERP62611.1| hypothetical protein POPTR_0004s21310g [Populus trichocarpa]
Length=190

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -3

Query  278  GREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAKR  99
            GRE+LKRH  EVAGRV++P + WGQE LL++W+D S+FD  LAPK + SARE L+++ +R
Sbjct  120  GRERLKRHREEVAGRVMIP-DTWGQENLLKDWIDCSTFDELLAPKEISSAREALVAEERR  178



>ref|XP_007027734.1| Uncharacterized protein TCM_022582 [Theobroma cacao]
 gb|EOY08236.1| Uncharacterized protein TCM_022582 [Theobroma cacao]
Length=169

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 51/71 (72%), Gaps = 1/71 (1%)
 Frame = -3

Query  290  KEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLIS  111
            +E +GRE+L+RH  EVAGRV +P E WGQE LL++W+D S+F+A L P G++SAR  LI 
Sbjct  95   EEENGRERLRRHRIEVAGRVWIP-EIWGQEQLLKDWIDCSAFEASLVPSGIMSARAALIE  153

Query  110  QAKRVCSTVFK  78
            + +   S  F+
Sbjct  154  EGRTANSGRFR  164



>ref|XP_010527628.1| PREDICTED: uncharacterized protein LOC104804934 [Tarenaya hassleriana]
Length=172

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            +GREKL RH  +VAGRV +P E WGQE  L++W+D S+FD+CL P G+ SAR  L+ +A+
Sbjct  96   NGREKLNRHRRQVAGRVWIP-EIWGQEEFLKDWIDCSTFDSCLVPTGISSARSALVEEAR  154

Query  101  RVCST  87
            R  S 
Sbjct  155  RASSN  159



>ref|XP_002312818.1| hypothetical protein POPTR_0009s16550g [Populus trichocarpa]
 gb|ABK95162.1| unknown [Populus trichocarpa]
 gb|EEE86773.1| hypothetical protein POPTR_0009s16550g [Populus trichocarpa]
Length=139

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            SGRE+LK+H  EVAGRV++P + WGQE  L++W+D S+FD  LAP G+ SARE L+++ +
Sbjct  68   SGRERLKKHREEVAGRVMIP-DTWGQEDSLKDWIDCSAFDELLAPNGISSARESLVAEGR  126

Query  101  RVCS  90
            +  S
Sbjct  127  KGSS  130



>ref|XP_006379365.1| hypothetical protein POPTR_0009s16550g [Populus trichocarpa]
 gb|ERP57162.1| hypothetical protein POPTR_0009s16550g [Populus trichocarpa]
Length=156

 Score = 76.3 bits (186),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            SGRE+LK+H  EVAGRV++P + WGQE  L++W+D S+FD  LAP G+ SARE L+++ +
Sbjct  68   SGRERLKKHREEVAGRVMIP-DTWGQEDSLKDWIDCSAFDELLAPNGISSARESLVAEGR  126

Query  101  R  99
            +
Sbjct  127  K  127



>ref|XP_011000930.1| PREDICTED: uncharacterized protein LOC105108346 [Populus euphratica]
Length=140

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            SGRE+LK+H  EVAGRV++P + WGQE  L++W+D S+FD  LAP G+ SARE L+++ +
Sbjct  69   SGRERLKKHREEVAGRVMIP-DTWGQEDSLKDWIDCSAFDELLAPNGISSARESLVAEGR  127

Query  101  R  99
            +
Sbjct  128  K  128



>ref|XP_010089822.1| hypothetical protein L484_022338 [Morus notabilis]
 gb|EXB38438.1| hypothetical protein L484_022338 [Morus notabilis]
Length=155

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            SG +++KRH  EVAGRV+VP ++WG+E L+++W+DYSSFD  L P G+ SARE L+ +A 
Sbjct  75   SGGDRMKRHREEVAGRVVVP-DRWGKEELMKDWIDYSSFDKVLVPSGVRSAREALVMEAP  133

Query  101  RVCST  87
            R  +T
Sbjct  134  RRQAT  138



>ref|XP_010912295.1| PREDICTED: uncharacterized protein LOC105038249 [Elaeis guineensis]
Length=150

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 57/91 (63%), Gaps = 2/91 (2%)
 Frame = -3

Query  362  MECDSPVAATRDVAMPENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREW  183
            ++C +P  + R ++  E  +     E  GRE+LKRH  E+AGRV +P E WGQE LL++W
Sbjct  53   IDCANPEGSRRKIS-KEVSSEGLSAEEYGRERLKRHRMEMAGRVWIP-EIWGQESLLKDW  110

Query  182  MDYSSFDACLAPKGLLSAREDLISQAKRVCS  90
            +D  +FD  L PKGL+ ARE L+   +R  S
Sbjct  111  IDCEAFDRFLVPKGLMLAREALMEDCRRANS  141



>ref|XP_006403775.1| hypothetical protein EUTSA_v10010806mg [Eutrema salsugineum]
 gb|ESQ45228.1| hypothetical protein EUTSA_v10010806mg [Eutrema salsugineum]
Length=141

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 59/91 (65%), Gaps = 5/91 (5%)
 Frame = -3

Query  350  SPVAATRDVAMPENVAAAPEKEH----SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREW  183
            S V+  +D A+PE      ++E     +GREKLK+H  E+AGRV +P E WG+E LL++W
Sbjct  38   SSVSDKKDEALPEEKPKQNQEEERVDTTGREKLKKHRREIAGRVWIP-EIWGKEELLKDW  96

Query  182  MDYSSFDACLAPKGLLSAREDLISQAKRVCS  90
            +D S+FD  L P  + SAR+ L+ +A+R  S
Sbjct  97   IDCSTFDTRLVPADISSARDALVEEARRAAS  127



>ref|XP_011007089.1| PREDICTED: uncharacterized protein LOC105112884 isoform X2 [Populus 
euphratica]
Length=148

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -3

Query  278  GREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAKR  99
            GRE+LKRH  EVAG V++P + WGQE LL++W+D S+FD  LAPK + SARE L+++ +R
Sbjct  80   GRERLKRHREEVAGGVMIP-DTWGQENLLKDWIDCSTFDELLAPKEISSAREALVAEERR  138



>ref|XP_011007079.1| PREDICTED: uncharacterized protein LOC105112884 isoform X1 [Populus 
euphratica]
Length=150

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -3

Query  278  GREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAKR  99
            GRE+LKRH  EVAG V++P + WGQE LL++W+D S+FD  LAPK + SARE L+++ +R
Sbjct  80   GRERLKRHREEVAGGVMIP-DTWGQENLLKDWIDCSTFDELLAPKEISSAREALVAEERR  138



>gb|AFK44733.1| unknown [Lotus japonicus]
Length=156

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = -3

Query  287  EHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQ  108
            E SGREKLKRH  EVAGRV +P + WGQE LL++W+D S+FDA L P  +  ARE L+ +
Sbjct  83   EDSGREKLKRHRVEVAGRVWIP-DMWGQEDLLKDWIDCSAFDAPLVPSKITMAREALVGE  141

Query  107  AKR  99
             +R
Sbjct  142  GRR  144



>ref|XP_011466764.1| PREDICTED: uncharacterized protein LOC105352154 [Fragaria vesca 
subsp. vesca]
Length=171

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = -3

Query  287  EHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQ  108
            E SGRE+LKRH  EVAGRV +P + WGQE  L++W+D ++FD  L P G++SAR  L+ +
Sbjct  98   EESGRERLKRHRIEVAGRVWIP-DIWGQEEFLKDWVDCTTFDDTLFPTGIMSARSALVEE  156

Query  107  AKRVCSTVFK  78
             +R  S+  +
Sbjct  157  GRRGTSSRLR  166



>ref|XP_010558990.1| PREDICTED: uncharacterized protein LOC104827509 [Tarenaya hassleriana]
Length=172

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 47/61 (77%), Gaps = 1/61 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            +GRE+LKRH  +VAGRV +P E WGQE  L++W+D S+FD+CL P G+ SAR  L+ +A+
Sbjct  96   NGRERLKRHRRKVAGRVWIP-EIWGQEEFLKDWIDCSAFDSCLVPTGISSARAALVQEAR  154

Query  101  R  99
            R
Sbjct  155  R  155



>ref|XP_007162900.1| hypothetical protein PHAVU_001G189900g [Phaseolus vulgaris]
 gb|ESW34894.1| hypothetical protein PHAVU_001G189900g [Phaseolus vulgaris]
Length=203

