BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF036D12

Length=710
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009771440.1|  PREDICTED: uncharacterized protein LOC104221976    304   1e-98   Nicotiana sylvestris
ref|XP_009617293.1|  PREDICTED: uncharacterized protein LOC104109646    298   2e-96   Nicotiana tomentosiformis
ref|XP_004245192.1|  PREDICTED: uncharacterized protein LOC101262737    295   5e-95   Solanum lycopersicum
ref|XP_006364278.1|  PREDICTED: uncharacterized protein LOC102598357    294   8e-95   Solanum tuberosum [potatoes]
ref|XP_011085499.1|  PREDICTED: uncharacterized protein LOC105167438    290   4e-93   Sesamum indicum [beniseed]
emb|CDP04798.1|  unnamed protein product                                288   2e-92   Coffea canephora [robusta coffee]
ref|XP_010254319.1|  PREDICTED: uncharacterized protein LOC104595325    283   2e-90   Nelumbo nucifera [Indian lotus]
gb|EYU21948.1|  hypothetical protein MIMGU_mgv1a0096341mg               281   4e-90   Erythranthe guttata [common monkey flower]
ref|XP_006399647.1|  hypothetical protein EUTSA_v10013887mg             280   8e-90   
ref|XP_011081926.1|  PREDICTED: uncharacterized protein LOC105164832    282   9e-90   Sesamum indicum [beniseed]
ref|XP_010453190.1|  PREDICTED: uncharacterized protein LOC104735158    281   1e-89   Camelina sativa [gold-of-pleasure]
ref|XP_006399646.1|  hypothetical protein EUTSA_v10013887mg             280   2e-89   Eutrema salsugineum [saltwater cress]
ref|XP_002515557.1|  conserved hypothetical protein                     280   3e-89   
ref|NP_196703.1|  uncharacterized protein                               279   4e-89   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010491872.1|  PREDICTED: uncharacterized protein LOC104769372    279   4e-89   Camelina sativa [gold-of-pleasure]
ref|XP_002871473.1|  hypothetical protein ARALYDRAFT_487977             279   8e-89   
gb|KDP33619.1|  hypothetical protein JCGZ_07190                         278   1e-88   Jatropha curcas
gb|AAN31807.1|  unknown protein                                         278   1e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287989.1|  hypothetical protein CARUB_v10001222mg             278   2e-88   Capsella rubella
ref|XP_010419712.1|  PREDICTED: uncharacterized protein LOC104705408    278   2e-88   Camelina sativa [gold-of-pleasure]
gb|AAM63507.1|  unknown                                                 277   3e-88   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57107.1|  AT5G25460                                              271   4e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009121952.1|  PREDICTED: uncharacterized protein LOC103846721    275   1e-87   Brassica rapa
ref|XP_004138737.1|  PREDICTED: uncharacterized protein LOC101219952    275   2e-87   Cucumis sativus [cucumbers]
ref|XP_010048991.1|  PREDICTED: uncharacterized protein LOC104437692    273   4e-87   Eucalyptus grandis [rose gum]
ref|XP_010249980.1|  PREDICTED: uncharacterized protein LOC104592350    274   4e-87   Nelumbo nucifera [Indian lotus]
dbj|BAD93856.1|  hypothetical protein                                   269   5e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125805.1|  PREDICTED: uncharacterized protein LOC103850771    274   6e-87   Brassica rapa
ref|XP_008445161.1|  PREDICTED: uncharacterized protein LOC103488281    276   6e-87   
emb|CDX85713.1|  BnaA02g01000D                                          274   6e-87   
ref|XP_010519935.1|  PREDICTED: uncharacterized protein LOC104799224    274   6e-87   Tarenaya hassleriana [spider flower]
ref|XP_010493802.1|  PREDICTED: uncharacterized protein LOC104771027    274   7e-87   Camelina sativa [gold-of-pleasure]
ref|XP_010454874.1|  PREDICTED: uncharacterized protein LOC104736571    274   7e-87   Camelina sativa [gold-of-pleasure]
ref|XP_010421395.1|  PREDICTED: uncharacterized protein LOC104706866    274   7e-87   Camelina sativa [gold-of-pleasure]
ref|XP_006287976.1|  hypothetical protein CARUB_v10001211mg             274   7e-87   Capsella rubella
emb|CDX91217.1|  BnaC02g03800D                                          273   9e-87   
gb|KFK25408.1|  hypothetical protein AALP_AA8G110600                    273   1e-86   Arabis alpina [alpine rockcress]
ref|XP_010541619.1|  PREDICTED: uncharacterized protein LOC104815031    273   1e-86   Tarenaya hassleriana [spider flower]
gb|KFK27809.1|  hypothetical protein AALP_AA8G432300                    273   1e-86   Arabis alpina [alpine rockcress]
ref|XP_006483312.1|  PREDICTED: uncharacterized protein LOC102608149    273   2e-86   Citrus sinensis [apfelsine]
emb|CDY19801.1|  BnaA09g04540D                                          273   2e-86   Brassica napus [oilseed rape]
ref|XP_008219896.1|  PREDICTED: uncharacterized protein LOC103320060    272   3e-86   Prunus mume [ume]
ref|XP_004291483.1|  PREDICTED: uncharacterized protein LOC101294330    272   3e-86   Fragaria vesca subsp. vesca
ref|XP_007223355.1|  hypothetical protein PRUPE_ppa007452mg             271   5e-86   Prunus persica
ref|NP_197928.1|  UF642 l-GalL-responsive protein 1                     271   8e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394799.1|  hypothetical protein EUTSA_v10004442mg             271   8e-86   Eutrema salsugineum [saltwater cress]
ref|XP_009345289.1|  PREDICTED: uncharacterized protein LOC103937097    271   1e-85   Pyrus x bretschneideri [bai li]
ref|XP_006450498.1|  hypothetical protein CICLE_v10008711mg             270   1e-85   Citrus clementina [clementine]
ref|XP_002872166.1|  hypothetical protein ARALYDRAFT_910605             270   1e-85   Arabidopsis lyrata subsp. lyrata
ref|XP_009334778.1|  PREDICTED: uncharacterized protein LOC103927565    270   1e-85   Pyrus x bretschneideri [bai li]
gb|AAL06839.1|  AT5g25460/F18G18_200                                    270   2e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010526203.1|  PREDICTED: uncharacterized protein LOC104803829    270   2e-85   Tarenaya hassleriana [spider flower]
emb|CDX97108.1|  BnaC09g45170D                                          270   2e-85   
gb|EPS73289.1|  hypothetical protein M569_01466                         269   3e-85   Genlisea aurea
ref|XP_007161233.1|  hypothetical protein PHAVU_001G053100g             269   3e-85   Phaseolus vulgaris [French bean]
gb|AAM61720.1|  unknown                                                 269   4e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002324280.2|  hypothetical protein POPTR_0018s01390g             270   6e-85   
ref|XP_008394047.1|  PREDICTED: uncharacterized protein LOC103456171    269   6e-85   
ref|XP_009129962.1|  PREDICTED: uncharacterized protein LOC103854751    268   8e-85   Brassica rapa
emb|CDY54909.1|  BnaC02g48660D                                          267   9e-85   Brassica napus [oilseed rape]
ref|XP_009151074.1|  PREDICTED: uncharacterized protein LOC103874406    268   9e-85   Brassica rapa
ref|XP_008378299.1|  PREDICTED: uncharacterized protein LOC103441403    268   9e-85   
gb|KHN06654.1|  hypothetical protein glysoja_037506                     268   1e-84   Glycine soja [wild soybean]
ref|XP_006601137.1|  PREDICTED: uncharacterized protein LOC100813...    268   1e-84   
ref|XP_003544618.1|  PREDICTED: uncharacterized protein LOC100776765    268   1e-84   Glycine max [soybeans]
ref|XP_002284962.1|  PREDICTED: uncharacterized protein LOC100252479    268   1e-84   Vitis vinifera
gb|KHG29602.1|  Allergen Act d 3                                        267   2e-84   Gossypium arboreum [tree cotton]
gb|KJB80694.1|  hypothetical protein B456_013G110800                    266   3e-84   Gossypium raimondii
ref|XP_011026488.1|  PREDICTED: uncharacterized protein LOC105127071    266   4e-84   Populus euphratica
emb|CAA06490.1|  hypothetical protein                                   260   4e-84   Cicer arietinum [garbanzo]
ref|XP_009407651.1|  PREDICTED: uncharacterized protein LOC103990295    266   4e-84   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB80693.1|  hypothetical protein B456_013G110800                    266   5e-84   Gossypium raimondii
ref|XP_006841925.1|  hypothetical protein AMTR_s00042p00185900          265   6e-84   
emb|CAA22573.1|  putative protein                                       265   6e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011019764.1|  PREDICTED: uncharacterized protein LOC105122387    265   6e-84   Populus euphratica
ref|XP_011019761.1|  PREDICTED: uncharacterized protein LOC105122382    265   1e-83   Populus euphratica
ref|XP_002867243.1|  hypothetical protein ARALYDRAFT_913203             265   2e-83   Arabidopsis lyrata subsp. lyrata
dbj|BAE98407.1|  hypothetical protein                                   265   2e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007013814.1|  Uncharacterized protein isoform 2                  265   2e-83   Theobroma cacao [chocolate]
ref|XP_006412472.1|  hypothetical protein EUTSA_v10025706mg             263   2e-83   
ref|XP_006285882.1|  hypothetical protein CARUB_v10007385mg             264   3e-83   
emb|CDX80516.1|  BnaC07g29280D                                          262   3e-83   
ref|XP_003588711.1|  hypothetical protein MTR_1g011800                  263   3e-83   
ref|NP_567894.1|  uncharacterized protein                               264   4e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007013813.1|  Uncharacterized protein isoform 1                  265   5e-83   
gb|KJB07801.1|  hypothetical protein B456_001G045200                    263   9e-83   Gossypium raimondii
gb|KJB07802.1|  hypothetical protein B456_001G045200                    263   1e-82   Gossypium raimondii
gb|KHG19965.1|  putative e3 ubiquitin-protein ligase hul4               263   1e-82   Gossypium arboreum [tree cotton]
gb|ACJ84308.1|  unknown                                                 263   1e-82   Medicago truncatula
gb|AES58962.2|  plant/F18G18-200 protein                                263   1e-82   Medicago truncatula
gb|ABK94923.1|  unknown                                                 262   2e-82   Populus trichocarpa [western balsam poplar]
ref|XP_010432718.1|  PREDICTED: uncharacterized protein LOC104716937    261   4e-82   Camelina sativa [gold-of-pleasure]
ref|XP_010447383.1|  PREDICTED: uncharacterized protein LOC104730027    261   4e-82   Camelina sativa [gold-of-pleasure]
ref|XP_002308647.2|  hypothetical protein POPTR_0006s26630g             263   6e-82   
emb|CDX68849.1|  BnaC01g06040D                                          261   8e-82   
ref|XP_009401767.1|  PREDICTED: uncharacterized protein LOC103985700    260   1e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010918669.1|  PREDICTED: uncharacterized protein LOC105042950    260   1e-81   Elaeis guineensis
gb|AAB41813.1|  unknown protein                                         260   2e-81   Medicago sativa [alfalfa]
ref|XP_004498654.1|  PREDICTED: uncharacterized protein LOC101508759    259   2e-81   Cicer arietinum [garbanzo]
ref|XP_010106829.1|  hypothetical protein L484_006602                   254   3e-81   
ref|XP_009125963.1|  PREDICTED: uncharacterized protein LOC103850912    259   3e-81   Brassica rapa
emb|CDX69757.1|  BnaA10g21060D                                          275   4e-81   
ref|XP_010048243.1|  PREDICTED: uncharacterized protein LOC104437065    258   1e-80   Eucalyptus grandis [rose gum]
ref|XP_006341715.1|  PREDICTED: uncharacterized protein LOC102601890    257   2e-80   
ref|XP_004235717.1|  PREDICTED: uncharacterized protein LOC101252763    257   2e-80   Solanum lycopersicum
ref|XP_009389493.1|  PREDICTED: uncharacterized protein LOC103976040    257   3e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009778816.1|  PREDICTED: uncharacterized protein LOC104228110    256   4e-80   Nicotiana sylvestris
ref|XP_004241713.1|  PREDICTED: uncharacterized protein LOC101268115    256   6e-80   Solanum lycopersicum
ref|XP_010914930.1|  PREDICTED: uncharacterized protein LOC105040204    256   7e-80   Elaeis guineensis
ref|XP_010670694.1|  PREDICTED: uncharacterized protein LOC104887687    256   7e-80   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG21629.1|  GTPase Der                                              253   1e-79   Gossypium arboreum [tree cotton]
ref|XP_009590498.1|  PREDICTED: uncharacterized protein LOC104087663    255   2e-79   Nicotiana tomentosiformis
ref|XP_009591297.1|  PREDICTED: uncharacterized protein LOC104088341    254   2e-79   Nicotiana tomentosiformis
ref|XP_008775036.1|  PREDICTED: uncharacterized protein LOC103695476    254   2e-79   Phoenix dactylifera
gb|KJB70569.1|  hypothetical protein B456_011G080100                    253   3e-79   Gossypium raimondii
ref|XP_008792101.1|  PREDICTED: uncharacterized protein LOC103708794    254   3e-79   Phoenix dactylifera
ref|XP_010654739.1|  PREDICTED: uncharacterized protein LOC100261739    254   3e-79   Vitis vinifera
ref|XP_002517567.1|  conserved hypothetical protein                     254   5e-79   Ricinus communis
gb|KJB70568.1|  hypothetical protein B456_011G080100                    254   5e-79   Gossypium raimondii
gb|KHG06895.1|  Agmatine deiminase                                      254   6e-79   Gossypium arboreum [tree cotton]
emb|CBI36253.3|  unnamed protein product                                254   9e-79   Vitis vinifera
ref|XP_006356190.1|  PREDICTED: uncharacterized protein LOC102589576    253   1e-78   Solanum tuberosum [potatoes]
ref|XP_009758146.1|  PREDICTED: uncharacterized protein LOC104210873    252   2e-78   Nicotiana sylvestris
gb|KHN07099.1|  hypothetical protein glysoja_023282                     251   2e-78   Glycine soja [wild soybean]
ref|XP_007023946.1|  Uncharacterized protein TCM_028364                 252   3e-78   Theobroma cacao [chocolate]
ref|XP_006581022.1|  PREDICTED: uncharacterized protein LOC100802...    251   3e-78   
ref|XP_010110340.1|  GTP-binding nuclear protein                        257   4e-78   
ref|XP_007150706.1|  hypothetical protein PHAVU_005G1745000g            248   1e-77   Phaseolus vulgaris [French bean]
ref|XP_006346648.1|  PREDICTED: uncharacterized protein LOC102598480    250   2e-77   
gb|AFK48067.1|  unknown                                                 243   3e-77   Lotus japonicus
gb|AGV54541.1|  hypothetical protein                                    249   5e-77   Phaseolus vulgaris [French bean]
ref|XP_003531698.1|  PREDICTED: uncharacterized protein LOC100779277    248   5e-77   Glycine max [soybeans]
gb|KHN47787.1|  hypothetical protein glysoja_029205                     248   6e-77   Glycine soja [wild soybean]
ref|XP_011081171.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    248   6e-77   Sesamum indicum [beniseed]
gb|KHN07098.1|  hypothetical protein glysoja_023281                     247   7e-77   Glycine soja [wild soybean]
ref|XP_010061944.1|  PREDICTED: uncharacterized protein LOC104449472    248   7e-77   Eucalyptus grandis [rose gum]
gb|KDP37140.1|  hypothetical protein JCGZ_06196                         248   8e-77   Jatropha curcas
ref|XP_011072257.1|  PREDICTED: uncharacterized protein LOC105157546    248   1e-76   
gb|KHG10708.1|  Allergen Act d 3                                        247   2e-76   Gossypium arboreum [tree cotton]
ref|XP_004486698.1|  PREDICTED: uncharacterized protein LOC101495368    247   2e-76   Cicer arietinum [garbanzo]
ref|XP_009598172.1|  PREDICTED: uncharacterized protein LOC104094024    247   2e-76   Nicotiana tomentosiformis
ref|XP_003526423.1|  PREDICTED: uncharacterized protein LOC100801917    246   4e-76   
gb|KJB68131.1|  hypothetical protein B456_010G227400                    246   6e-76   Gossypium raimondii
dbj|BAK03126.1|  predicted protein                                      245   9e-76   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002303263.1|  hypothetical protein POPTR_0003s05850g             245   1e-75   
ref|XP_011040006.1|  PREDICTED: uncharacterized protein LOC105136392    246   1e-75   Populus euphratica
ref|XP_011466738.1|  PREDICTED: uncharacterized protein LOC101306...    243   2e-75   Fragaria vesca subsp. vesca
ref|XP_009764126.1|  PREDICTED: uncharacterized protein LOC104215887    244   2e-75   Nicotiana sylvestris
ref|XP_004252488.1|  PREDICTED: uncharacterized protein LOC101250580    244   3e-75   Solanum lycopersicum
ref|XP_009333642.1|  PREDICTED: uncharacterized protein LOC103926567    244   4e-75   Pyrus x bretschneideri [bai li]
gb|EMS52012.1|  hypothetical protein TRIUR3_31218                       242   4e-75   Triticum urartu
ref|XP_011466736.1|  PREDICTED: uncharacterized protein LOC101306...    243   6e-75   Fragaria vesca subsp. vesca
ref|XP_011035644.1|  PREDICTED: uncharacterized protein LOC105133377    243   7e-75   Populus euphratica
ref|NP_001242447.1|  uncharacterized protein LOC100802444 precursor     242   1e-74   Glycine max [soybeans]
ref|XP_008347484.1|  PREDICTED: uncharacterized protein LOC103410579    242   2e-74   Malus domestica [apple tree]
gb|EYU24667.1|  hypothetical protein MIMGU_mgv1a008541mg                241   2e-74   Erythranthe guttata [common monkey flower]
ref|XP_009348421.1|  PREDICTED: uncharacterized protein LOC103940075    242   2e-74   Pyrus x bretschneideri [bai li]
ref|XP_003597843.1|  hypothetical protein MTR_2g103170                  241   3e-74   Medicago truncatula
ref|XP_008377611.1|  PREDICTED: uncharacterized protein LOC103440696    241   3e-74   Malus domestica [apple tree]
ref|XP_008228640.1|  PREDICTED: uncharacterized protein LOC103328032    241   3e-74   Prunus mume [ume]
ref|XP_002298115.2|  hypothetical protein POPTR_0001s17430g             242   4e-74   Populus trichocarpa [western balsam poplar]
gb|KHN44154.1|  hypothetical protein glysoja_031815                     241   4e-74   Glycine soja [wild soybean]
ref|XP_007217604.1|  hypothetical protein PRUPE_ppa018156mg             241   4e-74   Prunus persica
gb|EMT16005.1|  hypothetical protein F775_13621                         240   4e-74   
dbj|BAD16016.1|  unknown protein                                        238   1e-73   Oryza sativa Japonica Group [Japonica rice]
gb|KJB70570.1|  hypothetical protein B456_011G080200                    234   2e-73   Gossypium raimondii
gb|EEE56530.1|  hypothetical protein OsJ_05823                          239   4e-73   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002453515.1|  hypothetical protein SORBIDRAFT_04g007160          238   5e-73   
ref|XP_010088264.1|  hypothetical protein L484_005140                   238   5e-73   Morus notabilis
gb|EYU21602.1|  hypothetical protein MIMGU_mgv1a008411mg                238   7e-73   Erythranthe guttata [common monkey flower]
gb|KHG21630.1|  Adenosylhomocysteinase                                  238   8e-73   Gossypium arboreum [tree cotton]
gb|EEC72709.1|  hypothetical protein OsI_06304                          238   8e-73   Oryza sativa Indica Group [Indian rice]
ref|NP_001046247.2|  Os02g0205200                                       237   1e-72   
ref|XP_006465391.1|  PREDICTED: uncharacterized protein LOC102618171    237   1e-72   Citrus sinensis [apfelsine]
ref|XP_010539514.1|  PREDICTED: uncharacterized protein LOC104813570    236   2e-72   Tarenaya hassleriana [spider flower]
emb|CDO98109.1|  unnamed protein product                                235   2e-72   Coffea canephora [robusta coffee]
gb|KFK42429.1|  hypothetical protein AALP_AA2G255100                    236   5e-72   Arabis alpina [alpine rockcress]
ref|XP_004951511.1|  PREDICTED: uncharacterized protein LOC101755979    235   7e-72   Setaria italica
ref|XP_002887838.1|  hypothetical protein ARALYDRAFT_340195             235   9e-72   Arabidopsis lyrata subsp. lyrata
ref|XP_010417734.1|  PREDICTED: uncharacterized protein LOC104703420    233   8e-71   Camelina sativa [gold-of-pleasure]
ref|XP_006427179.1|  hypothetical protein CICLE_v10025880mg             233   9e-71   Citrus clementina [clementine]
ref|XP_010429991.1|  PREDICTED: uncharacterized protein LOC104714356    232   1e-70   Camelina sativa [gold-of-pleasure]
ref|NP_178141.1|  protein DUF642 L-GALL RESPONSIVE GENE 1               232   1e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006301335.1|  hypothetical protein CARUB_v10021745mg             232   2e-70   Capsella rubella
ref|XP_010472958.1|  PREDICTED: uncharacterized protein LOC104752499    231   4e-70   Camelina sativa [gold-of-pleasure]
gb|KDO83473.1|  hypothetical protein CISIN_1g017636mg                   228   8e-70   Citrus sinensis [apfelsine]
emb|CDY54317.1|  BnaC06g43150D                                          229   2e-69   Brassica napus [oilseed rape]
ref|XP_008362680.1|  PREDICTED: uncharacterized protein LOC103426358    228   2e-69   
ref|XP_006439076.1|  hypothetical protein CICLE_v10031881mg             227   9e-69   Citrus clementina [clementine]
emb|CDO98108.1|  unnamed protein product                                226   3e-68   Coffea canephora [robusta coffee]
emb|CDY57694.1|  BnaA07g38340D                                          225   5e-68   Brassica napus [oilseed rape]
ref|XP_009104452.1|  PREDICTED: uncharacterized protein LOC103830427    226   8e-68   Brassica rapa
ref|NP_001140426.1|  hypothetical protein precursor                     224   1e-67   Zea mays [maize]
dbj|BAD52536.1|  unknown protein                                        221   4e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010241207.1|  PREDICTED: uncharacterized protein LOC104585883    223   4e-67   Nelumbo nucifera [Indian lotus]
ref|XP_010257157.1|  PREDICTED: uncharacterized protein LOC104597377    222   1e-66   Nelumbo nucifera [Indian lotus]
gb|ABF99456.1|  expressed protein                                       219   2e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010534242.1|  PREDICTED: uncharacterized protein LOC104809851    220   3e-66   Tarenaya hassleriana [spider flower]
dbj|BAB21293.1|  unknown protein                                        220   5e-66   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001043549.2|  Os01g0611000                                       220   8e-66   
ref|XP_006389772.1|  hypothetical protein EUTSA_v10018730mg             219   1e-65   Eutrema salsugineum [saltwater cress]
emb|CDP07813.1|  unnamed protein product                                219   2e-65   Coffea canephora [robusta coffee]
gb|EAY92272.1|  hypothetical protein OsI_13995                          218   3e-65   Oryza sativa Indica Group [Indian rice]
ref|XP_003564086.1|  PREDICTED: uncharacterized protein LOC100845370    219   3e-65   Brachypodium distachyon [annual false brome]
ref|XP_006826721.1|  hypothetical protein AMTR_s00264p00012960          218   3e-65   
ref|XP_004149718.1|  PREDICTED: uncharacterized protein LOC101216438    218   4e-65   Cucumis sativus [cucumbers]
gb|KJB24990.1|  hypothetical protein B456_004G171200                    218   4e-65   Gossypium raimondii
ref|XP_008245331.1|  PREDICTED: uncharacterized protein LOC103343457    218   5e-65   Prunus mume [ume]
dbj|BAK03627.1|  predicted protein                                      217   6e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001051644.1|  Os03g0807700                                       218   6e-65   
gb|KHG12815.1|  DNA-directed RNA polymerase subunit beta''              218   6e-65   Gossypium arboreum [tree cotton]
gb|KJB24991.1|  hypothetical protein B456_004G171200                    218   9e-65   Gossypium raimondii
ref|XP_004969140.1|  PREDICTED: uncharacterized protein LOC101755969    217   1e-64   Setaria italica
ref|XP_002517797.1|  conserved hypothetical protein                     216   2e-64   Ricinus communis
ref|XP_010067858.1|  PREDICTED: uncharacterized protein LOC104454644    216   2e-64   Eucalyptus grandis [rose gum]
ref|XP_007052493.1|  F17A17.37 protein                                  216   2e-64   
gb|KDP43556.1|  hypothetical protein JCGZ_16843                         216   2e-64   Jatropha curcas
ref|XP_006845336.1|  hypothetical protein AMTR_s00141p00085330          215   3e-64   Amborella trichopoda
ref|XP_007201993.1|  hypothetical protein PRUPE_ppa024647mg             216   4e-64   
ref|XP_008461812.1|  PREDICTED: uncharacterized protein LOC103500323    214   7e-64   Cucumis melo [Oriental melon]
gb|EMT06486.1|  hypothetical protein F775_26416                         214   7e-64   
gb|EMT25156.1|  hypothetical protein F775_26385                         215   8e-64   
dbj|BAJ89665.1|  predicted protein                                      215   1e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011048055.1|  PREDICTED: uncharacterized protein LOC105142230    214   1e-63   Populus euphratica
ref|XP_011016219.1|  PREDICTED: uncharacterized protein LOC105119742    213   2e-63   Populus euphratica
ref|XP_002308027.2|  hypothetical protein POPTR_0006s04880g             213   2e-63   
ref|XP_007218161.1|  hypothetical protein PRUPE_ppa007461mg             211   2e-63   