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 2/76 (3%)
 Frame = -3

Query  326  VAMPENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAP  147
            VA   +VA A E E SGRE+LKRH  EVAGRV +P + WGQE LL++W+D S+FDA L P
Sbjct  88   VAKESSVAEALE-EDSGRERLKRHRVEVAGRVWIP-DMWGQEELLKDWIDCSAFDAPLVP  145

Query  146  KGLLSAREDLISQAKR  99
              + +ARE L+ +  R
Sbjct  146  SRIATAREALVEECTR  161



>ref|XP_006404461.1| hypothetical protein EUTSA_v10011075mg [Eutrema salsugineum]
 gb|ESQ45914.1| hypothetical protein EUTSA_v10011075mg [Eutrema salsugineum]
Length=135

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 48/71 (68%), Gaps = 3/71 (4%)
 Frame = -3

Query  311  NVAAAPEKEH--SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGL  138
            N+   PEK    SGRE+LKRH  EVAG+V +P E WG+EGLL  WMD+S+FDA      +
Sbjct  46   NIQEQPEKTTVLSGRERLKRHREEVAGKVPIP-ESWGKEGLLMGWMDFSAFDAAFTSSQI  104

Query  137  LSAREDLISQA  105
            +SAR  LI+ A
Sbjct  105  VSARAALIADA  115



>gb|EAZ23308.1| hypothetical protein OsJ_07004 [Oryza sativa Japonica Group]
Length=196

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 57/80 (71%), Gaps = 3/80 (4%)
 Frame = -3

Query  344  VAATRDVAMPENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSF  165
            VA  R    P +VAA  E+E S RE+LKRH TE+AGRV + PE WGQE LL++W+D + F
Sbjct  95   VAGCRGGRRPSSVAAGEERE-SARERLKRHRTEMAGRVRI-PEMWGQERLLKDWVDCAVF  152

Query  164  DACL-APKGLLSAREDLISQ  108
            D  L A +GLL+AR+ L+++
Sbjct  153  DRPLAATRGLLTARDALVAE  172



>ref|XP_002523802.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38528.1| conserved hypothetical protein [Ricinus communis]
Length=140

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -3

Query  293  EKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLI  114
            EK+  GRE+LK+H  EVAG+VL+P + WGQE LL++W+D SSFD  LAP G+ SAR+ L+
Sbjct  61   EKKDCGRERLKKHREEVAGQVLIP-DTWGQEDLLKDWIDCSSFDKSLAPDGIASARQALV  119



>ref|XP_006430209.1| hypothetical protein CICLE_v10012842mg [Citrus clementina]
 gb|ESR43449.1| hypothetical protein CICLE_v10012842mg [Citrus clementina]
Length=194

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 57/89 (64%), Gaps = 7/89 (8%)
 Frame = -3

Query  356  CDSPVAATRDVAMPENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMD  177
            C+ P     D+ +P  V     +E +GRE+LKRH  +VAGRV +P + WGQE +L++W+D
Sbjct  100  CEKPA----DLPLP--VQEEKSEEDNGRERLKRHRIDVAGRVWIP-DIWGQEEMLKDWID  152

Query  176  YSSFDACLAPKGLLSAREDLISQAKRVCS  90
             S+FDA L P G++SAR  L  + +R  S
Sbjct  153  CSAFDALLVPSGIMSARAALAQEGRRAHS  181



>ref|XP_009374766.1| PREDICTED: uncharacterized protein LOC103963656 [Pyrus x bretschneideri]
Length=160

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = -3

Query  308  VAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSA  129
             AAA E+  SG E LK+H  EVAG+V +P E WGQE LL++W+D S+FDA L P G+++A
Sbjct  80   TAAAAEEGESGLEGLKKHRMEVAGQVWIP-EIWGQEELLQDWIDCSAFDASLFPSGIMTA  138

Query  128  REDLISQAKR  99
            R  L+ + +R
Sbjct  139  RSALVEEGRR  148



>ref|XP_006481780.1| PREDICTED: uncharacterized protein LOC102625741 [Citrus sinensis]
Length=190

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = -3

Query  320  MPENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKG  141
            +P  V     +E +GRE+LKRH  +VAGRV +P + WGQE +L++W+D S+FDA L P G
Sbjct  104  LPSPVQEEKLEEDNGRERLKRHRIDVAGRVWIP-DIWGQEEMLKDWIDCSAFDALLVPSG  162

Query  140  LLSAREDLISQAKRVCS  90
            ++SAR  L  + +R  S
Sbjct  163  IMSARAALAQEGRRAHS  179



>gb|KDO70391.1| hypothetical protein CISIN_1g042384mg, partial [Citrus sinensis]
Length=78

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = -3

Query  290  KEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLIS  111
            +E +GRE+LKRH  +VAGRV +P + WGQE +L++W+D S+FDA L P G++SAR  L  
Sbjct  4    EEDNGRERLKRHRIDVAGRVWIP-DIWGQEEMLKDWIDCSAFDALLVPSGIMSARAALAQ  62

Query  110  QAKRVCSTVFKSQ  72
            + +R  S   + +
Sbjct  63   EGRRAHSGGLRVE  75



>gb|EYU35484.1| hypothetical protein MIMGU_mgv1a024452mg [Erythranthe guttata]
Length=133

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            +GRE+LKRH  EVAGRV +P + WGQE  L++W+D ++FDA L    + SAR+ L+ +A+
Sbjct  62   AGRERLKRHRVEVAGRVWIP-DMWGQENFLKDWIDCTAFDASLVNSSITSARDSLVEEAR  120

Query  101  RVCS  90
            R  S
Sbjct  121  RANS  124



>ref|XP_010535696.1| PREDICTED: uncharacterized protein LOC104810919 [Tarenaya hassleriana]
Length=154

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQA  105
            SGRE+LKRH  E+AG+V +P EKWG+EGLL+ WMD+S FD+      + SAR  L++ +
Sbjct  73   SGRERLKRHREEIAGKVSIP-EKWGKEGLLKNWMDFSVFDSAFTSNQVFSARASLMADS  130



>ref|NP_001239944.1| uncharacterized protein LOC100792377 [Glycine max]
 gb|ACU23865.1| unknown [Glycine max]
Length=179

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 59/106 (56%), Gaps = 8/106 (8%)
 Frame = -3

Query  407  NAVVSSPRAQKAAAMMECDSPVAATRDVAMPENVAAAPEKEHSGREKLKRHWTEVAGRVL  228
            N    +P A K    +E      AT +         + E E SGRE+LKRH  EVAGRV 
Sbjct  73   NTHGQTPSASKVHNKVEITLDYNATTE-------GTSVEGEDSGRERLKRHRVEVAGRVW  125

Query  227  VPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAKRVCS  90
            +P + WGQE LL++W+D ++FDA L P  ++ AR  L+ + +R  S
Sbjct  126  IP-DIWGQEELLKDWIDCTAFDAPLVPSRIVMARTALVEEGRRATS  170



>ref|XP_006487941.1| PREDICTED: uncharacterized protein LOC102609694 [Citrus sinensis]
Length=162

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = -3

Query  278  GREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            GRE+LKRH  EVAGRVL+P + WGQEGLL+ W+D S+F+A + P  + SAR+ L++  +
Sbjct  84   GRERLKRHREEVAGRVLIP-DTWGQEGLLKNWIDCSAFEALMVPNKIASARKALVADNR  141



>ref|XP_007145301.1| hypothetical protein PHAVU_007G227500g [Phaseolus vulgaris]
 gb|ESW17295.1| hypothetical protein PHAVU_007G227500g [Phaseolus vulgaris]
Length=154

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 48/68 (71%), Gaps = 1/68 (1%)
 Frame = -3

Query  293  EKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLI  114
            E E SGRE+LKRH  EV+GRV +P E WGQE LL++W+D ++FDA L P  ++ AR  L+
Sbjct  79   EGEASGRERLKRHRVEVSGRVWIP-EIWGQEDLLKDWIDCTAFDAPLVPSRIVMARTALV  137

Query  113  SQAKRVCS  90
             + +R  S
Sbjct  138  EEGRRATS  145



>dbj|BAJ89637.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=159

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 47/63 (75%), Gaps = 1/63 (2%)
 Frame = -3

Query  293  EKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLI  114
            E+  S RE+LKRH  E+AGRV VP E WGQE LL++WMD S+FD  L P GLL+AR  L+
Sbjct  75   EEGESARERLKRHRREMAGRVWVP-EMWGQEKLLKDWMDCSAFDRPLVPAGLLTARRALV  133

Query  113  SQA  105
            +++
Sbjct  134  AES  136



>ref|XP_002528742.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33654.1| conserved hypothetical protein [Ricinus communis]
Length=172

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = -3

Query  278  GREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAKR  99
            GRE+LKRH  EVAGRV +P + WGQE LL++W+D S+FDA L P  ++SAR  L+ + +R
Sbjct  102  GRERLKRHRVEVAGRVWIP-DIWGQEELLKDWIDCSAFDAPLLPNRIMSARTALVEEGRR  160

Query  98   VCS  90
              S
Sbjct  161  ATS  163



>ref|XP_008389780.1| PREDICTED: uncharacterized protein LOC103452045 [Malus domestica]
Length=160

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 47/61 (77%), Gaps = 1/61 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            SGRE+L++H  EVAG+V +P E WGQE LL++W+D S+FDA L P G+++AR  L+ + +
Sbjct  89   SGRERLQKHRMEVAGQVWIP-EIWGQEELLQDWIDCSAFDASLFPSGIMTARSALVEEGR  147

Query  101  R  99
            R
Sbjct  148  R  148



>ref|NP_001047026.1| Os02g0532800 [Oryza sativa Japonica Group]
 dbj|BAD28423.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08940.1| Os02g0532800 [Oryza sativa Japonica Group]
Length=195

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 60/82 (73%), Gaps = 4/82 (5%)
 Frame = -3

Query  350  SPVAATRDVAMPENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYS  171
            +P+  +R  A P +VAA  E+E S RE+LKRH TE+AGRV + PE WGQE LL++W+D +
Sbjct  93   APLPVSRRPA-PSSVAAGEERE-SARERLKRHRTEMAGRVRI-PEMWGQERLLKDWVDCA  149

Query  170  SFDACL-APKGLLSAREDLISQ  108
             FD  L A +GLL+AR+ L+++
Sbjct  150  VFDRPLAATRGLLTARDALVAE  171



>gb|EAY86148.1| hypothetical protein OsI_07521 [Oryza sativa Indica Group]
Length=195

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 60/82 (73%), Gaps = 4/82 (5%)
 Frame = -3

Query  350  SPVAATRDVAMPENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYS  171
            +P+  +R  A P +VAA  E+E S RE+LKRH TE+AGRV + PE WGQE LL++W+D +
Sbjct  93   APLPVSRRPA-PSSVAAGEERE-SARERLKRHRTEMAGRVRI-PEMWGQERLLKDWVDCA  149

Query  170  SFDACL-APKGLLSAREDLISQ  108
             FD  L A +GLL+AR+ L+++
Sbjct  150  VFDRPLAATRGLLTARDALVAE  171



>gb|KFK33881.1| hypothetical protein AALP_AA5G072300 [Arabis alpina]
Length=125

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQA  105
            SGRE+LKRH  EVAG+V +P E WG+EGLL  WMD+S+FDA      ++SAR  L++ A
Sbjct  50   SGRERLKRHREEVAGKVPIP-ESWGKEGLLMGWMDFSAFDAAFTSNQIVSARAALMADA  107



>gb|KHN14999.1| hypothetical protein glysoja_037126, partial [Glycine soja]
Length=174

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 58/103 (56%), Gaps = 8/103 (8%)
 Frame = -3

Query  407  NAVVSSPRAQKAAAMMECDSPVAATRDVAMPENVAAAPEKEHSGREKLKRHWTEVAGRVL  228
            N    +P A K    +E      AT +         + E E SGRE+LKRH  EVAGRV 
Sbjct  79   NTHGQTPSASKVHNKVEITLDYNATTE-------GTSVEGEDSGRERLKRHRVEVAGRVW  131

Query  227  VPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAKR  99
            +P + WGQE LL++W+D ++FDA L P  ++ AR  L+ + +R
Sbjct  132  IP-DIWGQEELLKDWIDCTAFDAPLVPSRIVMARTALVEEGRR  173



>ref|XP_009366670.1| PREDICTED: uncharacterized protein LOC103956416 [Pyrus x bretschneideri]
Length=164

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 47/61 (77%), Gaps = 1/61 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            SGRE+LK+H  EVAG+V +P + WGQE LL++W+D S+FDA L P G+++AR  L+ + +
Sbjct  93   SGRERLKKHRMEVAGQVWIP-DIWGQEELLQDWIDCSAFDASLFPSGIMTARSALVEEGR  151

Query  101  R  99
            R
Sbjct  152  R  152



>ref|XP_009150271.1| PREDICTED: uncharacterized protein LOC103873611 [Brassica rapa]
Length=132

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 47/71 (66%), Gaps = 3/71 (4%)
 Frame = -3

Query  311  NVAAAPEKE--HSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGL  138
            N+   PE     SGRE+LKRH  EVAG+V +P E WG+EGLL  WMD+S+FDA      +
Sbjct  43   NIKVQPETTPVLSGRERLKRHREEVAGKVPIP-ESWGKEGLLVGWMDFSTFDASFTSSQI  101

Query  137  LSAREDLISQA  105
            +SAR  L++ A
Sbjct  102  VSARAALMADA  112



>ref|XP_008671321.1| PREDICTED: uncharacterized protein LOC103648675 [Zea mays]
Length=177

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = -3

Query  302  AAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSARE  123
            AA + + S RE+LKRH  E+AGRV VP E WGQE LL++W+DY+ FD  L   GLL+AR 
Sbjct  86   AAADDQESTRERLKRHRREMAGRVWVP-EMWGQEKLLKDWVDYAVFDRPLVATGLLTARR  144

Query  122  DLISQ  108
             LI++
Sbjct  145  ALIAE  149



>ref|XP_003581199.1| PREDICTED: uncharacterized protein LOC100823432 [Brachypodium 
distachyon]
Length=151

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 51/77 (66%), Gaps = 8/77 (10%)
 Frame = -3

Query  314  ENVAAAPEKEHSG-------REKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDAC  156
            E +  +P KE  G       RE+LKRH  E+AG+V VP E WGQE LL++WMD S+FD  
Sbjct  49   EKLLKSPAKEEEGEDAGESTRERLKRHRREMAGKVWVP-ELWGQEKLLKDWMDCSAFDRP  107

Query  155  LAPKGLLSAREDLISQA  105
            L P GLL+AR  L++++
Sbjct  108  LVPAGLLTARRALVAES  124



>tpg|DAA37922.1| TPA: hypothetical protein ZEAMMB73_953930 [Zea mays]
Length=182

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = -3

Query  302  AAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSARE  123
            AA + + S RE+LKRH  E+AGRV VP E WGQE LL++W+DY+ FD  L   GLL+AR 
Sbjct  91   AAADDQESTRERLKRHRREMAGRVWVP-EMWGQEKLLKDWVDYAVFDRPLVATGLLTARR  149

Query  122  DLISQ  108
             LI++
Sbjct  150  ALIAE  154



>ref|XP_003554435.1| PREDICTED: uncharacterized protein LOC100793911 isoform X1 [Glycine 
max]
 ref|XP_006604639.1| PREDICTED: uncharacterized protein LOC100793911 isoform X4 [Glycine 
max]
 ref|XP_006604640.1| PREDICTED: uncharacterized protein LOC100793911 isoform X5 [Glycine 
max]
Length=187

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            SGRE+L RH  EVAGRV +P + WGQE LL++W+D ++FDA L P  + +ARE L+ +  
Sbjct  108  SGRERLNRHRVEVAGRVWIP-DIWGQEELLKDWIDCTAFDATLVPSRISTAREALVQECT  166

Query  101  RVCS  90
            R  S
Sbjct  167  RANS  170



>emb|CDP15409.1| unnamed protein product [Coffea canephora]
Length=190

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 5/85 (6%)
 Frame = -3

Query  320  MPENVAAAPEKEHS----GREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACL  153
            + EN+    E E S    GRE+LKRH  EVAGRV +P + WGQE LL++W+D S+FDA +
Sbjct  102  LVENLRTTNEAEVSTVVTGRERLKRHRIEVAGRVWIP-DIWGQEELLKDWIDCSAFDASV  160