ref|XP_004981346.1|  PREDICTED: uncharacterized protein LOC101768647    214   3e-63   Setaria italica
ref|XP_003569339.1|  PREDICTED: uncharacterized protein LOC100821501    213   3e-63   Brachypodium distachyon [annual false brome]
ref|XP_002455939.1|  hypothetical protein SORBIDRAFT_03g027650          213   3e-63   
gb|KJB36028.1|  hypothetical protein B456_006G137000                    213   3e-63   Gossypium raimondii
ref|XP_010057181.1|  PREDICTED: uncharacterized protein LOC104445070    213   3e-63   Eucalyptus grandis [rose gum]
ref|XP_002299934.2|  hypothetical protein POPTR_0001s27110g             213   4e-63   Populus trichocarpa [western balsam poplar]
ref|XP_004307221.1|  PREDICTED: uncharacterized protein LOC101292742    213   4e-63   Fragaria vesca subsp. vesca
ref|XP_006411450.1|  hypothetical protein EUTSA_v10016825mg             213   4e-63   Eutrema salsugineum [saltwater cress]
gb|KHG07966.1|  Imidazolonepropionase                                   213   4e-63   Gossypium arboreum [tree cotton]
ref|XP_011047367.1|  PREDICTED: uncharacterized protein LOC105141733    212   4e-63   Populus euphratica
ref|XP_011013325.1|  PREDICTED: uncharacterized protein LOC105117377    212   4e-63   Populus euphratica
ref|XP_008392232.1|  PREDICTED: uncharacterized protein LOC103454416    212   5e-63   
ref|XP_002308942.2|  hypothetical protein POPTR_0006s04890g             212   6e-63   Populus trichocarpa [western balsam poplar]
ref|XP_002276894.1|  PREDICTED: uncharacterized protein LOC100258445    212   8e-63   Vitis vinifera
ref|XP_010241208.1|  PREDICTED: uncharacterized protein LOC104585885    211   1e-62   Nelumbo nucifera [Indian lotus]
gb|KJB19256.1|  hypothetical protein B456_003G091800                    209   1e-62   Gossypium raimondii
ref|XP_002466246.1|  hypothetical protein SORBIDRAFT_01g004270          212   1e-62   Sorghum bicolor [broomcorn]
ref|XP_009355525.1|  PREDICTED: uncharacterized protein LOC103946533    211   1e-62   Pyrus x bretschneideri [bai li]
gb|AFK44456.1|  unknown                                                 205   1e-62   Lotus japonicus
ref|XP_009418805.1|  PREDICTED: uncharacterized protein LOC103998920    211   2e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007218160.1|  hypothetical protein PRUPE_ppa007461mg             211   2e-62   Prunus persica
ref|XP_010695068.1|  PREDICTED: uncharacterized protein LOC104907775    211   2e-62   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU43005.1|  hypothetical protein MIMGU_mgv1a011073mg                208   2e-62   Erythranthe guttata [common monkey flower]
ref|XP_007028767.1|  F17A17.37 protein                                  210   3e-62   
ref|XP_009142779.1|  PREDICTED: uncharacterized protein LOC103866589    210   3e-62   Brassica rapa
ref|XP_010257158.1|  PREDICTED: uncharacterized protein LOC104597378    210   4e-62   Nelumbo nucifera [Indian lotus]
gb|KJB19257.1|  hypothetical protein B456_003G091800                    209   4e-62   Gossypium raimondii
ref|XP_009355498.1|  PREDICTED: uncharacterized protein LOC103946508    209   5e-62   Pyrus x bretschneideri [bai li]
gb|KHN11697.1|  hypothetical protein glysoja_006150                     209   6e-62   Glycine soja [wild soybean]
ref|XP_009758716.1|  PREDICTED: uncharacterized protein LOC104211372    209   7e-62   Nicotiana sylvestris
ref|XP_008776092.1|  PREDICTED: uncharacterized protein LOC103696299    209   7e-62   Phoenix dactylifera
ref|NP_001144239.1|  uncharacterized protein LOC100277106 precursor     210   8e-62   
gb|KDP26060.1|  hypothetical protein JCGZ_21093                         209   1e-61   Jatropha curcas
gb|KDO53673.1|  hypothetical protein CISIN_1g017355mg                   209   1e-61   Citrus sinensis [apfelsine]
ref|XP_006489938.1|  PREDICTED: uncharacterized protein LOC102625022    209   1e-61   Citrus sinensis [apfelsine]
ref|XP_010937268.1|  PREDICTED: uncharacterized protein LOC105056672    209   1e-61   Elaeis guineensis
ref|XP_010517673.1|  PREDICTED: uncharacterized protein LOC104793095    208   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_006345424.1|  PREDICTED: uncharacterized protein LOC102582371    208   2e-61   Solanum tuberosum [potatoes]
tpg|DAA52069.1|  TPA: hypothetical protein ZEAMMB73_133538              209   2e-61   
ref|XP_006296392.1|  hypothetical protein CARUB_v10025565mg             208   2e-61   Capsella rubella
ref|XP_010508668.1|  PREDICTED: uncharacterized protein LOC104785200    208   2e-61   Camelina sativa [gold-of-pleasure]
gb|AGV54808.1|  hypothetical protein                                    208   2e-61   Phaseolus vulgaris [French bean]
ref|XP_007148907.1|  hypothetical protein PHAVU_005G024100g             208   2e-61   Phaseolus vulgaris [French bean]
ref|NP_001241275.1|  uncharacterized protein LOC100796094 precursor     208   2e-61   Glycine max [soybeans]
ref|NP_001239749.1|  uncharacterized protein LOC100804119 precursor     208   3e-61   Glycine max [soybeans]
gb|KHN45084.1|  hypothetical protein glysoja_040000                     207   3e-61   Glycine soja [wild soybean]
ref|XP_004229647.1|  PREDICTED: uncharacterized protein LOC101251618    209   3e-61   
ref|XP_010546243.1|  PREDICTED: uncharacterized protein LOC104818346    207   5e-61   Tarenaya hassleriana [spider flower]
ref|XP_010445004.1|  PREDICTED: uncharacterized protein LOC104727612    206   5e-61   
ref|XP_002313314.1|  hypothetical protein POPTR_0009s06370g             207   5e-61   Populus trichocarpa [western balsam poplar]
ref|XP_008231461.1|  PREDICTED: uncharacterized protein LOC103330638    209   6e-61   Prunus mume [ume]
ref|XP_009630913.1|  PREDICTED: uncharacterized protein LOC104120779    207   6e-61   Nicotiana tomentosiformis
ref|XP_010505974.1|  PREDICTED: uncharacterized protein LOC104782672    207   6e-61   
ref|XP_003534397.1|  PREDICTED: uncharacterized protein LOC100812299    207   7e-61   
emb|CDX79912.1|  BnaA05g02440D                                          209   9e-61   
gb|AFK34548.1|  unknown                                                 206   1e-60   
gb|AFK39148.1|  unknown                                                 206   1e-60   
gb|KEH17090.1|  DUF642 family protein                                   206   2e-60   
gb|AFK39561.1|  unknown                                                 206   2e-60   
ref|XP_011033339.1|  PREDICTED: uncharacterized protein LOC105131855    206   2e-60   
ref|XP_002881799.1|  hypothetical protein ARALYDRAFT_483261             205   3e-60   
ref|XP_009379646.1|  PREDICTED: uncharacterized protein LOC103968043    210   3e-60   
ref|XP_006421409.1|  hypothetical protein CICLE_v10005198mg             205   3e-60   
ref|XP_008375195.1|  PREDICTED: uncharacterized protein LOC103438421    205   3e-60   
ref|NP_181712.1|  uncharacterized protein                               205   4e-60   
ref|XP_002532070.1|  conserved hypothetical protein                     204   5e-60   
gb|ACG40327.1|  hypothetical protein                                    205   5e-60   
ref|XP_008672703.1|  PREDICTED: hypothetical protein isoform X1         205   6e-60   
gb|KHN32410.1|  hypothetical protein glysoja_026304                     203   6e-60   
ref|XP_010672846.1|  PREDICTED: uncharacterized protein LOC104889...    204   6e-60   
ref|XP_009354784.1|  PREDICTED: uncharacterized protein LOC103945912    204   6e-60   
ref|XP_006489949.1|  PREDICTED: uncharacterized protein LOC102629059    204   9e-60   
ref|XP_002322719.1|  hypothetical protein POPTR_0016s05640g             204   1e-59   
emb|CAH67378.1|  OSIGBa0159F11.2                                        203   2e-59   
ref|XP_008363312.1|  PREDICTED: uncharacterized protein LOC103427013    203   2e-59   
ref|NP_001145978.1|  hypothetical protein                               204   2e-59   
ref|XP_010554835.1|  PREDICTED: uncharacterized protein LOC104824444    203   2e-59   
ref|XP_003605795.1|  hypothetical protein MTR_4g039740                  202   3e-59   
gb|KDO52908.1|  hypothetical protein CISIN_1g0399092mg                  201   3e-59   
ref|XP_011025472.1|  PREDICTED: uncharacterized protein LOC105126334    202   3e-59   
ref|XP_011091660.1|  PREDICTED: uncharacterized protein LOC105172024    202   3e-59   
ref|XP_006421407.1|  hypothetical protein CICLE_v10006613mg             202   4e-59   
gb|EAY74932.1|  hypothetical protein OsI_02826                          202   4e-59   
ref|XP_004499913.1|  PREDICTED: uncharacterized protein LOC101495888    202   6e-59   
ref|XP_003605793.1|  hypothetical protein MTR_4g039720                  202   6e-59   
gb|AES87990.2|  DUF642 family protein                                   202   7e-59   
emb|CDY48765.1|  BnaC04g02180D                                          203   7e-59   
ref|XP_006407770.1|  hypothetical protein EUTSA_v10020990mg             201   7e-59   
ref|XP_006294452.1|  hypothetical protein CARUB_v10023465mg             201   8e-59   
ref|XP_004506314.1|  PREDICTED: uncharacterized protein LOC101488216    201   1e-58   
ref|NP_181711.1|  uncharacterized protein                               201   2e-58   
ref|XP_002881800.1|  hypothetical protein ARALYDRAFT_483262             201   2e-58   
ref|XP_010672845.1|  PREDICTED: uncharacterized protein LOC104889...    201   2e-58   
ref|XP_002882567.1|  hypothetical protein ARALYDRAFT_478145             199   2e-58   
ref|XP_011087959.1|  PREDICTED: uncharacterized protein LOC105169285    200   2e-58   
emb|CAE01677.2|  OSJNBb0091E11.19                                       200   2e-58   
ref|XP_008364711.1|  PREDICTED: uncharacterized protein LOC103428382    200   3e-58   
ref|XP_010505975.1|  PREDICTED: uncharacterized protein LOC104782673    200   3e-58   
ref|NP_974254.1|  germination-related protein                           198   4e-58   
gb|EYU20209.1|  hypothetical protein MIMGU_mgv1a008620mg                199   4e-58   
tpg|DAA37152.1|  TPA: hypothetical protein ZEAMMB73_071426              199   6e-58   
ref|XP_009142006.1|  PREDICTED: uncharacterized protein LOC103865900    199   6e-58   
ref|XP_010461096.1|  PREDICTED: uncharacterized protein LOC104741840    199   7e-58   
ref|XP_010486384.1|  PREDICTED: uncharacterized protein LOC104764532    199   8e-58   
ref|XP_010517674.1|  PREDICTED: uncharacterized protein LOC104793096    199   8e-58   
ref|XP_002283940.2|  PREDICTED: uncharacterized protein LOC100257236    199   9e-58   
ref|XP_010691193.1|  PREDICTED: uncharacterized protein LOC104904598    199   9e-58   
gb|EPS66311.1|  hypothetical protein M569_08463                         198   1e-57   
emb|CDY22149.1|  BnaC01g39520D                                          198   1e-57   
ref|NP_566328.1|  germination-related protein                           198   1e-57   
ref|XP_009123974.1|  PREDICTED: uncharacterized protein LOC103848900    198   1e-57   
ref|XP_010673134.1|  PREDICTED: uncharacterized protein LOC104889574    198   1e-57   
gb|EAY94676.1|  hypothetical protein OsI_16455                          198   2e-57   
ref|XP_006297975.1|  hypothetical protein CARUB_v10014019mg             198   2e-57   
gb|KFK37021.1|  hypothetical protein AALP_AA4G201900                    198   2e-57   
emb|CDY28002.1|  BnaC05g44040D                                          197   2e-57   
ref|XP_010464451.1|  PREDICTED: uncharacterized protein LOC104744998    197   2e-57   
emb|CDY14785.1|  BnaC04g47820D                                          198   2e-57   
emb|CAH67292.1|  OSIGBa0103O01.10                                       197   2e-57   
gb|EMS63052.1|  hypothetical protein TRIUR3_01733                       197   3e-57   
emb|CDX79913.1|  BnaA05g02430D                                          192   3e-57   
ref|XP_010508664.1|  PREDICTED: uncharacterized protein LOC104785...    197   3e-57   
gb|EYU20746.1|  hypothetical protein MIMGU_mgv1a008437mg                197   3e-57   
gb|EMT04285.1|  hypothetical protein F775_14657                         197   4e-57   
ref|XP_003580051.1|  PREDICTED: uncharacterized protein LOC100841904    197   5e-57   
ref|XP_006652463.1|  PREDICTED: uncharacterized protein LOC102714172    197   5e-57   
emb|CDY48764.1|  BnaC04g02170D                                          191   6e-57   
ref|XP_009147007.1|  PREDICTED: uncharacterized protein LOC103870618    196   7e-57   
ref|XP_010673132.1|  PREDICTED: uncharacterized protein LOC104889572    196   8e-57   
ref|XP_008460770.1|  PREDICTED: uncharacterized protein LOC103499530    196   8e-57   
ref|NP_001053188.1|  Os04g0494600                                       196   1e-56   
emb|CAE01676.2|  OSJNBb0091E11.17                                       196   1e-56   
ref|XP_004978108.1|  PREDICTED: uncharacterized protein LOC101762525    196   1e-56   
ref|NP_001053189.1|  Os04g0494800                                       196   2e-56   
emb|CDY06908.1|  BnaA04g24070D                                          195   2e-56   
ref|XP_003605789.1|  hypothetical protein MTR_4g039680                  195   3e-56   
ref|XP_010673133.1|  PREDICTED: uncharacterized protein LOC104889573    195   3e-56   
ref|XP_006411449.1|  hypothetical protein EUTSA_v10017674mg             194   4e-56   
gb|KJB36031.1|  hypothetical protein B456_006G137000                    194   6e-56   
ref|XP_002446724.1|  hypothetical protein SORBIDRAFT_06g021280          194   9e-56   
ref|XP_010097437.1|  hypothetical protein L484_003208                   194   9e-56   
ref|XP_004149398.1|  PREDICTED: uncharacterized protein LOC101213859    193   1e-55   
ref|XP_004162183.1|  PREDICTED: uncharacterized LOC101213859            193   1e-55   
ref|XP_006411448.1|  hypothetical protein EUTSA_v10016810mg             193   1e-55   
emb|CAN80832.1|  hypothetical protein VITISV_002505                     199   2e-55   
ref|XP_009142778.1|  PREDICTED: uncharacterized protein LOC103866588    192   2e-55   
emb|CAH67377.1|  OSIGBa0159F11.1                                        192   2e-55   
ref|XP_006350194.1|  PREDICTED: uncharacterized protein LOC102578783    192   3e-55   
ref|XP_004978106.1|  PREDICTED: uncharacterized protein LOC101761311    191   7e-55   
ref|XP_008669229.1|  PREDICTED: uncharacterized protein LOC103646276    191   8e-55   
ref|XP_002446728.1|  hypothetical protein SORBIDRAFT_06g021320          191   9e-55   
emb|CAD41548.2|  OSJNBb0091E11.18                                       191   1e-54   
ref|XP_009587019.1|  PREDICTED: uncharacterized protein LOC104084774    191   1e-54   
ref|XP_008669227.1|  PREDICTED: uncharacterized protein LOC103646275    191   1e-54   
ref|XP_009775467.1|  PREDICTED: uncharacterized protein LOC104225390    191   1e-54   
ref|NP_001053190.1|  Os04g0494900                                       191   1e-54   
ref|XP_004236613.1|  PREDICTED: uncharacterized protein LOC101245049    190   2e-54   
tpg|DAA37149.1|  TPA: hypothetical protein ZEAMMB73_398073              189   5e-54   
ref|XP_004976082.1|  PREDICTED: uncharacterized protein LOC101765204    187   2e-53   
emb|CDP21696.1|  unnamed protein product                                187   3e-53   
ref|XP_006653557.1|  PREDICTED: uncharacterized protein LOC102718925    187   4e-53   
ref|NP_001141282.1|  hypothetical protein precursor                     186   5e-53   
ref|XP_011078904.1|  PREDICTED: uncharacterized protein LOC105162545    186   7e-53   
gb|EEC81716.1|  hypothetical protein OsI_25327                          186   9e-53   
ref|XP_003581385.1|  PREDICTED: uncharacterized protein LOC100824265    186   1e-52   
emb|CDY39990.1|  BnaC06g40680D                                          185   1e-52   
ref|XP_004236614.1|  PREDICTED: uncharacterized protein LOC101245348    185   1e-52   
ref|XP_006350197.1|  PREDICTED: uncharacterized protein LOC102579762    185   2e-52   
ref|XP_006653558.1|  PREDICTED: uncharacterized protein LOC102719203    184   4e-52   
ref|XP_002446725.1|  hypothetical protein SORBIDRAFT_06g021290          184   4e-52   
gb|EMT04284.1|  hypothetical protein F775_14656                         182   9e-52   
ref|XP_002446726.1|  hypothetical protein SORBIDRAFT_06g021300          181   5e-51   
gb|EMS63053.1|  hypothetical protein TRIUR3_01734                       180   6e-51   
emb|CDX87297.1|  BnaA07g35760D                                          180   8e-51   
dbj|BAJ96954.1|  predicted protein                                      180   1e-50   
ref|XP_004976081.1|  PREDICTED: uncharacterized protein LOC101764801    179   3e-50   
ref|XP_002446723.1|  hypothetical protein SORBIDRAFT_06g021270          179   6e-50   
tpg|DAA58940.1|  TPA: hypothetical protein ZEAMMB73_364218              171   4e-49   
gb|EMS51274.1|  hypothetical protein TRIUR3_06873                       176   6e-49   
ref|XP_010911072.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    176   8e-49   
ref|XP_007147896.1|  hypothetical protein PHAVU_006G164100g             175   1e-48   
gb|AGV54847.1|  hypothetical protein                                    175   1e-48   
ref|XP_008792993.1|  PREDICTED: uncharacterized protein LOC103709448    175   2e-48   
gb|EMS51358.1|  hypothetical protein TRIUR3_26274                       173   2e-48   
ref|NP_001053191.2|  Os04g0495000                                       173   4e-48   
gb|EAY94679.1|  hypothetical protein OsI_16458                          173   4e-48   
dbj|BAJ97095.1|  predicted protein                                      172   8e-48   
gb|AGV54803.1|  hypothetical protein                                    173   1e-47   
gb|ACL52831.1|  unknown                                                 165   2e-47   
ref|XP_002446727.1|  hypothetical protein SORBIDRAFT_06g021310          172   2e-47   
gb|KDO78161.1|  hypothetical protein CISIN_1g0159862mg                  171   3e-47   
ref|XP_003546086.1|  PREDICTED: uncharacterized protein LOC100807088    171   6e-47   
ref|XP_009396509.1|  PREDICTED: uncharacterized protein LOC103981490    171   7e-47   
ref|XP_002893594.1|  predicted protein                                  170   7e-47   
ref|XP_010549485.1|  PREDICTED: uncharacterized protein LOC104820646    171   8e-47   
ref|XP_006467477.1|  PREDICTED: uncharacterized protein LOC102617...    171   8e-47   
ref|XP_010504914.1|  PREDICTED: uncharacterized protein LOC104781...    171   9e-47   
ref|XP_010504912.1|  PREDICTED: uncharacterized protein LOC104781...    171   9e-47   
gb|AFK48735.1|  unknown                                                 170   1e-46   
ref|XP_006467478.1|  PREDICTED: uncharacterized protein LOC102617...    170   1e-46   
ref|XP_006449683.1|  hypothetical protein CICLE_v10015527mg             170   1e-46   
dbj|BAD87481.1|  unknown protein                                        165   2e-46   
ref|XP_008383561.1|  PREDICTED: uncharacterized protein LOC103446251    169   2e-46   
ref|XP_008812841.1|  PREDICTED: uncharacterized protein LOC103723648    169   2e-46   
ref|XP_010919817.1|  PREDICTED: uncharacterized protein LOC105043799    169   2e-46   
ref|XP_009394197.1|  PREDICTED: uncharacterized protein LOC103979736    170   3e-46   
gb|EEE61252.1|  hypothetical protein OsJ_15312                          173   3e-46   
gb|KHN47316.1|  hypothetical protein glysoja_020184                     169   3e-46   
ref|XP_009788467.1|  PREDICTED: uncharacterized protein LOC104236274    169   4e-46   
ref|XP_008371603.1|  PREDICTED: uncharacterized protein LOC103434995    169   4e-46   
ref|XP_003542933.1|  PREDICTED: uncharacterized protein LOC100788675    169   4e-46   
ref|XP_006415525.1|  hypothetical protein EUTSA_v10007784mg             169   4e-46   
ref|XP_009360881.1|  PREDICTED: uncharacterized protein LOC103951270    168   5e-46   
ref|XP_009603034.1|  PREDICTED: uncharacterized protein LOC104098081    168   6e-46   
ref|XP_004293568.1|  PREDICTED: uncharacterized protein LOC101302531    168   7e-46   
ref|XP_006352963.1|  PREDICTED: uncharacterized protein LOC102582541    167   1e-45   
ref|XP_008669230.1|  PREDICTED: uncharacterized protein LOC103646278    168   1e-45   
ref|XP_008225474.1|  PREDICTED: uncharacterized protein LOC103325117    167   1e-45   
ref|XP_007213876.1|  hypothetical protein PRUPE_ppa006814mg             167   1e-45   
ref|XP_010540565.1|  PREDICTED: uncharacterized protein LOC104814294    167   1e-45   
ref|XP_002881340.1|  hypothetical protein ARALYDRAFT_902536             167   1e-45   
ref|NP_973938.1|  uncharacterized protein                               167   1e-45   
ref|XP_002317331.2|  hypothetical protein POPTR_0011s08980g             167   1e-45   
ref|XP_004233117.1|  PREDICTED: uncharacterized protein LOC101246207    167   2e-45   
ref|XP_011015145.1|  PREDICTED: uncharacterized protein LOC105118803    167   2e-45   
ref|XP_006294334.1|  hypothetical protein CARUB_v10023341mg             167   2e-45   
gb|EEC70811.1|  hypothetical protein OsI_02272                          167   2e-45   
ref|XP_002519690.1|  conserved hypothetical protein                     167   3e-45   
gb|KHN33140.1|  La-related protein 7                                    171   3e-45   
gb|KHG06200.1|  Periplasmic nitrate reductase                           166   3e-45   
ref|NP_564344.1|  uncharacterized protein                               167   3e-45   
emb|CDP19178.1|  unnamed protein product                                166   4e-45   
gb|KDP37968.1|  hypothetical protein JCGZ_04611                         166   4e-45   
ref|XP_007025094.1|  Uncharacterized protein TCM_029497                 167   4e-45   
gb|ACN30906.1|  unknown                                                 166   4e-45   
gb|KJB69807.1|  hypothetical protein B456_011G043300                    166   5e-45   
gb|EYU43266.1|  hypothetical protein MIMGU_mgv1a007866mg                166   5e-45   
ref|XP_010478373.1|  PREDICTED: uncharacterized protein LOC104757341    166   5e-45   
emb|CDX84311.1|  BnaC04g10730D                                          166   6e-45   
gb|ACF86181.1|  unknown                                                 166   6e-45   
ref|XP_009143769.1|  PREDICTED: uncharacterized protein LOC103867448    166   6e-45   
ref|XP_010460777.1|  PREDICTED: uncharacterized protein LOC104741589    166   7e-45   
ref|XP_002456374.1|  hypothetical protein SORBIDRAFT_03g034960          166   7e-45   
ref|XP_006845348.1|  hypothetical protein AMTR_s00141p00103540          166   7e-45   
gb|KJB69808.1|  hypothetical protein B456_011G043300                    166   7e-45   
ref|NP_001143445.1|  uncharacterized protein LOC100276100               164   7e-45   
gb|KHG28355.1|  putative metabolite transport                           166   8e-45   
ref|XP_010509742.1|  PREDICTED: uncharacterized protein LOC104786108    166   8e-45   
ref|XP_003593943.1|  hypothetical protein MTR_2g019600                  165   9e-45   
ref|NP_180998.1|  uncharacterized protein                               165   1e-44   
ref|XP_003569841.1|  PREDICTED: uncharacterized protein LOC100844886    165   1e-44   
gb|KJB57253.1|  hypothetical protein B456_009G155400                    165   1e-44   
ref|XP_006410597.1|  hypothetical protein EUTSA_v10016749mg             165   1e-44   
ref|XP_006307659.1|  hypothetical protein CARUB_v10009287mg             165   1e-44   
emb|CDY17255.1|  BnaA05g09330D                                          165   1e-44   
ref|XP_008663355.1|  PREDICTED: uncharacterized protein LOC103641799    165   1e-44   
ref|XP_004978107.1|  PREDICTED: uncharacterized protein LOC101761699    164   2e-44   
ref|XP_002275370.1|  PREDICTED: uncharacterized protein LOC100253669    164   2e-44   
emb|CDX99870.1|  BnaC05g22920D                                          164   2e-44   
gb|KJB57254.1|  hypothetical protein B456_009G155400                    165   2e-44   
emb|CBI30867.3|  unnamed protein product                                164   2e-44   
ref|XP_006644728.1|  PREDICTED: uncharacterized protein LOC102722258    164   2e-44   
tpg|DAA57583.1|  TPA: hypothetical protein ZEAMMB73_913803              165   2e-44   
ref|XP_004486030.1|  PREDICTED: uncharacterized protein LOC101488455    164   2e-44   
emb|CDY26302.1|  BnaA09g26530D                                          164   2e-44   
ref|XP_009115202.1|  PREDICTED: uncharacterized protein LOC103840445    164   3e-44   
ref|XP_010516598.1|  PREDICTED: uncharacterized protein LOC104792204    164   3e-44   
gb|ACJ84883.1|  unknown                                                 159   3e-44   
ref|XP_004970002.1|  PREDICTED: uncharacterized protein LOC101758272    164   3e-44   
ref|NP_001044289.1|  Os01g0756600                                       164   4e-44   
ref|XP_010275001.1|  PREDICTED: uncharacterized protein LOC104610185    163   4e-44   
emb|CDM84231.1|  unnamed protein product                                163   5e-44   
ref|NP_001043243.2|  Os01g0531400                                       165   7e-44   