Query  152  APKGLLSAREDLISQAKRVCSTVFK  78
                ++SAR  L+ + +R  S+  +
Sbjct  161  MNSSIMSARAALVEEGRRANSSRIR  185



>ref|XP_006424244.1| hypothetical protein CICLE_v10029406mg [Citrus clementina]
 gb|ESR37484.1| hypothetical protein CICLE_v10029406mg [Citrus clementina]
 gb|KDO58077.1| hypothetical protein CISIN_1g030990mg [Citrus sinensis]
Length=168

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -3

Query  275  REKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            RE+LKRH  EVAGRVL+P + WGQEGLL+ W+D S+F+A + P  + SAR+ L++  +
Sbjct  91   RERLKRHREEVAGRVLIP-DTWGQEGLLKNWIDCSAFEALMVPNKIASARKALVADNR  147



>gb|KHN02226.1| hypothetical protein glysoja_002250 [Glycine soja]
Length=179

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            SGRE+L RH  EVAGRV +P + WGQE LL++W+D ++FDA L P  + +ARE L+ +  
Sbjct  108  SGRERLNRHRVEVAGRVWIP-DIWGQEELLKDWIDCTAFDATLVPSRISTAREALVQECT  166

Query  101  RVCS  90
            R  S
Sbjct  167  RANS  170



>ref|XP_006604638.1| PREDICTED: uncharacterized protein LOC100793911 isoform X3 [Glycine 
max]
Length=195

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            SGRE+L RH  EVAGRV +P + WGQE LL++W+D ++FDA L P  + +ARE L+ +  
Sbjct  108  SGRERLNRHRVEVAGRVWIP-DIWGQEELLKDWIDCTAFDATLVPSRISTAREALVQECT  166

Query  101  RVCS  90
            R  S
Sbjct  167  RANS  170



>gb|ACU19002.1| unknown [Glycine max]
Length=140

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 48/68 (71%), Gaps = 1/68 (1%)
 Frame = -3

Query  293  EKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLI  114
            + + SGREKLKRH  EVAGRV +P + WGQE +L++W+D ++FDA L P  ++ AR  L+
Sbjct  65   DHQDSGREKLKRHRVEVAGRVWIP-DIWGQEEILKDWIDCTAFDAPLVPSRIVMARTALV  123

Query  113  SQAKRVCS  90
             + +R  S
Sbjct  124  EEGRRATS  131



>ref|XP_003535631.2| PREDICTED: uncharacterized protein LOC100815684 [Glycine max]
 gb|KHN13514.1| hypothetical protein glysoja_038752 [Glycine soja]
Length=180

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 48/68 (71%), Gaps = 1/68 (1%)
 Frame = -3

Query  293  EKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLI  114
            + + SGREKLKRH  EVAGRV +P + WGQE +L++W+D ++FDA L P  ++ AR  L+
Sbjct  105  DHQDSGREKLKRHRVEVAGRVWIP-DIWGQEEILKDWIDCTAFDAPLVPSRIVMARTALV  163

Query  113  SQAKRVCS  90
             + +R  S
Sbjct  164  EEGRRATS  171



>ref|XP_006604637.1| PREDICTED: uncharacterized protein LOC100793911 isoform X2 [Glycine 
max]
Length=200

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            SGRE+L RH  EVAGRV +P + WGQE LL++W+D ++FDA L P  + +ARE L+ +  
Sbjct  108  SGRERLNRHRVEVAGRVWIP-DIWGQEELLKDWIDCTAFDATLVPSRISTAREALVQECT  166

Query  101  RVCS  90
            R  S
Sbjct  167  RANS  170



>ref|XP_010514778.1| PREDICTED: uncharacterized protein LOC104790697 [Camelina sativa]
Length=202

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 58/98 (59%), Gaps = 10/98 (10%)
 Frame = -3

Query  395  SSPRA-QKAAAMMECDSPVAATRDVAMPENVAAAPEKEHSGREKLKRHWTEVAGRVLVPP  219
            +SPR+ Q+   ++E  S  A      +PE          SGRE+LKRH  EVAG+V +P 
Sbjct  94   TSPRSSQRDHVLVEKQSKTAT--KTCLPETTVL------SGRERLKRHRDEVAGKVPIP-  144

Query  218  EKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQA  105
            + WG+EGLL  WMD+S+FDA      ++SAR  L++ A
Sbjct  145  DSWGKEGLLMGWMDFSAFDAAFTSSQIVSARAALMADA  182



>ref|XP_009336972.1| PREDICTED: uncharacterized protein LOC103929487 [Pyrus x bretschneideri]
Length=137

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            SG E+LK+H  EVAG+V +P E WGQE LL++W+D S+FDA L P G+++AR  L+ + +
Sbjct  66   SGLERLKKHRMEVAGQVWIP-EIWGQEELLQDWIDCSAFDASLFPSGIMTARSALVEEGR  124

Query  101  R  99
            R
Sbjct  125  R  125



>ref|XP_004149256.1| PREDICTED: uncharacterized protein LOC101217932 [Cucumis sativus]
 ref|XP_004165127.1| PREDICTED: uncharacterized LOC101217932 [Cucumis sativus]
 gb|KGN46948.1| hypothetical protein Csa_6G152340 [Cucumis sativus]
Length=123

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = -3

Query  275  REKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAKR  99
            RE+LKRH  EVAG+V+VP EKWG+E LL++W+DYS+FD  LA   + SAR  L ++ +R
Sbjct  53   RERLKRHREEVAGKVMVP-EKWGKEELLKDWIDYSAFDRILAAGRIASARASLAAEGQR  110



>ref|NP_001143077.1| uncharacterized protein LOC100275550 [Zea mays]
 gb|ACG28806.1| hypothetical protein [Zea mays]
 gb|ACG30288.1| hypothetical protein [Zea mays]
Length=173

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = -3

Query  332  RDVAMPENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACL  153
            +D+ + E  AAA ++E S R++LKRH  E+AGRV VP E WGQE LL++W+D + FD  +
Sbjct  72   KDLQVAEPKAAADDQE-STRDRLKRHRREMAGRVWVP-ETWGQEKLLKDWVDCAVFDRPM  129

Query  152  APKGLLSAREDLISQ  108
             P GLL+AR  LI++
Sbjct  130  VPMGLLTARRALIAE  144



>gb|AFW58185.1| hypothetical protein ZEAMMB73_804767 [Zea mays]
Length=183

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = -3

Query  332  RDVAMPENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACL  153
            +D+ + E  AAA ++E S R++LKRH  E+AGRV VP E WGQE LL++W+D + FD  +
Sbjct  82   KDLQVAEPKAAADDQE-STRDRLKRHRREMAGRVWVP-ETWGQEKLLKDWVDCAVFDRPM  139

Query  152  APKGLLSAREDLISQ  108
             P GLL+AR  LI++
Sbjct  140  VPMGLLTARRALIAE  154



>ref|XP_002877340.1| hypothetical protein ARALYDRAFT_484861 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53599.1| hypothetical protein ARALYDRAFT_484861 [Arabidopsis lyrata subsp. 
lyrata]
Length=116

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQA  105
            SGRE+LKRH  EVAG+V +P + WG+EGLL  WMD+S+FDA      ++SAR  L++ A
Sbjct  39   SGRERLKRHREEVAGKVPIP-DSWGKEGLLMGWMDFSTFDAAFTSSQIVSARAALMADA  96



>ref|XP_010425861.1| PREDICTED: uncharacterized protein LOC104710906 [Camelina sativa]
Length=122

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 57/97 (59%), Gaps = 10/97 (10%)
 Frame = -3

Query  392  SPRA-QKAAAMMECDSPVAATRDVAMPENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPE  216
            SPR+ Q+   ++E  S  A      +PE          SGRE+LKRH  EVAG+V +P +
Sbjct  15   SPRSSQRDHILVEKQSKTATK--TCLPETTVL------SGRERLKRHRDEVAGKVPIP-D  65

Query  215  KWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQA  105
             WG+EGLL  WMD+S+FDA      ++SAR  L++ A
Sbjct  66   SWGKEGLLMGWMDFSAFDAAFTSSQIVSARAALMADA  102



>ref|XP_006576219.1| PREDICTED: uncharacterized protein LOC100779351 isoform X5 [Glycine 
max]
Length=187

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            SGRE+L RH  EVAGRV +P E WGQE LL++W+D S+FDA L P  + +AR+ L+ +  
Sbjct  108  SGRERLNRHRVEVAGRVWIP-EIWGQEELLKDWIDCSAFDAPLVPSRISTARKALVEECT  166

Query  101  R  99
            R
Sbjct  167  R  167



>ref|NP_001242227.1| uncharacterized protein LOC100779351 [Glycine max]
 gb|ACU22758.1| unknown [Glycine max]
Length=187

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            SGRE+L RH  EVAGRV +P E WGQE LL++W+D S+FDA L P  + +AR+ L+ +  
Sbjct  108  SGRERLNRHRVEVAGRVWIP-EIWGQEELLKDWIDCSAFDAPLVPSRISTARKALVEECT  166

Query  101  R  99
            R
Sbjct  167  R  167



>ref|XP_006292063.1| hypothetical protein CARUB_v10018258mg [Capsella rubella]
 gb|EOA24961.1| hypothetical protein CARUB_v10018258mg [Capsella rubella]
Length=118

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQA  105
            SGRE+LKRH  EVAG+V +P + WG+EGLL  WMD+S+FDA      ++SAR  L++ A
Sbjct  41   SGRERLKRHREEVAGKVPIP-DSWGKEGLLMGWMDFSAFDASFTSSQIVSARAALMADA  98



>ref|XP_006576217.1| PREDICTED: uncharacterized protein LOC100779351 isoform X3 [Glycine 
max]
 ref|XP_006576218.1| PREDICTED: uncharacterized protein LOC100779351 isoform X4 [Glycine 
max]
Length=208

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            SGRE+L RH  EVAGRV +P E WGQE LL++W+D S+FDA L P  + +AR+ L+ +  
Sbjct  108  SGRERLNRHRVEVAGRVWIP-EIWGQEELLKDWIDCSAFDAPLVPSRISTARKALVEECT  166

Query  101  R  99
            R
Sbjct  167  R  167



>gb|KHN18769.1| hypothetical protein glysoja_021520 [Glycine soja]
Length=200

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            SGRE+L RH  EVAGRV +P E WGQE LL++W+D S+FDA L P  + +AR+ L+ +  
Sbjct  108  SGRERLNRHRVEVAGRVWIP-EIWGQEELLKDWIDCSAFDAPLVPSRISTARKALVEECT  166

Query  101  R  99
            R
Sbjct  167  R  167



>ref|XP_003625814.1| hypothetical protein MTR_7g104540 [Medicago truncatula]
 gb|AES82032.1| plant/F3C22-140 protein, putative [Medicago truncatula]
Length=180

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 58/98 (59%), Gaps = 5/98 (5%)
 Frame = -3

Query  380  QKAAAMMECDSPVAATRDVAMPENVA---AAPEKEHSGREKLKRHWTEVAGRVLVPPEKW  210
            +K A + E  +PV++  DV   E      A   +E S RE+LKRH  EVAGRV +P E W
Sbjct  67   EKMALLQEL-APVSSMDDVEAKELTTMDEALDLEEDSERERLKRHRVEVAGRVWIP-EIW  124

Query  209  GQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAKRV  96
            GQE LL++W+D ++FDA L P  +  AR  L+ +  + 
Sbjct  125  GQEDLLKDWIDCTAFDAPLVPSKITMARAALVEEGTKT  162



>ref|XP_004954965.1| PREDICTED: uncharacterized protein LOC101759245, partial [Setaria 
italica]
Length=109

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = -3

Query  296  PEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPK-GLLSARED  120
            P  E S RE+LKRH TE+AGRV + PE WGQE LL++W+D + FD  LA   GLL+AR+ 
Sbjct  22   PAAEESARERLKRHRTEMAGRVRI-PEMWGQERLLKDWVDCAVFDRPLAATAGLLTARDA  80

Query  119  LISQ  108
            L+++
Sbjct  81   LVAE  84



>gb|KDP42745.1| hypothetical protein JCGZ_23685 [Jatropha curcas]
Length=227

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            SG E+L+RH  EVAGRV +P + WGQE LL++W+D S+FDA L P  ++SAR  L+ + +
Sbjct  156  SGCERLRRHRIEVAGRVWIP-DIWGQEELLKDWIDCSAFDAPLMPNSIMSARAALVEEGR  214

Query  101  RVCS  90
            R  S
Sbjct  215  RATS  218



>emb|CAN69280.1| hypothetical protein VITISV_023275 [Vitis vinifera]
Length=164

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 57/89 (64%), Gaps = 4/89 (4%)
 Frame = -3

Query  344  VAATRDVAMPENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSF  165
            V  T++    E +A++   E SGR++LKRH  EVAGRV +P + WGQE L+++W D S F
Sbjct  75   VDVTKEPIKTEXLASS---EDSGRDRLKRHRVEVAGRVWIP-DIWGQEELMKDWTDCSVF  130

Query  164  DACLAPKGLLSAREDLISQAKRVCSTVFK  78
            DA L    ++SAR  L+++ +R  S+  +
Sbjct  131  DASLVSSRIMSARAALMAEGRRPNSSRLR  159



>emb|CDY30933.1| BnaA06g19800D [Brassica napus]
Length=132

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 46/71 (65%), Gaps = 3/71 (4%)
 Frame = -3

Query  311  NVAAAPEKEH--SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGL  138
            N+   PE     SGRE+LKRH  EVAG+V +P E W +EGLL  WMD+S+FDA      +
Sbjct  43   NIKVQPETTPVLSGRERLKRHREEVAGKVPIP-ESWDKEGLLVGWMDFSTFDASFTSSQI  101

Query  137  LSAREDLISQA  105
            +SAR  L++ A
Sbjct  102  VSARAALMADA  112



>ref|XP_006576216.1| PREDICTED: uncharacterized protein LOC100779351 isoform X2 [Glycine 
max]
Length=217

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            SGRE+L RH  EVAGRV +P E WGQE LL++W+D S+FDA L P  + +AR+ L+ +  
Sbjct  108  SGRERLNRHRVEVAGRVWIP-EIWGQEELLKDWIDCSAFDAPLVPSRISTARKALVEECT  166

Query  101  R  99
            R
Sbjct  167  R  167



>ref|XP_003575071.1| PREDICTED: uncharacterized protein LOC100845821 [Brachypodium 
distachyon]
Length=142

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = -3

Query  371  AAMMECDSPVAATRDVAMPENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLL  192
            A    C +   A   +A  +        E S RE+LKRH TE+AGRV + P+ WGQE LL
Sbjct  35   AGTSSCGTDATAGSSLAEKQTKGGRAAGEESARERLKRHRTEMAGRVRI-PDMWGQERLL  93

Query  191  REWMDYSSFDACL-APKGLLSAREDLISQ  108
            ++W+D + FD  L A +GLL+AR+ L+++
Sbjct  94   KDWVDCAVFDRPLAATRGLLTARDALVAE  122



>ref|XP_010661366.1| PREDICTED: uncharacterized protein LOC104881801 [Vitis vinifera]
Length=172

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = -3

Query  287  EHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQ  108
            E SGR++LKRH  EVAGRV +P + WGQE L+++W D S FDA L    ++SAR  L+++
Sbjct  99   EDSGRDRLKRHRVEVAGRVWIP-DIWGQEELMKDWTDCSVFDASLVSSRIMSARAALMAE  157

Query  107  AKRVCSTVFK  78
             +R  S+  +
Sbjct  158  GRRPNSSRLR  167



>ref|XP_010503097.1| PREDICTED: uncharacterized protein LOC104780294 [Camelina sativa]
Length=122

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQA  105
            SGRE+LKRH  EVAG+V +P + WG+EGLL  WMD+S+FDA      ++SAR  L+  A
Sbjct  45   SGRERLKRHRDEVAGKVPIP-DSWGKEGLLMGWMDFSAFDAAFTSSQIVSARAALMVDA  102



>emb|CAN80332.1| hypothetical protein VITISV_018276 [Vitis vinifera]
Length=196

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  317  PENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGL  138
            P    A    E SGRE+LKRH  EVAG V +P + WGQE L+++W+D S FDA L    +
Sbjct  84   PIKTEALASSEDSGRERLKRHRVEVAGSVGIP-DMWGQEELMKDWVDCSVFDASLVTSRI  142