>ref|XP_009771440.1| PREDICTED: uncharacterized protein LOC104221976 [Nicotiana sylvestris]
Length=373

 Score =   304 bits (778),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NLLKN DFEEGPY+FP    GVL PP  EDDHSPLPAW VESLKAVKY+D++HF
Sbjct  190  PRATNKNLLKNGDFEEGPYIFPNTSWGVLVPPNIEDDHSPLPAWMVESLKAVKYLDSDHF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+RA+ELVAGKESA+ Q+ART  GK Y+L+F VGDASN CEGSM++EAFAG  TLK
Sbjct  250  SVPQGKRAIELVAGKESAIAQVARTTIGKMYELSFKVGDASNSCEGSMIVEAFAGMDTLK  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GGYK A LRF+ATANRTR+MF STYYHTRSDDFVSLCGPVVD VKL+SVRNP
Sbjct  310  VPYESKGKGGYKRAVLRFKATANRTRIMFLSTYYHTRSDDFVSLCGPVVDDVKLLSVRNP  369

Query  161  HRRL  150
             R L
Sbjct  370  RRFL  373



>ref|XP_009617293.1| PREDICTED: uncharacterized protein LOC104109646 [Nicotiana tomentosiformis]
Length=373

 Score =   298 bits (764),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NLLKN DFEEGPY+FP    GVL PP  EDDHSPLPAW VESLKAVKY+D++HF
Sbjct  190  PRATNKNLLKNGDFEEGPYIFPNTSWGVLVPPNIEDDHSPLPAWMVESLKAVKYLDSDHF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+RA+ELVAGKESA+ Q+ART  GK Y+L+F VGDASN CEGSM++EAFAG  TLK
Sbjct  250  SVPQGKRAIELVAGKESAIAQVARTTIGKMYELSFKVGDASNSCEGSMIVEAFAGRDTLK  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GG+K A LRF+A ANRTR+MF STYYHTRSDD+VSLCGPVVD VKL+SVRNP
Sbjct  310  VPYESKGKGGFKRAVLRFKANANRTRIMFLSTYYHTRSDDYVSLCGPVVDDVKLLSVRNP  369

Query  161  HRRL  150
             R L
Sbjct  370  RRFL  373



>ref|XP_004245192.1| PREDICTED: uncharacterized protein LOC101262737 [Solanum lycopersicum]
Length=371

 Score =   295 bits (754),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 156/184 (85%), Gaps = 1/184 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NLLKN DFEEGPYVFP    GVL PP  EDDHSPLPAW VESLKAVKY+D++HF
Sbjct  188  PRATNQNLLKNGDFEEGPYVFPNTSWGVLVPPNIEDDHSPLPAWMVESLKAVKYLDSDHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVPHG+RA+ELVAGKESA+ Q+ART  GK Y L+F VGDASN CEGSM++EAFAG  TLK
Sbjct  248  SVPHGKRAIELVAGKESAIAQVARTTIGKMYQLSFKVGDASNACEGSMIVEAFAGRDTLK  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES G+GGYK A LRF+ATA+RTR+MF STYYHTRSDDFVSLCGPVVD V L+SVR  
Sbjct  308  VPYESMGKGGYKRAILRFKATASRTRIMFLSTYYHTRSDDFVSLCGPVVDDVTLLSVRT-  366

Query  161  HRRL  150
            HRR+
Sbjct  367  HRRV  370



>ref|XP_006364278.1| PREDICTED: uncharacterized protein LOC102598357 [Solanum tuberosum]
Length=371

 Score =   294 bits (753),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 156/184 (85%), Gaps = 1/184 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NLLKN DFEEGPY+FP    GVL PP  EDDHSPLPAW VESLKAVKY+D++HF
Sbjct  188  PRATNQNLLKNGDFEEGPYIFPNTSWGVLVPPNIEDDHSPLPAWMVESLKAVKYLDSDHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVPHG+RA+ELVAGKESA+ Q+ART  GK Y L+F VGDASN CEGSM++EAFAG  TLK
Sbjct  248  SVPHGKRAIELVAGKESAIAQVARTTIGKMYQLSFKVGDASNACEGSMIVEAFAGRDTLK  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES G+GGYK A LRF+ATA+RTR+MF STYYHTRSDDFVSLCGPVVD V L+SVR  
Sbjct  308  VPYESMGKGGYKRAILRFKATASRTRIMFLSTYYHTRSDDFVSLCGPVVDDVTLLSVRT-  366

Query  161  HRRL  150
            HRR+
Sbjct  367  HRRV  370



>ref|XP_011085499.1| PREDICTED: uncharacterized protein LOC105167438 [Sesamum indicum]
Length=369

 Score =   290 bits (741),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ T  NLLKN DFEEGPYVFP    GVL PP  EDDHSPLPAW VESLKAVKYIDA HF
Sbjct  186  PKATRDNLLKNGDFEEGPYVFPNTSWGVLVPPNIEDDHSPLPAWIVESLKAVKYIDAAHF  245

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVPHG+RA+ELV GKESA+ Q+ART+ GK Y+LTF +GDASN CEGSM++EAFAG  T+K
Sbjct  246  SVPHGQRAIELVGGKESAIAQVARTIIGKTYELTFAIGDASNSCEGSMIVEAFAGRDTVK  305

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GGYK A LRF ATA RTR+MFFSTYYH RSDDF SLCGPVVD VKL+SV  P
Sbjct  306  VPYESKGKGGYKRAVLRFAATAARTRIMFFSTYYHMRSDDFASLCGPVVDDVKLLSVHKP  365

Query  161  HR  156
             R
Sbjct  366  RR  367



>emb|CDP04798.1| unnamed protein product [Coffea canephora]
Length=371

 Score =   288 bits (737),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ T+ NL+KN DFEEGPY+FP    GVL PP  EDDHSPLP W +ESLKAVKYIDA HF
Sbjct  188  PKATSENLVKNGDFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDAAHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVPH  RAVELVAGKESA+ Q+ART+ GK Y LTFLVGDASN CEGSM++EA+AG  T+K
Sbjct  248  SVPHNSRAVELVAGKESAIAQVARTIIGKTYTLTFLVGDASNSCEGSMIVEAYAGIVTVK  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            +PY S+G+GGYKPA L F AT NRTR+MFFSTYYHTRSDD  SLCGPV+D VKL+SVRNP
Sbjct  308  IPYTSQGKGGYKPAVLHFVATTNRTRIMFFSTYYHTRSDDNASLCGPVIDDVKLLSVRNP  367

Query  161  HRRL  150
             + +
Sbjct  368  RKLM  371



>ref|XP_010254319.1| PREDICTED: uncharacterized protein LOC104595325 [Nelumbo nucifera]
 ref|XP_010254320.1| PREDICTED: uncharacterized protein LOC104595325 [Nelumbo nucifera]
Length=370

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NLLKN DFEEGPY+FP    GVL PP  EDDHSPLP W +ESLKAVKYIDAEHF
Sbjct  188  PRPTNKNLLKNGDFEEGPYIFPNTSWGVLVPPNIEDDHSPLPGWMIESLKAVKYIDAEHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESA+ QIART+ GK Y LTF VGDA+NKCEGSMV+EAFA  +T+K
Sbjct  248  SVPQGRRAVELVAGKESAIAQIARTIPGKVYTLTFAVGDANNKCEGSMVVEAFADRNTVK  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG GG+K A LRF A + RTR+MF ST+Y  RSDD  SLCGPVVD VKL+S+RNP
Sbjct  308  VPYESKGTGGFKRAVLRFTAVSTRTRIMFLSTFYTMRSDDMASLCGPVVDDVKLLSIRNP  367

Query  161  HR  156
             R
Sbjct  368  RR  369



>gb|EYU21948.1| hypothetical protein MIMGU_mgv1a0096341mg [Erythranthe guttata]
Length=336

 Score =   281 bits (718),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR T  NLLKN DFEEG Y+ PK   GVL PP  EDD+SPLPAW VESLKAVKYID  HF
Sbjct  153  PRPTRDNLLKNGDFEEGAYILPKTSWGVLIPPNIEDDNSPLPAWMVESLKAVKYIDRAHF  212

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVPHG RA+ELV GKESA+ Q+ART+AGK Y LTF VGDASN CEGSM++EAFAG  T+K
Sbjct  213  SVPHGERAIELVGGKESAIAQVARTIAGKTYQLTFAVGDASNSCEGSMIVEAFAGRDTVK  272

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES+G+GGYK A LRF A  NRTR+MF STYYH RSDD+ SLCGPVVD VKL+SVRNP
Sbjct  273  VPYESRGKGGYKRAVLRFVAPTNRTRIMFLSTYYHMRSDDYASLCGPVVDDVKLLSVRNP  332

Query  161  HR  156
             +
Sbjct  333  RK  334



>ref|XP_006399647.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
 gb|ESQ41100.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
Length=340

 Score =   280 bits (717),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGPYV P   TGVL PPF EDDHSPLPAW +ESLKA+KY+D EHF
Sbjct  161  PRPTNKNILKNGGFEEGPYVLPNATTGVLIPPFIEDDHSPLPAWMIESLKAIKYVDVEHF  220

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSM++EAFAG  TLK
Sbjct  221  SVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACQGSMIVEAFAGKDTLK  280

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES+G+GG+K A +RF A +NRTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  281  VPYESRGKGGFKRASMRFVAVSNRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVRKP  340



>ref|XP_011081926.1| PREDICTED: uncharacterized protein LOC105164832 [Sesamum indicum]
Length=405

 Score =   282 bits (722),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ TN NLLKN DFEEG Y+FP    GVL PP  EDD+SPLPAW VESLKAVKYIDA HF
Sbjct  222  PKPTNQNLLKNGDFEEGAYIFPNTSWGVLIPPNIEDDNSPLPAWMVESLKAVKYIDAAHF  281

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVPHG+RA+ELV GKESA+ Q+ART+ GK Y LTF VGDASN CEGSM++EAFAG  T+K
Sbjct  282  SVPHGQRAIELVGGKESAIAQVARTIVGKTYQLTFAVGDASNSCEGSMIVEAFAGRDTVK  341

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GGYK A LRF AT  RTR+MF ST+YH RSDD+ SLCGPVVD VKL+SVR P
Sbjct  342  VPYESKGKGGYKRAVLRFVATTTRTRIMFLSTFYHMRSDDYASLCGPVVDDVKLLSVRKP  401

Query  161  HR  156
             R
Sbjct  402  RR  403



>ref|XP_010453190.1| PREDICTED: uncharacterized protein LOC104735158 [Camelina sativa]
Length=367

 Score =   281 bits (718),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGPY+ P   TGVL PPF EDDHSPLPAW +ESLKAVKY+D EHF
Sbjct  188  PRPTNKNILKNGGFEEGPYILPNATTGVLVPPFIEDDHSPLPAWMIESLKAVKYVDVEHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSMV+EAFAG  TLK
Sbjct  248  SVPQGRRAVELVAGKESAIAQVARTIVGKTYVLSFAVGDANNACQGSMVVEAFAGRDTLK  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES+G+GG+K A +RF A +NRTR+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  308  VPYESRGKGGFKRASMRFVAVSNRTRIMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVRKP  367



>ref|XP_006399646.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
 gb|ESQ41099.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
Length=366

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGPYV P   TGVL PPF EDDHSPLPAW +ESLKA+KY+D EHF
Sbjct  187  PRPTNKNILKNGGFEEGPYVLPNATTGVLIPPFIEDDHSPLPAWMIESLKAIKYVDVEHF  246

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSM++EAFAG  TLK
Sbjct  247  SVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACQGSMIVEAFAGKDTLK  306

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES+G+GG+K A +RF A +NRTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  307  VPYESRGKGGFKRASMRFVAVSNRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVRKP  366



>ref|XP_002515557.1| conserved hypothetical protein [Ricinus communis]
 emb|CAB02653.1| unknown [Ricinus communis]
 gb|EEF47006.1| conserved hypothetical protein [Ricinus communis]
Length=364

 Score =   280 bits (715),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGPYVFP    GVL PP  EDDHSPLP W VESLKAVKYID +HF
Sbjct  185  PRPTNKNILKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDVDHF  244

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRA+ELVAGKESA+ Q+ARTV GK Y L+F VGDASN CEGSMV+EAFAG  TLK
Sbjct  245  SVPQGRRAIELVAGKESAIAQVARTVIGKTYTLSFAVGDASNSCEGSMVVEAFAGKDTLK  304

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GG+K A LRF A ANRTR+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  305  VPYESKGKGGFKRAVLRFVAVANRTRIMFYSTFYTMRSDDFSSLCGPVLDDVKLLSVRKP  364



>ref|NP_196703.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB87702.1| putative protein [Arabidopsis thaliana]
 gb|AAK76721.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20000.1| unknown protein [Arabidopsis thaliana]
 gb|AED91677.1| uncharacterized protein AT5G11420 [Arabidopsis thaliana]
Length=366

 Score =   279 bits (714),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGPYV P   TGVL PPF EDDHSPLPAW VESLKA+KY+D EHF
Sbjct  187  PRPTNKNILKNGGFEEGPYVLPNATTGVLVPPFIEDDHSPLPAWMVESLKAIKYVDVEHF  246

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLK
Sbjct  247  SVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACQGSMVVEAFAGKDTLK  306

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES+G+GG+K A LRF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+S R P
Sbjct  307  VPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFSSLCGPVIDDVKLLSARKP  366



>ref|XP_010491872.1| PREDICTED: uncharacterized protein LOC104769372 [Camelina sativa]
Length=367

 Score =   279 bits (714),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGPY+ P   TGVL PP+ EDDHSPLPAW +ESLKAVKY+D EHF
Sbjct  188  PRPTNKNILKNGGFEEGPYILPNATTGVLIPPYIEDDHSPLPAWMIESLKAVKYVDVEHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSMV+EAFAG  TLK
Sbjct  248  SVPQGRRAVELVAGKESAIAQVARTIVGKTYVLSFAVGDANNACQGSMVVEAFAGRDTLK  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES+G+GG+K A +RF A +NRTR+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  308  VPYESRGKGGFKRASMRFVAVSNRTRIMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVRKP  367



>ref|XP_002871473.1| hypothetical protein ARALYDRAFT_487977 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47732.1| hypothetical protein ARALYDRAFT_487977 [Arabidopsis lyrata subsp. 
lyrata]
Length=366

 Score =   279 bits (713),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGPYV P   TGVL PPF EDDHSPLPAW +ESLKA+KY+D EHF
Sbjct  187  PRPTNKNILKNGGFEEGPYVLPNATTGVLVPPFIEDDHSPLPAWMIESLKAIKYVDVEHF  246

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDA+N C+GSM++EAFAG  TLK
Sbjct  247  SVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACQGSMIVEAFAGKDTLK  306

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES+G+GG+K A LRF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+S R P
Sbjct  307  VPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFSSLCGPVIDDVKLLSARKP  366



>gb|KDP33619.1| hypothetical protein JCGZ_07190 [Jatropha curcas]
Length=364

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGPY+FP    GVL PP  EDDHSPLP W +ESLKAVKYID++HF
Sbjct  185  PRPTNKNILKNGGFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDSDHF  244

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP  RRAVELVAGKESA+ Q+ARTV GK Y L+F VGDASN CEGSMV+EAFAG  TLK
Sbjct  245  SVPQARRAVELVAGKESAIAQVARTVVGKTYTLSFAVGDASNSCEGSMVVEAFAGKDTLK  304

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GG+K A LRF A +NRTR+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  305  VPYESKGKGGFKRAVLRFVAASNRTRIMFYSTFYTMRSDDFSSLCGPVIDDVKLLSVRKP  364



>gb|AAN31807.1| unknown protein [Arabidopsis thaliana]
Length=366

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGPYV P   TGVL PPF EDDHSPLPAW VESLKA+KY+D EHF
Sbjct  187  PRPTNKNILKNGGFEEGPYVLPNATTGVLVPPFIEDDHSPLPAWMVESLKAIKYVDVEHF  246

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESA+ Q+A+TV GK Y L+F VGDA+N C+GSMV+EAFAG  TLK
Sbjct  247  SVPQGRRAVELVAGKESAIAQVAKTVVGKTYVLSFAVGDANNACQGSMVVEAFAGKDTLK  306

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES+G+GG+K A LRF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+S R P
Sbjct  307  VPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFSSLCGPVIDDVKLLSARKP  366



>ref|XP_006287989.1| hypothetical protein CARUB_v10001222mg [Capsella rubella]
 gb|EOA20887.1| hypothetical protein CARUB_v10001222mg [Capsella rubella]
Length=367

 Score =   278 bits (711),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGPY+ P   TGVL PPF EDDHSPLPAW +ESLKAVKY+D EHF
Sbjct  188  PRPTNKNILKNGGFEEGPYILPNSTTGVLIPPFIEDDHSPLPAWMIESLKAVKYVDVEHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLK
Sbjct  248  SVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFSVGDANNACQGSMVVEAFAGRDTLK  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES+G+GG+K A +RF A +NRTR+MF+ST+Y  RSDDF SLCGPV+D VKL+ VR P
Sbjct  308  VPYESRGKGGFKRATMRFVAVSNRTRIMFYSTFYAMRSDDFSSLCGPVIDDVKLLGVRKP  367



>ref|XP_010419712.1| PREDICTED: uncharacterized protein LOC104705408 [Camelina sativa]
Length=367

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGPY+     TGVL PPF EDDHSPLPAW +ESLKAVKY+D EHF
Sbjct  188  PRPTNKNILKNGGFEEGPYILSNATTGVLIPPFIEDDHSPLPAWMIESLKAVKYVDVEHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLK
Sbjct  248  SVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACQGSMVVEAFAGRDTLK  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES+G+GG+K A +RF A +NRTR+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  308  VPYESRGKGGFKRASMRFVAVSNRTRIMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVRKP  367



>gb|AAM63507.1| unknown [Arabidopsis thaliana]
Length=366

 Score =   277 bits (709),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR T+ N+LKN  FEEGPYV P   TGVL PPF EDDHSPLPAW VESLKA+KY+D EHF
Sbjct  187  PRPTSKNILKNGGFEEGPYVLPNATTGVLVPPFIEDDHSPLPAWMVESLKAIKYVDVEHF  246

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLK
Sbjct  247  SVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACQGSMVVEAFAGKDTLK  306

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES+G+GG+K A LRF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+S R P
Sbjct  307  VPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFSSLCGPVIDDVKLLSARKP  366



>dbj|BAH57107.1| AT5G25460 [Arabidopsis thaliana]
Length=186

 Score =   271 bits (692),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D EHF
Sbjct  7    PRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVEHF  66

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRA+ELVAGKESA+ Q+ RTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLK
Sbjct  67   SVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKDTLK  126

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG GG+K A +RF A + R+R+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  127  VPYESKGTGGFKRASIRFVAVSTRSRIMFYSTFYAMRSDDFSSLCGPVIDDVKLISVRKP  186



>ref|XP_009121952.1| PREDICTED: uncharacterized protein LOC103846721 [Brassica rapa]
Length=366

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGPY+ P   TGVL PPF EDDHSPLPAW +ESLKAVKY+D EHF
Sbjct  187  PRPTNKNILKNGGFEEGPYIIPNATTGVLIPPFIEDDHSPLPAWIIESLKAVKYVDVEHF  246

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSM++EAFAG  TLK
Sbjct  247  SVPQGRRAVELVAGKESAIAQVARTIVGKSYVLSFAVGDANNACKGSMIVEAFAGKDTLK  306

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            V YESKG+GG+K A LRF A +NRTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SV  P
Sbjct  307  VAYESKGKGGFKRAALRFVAVSNRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVGKP  366



>ref|XP_004138737.1| PREDICTED: uncharacterized protein LOC101219952 [Cucumis sativus]
 ref|XP_004164530.1| PREDICTED: uncharacterized protein LOC101227825 [Cucumis sativus]
 gb|KGN62919.1| hypothetical protein Csa_2G379990 [Cucumis sativus]
Length=368

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ +N NL+KN DFE GPYVFP   +GVL PP  EDDHSP+P W VESLKAVKYID++HF
Sbjct  187  PKASNDNLVKNGDFESGPYVFPNASSGVLVPPNIEDDHSPIPGWMVESLKAVKYIDSDHF  246

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+RAVELVAGKESA+ QI RT+ GK Y L+F+VGDASN CEGSMV+EAFAG +TLK
Sbjct  247  SVPSGKRAVELVAGKESAIAQIVRTIPGKTYILSFVVGDASNSCEGSMVVEAFAGKNTLK  306

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPY+SKG GG KPA L+F+A + RTR+MF ST+Y  RSDDF SLCGPV+D V+L+SVRNP
Sbjct  307  VPYQSKGNGGSKPAALKFKAESTRTRIMFLSTFYTMRSDDFSSLCGPVLDKVRLLSVRNP  366



>ref|XP_010048991.1| PREDICTED: uncharacterized protein LOC104437692 [Eucalyptus grandis]
 gb|KCW81432.1| hypothetical protein EUGRSUZ_C02812 [Eucalyptus grandis]
Length=325

 Score =   273 bits (698),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ +N NLLKN DFEEGPYVFP    GVL PP  EDDHSPLP W VESLKAVKYID+ HF
Sbjct  146  PKASNRNLLKNGDFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSGHF  205

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+RAVELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSMV+EAFAG  T+K
Sbjct  206  SVPEGKRAVELVAGKESAIAQVARTIPGKTYVLSFAVGDASNSCEGSMVVEAFAGKDTVK  265

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GGYK A LRF+A + RTR+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  266  VPYESKGKGGYKRAVLRFKAVSVRTRIMFYSTFYTMRSDDFSSLCGPVLDDVKLLSVRFP  325



>ref|XP_010249980.1| PREDICTED: uncharacterized protein LOC104592350 [Nelumbo nucifera]
Length=369