Query  137  LSAREDLISQAKR  99
            +SAR  L+++ +R
Sbjct  143  MSARAALVAEGRR  155



>ref|XP_006826648.1| hypothetical protein AMTR_s00139p00102470 [Amborella trichopoda]
 gb|ERM93885.1| hypothetical protein AMTR_s00139p00102470 [Amborella trichopoda]
Length=137

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 50/81 (62%), Gaps = 1/81 (1%)
 Frame = -3

Query  320  MPENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKG  141
              ++ A   E+   GRE+L++H   VAG+V +P E WGQE LL+EW+D  + D  L P G
Sbjct  52   FSDDAAEGGEERIEGRERLQKHRMMVAGKVWIP-ETWGQEELLKEWVDCGAIDRSLMPNG  110

Query  140  LLSAREDLISQAKRVCSTVFK  78
            L+SAR  L+ + +R  S+  +
Sbjct  111  LVSARNALVEECRRAGSSSLE  131



>ref|XP_010654082.1| PREDICTED: uncharacterized protein LOC104880149 [Vitis vinifera]
Length=194

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  317  PENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGL  138
            P    A    E SGRE+LKRH  EVAG V +P + WGQE L+++W+D S FDA L    +
Sbjct  84   PIKTEALASSEDSGRERLKRHRVEVAGSVGIP-DMWGQEELMKDWVDCSVFDASLVTSRI  142

Query  137  LSAREDLISQAKR  99
            +SAR  L+++ +R
Sbjct  143  MSARAALVAEGRR  155



>ref|XP_008784230.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020 
[Phoenix dactylifera]
Length=926

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = -3

Query  287  EHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQ  108
            E  GRE+LKRH  E+ GRV +P E WGQE LL++W+D ++FD  L  KGL+ ARE L+ +
Sbjct  77   EDCGRERLKRHRMEMEGRVWIP-EIWGQESLLKDWIDCAAFDRFLVSKGLMLAREALVEE  135

Query  107  AKRVCST  87
             +R  S+
Sbjct  136  CRRANSS  142



>ref|XP_009617401.1| PREDICTED: uncharacterized protein LOC104109751 [Nicotiana tomentosiformis]
Length=163

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = -3

Query  287  EHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQ  108
            E +GR++LKRH  EVAG V +P + WGQE LL++W+D S+FDA L    ++SAR  L+  
Sbjct  89   EDNGRDRLKRHRVEVAGHVWIP-DIWGQEELLKDWIDCSAFDASLMNSNIMSARAALVED  147

Query  107  AKRVCST  87
             +R  S+
Sbjct  148  RRRANSS  154



>ref|XP_006576215.1| PREDICTED: uncharacterized protein LOC100779351 isoform X1 [Glycine 
max]
Length=243

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            SGRE+L RH  EVAGRV +P E WGQE LL++W+D S+FDA L P  + +AR+ L+ +  
Sbjct  108  SGRERLNRHRVEVAGRVWIP-EIWGQEELLKDWIDCSAFDAPLVPSRISTARKALVEECT  166

Query  101  R  99
            R
Sbjct  167  R  167



>ref|NP_190031.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB86923.1| putative protein [Arabidopsis thaliana]
 gb|AAS99657.1| At3g44450 [Arabidopsis thaliana]
 gb|AAT41797.1| At3g44450 [Arabidopsis thaliana]
 gb|AEE77904.1| uncharacterized protein AT3G44450 [Arabidopsis thaliana]
Length=116

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQA  105
            SGR++LKRH  EVAG+V +P + WG+EGLL  WMD+S+FDA      ++SAR  L++ +
Sbjct  39   SGRDRLKRHREEVAGKVPIP-DSWGKEGLLMGWMDFSTFDAAFTSSQIVSARAALMADS  96



>ref|XP_002446410.1| hypothetical protein SORBIDRAFT_06g015560 [Sorghum bicolor]
 gb|EES10738.1| hypothetical protein SORBIDRAFT_06g015560 [Sorghum bicolor]
Length=209

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQ  108
            S RE+LKRH  E+AGRV VP E WGQE LL++W+D + FD  + P GLL+AR  LI++
Sbjct  118  STRERLKRHRREMAGRVWVP-EMWGQEKLLKDWVDCAVFDRPMVPTGLLTARRALIAE  174



>ref|XP_008442840.1| PREDICTED: uncharacterized protein LOC103486607 [Cucumis melo]
Length=156

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = -3

Query  266  LKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAKR  99
            LKRH  E+AGRV +P E WGQE LL++W+D S+FDACL P G+ SAR  L+ + +R
Sbjct  90   LKRHRREMAGRVWIP-EIWGQEELLKDWIDCSAFDACLFPTGIGSARAALVEERRR  144



>gb|KJB16115.1| hypothetical protein B456_002G240200 [Gossypium raimondii]
Length=134

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  KEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLIS  111
            +E +GRE+LK+H  E+    +  P+ WGQE LL++W+D S FD CL P G++ ARE L+ 
Sbjct  60   EEDNGRERLKKHRIEMGKSKVWIPDIWGQEELLKDWIDCSGFDDCLVPSGIMLAREALVE  119

Query  110  QAK  102
            + +
Sbjct  120  EVR  122



>ref|XP_008809927.1| PREDICTED: uncharacterized protein LOC103721474 [Phoenix dactylifera]
Length=123

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -3

Query  287  EHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQ  108
            E SGRE+L+RH  E+A R +   + WGQE LL++W D S+F     PKG+ SARE L+++
Sbjct  50   EDSGRERLRRHRFEMA-RSICISDTWGQESLLKDWTDCSAFSTSFIPKGIASAREALVAE  108

Query  107  AKRVCSTVFK  78
             +R  S   K
Sbjct  109  FRRASSKGLK  118



>ref|XP_008458586.1| PREDICTED: uncharacterized protein LOC103497945 [Cucumis melo]
Length=118

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -3

Query  275  REKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAKR  99
            RE+LKRH  EVAG+V VP +KWG+E LL++W+DYS+FD  LA   + SAR  L ++ ++
Sbjct  50   RERLKRHREEVAGKVTVP-DKWGKEELLKDWIDYSAFDRILAAGRIASARASLAAEGQQ  107



>ref|XP_006341142.1| PREDICTED: uncharacterized protein LOC102585102 [Solanum tuberosum]
Length=154

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = -3

Query  323  AMPENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDA-CLAP  147
            A   N       E SGRE+LKRH  EVAG V +P E WGQE LL++W+D S+FD+  +  
Sbjct  67   ASAHNEGGLMRTEDSGRERLKRHRIEVAGHVWIP-EIWGQEELLKDWIDCSAFDSKLMNN  125

Query  146  KGLLSAREDLISQAKRVCST  87
              ++SAR  L+ + +R  S+
Sbjct  126  NNIMSARAALVEERRRTNSS  145



>ref|XP_009796861.1| PREDICTED: uncharacterized protein LOC104243376 [Nicotiana sylvestris]
Length=159

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = -3

Query  287  EHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQ  108
            E +GRE+LKRH  EVAG V +P + WGQE LL++W+D S+FDA L    ++SAR  L+ +
Sbjct  85   EDNGRERLKRHRVEVAGHVWIP-DIWGQEELLKDWIDCSAFDASLMNSNIVSARTALVEE  143

Query  107  AK  102
             +
Sbjct  144  RR  145



>ref|XP_004161241.1| PREDICTED: uncharacterized protein LOC101223869 [Cucumis sativus]
Length=91

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = -3

Query  266  LKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAKR  99
            LKRH  E+AGRV +P + WGQE LL++W+D S+FDACL P G+ SAR  L+ + +R
Sbjct  25   LKRHRREMAGRVWIP-DIWGQEELLKDWIDCSAFDACLFPTGIGSARAALVEERRR  79



>gb|KGN59130.1| hypothetical protein Csa_3G776900 [Cucumis sativus]
Length=157

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = -3

Query  266  LKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAKR  99
            LKRH  E+AGRV +P + WGQE LL++W+D S+FDACL P G+ SAR  L+ + +R
Sbjct  91   LKRHRREMAGRVWIP-DIWGQEELLKDWIDCSAFDACLFPTGIGSARAALVEERRR  145



>ref|XP_008809941.1| PREDICTED: uncharacterized protein LOC103721477 [Phoenix dactylifera]
Length=119