 Score =   274 bits (701),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR T  NLLKN +FEEGPYVFP    GVL PP  EDDHSPLP W +ESLKAVKYIDAEHF
Sbjct  187  PRPTGKNLLKNGNFEEGPYVFPNTSWGVLVPPNIEDDHSPLPGWMIESLKAVKYIDAEHF  246

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+RAVELVAGKESA+ Q+ARTV GK Y L F VGDA+N+CEGSMV+EAFAG  T+K
Sbjct  247  SVPEGKRAVELVAGKESAIAQVARTVPGKAYALMFAVGDANNRCEGSMVVEAFAGRDTVK  306

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG GG+K A L+F A + RTR+MF ST+Y  RSDD  SLCGPVVD VKL+S+RNP
Sbjct  307  VPYESKGTGGFKRAVLKFTAASPRTRIMFLSTFYTMRSDDMASLCGPVVDDVKLLSIRNP  366

Query  161  HR  156
             R
Sbjct  367  RR  368



>dbj|BAD93856.1| hypothetical protein [Arabidopsis thaliana]
Length=224

 Score =   269 bits (688),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D EHF
Sbjct  45   PRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVEHF  104

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRA+ELVAGKESA+ Q+ RTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLK
Sbjct  105  SVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKDTLK  164

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG GG+K A +RF A + R+R+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  165  VPYESKGTGGFKRASIRFVAVSTRSRIMFYSTFYAMRSDDFSSLCGPVIDDVKLISVRKP  224



>ref|XP_009125805.1| PREDICTED: uncharacterized protein LOC103850771 [Brassica rapa]
Length=366

 Score =   274 bits (700),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGPY+ P   TGVL PPF EDDHSPLPAW +ESLKAVKY+D EHF
Sbjct  187  PRPTNKNILKNGGFEEGPYLLPNSTTGVLIPPFIEDDHSPLPAWMIESLKAVKYVDVEHF  246

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N CEGSM++EAFAG  TLK
Sbjct  247  SVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACEGSMIVEAFAGRDTLK  306

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
            VPYESKG+GG+K A LRF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SV
Sbjct  307  VPYESKGKGGFKRATLRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSV  363



>ref|XP_008445161.1| PREDICTED: uncharacterized protein LOC103488281 [Cucumis melo]
Length=422

 Score =   276 bits (705),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ +N NL+KN DFE GPYVFP   +GVL PP  EDDHSP+P W VESLKAVKYID++HF
Sbjct  241  PKASNDNLVKNGDFESGPYVFPNASSGVLVPPNIEDDHSPIPGWMVESLKAVKYIDSDHF  300

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+RAVELVAGKESA+ QI RT+ GK Y L+F+VGDASN CEGSMV+EAFAG +TLK
Sbjct  301  SVPSGKRAVELVAGKESAIAQIVRTIPGKTYILSFVVGDASNSCEGSMVVEAFAGKNTLK  360

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPY+SKG GG KPA L+F+A + RTR+MF ST+Y  RSDDF SLCGPV+D V+L+SVRNP
Sbjct  361  VPYQSKGNGGSKPAALKFKAESTRTRIMFLSTFYTMRSDDFSSLCGPVLDKVRLLSVRNP  420



>emb|CDX85713.1| BnaA02g01000D [Brassica napus]
Length=366

 Score =   274 bits (700),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGPY+ P   TGVL PPF EDDHSPLPAW +ESLKAVKY+D EHF
Sbjct  187  PRPTNKNILKNGGFEEGPYLLPNSTTGVLIPPFIEDDHSPLPAWMIESLKAVKYVDVEHF  246

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N CEGSM++EAFAG  TLK
Sbjct  247  SVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACEGSMIVEAFAGRDTLK  306

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
            VPYESKG+GG+K A LRF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SV
Sbjct  307  VPYESKGKGGFKRATLRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSV  363



>ref|XP_010519935.1| PREDICTED: uncharacterized protein LOC104799224 [Tarenaya hassleriana]
Length=365

 Score =   274 bits (700),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKYID EHF
Sbjct  186  PRPTNKNILKNGGFEEGPLVLPNATTGVLIPPFIEDDHSPLPGWMVESLKAVKYIDVEHF  245

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDA+N C+GSM++EAFAG  T+K
Sbjct  246  SVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACKGSMIVEAFAGRDTIK  305

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES+G GG+K A LRF A ++RTR+MF+ST+Y  RSDDF SLCGPVVD VKL+SVR P
Sbjct  306  VPYESRGTGGFKRAALRFVAASDRTRIMFYSTFYSMRSDDFSSLCGPVVDDVKLLSVRKP  365



>ref|XP_010493802.1| PREDICTED: uncharacterized protein LOC104771027 [Camelina sativa]
Length=370

 Score =   274 bits (700),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D EHF
Sbjct  191  PRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVEHF  250

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRA+ELVAGKESA+ QI RTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLK
Sbjct  251  SVPQGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKETLK  310

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES+G GG+K A +RF A +NR+RVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  311  VPYESRGTGGFKRASIRFVAVSNRSRVMFYSTFYSMRSDDFSSLCGPVIDDVKLISVRKP  370



>ref|XP_010454874.1| PREDICTED: uncharacterized protein LOC104736571 [Camelina sativa]
Length=369

 Score =   274 bits (700),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D EHF
Sbjct  190  PRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVEHF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRA+ELVAGKESA+ QI RTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLK
Sbjct  250  SVPQGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKETLK  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES+G GG+K A +RF A +NR+RVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  310  VPYESRGTGGFKRASIRFVAVSNRSRVMFYSTFYSMRSDDFSSLCGPVIDDVKLISVRKP  369



>ref|XP_010421395.1| PREDICTED: uncharacterized protein LOC104706866 [Camelina sativa]
Length=369

 Score =   274 bits (700),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D EHF
Sbjct  190  PRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVEHF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRA+ELVAGKESA+ QI RTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLK
Sbjct  250  SVPQGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKETLK  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES+G GG+K A +RF A +NR+RVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  310  VPYESRGTGGFKRASIRFVAVSNRSRVMFYSTFYSMRSDDFSSLCGPVIDDVKLISVRKP  369



>ref|XP_006287976.1| hypothetical protein CARUB_v10001211mg [Capsella rubella]
 gb|EOA20874.1| hypothetical protein CARUB_v10001211mg [Capsella rubella]
Length=370

 Score =   274 bits (700),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D EHF
Sbjct  191  PRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVEHF  250

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRA+ELVAGKESA+ QI RTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLK
Sbjct  251  SVPQGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKETLK  310

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES+G GG+K A +RF A +NR+R+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  311  VPYESRGTGGFKRASIRFVAVSNRSRIMFYSTFYSMRSDDFSSLCGPVIDDVKLISVRKP  370



>emb|CDX91217.1| BnaC02g03800D [Brassica napus]
Length=366

 Score =   273 bits (699),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGPY+ P   TGVL PPF EDDHSPLPAW VESLKAVKY+D EHF
Sbjct  187  PRPTNKNILKNGGFEEGPYLLPNSTTGVLIPPFIEDDHSPLPAWMVESLKAVKYVDVEHF  246

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N CEGSM++EAFAG  TLK
Sbjct  247  SVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACEGSMIVEAFAGRDTLK  306

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
            VPY+SKG+GG+K A LRF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SV
Sbjct  307  VPYQSKGKGGFKRATLRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSV  363



>gb|KFK25408.1| hypothetical protein AALP_AA8G110600 [Arabis alpina]
Length=367

 Score =   273 bits (699),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGPYV P   TGVL PPF EDDHSPLPAW +ESLKA+KY+D EHF
Sbjct  188  PRPTNKNILKNGGFEEGPYVLPNATTGVLIPPFIEDDHSPLPAWMIESLKAIKYVDVEHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N CEGSM++EAFAG  TLK
Sbjct  248  SVPQGRRAVELVAGKESAIAQVARTIVGKTYVLSFAVGDANNACEGSMIVEAFAGRDTLK  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPY+S G+GG+K A LRF A + RTR+MF+ST+Y  RSDDF SLCGPV+D VKL++ R P
Sbjct  308  VPYKSLGKGGFKRASLRFIAVSTRTRIMFYSTFYAMRSDDFSSLCGPVIDDVKLLTARKP  367



>ref|XP_010541619.1| PREDICTED: uncharacterized protein LOC104815031 [Tarenaya hassleriana]
Length=364

 Score =   273 bits (698),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKYID EHF
Sbjct  185  PRPTNKNVLKNGGFEEGPLVLPNSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYIDIEHF  244

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRA+ELVAGKESA+ Q+A  +AGK Y L+F VGDASN C+GSM++EAFAG  TLK
Sbjct  245  SVPQGRRAIELVAGKESAIAQVAPAIAGKTYVLSFAVGDASNACKGSMIVEAFAGRDTLK  304

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES+G GG+K A +RF AT+NRTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  305  VPYESRGTGGFKRAAMRFVATSNRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVRKP  364



>gb|KFK27809.1| hypothetical protein AALP_AA8G432300 [Arabis alpina]
Length=370

 Score =   273 bits (698),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D EHF
Sbjct  191  PRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDTEHF  250

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRA+ELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSMV+EAFAG  TLK
Sbjct  251  SVPQGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACKGSMVVEAFAGKETLK  310

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  311  VPYESRGTGGFKRASVRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVRKP  370



>ref|XP_006483312.1| PREDICTED: uncharacterized protein LOC102608149 [Citrus sinensis]
Length=366

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR +N N+LKN  FEEGPYVFP    GVL PP  EDDHSPLP W +ESLKAVKYID++HF
Sbjct  186  PRASNKNILKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDSDHF  245

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+RA+ELVAGKESA+ QIART+ GK Y LTF VGDA+N C GSMV+EAFAG  T+K
Sbjct  246  SVPQGKRAIELVAGKESAIAQIARTIPGKTYTLTFTVGDANNACAGSMVVEAFAGKGTIK  305

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  165
            VPYESKG+GG+K A LRF A +NRTR+MF ST+Y  RSDDF SLCGPV+D VKL+SVRN
Sbjct  306  VPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDFSSLCGPVIDDVKLLSVRN  364



>emb|CDY19801.1| BnaA09g04540D [Brassica napus]
Length=370

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D EHF
Sbjct  191  PRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDTEHF  250

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            S+P GRRA+ELVAGKESA+ Q+ARTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLK
Sbjct  251  SIPQGRRAIELVAGKESAIAQVARTVIGKTYVLSFAVGDANNACKGSMVVEAFAGRDTLK  310

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  311  VPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVRKP  370



>ref|XP_008219896.1| PREDICTED: uncharacterized protein LOC103320060 [Prunus mume]
Length=367

 Score =   272 bits (696),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NLLKN  FEEGPYVFP    GVL PP  EDDHSPLP W VESLKAVKYID+ HF
Sbjct  186  PRATNKNLLKNAGFEEGPYVFPNASWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSNHF  245

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+RAVELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+K
Sbjct  246  SVPEGKRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGRDTVK  305

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GG+K A L+F A + RTRVMF STYY  RSDDF SLCGPV+D VKL+S++NP
Sbjct  306  VPYESKGKGGFKRAVLKFVAVSTRTRVMFLSTYYTMRSDDFSSLCGPVLDDVKLLSLKNP  365

Query  161  HR  156
             +
Sbjct  366  RQ  367



>ref|XP_004291483.1| PREDICTED: uncharacterized protein LOC101294330 [Fragaria vesca 
subsp. vesca]
Length=368

 Score =   272 bits (695),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NLLKN  FEEGPYVFP    GVL PP  EDDHSPLP W VESLKAVKYID++HF
Sbjct  187  PRATNKNLLKNAGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSDHF  246

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+RAVELVAGKESA+ QI RT+ GK Y LTF VGDASN CEGSM++EAFAG  T+K
Sbjct  247  SVPEGKRAVELVAGKESAIAQIVRTIPGKTYMLTFSVGDASNSCEGSMIVEAFAGRDTIK  306

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GG+K A L+FRA   RTR+MF ST+Y  RSDDF SLCGPV+D VKL+S+R P
Sbjct  307  VPYESKGKGGFKRAVLKFRAVGPRTRIMFLSTFYTMRSDDFSSLCGPVLDDVKLLSLRRP  366

Query  161  HR  156
             +
Sbjct  367  RQ  368



>ref|XP_007223355.1| hypothetical protein PRUPE_ppa007452mg [Prunus persica]
 gb|EMJ24554.1| hypothetical protein PRUPE_ppa007452mg [Prunus persica]
Length=367

 Score =   271 bits (694),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NLLKN  FEEGPY+FP    GVL PP  EDDHSPLP W VESLKAVKYID+ HF
Sbjct  186  PRATNKNLLKNAGFEEGPYMFPNASWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSNHF  245

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+RAVELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+K
Sbjct  246  SVPEGKRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGRDTVK  305

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GG+K A L+F A + RTRVMF STYY  RSDDF SLCGPV+D VKL+S++NP
Sbjct  306  VPYESKGKGGFKRAVLKFVAVSTRTRVMFLSTYYTMRSDDFSSLCGPVLDDVKLLSLKNP  365

Query  161  HR  156
             +
Sbjct  366  RQ  367



>ref|NP_197928.1| UF642 l-GalL-responsive protein 1 [Arabidopsis thaliana]
 gb|AAK62407.1|AF386962_1 Unknown protein [Arabidopsis thaliana]
 gb|AAP37805.1| At5g25460 [Arabidopsis thaliana]
 gb|AED93446.1| uncharacterized protein AT5G25460 [Arabidopsis thaliana]
Length=369

 Score =   271 bits (693),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D EHF
Sbjct  190  PRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVEHF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRA+ELVAGKESA+ Q+ RTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLK
Sbjct  250  SVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKDTLK  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG GG+K A +RF A + R+R+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  310  VPYESKGTGGFKRASIRFVAVSTRSRIMFYSTFYAMRSDDFSSLCGPVIDDVKLISVRKP  369



>ref|XP_006394799.1| hypothetical protein EUTSA_v10004442mg [Eutrema salsugineum]
 gb|ESQ32085.1| hypothetical protein EUTSA_v10004442mg [Eutrema salsugineum]
Length=367

 Score =   271 bits (693),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D EHF
Sbjct  188  PRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDTEHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRA+ELVAGKESA+ Q+ARTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLK
Sbjct  248  SVPQGRRAIELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACKGSMVVEAFAGKDTLK  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VPYES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  308  VPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVR  365



>ref|XP_009345289.1| PREDICTED: uncharacterized protein LOC103937097 [Pyrus x bretschneideri]
Length=369

 Score =   271 bits (692),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NLLKN  FEEGPYVFP    GVL PP  EDDHSPLP W VESLKAVKYID++HF
Sbjct  190  PRATNKNLLKNAGFEEGPYVFPNASWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSDHF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+RAVELVAGKESA+ Q+ RT+ GK Y L+F VGDASN CEGSM++EAFA  +T+K
Sbjct  250  SVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASNSCEGSMIVEAFADKNTVK  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GGYK A L+F A + RTRVMF STYY  RSDDF SLCGPVVD VKL+S+R P
Sbjct  310  VPYESKGKGGYKRAVLKFVAASTRTRVMFLSTYYTMRSDDFSSLCGPVVDDVKLLSLRKP  369



>ref|XP_006450498.1| hypothetical protein CICLE_v10008711mg [Citrus clementina]
 gb|ESR63738.1| hypothetical protein CICLE_v10008711mg [Citrus clementina]
 gb|KDO61660.1| hypothetical protein CISIN_1g017767mg [Citrus sinensis]
Length=366

 Score =   270 bits (691),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR +N N+LKN  FEEGPYVFP    GVL PP  EDDHSPLP W +ESLKAVKYID++HF
Sbjct  186  PRASNKNILKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDSDHF  245

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+RA+ELVAGKESA+ QIART+ GK Y LTF VGDA+N C GSMV+EAFAG  T+K
Sbjct  246  SVPQGKRAIELVAGKESAIAQIARTIPGKTYTLTFTVGDANNACAGSMVVEAFAGKGTIK  305

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  165
            VPYESKG+GG+K A LRF A +NRTR+MF ST+Y  RSDDF SLCGPV+D VKL+SVR+
Sbjct  306  VPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDFSSLCGPVIDDVKLLSVRS  364



>ref|XP_002872166.1| hypothetical protein ARALYDRAFT_910605 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48425.1| hypothetical protein ARALYDRAFT_910605 [Arabidopsis lyrata subsp. 
lyrata]
Length=369

 Score =   270 bits (691),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D EHF
Sbjct  190  PRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDIEHF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRA+ELVAGKESA+ Q+ RT+ GK Y L+F VGDA+N C+GSMV+EAFAG  TLK
Sbjct  250  SVPQGRRAIELVAGKESAIAQVVRTIIGKTYVLSFAVGDANNACKGSMVVEAFAGKETLK  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES+G GG+K A +RF A ++R+R+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  310  VPYESQGTGGFKRASIRFVAVSSRSRIMFYSTFYAMRSDDFSSLCGPVIDDVKLISVRKP  369



>ref|XP_009334778.1| PREDICTED: uncharacterized protein LOC103927565 [Pyrus x bretschneideri]
Length=365

 Score =   270 bits (691),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NLLKN  FEEGPYVFP    GVL PP  EDDHSPLP W VESLKAVKYID++HF
Sbjct  186  PRATNKNLLKNAGFEEGPYVFPNASWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSDHF  245

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+RAVELVAGKESA+ Q+ RT+ GK Y L+F VGDASN CEGSM++EAFA  +T+K
Sbjct  246  SVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASNSCEGSMIVEAFADKNTVK  305

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GGYK A L+F A + RTRVMF STYY  RSDDF SLCGPVVD VKL+S+R P
Sbjct  306  VPYESKGKGGYKRAVLKFVAASTRTRVMFLSTYYTMRSDDFSSLCGPVVDDVKLLSLRKP  365



>gb|AAL06839.1| AT5g25460/F18G18_200 [Arabidopsis thaliana]
Length=369

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 144/180 (80%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D EHF
Sbjct  190  PRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVEHF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRA+ELVAGKESA+ Q+ RTV GK Y L+F VGDA+N C+GSMV+EAFAG  TLK
Sbjct  250  SVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKDTLK  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG GG+K A +RF A   R+R+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  310  VPYESKGTGGFKRASIRFVAVLTRSRIMFYSTFYAMRSDDFSSLCGPVIDDVKLISVRKP  369



>ref|XP_010526203.1| PREDICTED: uncharacterized protein LOC104803829 [Tarenaya hassleriana]
Length=363

 Score =   270 bits (690),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP+V P   +GVL PP  EDDHSPLP W VESLKAVK+ID++HF
Sbjct  184  PRPTNKNILKNGGFEEGPWVLPNASSGVLIPPNIEDDHSPLPGWIVESLKAVKFIDSDHF  243

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESA+ Q+ RT+ GK Y L+F VGDASN C GSMV+EAFAG  T+K
Sbjct  244  SVPQGRRAVELVAGKESAIAQVVRTIPGKTYVLSFAVGDASNACSGSMVVEAFAGKDTVK  303

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GG+K A LRF A +NRTR+MFFST+Y  RSDDF SLCGPV+D VKL+S R P
Sbjct  304  VPYESKGKGGFKRASLRFVAISNRTRIMFFSTFYSMRSDDFSSLCGPVIDDVKLLSARKP  363



>emb|CDX97108.1| BnaC09g45170D [Brassica napus]
Length=366

 Score =   270 bits (690),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGPY+ P   TGVL PPF EDDHSPLPAW +ESLKAVKY+D EHF
Sbjct  187  PRPTNKNILKNGGFEEGPYIIPNATTGVLIPPFIEDDHSPLPAWIIESLKAVKYVDVEHF  246

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSM++EAFAG  TLK
Sbjct  247  SVPQGRRAVELVAGKESAIAQVARTIVGKSYVLSFAVGDANNACKGSMIVEAFAGKDTLK  306

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
            V YES G+GG+K A LRF A ++RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SV
Sbjct  307  VAYESNGKGGFKRAALRFVAVSSRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSV  363



>gb|EPS73289.1| hypothetical protein M569_01466, partial [Genlisea aurea]
Length=348

 Score =   269 bits (688),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ TN N+LKN DFEEG Y+FP    GVL PP  EDD+SPLPAW VESLKAV+YID+ HF
Sbjct  166  PKPTNQNILKNGDFEEGAYIFPNTSWGVLIPPNIEDDNSPLPAWMVESLKAVRYIDSAHF  225

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRA+ELV G+ESA+ Q+ART AGKFY LTF VGDASN CEGSMV+EAFAG S+++
Sbjct  226  SVPRGRRAIELVGGRESAIAQVARTAAGKFYRLTFAVGDASNSCEGSMVVEAFAGGSSVR  285

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            +PYES G+GGYK A L+F A ++RTR+MF STYYH RSDD+ SLCGPVVD V+L+SVR  
Sbjct  286  IPYESSGRGGYKRAILQFVAASDRTRIMFTSTYYHMRSDDYASLCGPVVDDVELLSVRET  345

Query  161  HR  156
             R
Sbjct  346  PR  347



>ref|XP_007161233.1| hypothetical protein PHAVU_001G053100g [Phaseolus vulgaris]
 gb|ESW33227.1| hypothetical protein PHAVU_001G053100g [Phaseolus vulgaris]
Length=366

 Score =   269 bits (688),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ TN NLLKN  FEEGPYVFP    GV+ PP  EDDHSPLP W VESLKAVKYID++HF
Sbjct  187  PKATNQNLLKNGGFEEGPYVFPNSSWGVIIPPNIEDDHSPLPGWMVESLKAVKYIDSDHF  246

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+RAVEL+AGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+K
Sbjct  247  SVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASNYCEGSMIVEAFAGKDTIK  306

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GG+K A L+F A   RTRVMF ST+Y  RSDDF SLCGPVVD VKLVS+R P
Sbjct  307  VPYESKGKGGFKRAALKFVAVGPRTRVMFLSTFYTMRSDDFSSLCGPVVDDVKLVSLRKP  366



>gb|AAM61720.1| unknown [Arabidopsis thaliana]
Length=369

 Score =   269 bits (688),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D EHF
Sbjct  190  PRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVEHF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRA+ELVAGKESA+ Q+ RTV GK Y L+F VGDA+N C+GSMV+E+FAG  TLK
Sbjct  250  SVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANNACKGSMVVESFAGKDTLK  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG GG+K A +RF A + R+R+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR P
Sbjct  310  VPYESKGTGGFKRASIRFVAVSTRSRMMFYSTFYAMRSDDFSSLCGPVIDDVKLISVRKP  369



>ref|XP_002324280.2| hypothetical protein POPTR_0018s01390g [Populus trichocarpa]
 gb|EEF02845.2| hypothetical protein POPTR_0018s01390g [Populus trichocarpa]
Length=398

 Score =   270 bits (690),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 145/179 (81%), Gaps = 0/179 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGPYVFP    GVL PP  ED HSPLP W VESLKAVKYID EHF
Sbjct  219  PRPTNKNILKNGGFEEGPYVFPNTTWGVLIPPNIEDKHSPLPGWMVESLKAVKYIDVEHF  278

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDASN CEGSMV+EAFAG  TLK
Sbjct  279  SVPQGRRAVELVAGKESAIAQVARTVIGKTYTLSFAVGDASNSCEGSMVVEAFAGKDTLK  338

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  165
            VPYESKG+GG+K A L+F A + RTR+MF+ST+Y  RSDDF SLCGPV+D +KL+S+R 
Sbjct  339  VPYESKGKGGFKRAVLKFVAVSTRTRIMFYSTFYTMRSDDFSSLCGPVIDDIKLLSLRG  397



>ref|XP_008394047.1| PREDICTED: uncharacterized protein LOC103456171 [Malus domestica]
Length=365

 Score =   269 bits (687),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NLLKN  FEEGPYVFP    GVL PP  EDDHSPLP W VESLKAVKYID++HF
Sbjct  186  PRATNKNLLKNAGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSDHF  245

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+RAVELVAGKESA+ Q+ RT+ GK Y L+F VGDASN CEGSM++EAFA  +T+K
Sbjct  246  SVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASNSCEGSMIVEAFADKNTVK  305

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GG+K A L+F A + RTRVMF STYY  RSDDF SLCGPVVD VKL+S+R P
Sbjct  306  VPYESKGKGGFKRAVLKFVAASTRTRVMFLSTYYTMRSDDFSSLCGPVVDDVKLLSLRKP  365



>ref|XP_009129962.1| PREDICTED: uncharacterized protein LOC103854751 [Brassica rapa]
 emb|CDY05493.1| BnaA02g31980D [Brassica napus]
Length=366

 Score =   268 bits (686),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D EHF
Sbjct  188  PRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDTEHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            S+P GRRA+ELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSMV+EAFAG  TLK
Sbjct  248  SIPQGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACKGSMVVEAFAGRDTLK  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VPYES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+S R
Sbjct  308  VPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLISAR  365



>emb|CDY54909.1| BnaC02g48660D [Brassica napus]
Length=339

 Score =   267 bits (683),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D EHF
Sbjct  161  PRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDTEHF  220

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            S+P GRRA+ELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSMV+EAFAG  TLK
Sbjct  221  SIPQGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACKGSMVVEAFAGRDTLK  280

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VPYES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+S R
Sbjct  281  VPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLISAR  338



>ref|XP_009151074.1| PREDICTED: uncharacterized protein LOC103874406 [Brassica rapa]
 emb|CDX88180.1| BnaA06g27710D [Brassica napus]
 emb|CDX80511.1| BnaC07g29330D [Brassica napus]
Length=367

 Score =   268 bits (686),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D EHF
Sbjct  188  PRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDTEHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            S+P GRRA+ELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSMV+EAFAG  TLK
Sbjct  248  SIPQGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACKGSMVVEAFAGRDTLK  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VPYES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  308  VPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVR  365



>ref|XP_008378299.1| PREDICTED: uncharacterized protein LOC103441403, partial [Malus 
domestica]
Length=345

 Score =   268 bits (684),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NL+KN  FEEGPYVFP    GVL PP  EDDHSPLP W VESLKAVKYID++HF
Sbjct  166  PRATNKNLIKNAGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSDHF  225

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+RAVELVAGKESA+ Q+ RT+ GK Y L+F VGDASN CEGS+++EAFAG +T+K
Sbjct  226  SVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASNSCEGSLIVEAFAGKNTVK  285

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GG+K A L+F A + RTRVMF STYY  RSDDF SLCGPV+D VKL+S+R P
Sbjct  286  VPYESKGKGGFKRAVLKFVAVSTRTRVMFLSTYYTMRSDDFSSLCGPVLDDVKLLSLRKP  345



>gb|KHN06654.1| hypothetical protein glysoja_037506 [Glycine soja]
Length=366

 Score =   268 bits (685),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ TN N+LKN  FEEGPYVFP    GV+ PP  EDDHSPLP W VESLKAVKYID++HF
Sbjct  187  PKATNQNILKNGGFEEGPYVFPNSSWGVIIPPNIEDDHSPLPGWMVESLKAVKYIDSDHF  246

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+RAVEL+AGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+K
Sbjct  247  SVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDTIK  306

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG GG+K A L+F A   RTRVMF ST+Y  RSDDF SLCGPV+D VKLVS+R P
Sbjct  307  VPYESKGNGGFKRAALKFVAVTPRTRVMFLSTFYTMRSDDFSSLCGPVIDDVKLVSLRKP  366



>ref|XP_006601137.1| PREDICTED: uncharacterized protein LOC100813910 isoform X1 [Glycine 
max]
 ref|XP_006601138.1| PREDICTED: uncharacterized protein LOC100813910 isoform X2 [Glycine 
max]
Length=366

 Score =   268 bits (685),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ TN N+LKN  FEEGPYVFP    GV+ PP  EDDHSPLP W VESLKAVKYID++HF
Sbjct  187  PKATNQNILKNGGFEEGPYVFPNSSWGVIIPPNIEDDHSPLPGWMVESLKAVKYIDSDHF  246

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+RAVEL+AGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+K
Sbjct  247  SVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDTIK  306

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG GG+K A L+F A   RTRVMF ST+Y  RSDDF SLCGPV+D VKLVS+R P
Sbjct  307  VPYESKGNGGFKRAALKFVAVTPRTRVMFLSTFYTMRSDDFSSLCGPVIDDVKLVSLRKP  366



>ref|XP_003544618.1| PREDICTED: uncharacterized protein LOC100776765 [Glycine max]
 gb|KHN05403.1| hypothetical protein glysoja_046455 [Glycine soja]
Length=366

 Score =   268 bits (685),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGPYVFP    GV+ PP  EDDHSPLP W VESLKAVKYID+ HF
Sbjct  187  PRATNQNILKNGGFEEGPYVFPNSSWGVIIPPNIEDDHSPLPGWMVESLKAVKYIDSGHF  246

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+RAVEL+AGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+K
Sbjct  247  SVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDTIK  306

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GG+K A L+F A   RTR+MF ST+Y  RSDDF SLCGPV+D VKLVS+R P
Sbjct  307  VPYESKGKGGFKRAALKFVAVTPRTRIMFLSTFYTMRSDDFSSLCGPVIDDVKLVSLRKP  366



>ref|XP_002284962.1| PREDICTED: uncharacterized protein LOC100252479 [Vitis vinifera]
Length=368

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR ++ NLLKN  FEEGPYVFP    GVL PP  EDDHSPLP W VESLKAVKYID++HF
Sbjct  185  PRPSSKNLLKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSDHF  244

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP  +RAVELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSMV+EAFAG  T+K
Sbjct  245  SVPQEKRAVELVAGKESAIAQVARTIPGKTYALSFSVGDASNSCEGSMVVEAFAGRDTIK  304

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GG+K A LRF A +NRTR+MF ST+Y  RSDD+ SLCGPV+D VKL+S+R P
Sbjct  305  VPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDYASLCGPVLDDVKLLSLRTP  364

Query  161  HRRL  150
             R +
Sbjct  365  PRHI  368



>gb|KHG29602.1| Allergen Act d 3 [Gossypium arboreum]
Length=369

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N++KN  FEEGPY+FP    GVL PP  EDD+SPLPAW VESLKAVKYID+ H+
Sbjct  190  PRPTNKNIIKNGGFEEGPYIFPNTPWGVLIPPNIEDDNSPLPAWVVESLKAVKYIDSAHY  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP GRRAVELV GKESA+ QI RT+ GK Y L+F VGDA+N C GS+V+EAFAG +TLK
Sbjct  250  FVPQGRRAVELVGGKESAIAQITRTIVGKTYRLSFSVGDANNSCAGSLVVEAFAGKATLK  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG GG+K A LRF A +NRTR+MF ST+Y  RSDDF SLCGPVVD VKL+S+RNP
Sbjct  310  VPYESKGTGGFKRAALRFVAVSNRTRIMFLSTFYTMRSDDFSSLCGPVVDDVKLLSIRNP  369



>gb|KJB80694.1| hypothetical protein B456_013G110800 [Gossypium raimondii]
Length=325

 Score =   266 bits (679),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N++KN  FEEGPY+FP    GVL PP  EDD+SPLPAW VESLKAVKYID+ H+
Sbjct  146  PRPTNKNIMKNGGFEEGPYIFPNTPWGVLIPPNIEDDNSPLPAWVVESLKAVKYIDSAHY  205

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             +P GRRAVELV GKESA+ QI RT+ GK Y L+F VGDA+N C GS+V+EAFAG +TLK
Sbjct  206  FMPQGRRAVELVGGKESAIAQITRTIVGKTYRLSFSVGDANNSCAGSLVVEAFAGKATLK  265

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG GG+K A LRF A +NRTR+MF ST+Y  RSDDF SLCGPVVD VKL+S+RNP
Sbjct  266  VPYESKGTGGFKRAALRFVAVSNRTRIMFLSTFYTMRSDDFSSLCGPVVDDVKLLSIRNP  325



>ref|XP_011026488.1| PREDICTED: uncharacterized protein LOC105127071 [Populus euphratica]
Length=366

 Score =   266 bits (681),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGPYVFP    GVL PP  ED HS LP W VESLKAVKYID EHF
Sbjct  187  PRLTNKNILKNGGFEEGPYVFPNTTWGVLIPPNIEDKHSTLPGWMVESLKAVKYIDVEHF  246

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKES + Q+ARTV GK Y L+F VGDASN CEGSMV+EAFAG  TLK
Sbjct  247  SVPQGRRAVELVAGKESTIAQVARTVIGKTYTLSFAVGDASNSCEGSMVVEAFAGKDTLK  306

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VPYESKG+GG+K A L+F A + RTR+MF+ST+Y  RSDDF SLCGPV+D +KL+S+R
Sbjct  307  VPYESKGKGGFKRAVLKFVAVSTRTRIMFYSTFYTMRSDDFSSLCGPVIDDIKLLSLR  364



>emb|CAA06490.1| hypothetical protein [Cicer arietinum]
Length=180

 Score =   260 bits (664),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 144/180 (80%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ TN NLLKN  FEEGPY+FP    GV+ PP  ED+HSPLP W VESLKAVKY+D+ HF
Sbjct  1    PKATNKNLLKNGGFEEGPYIFPNTSYGVIIPPNIEDNHSPLPGWMVESLKAVKYLDSSHF  60

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G RA+ELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+K
Sbjct  61   SVPEGTRAIELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGRDTVK  120

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPY+SKG+GG+K A L+F A  +RTR+MF ST+Y  R+DD  SLCGPV+D VKL+S+R P
Sbjct  121  VPYQSKGKGGFKRAVLKFVAVGSRTRIMFLSTFYSMRTDDLSSLCGPVIDDVKLLSLRKP  180



>ref|XP_009407651.1| PREDICTED: uncharacterized protein LOC103990295 [Musa acuminata 
subsp. malaccensis]
Length=367

 Score =   266 bits (681),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NLLKN DFEEGPY+ P    GVL PP  EDDHSPLP W VESLKAVKY+DAEHF
Sbjct  185  PRRTNTNLLKNGDFEEGPYILPNTTWGVLIPPQIEDDHSPLPGWMVESLKAVKYLDAEHF  244

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVEL+AGKESA+ Q+ RTV G+ Y L+F VGDASN CEGS+++EAFAG  T+K
Sbjct  245  SVPRGRRAVELLAGKESAIAQVVRTVPGRRYALSFAVGDASNACEGSLLVEAFAGEHTIK  304

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GG K A L+F AT  RTRV+F+S+YY+TRSDD  SLCGPV+D V LVSVR P
Sbjct  305  VPYESKGRGGSKRAVLQFTATTARTRVVFWSSYYNTRSDDLSSLCGPVLDDVALVSVRYP  364



>gb|KJB80693.1| hypothetical protein B456_013G110800 [Gossypium raimondii]
Length=369

 Score =   266 bits (681),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N++KN  FEEGPY+FP    GVL PP  EDD+SPLPAW VESLKAVKYID+ H+
Sbjct  190  PRPTNKNIMKNGGFEEGPYIFPNTPWGVLIPPNIEDDNSPLPAWVVESLKAVKYIDSAHY  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             +P GRRAVELV GKESA+ QI RT+ GK Y L+F VGDA+N C GS+V+EAFAG +TLK
Sbjct  250  FMPQGRRAVELVGGKESAIAQITRTIVGKTYRLSFSVGDANNSCAGSLVVEAFAGKATLK  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG GG+K A LRF A +NRTR+MF ST+Y  RSDDF SLCGPVVD VKL+S+RNP
Sbjct  310  VPYESKGTGGFKRAALRFVAVSNRTRIMFLSTFYTMRSDDFSSLCGPVVDDVKLLSIRNP  369



>ref|XP_006841925.1| hypothetical protein AMTR_s00042p00185900 [Amborella trichopoda]
 gb|ERN03600.1| hypothetical protein AMTR_s00042p00185900 [Amborella trichopoda]
Length=332

 Score =   265 bits (677),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 144/182 (79%), Gaps = 0/182 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NLLKN +FEEGPY+FP    GVL PP  ED++SPLP W VESLKAVKYID+ HF
Sbjct  146  PRATNKNLLKNGNFEEGPYIFPNASWGVLVPPNIEDENSPLPGWMVESLKAVKYIDSNHF  205

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+RAVELVAGKESA+ Q+ART+ GK Y LTF VGDASN C GSMV+EAFAG  TLK
Sbjct  206  SVPEGKRAVELVAGKESAIAQVARTIPGKLYALTFAVGDASNACTGSMVVEAFAGRDTLK  265

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG GG+K A LRF A + RTRV+F ST+Y  RSDDF SLCGPV+D VKL+SV   
Sbjct  266  VPYESKGTGGFKRAVLRFTAVSERTRVVFLSTFYSMRSDDFSSLCGPVIDDVKLLSVHGA  325

Query  161  HR  156
             R
Sbjct  326  PR  327



>emb|CAA22573.1| putative protein [Arabidopsis thaliana]
 emb|CAB79963.1| putative protein [Arabidopsis thaliana]
Length=325

 Score =   265 bits (677),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP+V P + +GVL PP + DDHSPLP W VESLKAVKYID++HF
Sbjct  146  PRPTNKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSPLPGWMVESLKAVKYIDSDHF  205

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T+K
Sbjct  206  SVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDASNACAGSMIVEAFAGKDTIK  265

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GG+K + LRF A ++RTRVMF+ST+Y  R+DDF SLCGPV+D VKL+S R P
Sbjct  266  VPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDFSSLCGPVIDDVKLLSARRP  325



>ref|XP_011019764.1| PREDICTED: uncharacterized protein LOC105122387 [Populus euphratica]
Length=343

 Score =   265 bits (678),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NL+KN  FEEGPY+ P    GVL PP  ED HSPLP W VESLKAVK+ID EHF
Sbjct  164  PRPTNKNLIKNGGFEEGPYLLPNTSWGVLIPPNIEDKHSPLPGWMVESLKAVKFIDIEHF  223

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRA+ELVAGKESA+ Q+ RT+ GK Y L+F VGDASN CEGSMV+EAFAG  TLK
Sbjct  224  SVPQGRRAIELVAGKESAIAQVVRTIIGKTYSLSFAVGDASNSCEGSMVVEAFAGKDTLK  283

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  165
            VPYESKG+GG+K A L+F A ++RTRVMF+ST+Y  RSDDF SLCGPVVD VKL+S+R 
Sbjct  284  VPYESKGKGGFKRAVLKFVAVSSRTRVMFYSTFYTMRSDDFSSLCGPVVDDVKLLSLRG  342



>ref|XP_011019761.1| PREDICTED: uncharacterized protein LOC105122382 [Populus euphratica]
Length=365

 Score =   265 bits (678),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NL+KN  FEEGPY+ P    GVL PP  ED HSPLP W VESLKAVK+ID EHF
Sbjct  186  PRPTNKNLIKNGGFEEGPYLLPNTSWGVLIPPNIEDKHSPLPGWMVESLKAVKFIDIEHF  245

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRA+ELVAGKESA+ Q+ RT+ GK Y L+F VGDASN CEGSMV+EAFAG  TLK
Sbjct  246  SVPQGRRAIELVAGKESAIAQVVRTIIGKTYSLSFAVGDASNSCEGSMVVEAFAGKDTLK  305

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  165
            VPYESKG+GG+K A L+F A ++RTRVMF+ST+Y  RSDDF SLCGPVVD VKL+S+R 
Sbjct  306  VPYESKGKGGFKRAVLKFVAVSSRTRVMFYSTFYTMRSDDFSSLCGPVVDDVKLLSLRG  364



>ref|XP_002867243.1| hypothetical protein ARALYDRAFT_913203 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43502.1| hypothetical protein ARALYDRAFT_913203 [Arabidopsis lyrata subsp. 
lyrata]
Length=365

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP+V P + +GVL PP + DDHSPLP W VESLKAVKYID++HF
Sbjct  186  PRPTNKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSPLPGWMVESLKAVKYIDSDHF  245

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T+K
Sbjct  246  SVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEAFAGKDTIK  305

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GG+K + LRF A ++RTRVMF+ST+Y  R+DDF SLCGPV+D VKL+S R P
Sbjct  306  VPYESKGKGGFKRSSLRFVAVSDRTRVMFYSTFYAMRNDDFSSLCGPVIDDVKLLSARRP  365



>dbj|BAE98407.1| hypothetical protein [Arabidopsis thaliana]
Length=365

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP+V P + +GVL PP + DDHSPLP W VESLKAVKYID++HF
Sbjct  186  PRTTNKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSPLPGWMVESLKAVKYIDSDHF  245

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T+K
Sbjct  246  SVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDASNACAGSMIVEAFAGKDTIK  305

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GG+K + LRF A ++RTRVMF+ST+Y  R+DDF SLCGPV+D VKL+S R P
Sbjct  306  VPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDFSSLCGPVIDDVKLLSARRP  365



>ref|XP_007013814.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY31433.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=375

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEG Y+FP    GVL PP  EDDHSPLP W VESLKAVKYID++H+
Sbjct  196  PRATNKNILKNAGFEEGAYIFPNTPWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSDHY  255

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C GSMV+EAFAG  TLK
Sbjct  256  FVPQGRRAVELVAGKESAIAQVARTIIGKTYTLSFSVGDANNSCAGSMVVEAFAGKDTLK  315

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG GG+K A L F+A + RTR+MF ST+Y  RSDDF SLCGPVVD VKL+SVR P
Sbjct  316  VPYESKGTGGFKRAVLTFKAVSTRTRIMFLSTFYTMRSDDFSSLCGPVVDDVKLLSVRKP  375



>ref|XP_006412472.1| hypothetical protein EUTSA_v10025706mg [Eutrema salsugineum]
 gb|ESQ53925.1| hypothetical protein EUTSA_v10025706mg [Eutrema salsugineum]
Length=325

 Score =   263 bits (673),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 144/180 (80%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP+V P   +GVL PP + DDHSPLP W VESLKAVKYID++HF
Sbjct  146  PRPTNKNILKNGGFEEGPWVLPNSSSGVLIPPNSIDDHSPLPGWMVESLKAVKYIDSDHF  205

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T+K
Sbjct  206  SVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEAFAGKDTIK  265

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GG+K A LRF A + RTRVMF+ST+Y  R DDF SLCGPV+D VKL+S R P
Sbjct  266  VPYESKGKGGFKRASLRFVAVSARTRVMFYSTFYAMREDDFSSLCGPVIDDVKLLSARRP  325



>ref|XP_006285882.1| hypothetical protein CARUB_v10007385mg [Capsella rubella]
 gb|EOA18780.1| hypothetical protein CARUB_v10007385mg [Capsella rubella]
Length=354

 Score =   264 bits (675),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP+V P   +GVL PP + DDHSPLP W VESLKAVKYID++HF
Sbjct  175  PRPTNKNILKNGGFEEGPWVLPNTTSGVLIPPNSIDDHSPLPGWMVESLKAVKYIDSDHF  234

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T+K
Sbjct  235  SVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEAFAGKDTIK  294

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GG+K A LRF A + RTRVMF+ST+Y  R+DDF SLCGPV+D VKL+S R P
Sbjct  295  VPYESKGKGGFKRASLRFVAASGRTRVMFYSTFYAMRNDDFSSLCGPVIDDVKLLSARRP  354



>emb|CDX80516.1| BnaC07g29280D [Brassica napus]
Length=306

 Score =   262 bits (670),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 143/179 (80%), Gaps = 0/179 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP V P   T VL PPF EDDHSPLP W VESLKAVKY+D EHF
Sbjct  127  PRPTNKNILKNGGFEEGPLVLPGSTTRVLIPPFIEDDHSPLPGWMVESLKAVKYVDTEHF  186

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            S+P GRRA+ELV GKESA+ Q+ART+ GK Y L+F VGDA+N C+GSMV+EAFAG  TLK
Sbjct  187  SIPQGRRAIELVVGKESAIAQVARTIIGKTYVLSFAVGDANNACKGSMVVEAFAGRDTLK  246

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  165
            VPYES+G GG+K A +RF A + RT+VMF+ST+Y  RSDDF SLCGPV+D VKL+SVR 
Sbjct  247  VPYESRGTGGFKRASIRFVAVSTRTKVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVRK  305



>ref|XP_003588711.1| hypothetical protein MTR_1g011800 [Medicago truncatula]
Length=326

 Score =   263 bits (672),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ +N N+LKN  FEEGPY+FP    GV+ PP  EDDHSPLP W VESLKAVKY+D+ HF
Sbjct  147  PKASNKNILKNGGFEEGPYIFPNTSYGVIIPPNIEDDHSPLPGWMVESLKAVKYLDSAHF  206

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G RAVELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+K
Sbjct  207  SVPQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDTIK  266

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPY SKG+GG+K A L+F A   RTRVMF ST+Y  RSDD  SLCGPV+D VKL+SVR P
Sbjct  267  VPYTSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDLSSLCGPVIDDVKLLSVRKP  326



>ref|NP_567894.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_974661.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM65206.1| unknown [Arabidopsis thaliana]
 gb|ABF19001.1| At4g32460 [Arabidopsis thaliana]
 gb|AEE86063.1| uncharacterized protein AT4G32460 [Arabidopsis thaliana]
 gb|AEE86064.1| uncharacterized protein AT4G32460 [Arabidopsis thaliana]
Length=365

 Score =   264 bits (675),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP+V P + +GVL PP + DDHSPLP W VESLKAVKYID++HF
Sbjct  186  PRPTNKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSPLPGWMVESLKAVKYIDSDHF  245

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T+K
Sbjct  246  SVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDASNACAGSMIVEAFAGKDTIK  305

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GG+K + LRF A ++RTRVMF+ST+Y  R+DDF SLCGPV+D VKL+S R P
Sbjct  306  VPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDFSSLCGPVIDDVKLLSARRP  365



>ref|XP_007013813.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY31432.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=412

 Score =   265 bits (678),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEG Y+FP    GVL PP  EDDHSPLP W VESLKAVKYID++H+
Sbjct  233  PRATNKNILKNAGFEEGAYIFPNTPWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSDHY  292

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C GSMV+EAFAG  TLK
Sbjct  293  FVPQGRRAVELVAGKESAIAQVARTIIGKTYTLSFSVGDANNSCAGSMVVEAFAGKDTLK  352

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG GG+K A L F+A + RTR+MF ST+Y  RSDDF SLCGPVVD VKL+SVR P
Sbjct  353  VPYESKGTGGFKRAVLTFKAVSTRTRIMFLSTFYTMRSDDFSSLCGPVVDDVKLLSVRKP  412



>gb|KJB07801.1| hypothetical protein B456_001G045200 [Gossypium raimondii]
Length=372

 Score =   263 bits (673),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N +KN  FEEGPYVFP    GVL PP  EDDHSPLPAW VESLKAVKYID+ H+
Sbjct  190  PRPTNKNSVKNGGFEEGPYVFPNTPWGVLIPPNIEDDHSPLPAWIVESLKAVKYIDSAHY  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP GRRAVELVAGKESA+ QI RT+ GK Y L+F VGDA+N C GS+V+EAFAG  TLK
Sbjct  250  FVPQGRRAVELVAGKESAIAQIVRTIVGKMYRLSFAVGDANNSCVGSLVVEAFAGKDTLK  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VPYESKG+GG+K A+L+F+A +NRTR+MF ST+Y  RSDDF SLCGPV+D VKL+S++
Sbjct  310  VPYESKGKGGFKRAELKFKAVSNRTRIMFLSTFYTMRSDDFSSLCGPVLDDVKLLSIQ  367



>gb|KJB07802.1| hypothetical protein B456_001G045200 [Gossypium raimondii]
Length=377

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N +KN  FEEGPYVFP    GVL PP  EDDHSPLPAW VESLKAVKYID+ H+
Sbjct  195  PRPTNKNSVKNGGFEEGPYVFPNTPWGVLIPPNIEDDHSPLPAWIVESLKAVKYIDSAHY  254

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP GRRAVELVAGKESA+ QI RT+ GK Y L+F VGDA+N C GS+V+EAFAG  TLK
Sbjct  255  FVPQGRRAVELVAGKESAIAQIVRTIVGKMYRLSFAVGDANNSCVGSLVVEAFAGKDTLK  314

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VPYESKG+GG+K A+L+F+A +NRTR+MF ST+Y  RSDDF SLCGPV+D VKL+S++
Sbjct  315  VPYESKGKGGFKRAELKFKAVSNRTRIMFLSTFYTMRSDDFSSLCGPVLDDVKLLSIQ  372



>gb|KHG19965.1| putative e3 ubiquitin-protein ligase hul4 [Gossypium arboreum]
Length=377

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N +KN  FEEGPYVFP    GVL PP  EDDHSPLPAW VESLKAVKYID+ H+
Sbjct  195  PRPTNKNSVKNGGFEEGPYVFPNTPWGVLIPPNIEDDHSPLPAWIVESLKAVKYIDSAHY  254

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP GRRAVELVAGKESA+ QI RT+ GK Y L+F VGDA+N C GS+V+EAFAG  TLK
Sbjct  255  FVPQGRRAVELVAGKESAIAQIVRTIVGKMYRLSFAVGDANNSCVGSLVVEAFAGKDTLK  314

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VPYESKG+GG+K A+L+F+A +NRTR+MF ST+Y  RSDDF SLCGPV+D VKL+S++
Sbjct  315  VPYESKGKGGFKRAELKFKAVSNRTRIMFLSTFYTMRSDDFSSLCGPVLDDVKLLSIQ  372