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = -3

Query  287  EHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQ  108
            E SGRE+L+RH  E+A R +  P+ W QEGLL++W D S+F      KG+ SARE L+ +
Sbjct  50   EDSGRERLRRHRFEMA-RSICMPDTWEQEGLLKDWTDSSAFSTSFVSKGIASAREALVEE  108

Query  107  AKRVCSTVFK  78
             +R  S   K
Sbjct  109  FRRANSGGLK  118



>gb|ACA35272.1| unknown protein [Cucumis sativus]
Length=222

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 43/57 (75%), Gaps = 1/57 (2%)
 Frame = -3

Query  269  KLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAKR  99
            +LKRH  E+AGRV +P + WGQE LL++W+D S+FDACL P G+ SAR  L+ + +R
Sbjct  91   RLKRHRREMAGRVWIP-DIWGQEELLKDWIDCSAFDACLFPTGIGSARAALVEERRR  146



>ref|XP_004487496.1| PREDICTED: uncharacterized protein LOC101505815 [Cicer arietinum]
Length=138

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = -3

Query  287  EHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLS-AREDLIS  111
            E +GREKLKRH  EV G++ +P + W +E +L+EW+DY++FDA  AP  L+  AR+ LI 
Sbjct  66   EITGREKLKRHREEVKGKIELP-KNWEKEKMLKEWVDYTTFDASFAPHKLIVIARDALIE  124

Query  110  QAKRVCS  90
             A++  S
Sbjct  125  DARKARS  131



>ref|XP_010036690.1| PREDICTED: uncharacterized protein LOC104425646 [Eucalyptus grandis]
 gb|KCW48326.1| hypothetical protein EUGRSUZ_K02045 [Eucalyptus grandis]
Length=171

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAK  102
            +GRE+LKRH  EVAGR  +P + WGQE LL++W+D S+F+A   P  ++SA+  L+ + +
Sbjct  100  NGRERLKRHRIEVAGRAWIP-DIWGQEELLKDWVDCSAFEASFLPAKIMSAKAALVEEGR  158

Query  101  RVCSTVFK  78
            R  S   +
Sbjct  159  RANSGGLR  166



>ref|XP_004975560.1| PREDICTED: uncharacterized protein LOC101762913 [Setaria italica]
Length=184

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = -3

Query  293  EKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLI  114
            + + S RE+LKRH  E+AGRV VP E WGQE LL++W+D + FD  L P GL +AR  LI
Sbjct  96   DHQESTRERLKRHRREMAGRVWVP-ELWGQEKLLKDWVDCAVFDRPLVPAGLPTARRALI  154

Query  113  SQ  108
            ++
Sbjct  155  AE  156



>ref|XP_002452201.1| hypothetical protein SORBIDRAFT_04g021680 [Sorghum bicolor]
 gb|EES05177.1| hypothetical protein SORBIDRAFT_04g021680 [Sorghum bicolor]
Length=184

 Score = 64.7 bits (156),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 54/78 (69%), Gaps = 6/78 (8%)
 Frame = -3

Query  308  VAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACL-APKGLLS  132
            +AA   +E S RE+LKRH TE+AGRV + P+ WGQE LL++W+D + FD  L A  GLL+
Sbjct  91   MAARRTEEISARERLKRHRTEMAGRVRI-PDMWGQERLLKDWVDCAVFDRPLAATTGLLN  149

Query  131  AREDLISQAKRVCSTVFK  78
            AR+ L+++    C+T  +
Sbjct  150  ARDALVAE----CATARR  163



>ref|XP_011077929.1| PREDICTED: proline-rich transmembrane protein 2-like [Sesamum 
indicum]
Length=171

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = -3

Query  314  ENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACL  153
            E VA   E   SGRE+LKRH  EVAGRV + PE WGQE LL++W+D ++FDA L
Sbjct  89   EVVATVEEINSSGRERLKRHRVEVAGRVWI-PEMWGQEELLKDWIDCTAFDATL  141



>ref|XP_007150069.1| hypothetical protein PHAVU_005G123800g [Phaseolus vulgaris]
 gb|ESW22063.1| hypothetical protein PHAVU_005G123800g [Phaseolus vulgaris]
Length=131

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 42/63 (67%), Gaps = 1/63 (2%)
 Frame = -3

Query  287  EHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLL-SAREDLIS  111
            E +GREKLKR   EV    +  PE WGQE  L++W+DY+ FDA LAP  L+ SAR+ L  
Sbjct  64   EETGREKLKRLREEVMMEKISIPEDWGQEQKLKDWIDYTVFDAFLAPHSLIVSARDALCM  123

Query  110  QAK  102
            Q+K
Sbjct  124  QSK  126



>emb|CAH67161.1| H0717B12.8 [Oryza sativa Indica Group]
Length=203

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQ  108
            S RE+LKRH  E+AGRV VP + WGQE LL++W+D ++FD  L P  LL+AR  L+++
Sbjct  121  SARERLKRHRREMAGRVWVP-DMWGQEKLLKDWVDCAAFDRPLVPPDLLTARRALVAE  177



>gb|EAY94030.1| hypothetical protein OsI_15808 [Oryza sativa Indica Group]
Length=203

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQ  108
            S RE+LKRH  E+AGRV VP + WGQE LL++W+D ++FD  L P  LL+AR  L+++
Sbjct  121  SARERLKRHRREMAGRVWVP-DMWGQEKLLKDWVDCAAFDRPLVPPDLLTARRALVAE  177



>ref|XP_004246546.1| PREDICTED: uncharacterized protein LOC101264052 [Solanum lycopersicum]
Length=154

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (70%), Gaps = 2/66 (3%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACL-APKGLLSAREDLISQA  105
            SGRE+LKRH  EVAG V +P E WGQE LL++W+D S+FD+ L     ++SAR  L+ + 
Sbjct  81   SGRERLKRHRIEVAGHVWIP-EIWGQEELLKDWIDCSAFDSKLNNNNNIMSARAALVEER  139

Query  104  KRVCST  87
            +R  S+
Sbjct  140  RRNNSS  145



>gb|KCW74171.1| hypothetical protein EUGRSUZ_E02817 [Eucalyptus grandis]
Length=192

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = -3

Query  278  GREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAKR  99
            GRE L+RH  EVAG+V +P E WGQE LL++W+D S+F+A +AP  + SA+  L  + K+
Sbjct  122  GREMLQRHRVEVAGQVWIP-EIWGQEELLKDWVDCSAFEASMAPTKIYSAKAALTEEGKK  180

Query  98   VCSTVFK  78
              S   +
Sbjct  181  AKSGGLR  187



>ref|NP_001052737.1| Os04g0412100 [Oryza sativa Japonica Group]
 emb|CAD40657.2| OSJNBa0073L04.6 [Oryza sativa Japonica Group]
 dbj|BAF14651.1| Os04g0412100 [Oryza sativa Japonica Group]
 dbj|BAG98331.1| unnamed protein product [Oryza sativa Japonica Group]
Length=217

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = -3

Query  281  SGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQ  108
            S RE+LKRH  E+AGRV VP + WGQE LL++W+D ++FD  L P  LL+AR  L+++
Sbjct  121  SARERLKRHRREMAGRVWVP-DMWGQEKLLKDWVDCAAFDRPLVPPDLLTARRALVAE  177



>gb|EAZ30668.1| hypothetical protein OsJ_14724 [Oryza sativa Japonica Group]
Length=193

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -3

Query  284  HSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQ  108
             S RE+LKRH  E+AGRV VP + WGQE LL++W+D ++FD  L P  LL+AR  L+++
Sbjct  96   ESARERLKRHRREMAGRVWVP-DMWGQEKLLKDWVDCAAFDRPLVPPDLLTARRALVAE  153



>ref|XP_010907937.1| PREDICTED: uncharacterized protein LOC105034456 [Elaeis guineensis]
Length=123

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -3

Query  287  EHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQ  108
            E  GR++L+RH  E A R +  P+ WGQ GLL++W D S+F     PKG+ +ARE L+ +
Sbjct  50   EDCGRQRLRRHSFETA-RSICIPDTWGQAGLLKDWKDCSAFSTYFIPKGIATAREALVEE  108

Query  107  AKRVCSTVFK  78
             +R  S   K
Sbjct  109  FRRADSARLK  118



>gb|KEH42025.1| hypothetical protein MTR_1g059990 [Medicago truncatula]
Length=117