>gb|ACJ84308.1| unknown [Medicago truncatula]
Length=376

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ +N N+LKN  FEEGPY+FP    GV+ PP  EDDHSPLP W VESLKAVKY+D+ HF
Sbjct  197  PKASNKNILKNGGFEEGPYIFPNTSYGVIIPPNIEDDHSPLPGWMVESLKAVKYLDSAHF  256

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G RAVELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+K
Sbjct  257  SVPQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDTIK  316

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPY SKG+GG+K A L+F A   RTRVMF ST+Y  RSDD  SLCGPV+D VKL+SVR P
Sbjct  317  VPYTSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDLSSLCGPVIDDVKLLSVRKP  376



>gb|AES58962.2| plant/F18G18-200 protein [Medicago truncatula]
Length=376

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ +N N+LKN  FEEGPY+FP    GV+ PP  EDDHSPLP W VESLKAVKY+D+ HF
Sbjct  197  PKASNKNILKNGGFEEGPYIFPNTSYGVIIPPNIEDDHSPLPGWMVESLKAVKYLDSAHF  256

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G RAVELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+K
Sbjct  257  SVPQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDTIK  316

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPY SKG+GG+K A L+F A   RTRVMF ST+Y  RSDD  SLCGPV+D VKL+SVR P
Sbjct  317  VPYTSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDLSSLCGPVIDDVKLLSVRKP  376



>gb|ABK94923.1| unknown [Populus trichocarpa]
Length=365

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NL+KN  FEEGPY+ P    GVL PP  ED HSPLP W VESLKAVK+ID EHF
Sbjct  186  PRPTNKNLVKNGGFEEGPYLLPNTSWGVLIPPNIEDKHSPLPGWMVESLKAVKFIDVEHF  245

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRA+ELVAGKESA+ Q+ RT+ GK Y L+F VGDASN C+GSMV+EAFAG  T+K
Sbjct  246  SVPQGRRAIELVAGKESAIAQVVRTIIGKTYTLSFAVGDASNSCQGSMVVEAFAGKDTVK  305

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  165
            VPYESKG+GG+K A L+F A ++RTR+MF+ST+Y  RSDDF SLCGPVVD VKL+S+R 
Sbjct  306  VPYESKGKGGFKRAVLKFVAASSRTRIMFYSTFYTMRSDDFSSLCGPVVDDVKLLSLRG  364



>ref|XP_010432718.1| PREDICTED: uncharacterized protein LOC104716937 [Camelina sativa]
Length=365

 Score =   261 bits (668),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP+V P   +GVL PP + DDHSPLP W VESLKAVKYID++HF
Sbjct  186  PRPTNKNILKNGGFEEGPWVLPNTTSGVLIPPNSIDDHSPLPGWMVESLKAVKYIDSDHF  245

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T+K
Sbjct  246  SVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEAFAGKDTIK  305

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GG++ A LRF A + RTRVMF+ST+Y  R+DDF SLCGPV+D VKL+S R P
Sbjct  306  VPYESKGKGGFRRASLRFVAVSVRTRVMFYSTFYAMRNDDFSSLCGPVIDDVKLLSARRP  365



>ref|XP_010447383.1| PREDICTED: uncharacterized protein LOC104730027 [Camelina sativa]
Length=365

 Score =   261 bits (668),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP+V P   +GVL PP + DDHSPLP W VESLKAVKY+D++HF
Sbjct  186  PRPTNKNILKNGGFEEGPWVLPNTTSGVLIPPNSIDDHSPLPGWMVESLKAVKYLDSDHF  245

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T+K
Sbjct  246  SVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEAFAGKDTIK  305

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GG+K A LRF A + RTRVMF+ST+Y  R+DDF SLCGPV+D VKL+S R P
Sbjct  306  VPYESKGKGGFKRASLRFVAVSVRTRVMFYSTFYAMRNDDFSSLCGPVIDDVKLLSARRP  365



>ref|XP_002308647.2| hypothetical protein POPTR_0006s26630g [Populus trichocarpa]
 gb|EEE92170.2| hypothetical protein POPTR_0006s26630g [Populus trichocarpa]
Length=415

 Score =   263 bits (671),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NL+KN  FEEGPY+ P    GVL PP  ED HSPLP W VESLKAVK+ID EHF
Sbjct  236  PRPTNKNLVKNGGFEEGPYLLPNTSWGVLIPPNIEDKHSPLPGWMVESLKAVKFIDVEHF  295

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRA+ELVAGKESA+ Q+ RT+ GK Y L+F VGDASN CEGSMV+EAFAG  T+K
Sbjct  296  SVPQGRRAIELVAGKESAIAQVVRTIIGKTYTLSFAVGDASNSCEGSMVVEAFAGKDTVK  355

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  165
            VPYESKG+GG+K A L+F A ++RTR+MF+ST+Y  RSDDF SLCGPVVD VKL+S+R 
Sbjct  356  VPYESKGKGGFKRAVLKFVAASSRTRIMFYSTFYTMRSDDFSSLCGPVVDDVKLLSLRG  414



>emb|CDX68849.1| BnaC01g06040D [Brassica napus]
Length=365

 Score =   261 bits (666),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP+V P   +GVL PP   DDHSPLP W VESLKAVKYID++HF
Sbjct  186  PRPTNKNILKNGGFEEGPWVLPNTSSGVLIPPNAVDDHSPLPGWMVESLKAVKYIDSDHF  245

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVEL+AGKESAV Q+ RT  GK Y L+F VGDASN C GSM++EAFAG  TLK
Sbjct  246  SVPQGRRAVELIAGKESAVAQVVRTTPGKIYVLSFAVGDASNACAGSMIVEAFAGKDTLK  305

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VPYESKG+GG+K A L+F A ++RTR+MF+ST+Y  R+DDF SLCGPV+D VKL+S R
Sbjct  306  VPYESKGKGGFKRASLKFVAVSDRTRIMFYSTFYAMRNDDFSSLCGPVIDDVKLLSAR  363



>ref|XP_009401767.1| PREDICTED: uncharacterized protein LOC103985700 [Musa acuminata 
subsp. malaccensis]
Length=368

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 143/180 (79%), Gaps = 2/180 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR T  NLLKN DFEEGPYVFP    GVL PP  EDDHSPLP W VESLKAVKYID++HF
Sbjct  186  PRLTRDNLLKNRDFEEGPYVFPNTTWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSDHF  245

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVPHG+RAVELVAGKESA+ Q+ART+ GK Y LTF VGDA N C GSMV+EAFA   T+K
Sbjct  246  SVPHGKRAVELVAGKESALAQVARTIPGKVYTLTFSVGDAGNGCVGSMVVEAFASRGTVK  305

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            +PYESKG GGYK A LRF A   RTRV+F ST+YHT++D   SLCGPVVD V L+SVR+P
Sbjct  306  IPYESKGTGGYKRAVLRFTAAVERTRVVFLSTFYHTKTDG--SLCGPVVDDVSLLSVRSP  363



>ref|XP_010918669.1| PREDICTED: uncharacterized protein LOC105042950 [Elaeis guineensis]
Length=370

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 142/184 (77%), Gaps = 2/184 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NLLKN DFEEGPY+ P    G L PP  EDDHSPLP W VESLKAV YID+ HF
Sbjct  186  PRLTNKNLLKNADFEEGPYILPNTTWGALVPPNIEDDHSPLPGWMVESLKAVNYIDSAHF  245

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP G+RAVELV GKESA+ Q+ARTV G+ Y L+FLVGDA N C G MV+EAFA  ST+K
Sbjct  246  KVPQGKRAVELVGGKESALAQVARTVVGRVYTLSFLVGDAGNACTGPMVVEAFAARSTVK  305

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPY+SKG GG+K A LRF A A RTRV+F STYY+TR+D   SLCGPVVD V L+SVRNP
Sbjct  306  VPYDSKGTGGFKRAVLRFTAVAERTRVVFLSTYYNTRTDG--SLCGPVVDDVTLLSVRNP  363

Query  161  HRRL  150
             RRL
Sbjct  364  SRRL  367



>gb|AAB41813.1| unknown protein [Medicago sativa]
Length=375

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 141/178 (79%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ +N N+LKN  FEEGPY+FP    GV+ PP  EDDHSPLP W VESLKAVKY+D+ HF
Sbjct  196  PKASNKNILKNGGFEEGPYIFPNTSYGVIIPPNIEDDHSPLPGWMVESLKAVKYLDSGHF  255

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G RAVELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+K
Sbjct  256  SVPQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDTIK  315

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VPY SKG+GG+K A L+F A   RTRVMF ST+Y  RSDD  SLCGPV+D VKL+SVR
Sbjct  316  VPYSSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDLSSLCGPVIDDVKLLSVR  373



>ref|XP_004498654.1| PREDICTED: uncharacterized protein LOC101508759 [Cicer arietinum]
Length=366

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 144/180 (80%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ TN NLLKN  FEEGPY+FP    GV+ PP  ED+HSPLP W VESLKAVKY+D+ HF
Sbjct  187  PKATNKNLLKNGGFEEGPYIFPNTSYGVIIPPNIEDNHSPLPGWMVESLKAVKYLDSSHF  246

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G RA+ELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+K
Sbjct  247  SVPEGTRAIELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGRDTVK  306

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPY+SKG+GG+K A L+F A  +RTR+MF ST+Y  R+DD  SLCGPV+D VKL+S+R P
Sbjct  307  VPYQSKGKGGFKRAVLKFVAVGSRTRIMFLSTFYSMRTDDLSSLCGPVIDDVKLLSLRKP  366



>ref|XP_010106829.1| hypothetical protein L484_006602 [Morus notabilis]
 gb|EXC12058.1| hypothetical protein L484_006602 [Morus notabilis]
Length=217

 Score =   254 bits (649),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 141/174 (81%), Gaps = 1/174 (1%)
 Frame = -1

Query  683  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFSVPHGR  504
            NL++N  FE GPYVF    TGVL PP  EDDHSPLP W VESLKAVKYID++HFSVPHG+
Sbjct  44   NLIRNPSFEYGPYVF-NTTTGVLIPPNIEDDHSPLPYWMVESLKAVKYIDSDHFSVPHGK  102

Query  503  RAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYESK  324
            RAVELVAGKESA+ Q+ RT+ GK Y LTF VGDASN CEGSM++EAFAG +T+KVPYESK
Sbjct  103  RAVELVAGKESAIAQVVRTIVGKTYRLTFSVGDASNSCEGSMIVEAFAGRATVKVPYESK  162

Query  323  GQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            G+GG+K   L F AT  RTR+MF ST+Y  RSDDF SLCGPV+D +KL+SVR P
Sbjct  163  GKGGFKRGVLTFVATETRTRIMFLSTFYSMRSDDFSSLCGPVLDDIKLLSVRKP  216



>ref|XP_009125963.1| PREDICTED: uncharacterized protein LOC103850912 [Brassica rapa]
 emb|CDX75247.1| BnaA01g04550D [Brassica napus]
Length=365

 Score =   259 bits (662),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGP+V P   +GVL PP   DDHSPLP W VESLKAVKYID++HF
Sbjct  186  PRPTNKNILKNGGFEEGPWVLPNTSSGVLIPPNAVDDHSPLPGWMVESLKAVKYIDSDHF  245

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESAV Q+ RT  GK Y L+F VGDASN C GSM++EAFAG  TLK
Sbjct  246  SVPQGRRAVELVAGKESAVAQVVRTTPGKIYVLSFAVGDASNACAGSMIVEAFAGKDTLK  305

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VP+ESKG+GG+K A L+F A ++RTR+MF+ST+Y  R+DDF SLCGPV+D VKL+S R
Sbjct  306  VPHESKGKGGFKRASLKFVAVSDRTRIMFYSTFYAMRNDDFSSLCGPVIDDVKLLSAR  363



>emb|CDX69757.1| BnaA10g21060D [Brassica napus]
Length=1312

 Score =   275 bits (702),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN N+LKN  FEEGPY+ P   TGVL PPF EDDHSPLPAW +ESLKAVKY+D EHF
Sbjct  187  PRPTNKNILKNGGFEEGPYIIPNATTGVLIPPFIEDDHSPLPAWIIESLKAVKYVDVEHF  246

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSM++EAFAG  TLK
Sbjct  247  SVPQGRRAVELVAGKESAIAQVARTIVGKSYVLSFAVGDANNACKGSMIVEAFAGKDTLK  306

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
            V YESKG+GG+K A LRF A +NRTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SV
Sbjct  307  VAYESKGKGGFKRAALRFVAVSNRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSV  363



>ref|XP_010048243.1| PREDICTED: uncharacterized protein LOC104437065 [Eucalyptus grandis]
 gb|KCW80448.1| hypothetical protein EUGRSUZ_C01791 [Eucalyptus grandis]
Length=369

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 146/181 (81%), Gaps = 0/181 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NLLKN  FEEGPY+FP    GVL PP  EDDHSPLP W VESLKAVKYID+ HF
Sbjct  187  PRATNKNLLKNGGFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSAHF  246

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G RA+ELVAGKESA+ Q+ART+ GK Y L F VGDASN CEGSM++EAFAG  T+K
Sbjct  247  SVPGGYRAIELVAGKESAIAQVARTIPGKTYTLFFAVGDASNSCEGSMIVEAFAGRDTIK  306

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GG+K A LRF+A + RTR+MF+ST+Y  RSDDF SLCGPVVD V L+SVRNP
Sbjct  307  VPYESKGKGGFKRAVLRFKAVSTRTRIMFYSTFYTMRSDDFSSLCGPVVDDVVLLSVRNP  366

Query  161  H  159
             
Sbjct  367  R  367



>ref|XP_006341715.1| PREDICTED: uncharacterized protein LOC102601890 [Solanum tuberosum]
Length=368

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P     N+LKN +FEEGPY+FP    GVL PP  EDDHSPLP W +ESLKAVKYIDAEHF
Sbjct  189  PHRPKGNMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDAEHF  248

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+RA+ELVAG+ESA+ QI RT  GK YDL F VGDASN C+GSM++EAFAG  TL+
Sbjct  249  TVPEGKRAIELVAGRESAIAQIVRTQKGKVYDLMFSVGDASNSCQGSMLIEAFAGNITLR  308

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES G+GG+K AKLRF A   RTRV F STYYH +SD   SLCGPVVD V+LV VR P
Sbjct  309  VPYESAGKGGFKRAKLRFTAVTERTRVRFLSTYYHMKSDHSGSLCGPVVDDVRLVGVRYP  368


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/189 (28%), Positives = 79/189 (42%), Gaps = 34/189 (18%)
 Frame = -1

Query  680  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWT----VESLKAVKYIDAEHFSVP  513
            LL N +FE+GP       T V       D H+ +P W     VE +KA +        VP
Sbjct  23   LLPNGNFEQGPKASQMKGTKV------TDPHA-IPHWEISGYVEYIKAGQTQGDMLLPVP  75

Query  512  HGRRAVELVAGKESAV-TQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST----  348
             G  AV L  G+++ + T++     G FY L+F   + +  C     L     P+     
Sbjct  76   EGAFAVRL--GEDAYIKTRVTNVTNGTFYSLSF---NFARTCAQEEKLNVSVSPNNEPND  130

Query  347  -----LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVK  183
                 ++  Y S G   Y      F A AN   +M      H  + +    CGP++DF+ 
Sbjct  131  WAMLPMQTMYSSDGWDSYS---WGFLAQANEIEIML-----HNPAVEKDPACGPLIDFIA  182

Query  182  LVSVRNPHR  156
            L +++ PHR
Sbjct  183  LKALKTPHR  191



>ref|XP_004235717.1| PREDICTED: uncharacterized protein LOC101252763 [Solanum lycopersicum]
Length=373

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 140/180 (78%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P     N+LKN +FEEGPY+FP    GVL PP  EDDHSPLP W +ESLKAVKYIDAEHF
Sbjct  194  PHRQRGNMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDAEHF  253

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+RA+ELVAG+ESA+ QI RT  GK YDL F VGDASN C+GSM++EAFAG  TL+
Sbjct  254  TVPEGKRAIELVAGRESAIAQIVRTQKGKVYDLMFSVGDASNSCQGSMLIEAFAGKITLR  313

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES G+GG+K AKLRF A   RTRV F STYYH ++D   SLCGPVVD ++LV VR+P
Sbjct  314  VPYESAGKGGFKRAKLRFTAVTERTRVRFLSTYYHMKNDHSGSLCGPVVDDMRLVGVRHP  373


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 83/192 (43%), Gaps = 38/192 (20%)
 Frame = -1

Query  680  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH------FS  519
            LL N +FE+GP       T V  P      H+ +P W +     V+YI +          
Sbjct  28   LLPNGNFEQGPKASQMKGTKVTDP------HA-IPHWEISGY--VEYIRSGQTQGDMLLP  78

Query  518  VPHGRRAVELVAGKESAV-TQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST--  348
            VP G  AV L  G+++++ T++    +G FY L+F   + +  C     L     P+T  
Sbjct  79   VPEGAFAVRL--GEDASIKTRVTNVTSGSFYSLSF---NFARTCAQEEKLNVSVSPNTEP  133

Query  347  -------LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDF  189
                   ++  Y S G   Y      F A AN   +       H  + +    CGP++DF
Sbjct  134  NDWGMLPMQTMYSSDGWDSYS---WGFLAQANEIEITL-----HNPAVEKDPACGPLIDF  185

Query  188  VKLVSVRNPHRR  153
            + L +++NPHR+
Sbjct  186  IALKALKNPHRQ  197



>ref|XP_009389493.1| PREDICTED: uncharacterized protein LOC103976040 [Musa acuminata 
subsp. malaccensis]
Length=369

 Score =   257 bits (656),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 142/183 (78%), Gaps = 2/183 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ T  NLLKN DFEEGPYV P    GVL PP  EDDHSPLP WTVESLKAVKYID++HF
Sbjct  188  PKLTGDNLLKNRDFEEGPYVLPNTTWGVLIPPNIEDDHSPLPGWTVESLKAVKYIDSDHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+RAVELVAGKESA+ Q+ARTV GK Y L F +GDA N C GSMV+EAFAG  T K
Sbjct  248  SVPRGKRAVELVAGKESALAQVARTVPGKVYALAFSIGDAGNGCVGSMVVEAFAGRGTAK  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            +PYESKG GGYK   LRF A A RTRV+FFST+YHT+ D   SLCGP +D V L+SVR+P
Sbjct  308  IPYESKGTGGYKRGVLRFTAVAERTRVVFFSTFYHTKVDG--SLCGPSLDDVSLLSVRSP  365

Query  161  HRR  153
             RR
Sbjct  366  VRR  368



>ref|XP_009778816.1| PREDICTED: uncharacterized protein LOC104228110 [Nicotiana sylvestris]
Length=372

 Score =   256 bits (655),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 140/180 (78%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P     N+LKN +FEEGPY+FP    GVL PP  EDDHSPLP W +ESLKAVKYIDA HF
Sbjct  193  PHRPKGNMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDAAHF  252

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+RA+ELVAG+ESA+ Q+  T  GK YDL F VGDASN C+GSM++EAFAG  TL+
Sbjct  253  TVPEGKRAIELVAGRESAIAQVVITTKGKVYDLMFSVGDASNSCQGSMLIEAFAGQITLR  312

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG GG+K AKLRF+A + RTRV F STYYH +SD   SLCGPVVD V+LV VR+P
Sbjct  313  VPYESKGSGGFKRAKLRFKAVSERTRVRFLSTYYHMKSDHSGSLCGPVVDDVRLVGVRHP  372


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 83/192 (43%), Gaps = 34/192 (18%)
 Frame = -1

Query  689  NVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWT----VESLKAVKYIDAEHF  522
            N  LL N +FE+GP       T V  P      H+ +P W     VE +K+ +       
Sbjct  24   NDGLLPNGNFEQGPKPSQLKGTRVTNP------HA-IPHWEISGYVEYIKSGQTQGDMLL  76

Query  521  SVPHGRRAVELVAGKESAV-TQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST-  348
             VP G  AV L  G+++++ T+I     G FY L+F   + +  C     L     P++ 
Sbjct  77   PVPEGAFAVRL--GEDASIKTRITNFTKGTFYSLSF---NFARTCAQEEKLNVSVSPNSE  131

Query  347  --------LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVD  192
                    ++  Y S G   Y      F A AN   +M      H  + +    CGP++D
Sbjct  132  PNDWGMLPMQTMYSSDGWDSYS---WGFLAEANEIDIML-----HNPAIEKDPACGPLID  183

Query  191  FVKLVSVRNPHR  156
            F+ L +++NPHR
Sbjct  184  FIALKALKNPHR  195



>ref|XP_004241713.1| PREDICTED: uncharacterized protein LOC101268115 [Solanum lycopersicum]
Length=372

 Score =   256 bits (654),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 142/181 (78%), Gaps = 0/181 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+    N+LKN +FEEGPY+FP    GVL PP  EDDHSPL  W +ESLKAVKYID+EHF
Sbjct  190  PKRPRGNMLKNGNFEEGPYIFPNTTWGVLIPPNIEDDHSPLLGWMIESLKAVKYIDSEHF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP G+RAVELVAG+ESA+ Q+ RT  GK YDL F +GDASN CEGSM++EAFAG  T++
Sbjct  250  HVPQGKRAVELVAGRESAIAQVVRTRPGKIYDLLFSIGDASNSCEGSMLVEAFAGKITMQ  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
             PYESKG+GG+K A+LRF A + RTRV F STYYH +SD+  SLCGPVVD V+LV +RNP
Sbjct  310  FPYESKGKGGFKRARLRFTAISPRTRVRFLSTYYHMKSDNSGSLCGPVVDDVRLVGLRNP  369

Query  161  H  159
            H
Sbjct  370  H  370



>ref|XP_010914930.1| PREDICTED: uncharacterized protein LOC105040204 [Elaeis guineensis]
Length=370

 Score =   256 bits (653),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR +N NLLKN DFEEGPY+ P    GVL PP TEDDHSPLP W V+S KAVKY+D+ HF
Sbjct  185  PRRSNKNLLKNGDFEEGPYILPNTTWGVLIPPTTEDDHSPLPGWMVDSPKAVKYLDSTHF  244

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G RAVEL+AGKESA+ Q  RTV G+ Y L F VGDASN C+G+M++EAFAG  T+K
Sbjct  245  SVPRGSRAVELLAGKESALAQEVRTVPGRAYALAFSVGDASNACQGTMIVEAFAGEHTVK  304

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG GG K A LRFRA+  RTR++FFS+ Y+TRSDD  SLCGPV+D V LVS+RNP
Sbjct  305  VPYESKGAGGAKRAVLRFRASKARTRIVFFSSNYNTRSDDLSSLCGPVLDDVALVSIRNP  364



>ref|XP_010670694.1| PREDICTED: uncharacterized protein LOC104887687 [Beta vulgaris 
subsp. vulgaris]
Length=367

 Score =   256 bits (653),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 141/180 (78%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ T +NLLKN +FEEGPY+F     G L PP  ED HSPLP W +ESLKAVKY+D++HF
Sbjct  188  PKRTGLNLLKNGNFEEGPYIFRNTSWGTLIPPNIEDAHSPLPGWMIESLKAVKYLDSDHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP G+RA+ELVAGKESA+ Q+ RTV GK Y LTF VGDA+N C GSMV+EAFAG  T K
Sbjct  248  FVPSGKRAIELVAGKESAIAQVVRTVPGKLYALTFTVGDANNACSGSMVVEAFAGKDTAK  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPY SKG+GG+K A LRF AT  RTR+MF+ST+Y  RSDDF SLCGPV+D V+LVSVR P
Sbjct  308  VPYNSKGKGGFKRAVLRFVATQTRTRIMFYSTFYSMRSDDFSSLCGPVIDDVRLVSVRRP  367



>gb|KHG21629.1| GTPase Der [Gossypium arboreum]
Length=302

 Score =   253 bits (645),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 146/182 (80%), Gaps = 1/182 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPK-VDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  525
            P+ T  NLLKN +FEEGPY+FP+    GV+ PP  EDDHSPLP W +ESLKA+KYID+EH
Sbjct  119  PKRTRANLLKNGNFEEGPYIFPRPTSEGVIIPPHIEDDHSPLPGWIIESLKAIKYIDSEH  178

Query  524  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  345
            FSVP G+RA+EL+AGKESAV QI +T  G+ Y L+FLVGDA+N CEG MV+EAFAG +T+
Sbjct  179  FSVPKGKRAIELIAGKESAVAQIVKTTIGRNYVLSFLVGDANNGCEGPMVVEAFAGKNTV  238

Query  344  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  165
            KV Y SKG+GG+K A+L FRA + RTR+MF+ST+Y  +SD+  SLCGPV+D VKL+SVR 
Sbjct  239  KVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNSGSLCGPVLDDVKLLSVRK  298

Query  164  PH  159
             H
Sbjct  299  LH  300



>ref|XP_009590498.1| PREDICTED: uncharacterized protein LOC104087663 [Nicotiana tomentosiformis]
Length=372

 Score =   255 bits (651),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+    N+LKN +FEEGPY+FP    GVL PP  EDDHSPL  W +ESLKAVKYIDAEHF
Sbjct  190  PKRPKGNMLKNGNFEEGPYIFPNTTWGVLIPPNIEDDHSPLLGWMIESLKAVKYIDAEHF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+RAVELVAG+ESA+ Q+ RT  GK YDL F +GDASN CEGSM++EAFAG  T++
Sbjct  250  TVPEGKRAVELVAGRESAIAQVVRTRPGKVYDLIFSIGDASNSCEGSMLVEAFAGKITMQ  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
             PYESKG+GG+K A+LRF A + RTRV F STYYH +SD+  SLCGPVVD V+LV VRNP
Sbjct  310  FPYESKGKGGFKRARLRFTAISPRTRVRFLSTYYHMKSDNSGSLCGPVVDDVRLVGVRNP  369



>ref|XP_009591297.1| PREDICTED: uncharacterized protein LOC104088341 [Nicotiana tomentosiformis]
Length=372

 Score =   254 bits (650),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P     N+LKN +FEEGPY+FP    GVL PP  EDDHSPLP W +ESLKAVKYIDA HF
Sbjct  193  PHRPKGNMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDAAHF  252

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+RA+ELVAG+ESA+ Q   T  GK YDL F VGDASN C+GSM++EAFAG  TL+
Sbjct  253  AVPEGKRAIELVAGRESAIAQQVITTKGKVYDLMFSVGDASNSCQGSMLIEAFAGQITLR  312

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG GG+K AKLRF+A + RTRV F STYYH +SD   SLCGPVVD V+LV VR+P
Sbjct  313  VPYESKGNGGFKRAKLRFKAVSERTRVRFLSTYYHMKSDHSGSLCGPVVDDVRLVGVRHP  372


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/189 (27%), Positives = 80/189 (42%), Gaps = 34/189 (18%)
 Frame = -1

Query  680  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWT----VESLKAVKYIDAEHFSVP  513
            LL N +FE+GP       T V  P      H+ +P W     VE +K+ +        VP
Sbjct  27   LLPNGNFEQGPKPSQLKGTKVTEP------HA-IPHWEISGYVEYIKSGQTQGDMLLPVP  79

Query  512  HGRRAVELVAGKESAV-TQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST----  348
             G  AV L  G+++++ T+I     G FY L+F   + +  C     L     P+     
Sbjct  80   EGAFAVRL--GEDASIKTRITNVTKGTFYSLSF---NFARTCAQEEKLNVSVSPNNEPND  134

Query  347  -----LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVK  183
                 ++  Y S G   Y      F A A    +M      H  + +    CGP++D++ 
Sbjct  135  WGMLPMQTMYSSDGWDSYS---WGFLAQATEIDIML-----HNPAVEKDPACGPLIDYIA  186

Query  182  LVSVRNPHR  156
            L +++NPHR
Sbjct  187  LKALKNPHR  195



>ref|XP_008775036.1| PREDICTED: uncharacterized protein LOC103695476 [Phoenix dactylifera]
Length=376

 Score =   254 bits (650),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 142/184 (77%), Gaps = 2/184 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NLLKN DFEEGPY+ P    GVL PP  EDDHSPLP+W VESLKAV YID+ HF
Sbjct  192  PRLTNKNLLKNADFEEGPYILPNTTWGVLVPPNIEDDHSPLPSWMVESLKAVNYIDSAHF  251

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP G+RAVELV GKESA+ Q+ RTV G+ Y L+F VGDA N C G+M++EAFA  ST+K
Sbjct  252  KVPQGKRAVELVGGKESALAQVVRTVVGRVYTLSFSVGDAGNACAGTMMVEAFAARSTVK  311

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPY+SKG GG+K A LRF A A RTRV+F STYY+TR+D   SLCGPVVD V L+SVR P
Sbjct  312  VPYDSKGTGGFKRAVLRFTAEAERTRVVFLSTYYNTRTDG--SLCGPVVDDVTLLSVRKP  369

Query  161  HRRL  150
             RRL
Sbjct  370  SRRL  373



>gb|KJB70569.1| hypothetical protein B456_011G080100 [Gossypium raimondii]
Length=328

 Score =   253 bits (646),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 146/182 (80%), Gaps = 1/182 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPK-VDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  525
            P+ T  NLLKN +FEEGPY+FP+    GV+ PP  EDDHSPLP W +ESLKA+KYID+EH
Sbjct  145  PKRTRANLLKNGNFEEGPYIFPRPTSEGVIIPPHIEDDHSPLPGWIIESLKAIKYIDSEH  204

Query  524  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  345
            FSVP G+RA+EL+AGKESAV QI +T  G+ Y L+FLVGDA+N CEG MV+EAFAG +T+
Sbjct  205  FSVPKGKRAIELIAGKESAVAQIVKTAIGRNYVLSFLVGDANNGCEGPMVVEAFAGKNTV  264

Query  344  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  165
            KV Y SKG+GG+K A+L FRA + RTR+MF+ST+Y  +SD+  SLCGPV+D VKL+SVR 
Sbjct  265  KVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNSGSLCGPVLDDVKLLSVRK  324

Query  164  PH  159
             H
Sbjct  325  LH  326



>ref|XP_008792101.1| PREDICTED: uncharacterized protein LOC103708794 [Phoenix dactylifera]
Length=371

 Score =   254 bits (649),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P  TN NLLKN DFEEGPY+ P    GVL PP TEDDHSPLP W V+S KAVKY+D+ HF
Sbjct  186  PSRTNKNLLKNGDFEEGPYILPNTTWGVLIPPTTEDDHSPLPGWMVDSPKAVKYLDSAHF  245

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VPHGRRAVEL+AGKESA+ Q  RTV G+ Y L F VGDASN CEGSM++EAFAG  T+K
Sbjct  246  FVPHGRRAVELLAGKESALAQEVRTVPGRAYALAFSVGDASNACEGSMIVEAFAGEHTVK  305

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG GG K A LRFRA+  RTR++F S+ Y TR DD  SLCGPV+D V LVS+RNP
Sbjct  306  VPYESKGAGGAKRAVLRFRASKARTRIVFLSSNYSTRRDDLSSLCGPVLDDVALVSIRNP  365



>ref|XP_010654739.1| PREDICTED: uncharacterized protein LOC100261739 [Vitis vinifera]
Length=372

 Score =   254 bits (649),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR T  NLLKN +FEEGPYVFP    GVL PP  EDDHSPLP W +ESLKAVKYID++HF
Sbjct  191  PRRTRANLLKNGNFEEGPYVFPTASWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDSDHF  250

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+R VELVAGKESA++Q+  T+  + Y L+F VGDA+N CEGSMV+EAFAG  T+K
Sbjct  251  AVPEGKRGVELVAGKESALSQVVFTIPNRVYVLSFSVGDANNSCEGSMVVEAFAGLDTVK  310

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VPYESKG+GG+K AKLRF+A + RTRVMF STYY  ++D+  SLCGPV+D VKL+SVR
Sbjct  311  VPYESKGKGGFKRAKLRFKAISKRTRVMFLSTYYTMKNDNSGSLCGPVLDDVKLLSVR  368



>ref|XP_002517567.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44731.1| conserved hypothetical protein [Ricinus communis]
Length=378

 Score =   254 bits (648),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ T  NLLKN +FEEGPYVFP  D GVL PP  EDDHSPLP W +ESLKAVKYID +HF
Sbjct  195  PKRTRGNLLKNGNFEEGPYVFPNTDWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDLDHF  254

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+RA+ELVAGKESA+ Q+ +T+ GK Y LTF VGDA+N CEGSM++EA+AG   ++
Sbjct  255  AVPEGKRAIELVAGKESALAQVVKTIPGKTYVLTFSVGDANNACEGSMIVEAYAGKDKIQ  314

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
             PY SKG+GG+K AKL+F+A +  TR+MF S++Y  +SD+  SLCGPV+D VKL+SVR P
Sbjct  315  FPYVSKGKGGFKTAKLQFKAVSTHTRIMFLSSFYTMKSDNSGSLCGPVLDDVKLISVRQP  374

Query  161  HRRL  150
             R L
Sbjct  375  RRLL  378



>gb|KJB70568.1| hypothetical protein B456_011G080100 [Gossypium raimondii]
Length=374

 Score =   254 bits (648),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 146/182 (80%), Gaps = 1/182 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPK-VDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  525
            P+ T  NLLKN +FEEGPY+FP+    GV+ PP  EDDHSPLP W +ESLKA+KYID+EH
Sbjct  191  PKRTRANLLKNGNFEEGPYIFPRPTSEGVIIPPHIEDDHSPLPGWIIESLKAIKYIDSEH  250

Query  524  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  345
            FSVP G+RA+EL+AGKESAV QI +T  G+ Y L+FLVGDA+N CEG MV+EAFAG +T+
Sbjct  251  FSVPKGKRAIELIAGKESAVAQIVKTAIGRNYVLSFLVGDANNGCEGPMVVEAFAGKNTV  310

Query  344  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  165
            KV Y SKG+GG+K A+L FRA + RTR+MF+ST+Y  +SD+  SLCGPV+D VKL+SVR 
Sbjct  311  KVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNSGSLCGPVLDDVKLLSVRK  370

Query  164  PH  159
             H
Sbjct  371  LH  372


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 73/190 (38%), Gaps = 37/190 (19%)
 Frame = -1

Query  680  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH------FS  519
            LL N +FE GP       T V+           +P W +     V+YI + H        
Sbjct  26   LLPNGNFEYGPKASELEGTKVMSA-------KAIPNWEISGY--VEYIKSGHKQGDMLLI  76

Query  518  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST---  348
            VP G  AV L  G E+ + Q    V G FY LTF     +  C     L     P+    
Sbjct  77   VPEGAFAVRL--GNEALIKQKIEVVKGDFYSLTF---STARTCAQEERLNVSVSPNNEKN  131

Query  347  ------LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFV  186
                  ++  Y S G   Y  A   F+A A+   +       H    +  + CGP++D V
Sbjct  132  DFGLFPIQTMYSSNGWDSYAWA---FQADAHVIEISI-----HNPGVEEDAACGPLIDSV  183

Query  185  KLVSVRNPHR  156
             L ++ NP R
Sbjct  184  ALKTLYNPKR  193



>gb|KHG06895.1| Agmatine deiminase [Gossypium arboreum]
Length=374

 Score =   254 bits (648),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 146/182 (80%), Gaps = 1/182 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPK-VDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  525
            P+ T  NLLKN +FEEGPY+FP+    GV+ PP  EDDHSPLP W +ESLKA+KYID+EH
Sbjct  191  PKRTRANLLKNGNFEEGPYIFPRPTSEGVIIPPHIEDDHSPLPGWIIESLKAIKYIDSEH  250

Query  524  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  345
            FSVP G+RA+EL+AGKESAV QI +T  G+ Y L+FLVGDA+N CEG MV+EAFAG +T+
Sbjct  251  FSVPKGKRAIELIAGKESAVAQIVKTTIGRNYVLSFLVGDANNGCEGPMVVEAFAGKNTV  310

Query  344  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  165
            KV Y SKG+GG+K A+L FRA + RTR+MF+ST+Y  +SD+  SLCGPV+D VKL+SVR 
Sbjct  311  KVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNSGSLCGPVLDDVKLLSVRK  370

Query  164  PH  159
             H
Sbjct  371  LH  372


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 73/190 (38%), Gaps = 37/190 (19%)
 Frame = -1

Query  680  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH------FS  519
            LL N +FE GP       T V+           +P W +     V+YI + H        
Sbjct  26   LLPNGNFEYGPKASELEGTKVMSA-------KAIPNWEISGY--VEYIKSGHKQGDMLLI  76

Query  518  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST---  348
            VP G  AV L  G E+ + Q    V G FY LTF     +  C     L     P+    
Sbjct  77   VPEGAFAVRL--GNEALIKQKVEVVKGDFYSLTF---STARTCAQEERLNVSVSPNNEKN  131

Query  347  ------LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFV  186
                  ++  Y S G   Y  A   F+A A+   +       H    +  + CGP++D V
Sbjct  132  DFGLFPIQTMYSSNGWDSYAWA---FQADAHVIEISI-----HNPGVEEDAACGPLIDSV  183

Query  185  KLVSVRNPHR  156
             L ++ NP R
Sbjct  184  ALKTLYNPKR  193



>emb|CBI36253.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   254 bits (649),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR T  NLLKN +FEEGPYVFP    GVL PP  EDDHSPLP W +ESLKAVKYID++HF
Sbjct  191  PRRTRANLLKNGNFEEGPYVFPTASWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDSDHF  250

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+R VELVAGKESA++Q+  T+  + Y L+F VGDA+N CEGSMV+EAFAG  T+K
Sbjct  251  AVPEGKRGVELVAGKESALSQVVFTIPNRVYVLSFSVGDANNSCEGSMVVEAFAGLDTVK  310

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VPYESKG+GG+K AKLRF+A + RTRVMF STYY  ++D+  SLCGPV+D VKL+SVR
Sbjct  311  VPYESKGKGGFKRAKLRFKAISKRTRVMFLSTYYTMKNDNSGSLCGPVLDDVKLLSVR  368



>ref|XP_006356190.1| PREDICTED: uncharacterized protein LOC102589576 [Solanum tuberosum]
Length=371

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 141/181 (78%), Gaps = 0/181 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+    N+LKN +FE GPY+FP    GVL PP  EDDHSPL  W +ESLKAVKYID+EHF
Sbjct  189  PKRPRGNMLKNGNFEVGPYIFPNTTWGVLIPPNIEDDHSPLLGWMIESLKAVKYIDSEHF  248

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP G+RAVELVAG+ESA+ Q+ RT  GK YDL F +GDASN CEGSM++EAFAG  T++
Sbjct  249  HVPEGKRAVELVAGRESALAQVVRTRPGKIYDLLFSIGDASNSCEGSMLVEAFAGKITMQ  308

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
             PYESKG+GG+K A+LRF A + RTRV F STYYH +SD+  SLCGPVVD V+LV VRNP
Sbjct  309  FPYESKGKGGFKRARLRFTAISPRTRVRFLSTYYHMKSDNSGSLCGPVVDDVRLVGVRNP  368

Query  161  H  159
            H
Sbjct  369  H  369



>ref|XP_009758146.1| PREDICTED: uncharacterized protein LOC104210873 [Nicotiana sylvestris]
Length=372

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 141/180 (78%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+    N+LKN +FEEGPY+FP    GVL PP  EDDHSPL  W +ESLKAVKYIDAEHF
Sbjct  190  PKRPKGNMLKNGNFEEGPYIFPNTTWGVLIPPNIEDDHSPLLGWMIESLKAVKYIDAEHF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+RAVELVAG+ESA+ Q+ RT  GK YDL F +GDASN CEGSM++EAFAG  T++
Sbjct  250  TVPEGKRAVELVAGRESAIAQVVRTRPGKVYDLIFSIGDASNSCEGSMLVEAFAGKITMQ  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
             PYESKG+GG K ++LRF A + RTRV F STYYH +SD+  SLCGPVVD V+LV VRNP
Sbjct  310  FPYESKGKGGVKRSRLRFTAISPRTRVRFLSTYYHMKSDNSGSLCGPVVDDVRLVGVRNP  369



>gb|KHN07099.1| hypothetical protein glysoja_023282 [Glycine soja]
Length=359

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 144/186 (77%), Gaps = 2/186 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTED--DHSPLPAWTVESLKAVKYIDAE  528
            PR TN N+LKN  FEEGPYVFP   +GVL PP   D  +HSPLP W VESLKAV+YID++
Sbjct  172  PRLTNKNVLKNGGFEEGPYVFPNTSSGVLIPPNIVDHIEHSPLPGWMVESLKAVRYIDSD  231

Query  527  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  348
            HFSVP G+RAVEL+ GKESA+ Q+ART+ GK Y L F VGDA N CEGS+ +EA+ G  +
Sbjct  232  HFSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDAGNSCEGSLSVEAYVGKES  291

Query  347  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            +KVPYESKG+GG+K A L+F A + RTR++F ST+Y+ RSDD  SLCGPV+D V L+S+R
Sbjct  292  VKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYNMRSDDLASLCGPVIDDVTLISLR  351

Query  167  NPHRRL  150
             PHRR 
Sbjct  352  KPHRRF  357



>ref|XP_007023946.1| Uncharacterized protein TCM_028364 [Theobroma cacao]
 gb|EOY26568.1| Uncharacterized protein TCM_028364 [Theobroma cacao]
Length=372

 Score =   252 bits (643),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 145/182 (80%), Gaps = 0/182 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ T  NLLKN +FEEGPY+FP    GVL PP  EDDHSPLP W +ESLKAVKYID+EHF
Sbjct  190  PKRTPANLLKNGNFEEGPYIFPNTSWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDSEHF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+RA+ELVAGKESA+ Q+ +T  G+ Y L+F VGDA+N CEGSMV+EAFAG +T+K
Sbjct  250  SVPEGKRAIELVAGKESALAQVVKTTIGRSYVLSFTVGDANNACEGSMVVEAFAGKNTVK  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
              Y+SKG+GG+K A L F+A ++RTR+MF+ST+Y  +SD+  SLCGPV+D VKL+SVR  
Sbjct  310  ASYQSKGKGGFKRAILAFKAESSRTRIMFYSTFYTMKSDNSGSLCGPVLDDVKLLSVRKL  369

Query  161  HR  156
            H 
Sbjct  370  HH  371



>ref|XP_006581022.1| PREDICTED: uncharacterized protein LOC100802444 isoform X1 [Glycine 
max]
Length=372

 Score =   251 bits (642),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 144/186 (77%), Gaps = 2/186 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTED--DHSPLPAWTVESLKAVKYIDAE  528
            PR TN N+LKN  FEEGPYVFP   +GVL PP   D  +HSPLP W VESLKAV+YID++
Sbjct  185  PRLTNKNVLKNGGFEEGPYVFPNTSSGVLIPPNIVDHIEHSPLPGWMVESLKAVRYIDSD  244

Query  527  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  348
            HFSVP G+RAVEL+ GKESA+ Q+ART+ GK Y L F VGDA N CEGS+ +EA+ G  +
Sbjct  245  HFSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDAGNSCEGSLSVEAYVGKES  304

Query  347  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            +KVPYESKG+GG+K A L+F A + RTR++F ST+Y+ RSDD  SLCGPV+D V L+S+R
Sbjct  305  VKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYNMRSDDLASLCGPVIDDVTLISLR  364

Query  167  NPHRRL  150
             PHRR 
Sbjct  365  KPHRRF  370



>ref|XP_010110340.1| GTP-binding nuclear protein [Morus notabilis]
 gb|EXC26027.1| GTP-binding nuclear protein [Morus notabilis]
Length=573

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 147/182 (81%), Gaps = 1/182 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ T+ NL++N  FE GPYVF    TGVL PP  EDDHSPLP W VESLKAVKYID++HF
Sbjct  185  PKPTSENLIRNPSFEYGPYVF-NTTTGVLIPPNIEDDHSPLPYWMVESLKAVKYIDSDHF  243

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVPHG+RAVELVAGKESA+ Q+ RT+ GK Y LTF VGDASN CEGSM++EAFAG +T+K
Sbjct  244  SVPHGKRAVELVAGKESAIAQVVRTIVGKTYRLTFSVGDASNSCEGSMIVEAFAGRATVK  303

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GG+K   L F AT  RTR+MF ST+Y  RSDDF SLCGPV+D +KL+SVR P
Sbjct  304  VPYESKGKGGFKRGVLTFVATETRTRIMFLSTFYSMRSDDFSSLCGPVLDDIKLLSVRKP  363

Query  161  HR  156
            ++
Sbjct  364  NQ  365



>ref|XP_007150706.1| hypothetical protein PHAVU_005G1745000g, partial [Phaseolus vulgaris]
 gb|ESW22700.1| hypothetical protein PHAVU_005G1745000g, partial [Phaseolus vulgaris]
Length=294

 Score =   248 bits (632),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 141/182 (77%), Gaps = 0/182 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ T  NLLKN +FEEGPY+FP    G L PP  ED HSPLP W VESLKAVKYID++HF
Sbjct  112  PKRTRANLLKNGNFEEGPYLFPNSSWGALIPPHIEDAHSPLPGWIVESLKAVKYIDSDHF  171

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+RA+ELVAGKESA+ Q+  T  G+ YDLTF VGDA+N CEGSM++EAFAG  T++
Sbjct  172  AVPEGKRAIELVAGKESALAQVVITTIGRVYDLTFAVGDANNACEGSMIVEAFAGAETVQ  231

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            +PY+SKG+GG    KLRF+A A RTR+ F ST+Y  +SD+  SLCGPV+D VKL+SVR P
Sbjct  232  IPYQSKGKGGSVRGKLRFKAVATRTRLRFLSTFYTMKSDNSGSLCGPVIDDVKLLSVRYP  291

Query  161  HR  156
             R
Sbjct  292  RR  293



>ref|XP_006346648.1| PREDICTED: uncharacterized protein LOC102598480 [Solanum tuberosum]
Length=380

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 139/174 (80%), Gaps = 0/174 (0%)
 Frame = -1

Query  683  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFSVPHGR  504
            N+LKN +FEEGPY+FP    GVL PP  EDDH PLP W VESLKAVKY+DA+HF+VP G+
Sbjct  204  NMLKNGNFEEGPYIFPNTTWGVLIPPNIEDDHCPLPGWIVESLKAVKYVDADHFTVPEGK  263

Query  503  RAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYESK  324
            RA+ELVAG+ESA+ Q   T AG+ YDLTF VGDA+N CEGSMV+EAFAG   L+  Y SK
Sbjct  264  RAIELVAGRESAIAQQVITKAGRIYDLTFSVGDANNSCEGSMVVEAFAGNVALQFKYVSK  323

Query  323  GQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            G+GG+K AKLRF AT+ RTRV F S+YYH +SD+  SLCGPVVD V+LVSVRNP
Sbjct  324  GKGGFKRAKLRFTATSQRTRVRFLSSYYHMKSDNSGSLCGPVVDDVRLVSVRNP  377



>gb|AFK48067.1| unknown [Lotus japonicus]
Length=204

 Score =   243 bits (621),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 140/182 (77%), Gaps = 0/182 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR T  NLLKN +FEEGPY+FP    GVL PP  ED HSPLP W VESLKAVKYID+ HF
Sbjct  22   PRRTRDNLLKNGNFEEGPYMFPNTSWGVLIPPHIEDAHSPLPGWMVESLKAVKYIDSNHF  81

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+RAVELVAGKES + Q  +T  GK Y LTF VGDA+N CEGSMV+EAFAG  T++
Sbjct  82   AVPAGKRAVELVAGKESVIAQNVKTTIGKVYVLTFAVGDANNSCEGSMVVEAFAGGDTVQ  141

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPY+SKG+GG+   KLRF+A + RTRV F ST+Y  ++D+  SLCGP++D ++L+SVR P
Sbjct  142  VPYQSKGKGGFVRGKLRFKAVSARTRVRFLSTFYTMKNDNSGSLCGPIIDDIRLLSVRYP  201

Query  161  HR  156
             R
Sbjct  202  GR  203



>gb|AGV54541.1| hypothetical protein [Phaseolus vulgaris]
Length=376

 Score =   249 bits (635),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 141/182 (77%), Gaps = 0/182 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ T  NLLKN +FEEGPY+FP    G L PP  ED HSPLP W VESLKAVKYID++HF
Sbjct  194  PKRTRANLLKNGNFEEGPYLFPNSSWGALIPPHIEDAHSPLPGWIVESLKAVKYIDSDHF  253

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+RA+ELVAGKESA+ Q+  T  G+ YDLTF VGDA+N CEGSM++EAFAG  T++
Sbjct  254  AVPEGKRAIELVAGKESALAQVVITTIGRVYDLTFAVGDANNACEGSMIVEAFAGAETVQ  313

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            +PY+SKG+GG    KLRF+A A RTR+ F ST+Y  +SD+  SLCGPV+D VKL+SVR P
Sbjct  314  IPYQSKGKGGSVRGKLRFKAVATRTRLRFLSTFYTMKSDNSGSLCGPVIDDVKLLSVRYP  373

Query  161  HR  156
             R
Sbjct  374  RR  375



>ref|XP_003531698.1| PREDICTED: uncharacterized protein LOC100779277 [Glycine max]
Length=371

 Score =   248 bits (634),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ T  NLLKN +FEEGPYVFPK   GVL PP  ED +SPLP W VESLKAVKYID++HF
Sbjct  192  PKRTRDNLLKNGNFEEGPYVFPKESWGVLIPPHIEDAYSPLPGWMVESLKAVKYIDSDHF  251

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+RA+ELVAGKESA+ Q+  T+ GK YDLTF+VGDA+N CEGSMV+EAFAG  T++
Sbjct  252  AVPEGKRAIELVAGKESAIAQVVITIIGKVYDLTFVVGDANNSCEGSMVVEAFAGKDTIQ  311