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = -3

Query  293  EKEHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKG-LLSAREDL  117
            E+E SGRE+LKRH  E+ GRV + P+ WGQE  L++W+D ++FD  L     +++AR  L
Sbjct  48   EEEESGRERLKRHRVEMGGRVWI-PDMWGQEEYLKDWIDCTTFDPPLISNSKIVTARTAL  106

Query  116  ISQAKRV  96
            + +A R+
Sbjct  107  VQEATRI  113



>ref|NP_001241197.1| uncharacterized protein LOC100810928 [Glycine max]
 gb|ACU24021.1| unknown [Glycine max]
 gb|KHN27647.1| hypothetical protein glysoja_026214 [Glycine soja]
Length=139

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 51/95 (54%), Gaps = 5/95 (5%)
 Frame = -3

Query  359  ECDSPVAATR----DVAMPENVAAAPEK-EHSGREKLKRHWTEVAGRVLVPPEKWGQEGL  195
            EC SP    +    +    EN+    +  E +GRE+LKR   EV    +  PE WGQE  
Sbjct  41   ECKSPNTNDKAKDPEKGHSENIGKVDDDVEETGRERLKRLREEVTMEKVNIPENWGQEPK  100

Query  194  LREWMDYSSFDACLAPKGLLSAREDLISQAKRVCS  90
            L++WMDY+ FDA      +++AR+ LI+  ++  S
Sbjct  101  LKDWMDYTMFDAFFPHSLIVTARDALIANTRKAKS  135



>ref|XP_004494175.1| PREDICTED: uncharacterized protein LOC101508117 isoform X1 [Cicer 
arietinum]
Length=204

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 55/99 (56%), Gaps = 4/99 (4%)
 Frame = -3

Query  386  RAQKAAAMMECDSPVAATRDV---AMPENVAAAPEKEHSGREKLKRHWTEVAGRVLVPPE  216
            + Q  +  + C+    A++DV    +         +E S RE+LKRH  EVAGRV +P E
Sbjct  58   QNQPVSKTILCNKETVASKDVEEKVLTTTSVNEVWEEESERERLKRHRVEVAGRVWIP-E  116

Query  215  KWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAKR  99
             WGQE LL++W+D S+FDA L P  +  AR  L+    R
Sbjct  117  IWGQEELLKDWIDCSAFDAPLVPSKITMARAALVEDGTR  155



>ref|XP_004494053.1| PREDICTED: uncharacterized protein LOC101497497 [Cicer arietinum]
Length=131

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 61/117 (52%), Gaps = 13/117 (11%)
 Frame = -3

Query  434  SSSVKDYRCNAVVSSPRAQKAAAMM---ECDSPVAATRDVAMPENVAAAPEKEHSGREKL  264
            S S  D++ +  +  P   K    +   E +     T+++   E++        SGRE+L
Sbjct  20   SESHHDHQIDQELKKPNQDKDNNNVKEQEHEQNDTNTKEIVEAEDI--------SGRERL  71

Query  263  KRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAP-KGLLSAREDLISQAKRV  96
            KRH  E+ GRV +P + WGQE  L++W+D + FD  L P   +L+AR  L+ + +R 
Sbjct  72   KRHRVEMGGRVWIP-DIWGQEEFLKDWIDCTVFDPPLLPANKILTARTALVEEGRRF  127



>emb|CCH47172.1| hypothetical protein [Lupinus angustifolius]
Length=139

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 2/65 (3%)
 Frame = -3

Query  287  EHSGREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMD-YSSFDACLAPKGLLSAREDLIS  111
            E S RE+LK+H  EVAGRV + PE WGQE  L +W+D  ++F   L P  + +A+E L+ 
Sbjct  65   EDSERERLKKHRVEVAGRVWI-PEIWGQENFLMDWIDCTTAFHVHLVPSKITTAQEALVE  123

Query  110  QAKRV  96
            + K+V
Sbjct  124  EGKKV  128



>ref|XP_003596820.1| Soft fertilization envelope protein [Medicago truncatula]
 gb|AES67071.1| hypothetical protein MTR_2g086480 [Medicago truncatula]
Length=305

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 63/116 (54%), Gaps = 13/116 (11%)
 Frame = -3

Query  410  CNAVVSSPRAQKAAAMMECDSPVAATRD----------VAMPENVAAAPEKEHSGREKLK  261
            C+   S    Q++   +EC+SP     D              +    A  +E +GRE+LK
Sbjct  21   CHIPTSLLSLQQSDYKLECNSPNKKNYDEIDDDDEKAKEEENKENGTARVEEITGRERLK  80

Query  260  RHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACL-APKGLL-SAREDLISQAKR  99
            RH  E+ G+V VP E W +E  L+EW+DY++FDA + AP  L+ +AR+ LI+  ++
Sbjct  81   RHREEMKGKVKVP-ENWEKEQKLKEWVDYTTFDALIFAPHALIVTARDALIADVRK  135



>ref|NP_001238535.1| uncharacterized protein LOC100500466 [Glycine max]
 gb|ACU15554.1| unknown [Glycine max]
 gb|KHN32875.1| hypothetical protein glysoja_038804 [Glycine soja]
Length=141

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 51/95 (54%), Gaps = 5/95 (5%)
 Frame = -3

Query  359  ECDSPVAATR----DVAMPENVAAAPE-KEHSGREKLKRHWTEVAGRVLVPPEKWGQEGL  195
            EC SP    +    +    EN+      +E +GRE+LKR   EV    +  PE WGQE  
Sbjct  43   ECKSPNTNDKAKDPEEGHSENIGKVDGVEEITGRERLKRLREEVTMDKVNIPENWGQEPK  102

Query  194  LREWMDYSSFDACLAPKGLLSAREDLISQAKRVCS  90
            L++WMDY+ FDA      +++AR+ LI+ A+   S
Sbjct  103  LKDWMDYTMFDAFFPHTLIVTARDALIANAREAKS  137



>ref|NP_001142972.1| uncharacterized protein LOC100275425 [Zea mays]
 gb|ACG27990.1| hypothetical protein [Zea mays]
Length=174

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = -3

Query  266  LKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPK-GLLSAREDLISQ  108
            LKRH TE+AGRV +P E WGQE LL++W+D + FD  LA   GLL+AR+ L+++
Sbjct  96   LKRHRTEMAGRVRIP-EMWGQERLLKDWVDCAVFDRPLAATAGLLTARDALVAE  148



>ref|NP_001142587.1| uncharacterized protein LOC100274851 [Zea mays]
 gb|ACG25294.1| hypothetical protein [Zea mays]
 gb|ACN29091.1| unknown [Zea mays]
Length=180

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = -3

Query  266  LKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPK-GLLSAREDLISQ  108
            LKRH TE+AGRV +P E WGQE LL++W+D + FD  LA   GLL+AR+ L+++
Sbjct  103  LKRHRTEMAGRVRIP-EMWGQERLLKDWVDCAVFDRPLAATAGLLTARDALVAE  155



>ref|XP_008681577.1| PREDICTED: uncharacterized protein LOC100274851 isoform X1 [Zea 
mays]
 gb|AFW71675.1| hypothetical protein ZEAMMB73_625537 [Zea mays]
Length=231

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = -3

Query  266  LKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPK-GLLSAREDLISQ  108
            LKRH TE+AGRV +P E WGQE LL++W+D + FD  LA   GLL+AR+ L+++
Sbjct  154  LKRHRTEMAGRVRIP-EMWGQERLLKDWVDCAVFDRPLAATAGLLTARDALVAE  206



>gb|KGN48263.1| hypothetical protein Csa_6G452640 [Cucumis sativus]
Length=130

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = -3

Query  266  LKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAKRV  96
            LKRH   VAG V +P +KWG+E  L++W+D S+F+A L   G++SAR  L   AKR+
Sbjct  47   LKRHRMAVAGHVWIP-DKWGKEEFLKDWIDGSAFEASLFHSGIVSARCALARDAKRL  102



>gb|EPS58384.1| hypothetical protein M569_16431, partial [Genlisea aurea]
Length=63

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = -3

Query  278  GREKLKRHWTEVAGRVLVPPEKWGQEGLLREWMDYSSFDACLAPKGLLSAREDLISQAKR  99
            G EKL+ H + VAGR+ VP + WGQE  L++W+D + FDA +    + +A+  LI   +R
Sbjct  1    GLEKLEMHRSAVAGRISVP-DAWGQEEFLKDWIDCTVFDAPIVSSRVSTAKALLIGDVRR  59



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380