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            V Y+SKG+GG+   KLRF+A + RTR+ F ST+Y T+SD+  SLCGP++D ++L+SVR
Sbjct  312  VQYQSKGKGGFIRGKLRFKAMSTRTRIRFLSTFYTTKSDNTGSLCGPIIDDIRLLSVR  369


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 76/188 (40%), Gaps = 31/188 (16%)
 Frame = -1

Query  683  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH------F  522
             LL N DFE GP       + V  P       + +P WT+  +  V+YI +         
Sbjct  26   GLLPNGDFEVGPKPSELKGSIVTTP-------NGIPHWTISGM--VEYIKSGQKQGDMVL  76

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VPHG  AV L  G E+++ Q  + V G FY LTF    AS  C     L     PS  K
Sbjct  77   VVPHGTYAVRL--GNEASIKQKIQVVKGMFYSLTF---SASRTCAQEEKLNVSVVPSNEK  131

Query  341  -----VPYESK-GQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  180
                  P ++  G  G       FRA   R  ++      H    D    CGP++D V L
Sbjct  132  SDWGVFPIQTMYGSNGCDSYACGFRADYPRVEIVI-----HNPGVDEDPACGPLIDSVAL  186

Query  179  VSVRNPHR  156
              + +P R
Sbjct  187  KLLHSPKR  194



>gb|KHN47787.1| hypothetical protein glysoja_029205 [Glycine soja]
Length=369

 Score =   248 bits (634),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ T  NLLKN +FEEGPYVFPK   GVL PP  ED +SPLP W VESLKAVKYID++HF
Sbjct  190  PKRTRDNLLKNGNFEEGPYVFPKESWGVLIPPHIEDAYSPLPGWMVESLKAVKYIDSDHF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+RA+ELVAGKESA+ Q+  T+ GK YDLTF+VGDA+N CEGSMV+EAFAG  T++
Sbjct  250  AVPEGKRAIELVAGKESAIAQVVITIIGKVYDLTFVVGDANNSCEGSMVVEAFAGKDTIQ  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            V Y+SKG+GG+   KLRF+A + RTR+ F ST+Y T+SD+  SLCGP++D ++L+SVR
Sbjct  310  VQYQSKGKGGFIRGKLRFKAMSTRTRIRFLSTFYTTKSDNTGSLCGPIIDDIRLLSVR  367


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 76/188 (40%), Gaps = 31/188 (16%)
 Frame = -1

Query  683  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH------F  522
             LL N DFE GP       + V  P       + +P WT+  +  V+YI +         
Sbjct  24   GLLPNGDFEVGPKPSELKGSIVTTP-------NGIPHWTISGM--VEYIKSGQKQGDMVL  74

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VPHG  AV L  G E+++ Q  + V G FY LTF    AS  C     L     PS  K
Sbjct  75   VVPHGTYAVRL--GNEASIKQKIQVVKGMFYSLTF---SASRTCAQEEKLNVSVVPSNEK  129

Query  341  -----VPYESK-GQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  180
                  P ++  G  G       FRA   R  ++      H    D    CGP++D V L
Sbjct  130  SDWGVFPIQTMYGSNGCDSYACGFRADYPRVEIVI-----HNPGVDEDPACGPLIDSVAL  184

Query  179  VSVRNPHR  156
              + +P R
Sbjct  185  KLLHSPKR  192



>ref|XP_011081171.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105164253 
[Sesamum indicum]
Length=373

 Score =   248 bits (634),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 139/185 (75%), Gaps = 3/185 (2%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+    N+LKN +FEEGPY+FP    GVL PP  EDDHSPLP W +ESLKAVKYID++HF
Sbjct  188  PKRQRGNMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDSDHF  247

Query  521  SVPHGRRAVELVA---GKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPS  351
             VP G+RAVELVA   G+E A+ Q  RTV GK YDL F +GDA N CEGSM++EA AG  
Sbjct  248  GVPEGKRAVELVAVGKGRERALAQTVRTVPGKTYDLIFSIGDAKNSCEGSMMVEATAGKV  307

Query  350  TLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
             L+VPYESKG GG+K AKLRF+A + RTR+ F STYYH +SD+  SLCGPV+D VKLV V
Sbjct  308  ILQVPYESKGAGGFKRAKLRFKAISTRTRIRFLSTYYHMKSDNSGSLCGPVIDDVKLVGV  367

Query  170  RNPHR  156
            R P R
Sbjct  368  RRPGR  372



>gb|KHN07098.1| hypothetical protein glysoja_023281 [Glycine soja]
Length=328

 Score =   247 bits (630),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 141/182 (77%), Gaps = 2/182 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTED--DHSPLPAWTVESLKAVKYIDAE  528
            PR TN N+LKN  FEEGPYVFP   +GVL PP   D  DHSPLP W VESLKAVKYID++
Sbjct  147  PRPTNKNVLKNGGFEEGPYVFPNTTSGVLIPPNIVDLSDHSPLPGWIVESLKAVKYIDSD  206

Query  527  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  348
            HFSVP G+ AVEL+ GKESA+ Q+ART+ GK Y L+F VGDA N CEGS+ +EA+ G  +
Sbjct  207  HFSVPLGKGAVELIGGKESAIAQVARTIPGKTYTLSFAVGDAGNSCEGSLSVEAYVGKES  266

Query  347  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            +KVPYESKG+GG+K A L+F A + RTR++F ST+Y  RSDDF SLCGPV+D V L+S+R
Sbjct  267  VKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYTMRSDDFASLCGPVIDDVTLISLR  326

Query  167  NP  162
             P
Sbjct  327  KP  328



>ref|XP_010061944.1| PREDICTED: uncharacterized protein LOC104449472 [Eucalyptus grandis]
 gb|KCW68990.1| hypothetical protein EUGRSUZ_F02553 [Eucalyptus grandis]
Length=372

 Score =   248 bits (633),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = -1

Query  704  LPRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  525
            +P+ TN NL+KN +FEEGPYV PK   GVL PP  EDDHSPLP W +ESLKAVK++D++H
Sbjct  189  IPKRTNANLVKNGNFEEGPYVPPKTSWGVLIPPHIEDDHSPLPGWIIESLKAVKFVDSDH  248

Query  524  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  345
            F+VP G+RAVELVAGKESA+ Q+  T  GK Y LTF VGDA N CEGSM +EA+AG +++
Sbjct  249  FAVPEGKRAVELVAGKESAIAQVVSTQRGKVYVLTFAVGDAKNSCEGSMAVEAYAGTASV  308

Query  344  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  165
             VPY S G+GGY  AKLRF AT++RTRV F S+YY+ +SD   SLCGPV+D V+LVSVRN
Sbjct  309  TVPYTSTGKGGYVHAKLRFTATSDRTRVRFLSSYYNMQSDHSGSLCGPVIDDVRLVSVRN  368



>gb|KDP37140.1| hypothetical protein JCGZ_06196 [Jatropha curcas]
Length=375

 Score =   248 bits (633),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ T  NLLKN DFEEGPYVFP  D GVL PP  EDDHSPLP W +ESLKAVKYI++EHF
Sbjct  192  PKRTRDNLLKNGDFEEGPYVFPNTDWGVLIPPHIEDDHSPLPGWIIESLKAVKYINSEHF  251

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP G+RA+ELVAGKESA++QI +T+  K Y LTF VGDA+N CEGS+V+E +AG   ++
Sbjct  252  KVPQGKRAIELVAGKESALSQIVKTIPKKSYVLTFNVGDANNSCEGSLVVEVYAGNDKIE  311

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            +PY SKG+GG+KPA+ +F+A +  TR+MF S++Y  +SD+  SLCGPV+D VKL+SVR P
Sbjct  312  IPYVSKGKGGFKPARFQFQAVSTHTRLMFLSSFYTMKSDNSGSLCGPVIDDVKLLSVRRP  371

Query  161  HRRL  150
               L
Sbjct  372  RHLL  375



>ref|XP_011072257.1| PREDICTED: uncharacterized protein LOC105157546 [Sesamum indicum]
Length=401

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 140/180 (78%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+    N+LKN +FEEGPY+FP    G+L PP  EDDHSPLP W +ESLKAVKY+D+ HF
Sbjct  219  PKRQRGNILKNGNFEEGPYIFPNTSYGILIPPNIEDDHSPLPGWMIESLKAVKYVDSNHF  278

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+RAVELVAG+ESA+ Q  RTV GK Y+L F +GDA N CEGSM +EA AG   L+
Sbjct  279  AVPEGKRAVELVAGRESALAQTVRTVPGKTYNLIFSIGDAKNSCEGSMTVEANAGRDILQ  338

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG GG+K AKLRF+A ++RTRV F ST+YH +SD+  SLCGP++D V+LVS+R P
Sbjct  339  VPYESKGNGGFKRAKLRFKAVSSRTRVRFLSTFYHIKSDNSGSLCGPIIDDVRLVSIRYP  398


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/191 (27%), Positives = 77/191 (40%), Gaps = 37/191 (19%)
 Frame = -1

Query  680  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH------FS  519
            LL N +FE GP       T V+      D H+ +P+W +     V+YI + H        
Sbjct  54   LLPNGNFEYGPKPSQMKGTKVI------DPHA-IPSWEISGF--VEYITSGHKQGDMLLV  104

Query  518  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST---  348
            VP G  AV L  G E+++    +   G FY L+F    A+  C     L     P+    
Sbjct  105  VPEGASAVRL--GDEASIKTKVKVTNGMFYSLSF---SAARTCAQEEKLNVSVLPNKESK  159

Query  347  ------LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFV  186
                  ++  Y S G   Y      F A +N   +M      H    +    CGP++D +
Sbjct  160  DWGILPIQTVYSSDGWDSYS---WGFLAQSNDIEIMI-----HNPGKEKDPACGPLIDSI  211

Query  185  KLVSVRNPHRR  153
             L ++ NP R+
Sbjct  212  ALKALPNPKRQ  222



>gb|KHG10708.1| Allergen Act d 3 [Gossypium arboreum]
Length=374

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 148/182 (81%), Gaps = 1/182 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPK-VDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  525
            P+ T VNLLKN +FEEGPY+F   V  GV+ PP  EDDHSPLP W ++SLKAVKYID++H
Sbjct  191  PKRTRVNLLKNGNFEEGPYIFSGPVSEGVIIPPHIEDDHSPLPGWIIDSLKAVKYIDSDH  250

Query  524  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  345
            F+VP G+RA+EL+AGKES+++Q+ RT  G+ Y L+F +GDA+N CEGSMV+EAFA  +T+
Sbjct  251  FTVPEGKRAIELIAGKESSLSQVVRTTIGRDYVLSFTIGDANNACEGSMVVEAFANKNTV  310

Query  344  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  165
            KV Y+SKG+GG+K A+LRF+A + RTR+MF+ST+Y  ++D+  SLCGPVVD VKLVS+R 
Sbjct  311  KVTYDSKGKGGFKQARLRFKADSTRTRIMFYSTFYTMKNDNSGSLCGPVVDDVKLVSIRK  370

Query  164  PH  159
             H
Sbjct  371  LH  372



>ref|XP_004486698.1| PREDICTED: uncharacterized protein LOC101495368 [Cicer arietinum]
Length=373

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 139/183 (76%), Gaps = 0/183 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR T  NLLKN +FEEGPYVFP    GVL PP  ED H PLP W VESLKAVKYID++HF
Sbjct  190  PRRTRANLLKNGNFEEGPYVFPNASWGVLIPPHIEDAHGPLPGWIVESLKAVKYIDSKHF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP G RA+ELVAGKESA+ Q+  T  GK YDLTF VGDA+N CEGSM +EAFAG  T++
Sbjct  250  YVPEGNRAIELVAGKESALAQVVITTIGKVYDLTFSVGDANNSCEGSMTVEAFAGGDTVQ  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG+GG+   KLRF A + RTR+ F ST+Y  ++D+  SLCGPV+D VKL+SVR P
Sbjct  310  VPYESKGKGGFVRGKLRFTALSTRTRIRFLSTFYTMKNDNSGSLCGPVIDDVKLLSVRYP  369

Query  161  HRR  153
            ++ 
Sbjct  370  NKH  372


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 78/188 (41%), Gaps = 32/188 (17%)
 Frame = -1

Query  680  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH------FS  519
            LL N DFE GP    ++   V+        H  +P WT+     V+YI +          
Sbjct  25   LLPNGDFEVGPKA-SELKGSVVT------SHDGIPNWTISGF--VEYIKSGQKQGDMLLI  75

Query  518  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK-  342
            VP G  AV L  G E+ + Q  +   G FY +TF    A+  C     L     P+T K 
Sbjct  76   VPEGAYAVRL--GNEAYIKQKVKLNKGSFYSITF---SAARTCAQEEKLNVSVVPTTEKR  130

Query  341  ----VPYESK-GQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLV  177
                +P ++  G  G++     F+A   +  ++      H    +    CGP++D V L 
Sbjct  131  DYGIIPIQTMYGSNGWESFACGFKADYEQGEIVI-----HNSGVEDDPACGPLIDSVAL-  184

Query  176  SVRNPHRR  153
             V NP RR
Sbjct  185  KVLNPPRR  192



>ref|XP_009598172.1| PREDICTED: uncharacterized protein LOC104094024 [Nicotiana tomentosiformis]
Length=379

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P     N+LKN +FEEGPY+FP  + G+L PP  EDDH PLP W +ESLKAVKYID EHF
Sbjct  197  PHRPKGNMLKNGNFEEGPYIFPNTNWGILIPPNIEDDHCPLPGWIIESLKAVKYIDTEHF  256

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+RAVELVAG+ESA+ Q   T AGK YDL F VGDA+N CEGSM++EAFAG   L+
Sbjct  257  AVPEGKRAVELVAGRESALAQQVITKAGKIYDLIFTVGDANNSCEGSMLIEAFAGKVALQ  316

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPY SKG+GG+K AK RF A + RTRV F ST YH ++D+  SLCGPV+D V+LVSVRNP
Sbjct  317  VPYMSKGKGGFKRAKFRFTAISRRTRVRFLSTNYHMKTDNSGSLCGPVIDDVRLVSVRNP  376


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 81/189 (43%), Gaps = 34/189 (18%)
 Frame = -1

Query  680  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWT----VESLKAVKYIDAEHFSVP  513
            LL N +FE+GP       T V+      D H+ +P W     VE +K+ +        VP
Sbjct  31   LLPNGNFEQGPKPSQMKHTRVM------DPHA-IPHWELSGYVEYIKSGQMQGDMLLPVP  83

Query  512  HGRRAVELVAGKESAV-TQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST----  348
             G  AV L  G+++++ T++     G FY L+F+    +  C     L     PS     
Sbjct  84   QGDFAVRL--GEDASLKTKVVNVTKGTFYALSFVF---ARTCAQEERLNVSVTPSKEPKD  138

Query  347  -----LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVK  183
                 L+  Y S G   Y      F A AN   ++      H  + +    CGP++DFV 
Sbjct  139  WGMLPLQTMYSSDGWDTYS---WGFLAEANVVEIVL-----HNPAREKDPACGPLIDFVA  190

Query  182  LVSVRNPHR  156
            L +++ PHR
Sbjct  191  LKALKTPHR  199



>ref|XP_003526423.1| PREDICTED: uncharacterized protein LOC100801917 [Glycine max]
Length=365

 Score =   246 bits (628),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 141/182 (77%), Gaps = 2/182 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTED--DHSPLPAWTVESLKAVKYIDAE  528
            PR TN N+LKN  FEEGPYVFP   +GVL PP   D  DHSPLP W VESLKAVKYID++
Sbjct  184  PRPTNKNVLKNGGFEEGPYVFPNTTSGVLIPPNIVDLSDHSPLPGWIVESLKAVKYIDSD  243

Query  527  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  348
            HFSVP G+ AVEL+ GKESA+ Q+ART+ GK Y L+F VGDA N CEGS+ +EA+ G  +
Sbjct  244  HFSVPLGKGAVELIGGKESAIAQVARTIPGKTYTLSFAVGDAGNSCEGSLSVEAYVGKES  303

Query  347  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            +KVPYESKG+GG+K A L+F A + RTR++F ST+Y  RSDDF SLCGPV+D V L+S+R
Sbjct  304  VKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYTMRSDDFASLCGPVIDDVTLISLR  363

Query  167  NP  162
             P
Sbjct  364  KP  365



>gb|KJB68131.1| hypothetical protein B456_010G227400 [Gossypium raimondii]
Length=374

 Score =   246 bits (627),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 147/182 (81%), Gaps = 1/182 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPK-VDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  525
            P+ T VNLLKN +FEEGPY+F   +  GV+ PP  EDDHSPLP W ++SLKAVKYID++H
Sbjct  191  PKRTRVNLLKNGNFEEGPYIFAGPISEGVIIPPHIEDDHSPLPGWIIDSLKAVKYIDSDH  250

Query  524  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  345
            F+VP G+RA+EL+AGKES+++Q+ RT  G  Y L+F +GDA+N CEGSMV+EAFA  +T+
Sbjct  251  FTVPEGKRAIELIAGKESSLSQVVRTTIGGDYVLSFTIGDANNACEGSMVVEAFANKNTV  310

Query  344  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  165
            KV Y+SKG+GG+K A+LRF+A + RTR+MF+ST+Y  ++D+  SLCGPVVD VKLVS+R 
Sbjct  311  KVTYDSKGKGGFKQARLRFKADSTRTRIMFYSTFYTMKNDNSGSLCGPVVDDVKLVSIRK  370

Query  164  PH  159
             H
Sbjct  371  LH  372



>dbj|BAK03126.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   245 bits (626),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 143/182 (79%), Gaps = 1/182 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NL+KN DFEEGPY+ P    GVL P  T D+HSPLP W VESLKAVKYID++HF
Sbjct  189  PRRTNKNLVKNGDFEEGPYIIPGTKWGVLIPSRTVDEHSPLPGWMVESLKAVKYIDSDHF  248

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP GRRAVEL+AG+ESA+ Q+ RTV GK Y L+F VGDASN C GS+++EA+AG  + K
Sbjct  249  AVPRGRRAVELLAGRESAIAQVIRTVPGKQYALSFSVGDASNTCRGSLMVEAYAGRESAK  308

Query  341  VPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  165
            VPYES GQGG  K A L FRAT+ RTRV+FFS++Y+TR+DD  SLCGPV+D V +VSVR 
Sbjct  309  VPYESAGQGGAAKRAVLPFRATSPRTRVVFFSSFYNTRTDDMSSLCGPVIDDVAVVSVRA  368

Query  164  PH  159
             H
Sbjct  369  RH  370



>ref|XP_002303263.1| hypothetical protein POPTR_0003s05850g [Populus trichocarpa]
 gb|EEE78242.1| hypothetical protein POPTR_0003s05850g [Populus trichocarpa]
Length=374

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 139/184 (76%), Gaps = 0/184 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+    NLLKN +FEEGPYVFP  D GVL PP  EDDH PLP W V+SLKAVKYID++HF
Sbjct  190  PKRPKDNLLKNGNFEEGPYVFPNADWGVLVPPNIEDDHCPLPGWMVDSLKAVKYIDSDHF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+RAVELVAGKESA++Q+ +T   K Y LTF VGD SN C GSMV+E +AG    +
Sbjct  250  TVPEGKRAVELVAGKESAISQVVKTTISKIYALTFSVGDTSNSCVGSMVVEVYAGKDKTQ  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES G+GG+K AK  F+A +N TR+ F S++Y  +SD+  SLCGPV+D VKLVSVRNP
Sbjct  310  VPYESNGKGGFKHAKFVFKAISNHTRITFLSSFYTMKSDNSGSLCGPVLDDVKLVSVRNP  369

Query  161  HRRL  150
             R L
Sbjct  370  RRHL  373


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 75/190 (39%), Gaps = 37/190 (19%)
 Frame = -1

Query  680  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH------FS  519
            LL N DFE+GP   P    G +         + +P W +     ++YI + H        
Sbjct  25   LLPNGDFEQGPR--PSEMKGTVVTA-----KNAIPNWEISGF--IEYIKSGHKQGDMVLV  75

Query  518  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST---  348
            VP G  AV L  G E+++ Q  +   G FY LTF   + +  C     L     P++   
Sbjct  76   VPAGAYAVRL--GNEASIKQRVKVTQGLFYSLTF---NVARTCAQEEKLNVSVSPNSEPR  130

Query  347  ------LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFV  186
                  ++  Y S G   Y  A   F+A      +       H    +  + CGP++D V
Sbjct  131  DWGILPMQTMYSSNGWDAYAWA---FQADGPEVEISI-----HNPGVEEDAACGPLIDSV  182

Query  185  KLVSVRNPHR  156
             L  + NP R
Sbjct  183  ALKLLSNPKR  192



>ref|XP_011040006.1| PREDICTED: uncharacterized protein LOC105136392 [Populus euphratica]
Length=396

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 139/184 (76%), Gaps = 0/184 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+    NLLKN +FEEGPYVFP  D GVL PP  EDDH PLP W V+SLKAVKYID++HF
Sbjct  212  PKRPKDNLLKNGNFEEGPYVFPSTDWGVLVPPNIEDDHCPLPGWMVDSLKAVKYIDSDHF  271

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+RAVELVAGKESA++Q+ +T   K Y LTF VGD SN C GSMV+E +AG    +
Sbjct  272  TVPEGKRAVELVAGKESAISQVVKTTISKIYALTFSVGDTSNSCVGSMVVEVYAGKDKTQ  331

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES G+GG+K AK  F+A +N TR+ F S++Y  +SD+  SLCGPV+D VKLVSVRNP
Sbjct  332  VPYESNGKGGFKHAKFVFKAISNHTRITFLSSFYSMKSDNSGSLCGPVLDDVKLVSVRNP  391

Query  161  HRRL  150
             R L
Sbjct  392  RRHL  395


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 51/190 (27%), Positives = 75/190 (39%), Gaps = 37/190 (19%)
 Frame = -1

Query  680  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH------FS  519
            LL N DFE+GP       T V          S +P W +     ++YI + H        
Sbjct  47   LLPNGDFEQGPKPSEMKGTVVTA-------KSAIPNWEISGF--IEYIKSGHKQGDMVLV  97

Query  518  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST---  348
            VP G  AV L  G E+++ Q  +   G FY LTF   + +  C     L     P++   
Sbjct  98   VPAGAYAVRL--GNEASIKQRVKVTQGLFYSLTF---NVARTCAQEEKLNVSVSPNSEPR  152

Query  347  ------LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFV  186
                  ++  Y S G   Y  A   F+A     ++       H    +  + CGP++D V
Sbjct  153  DWGILPMQTMYSSNGWDAYAWA---FQADGPEVKISI-----HNPGVEEDAACGPLIDSV  204

Query  185  KLVSVRNPHR  156
             L  + NP R
Sbjct  205  ALKLLSNPKR  214



>ref|XP_011466738.1| PREDICTED: uncharacterized protein LOC101306247 isoform X2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466739.1| PREDICTED: uncharacterized protein LOC101306247 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=333

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 139/183 (76%), Gaps = 0/183 (0%)
 Frame = -1

Query  704  LPRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  525
            +P+ T  NLLKN +FEEGPYVFP    GVL PP  EDDHSPLP W +ESLKAVKYID++H
Sbjct  150  IPKRTRANLLKNGNFEEGPYVFPNTSWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDSKH  209

Query  524  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  345
            F+VP GRRA+EL+AGKESA+ Q+  T  G+ Y LTF VGD +N CEGS+ +EAFAG  T+
Sbjct  210  FAVPEGRRAIELIAGKESALAQVVFTKPGRRYTLTFSVGDGNNGCEGSLFIEAFAGKETV  269

Query  344  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  165
            KVPYESKG+GG+K A+L F A + RTRVMF ST Y   SD   SLCGPV+D VKL+S+R 
Sbjct  270  KVPYESKGKGGFKKARLFFTAVSPRTRVMFLSTMYTMTSDHSGSLCGPVIDDVKLLSIRG  329

Query  164  PHR  156
              R
Sbjct  330  RPR  332



>ref|XP_009764126.1| PREDICTED: uncharacterized protein LOC104215887 [Nicotiana sylvestris]
Length=379

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P     N+LKN +FEEGPY+FP  + G+L PP  EDDH PLP W +ESLKAVKY+DAEHF
Sbjct  197  PHRPKGNMLKNGNFEEGPYIFPNTNWGILIPPNIEDDHCPLPGWIIESLKAVKYVDAEHF  256

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+RAVELVAG+ESA+ Q   T AGK YDL F VGDA+N CEGSM++EAFAG   L+
Sbjct  257  TVPEGKRAVELVAGRESALAQQVITKAGKIYDLIFTVGDANNSCEGSMLIEAFAGKVALQ  316

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            V Y SKG+GG+K AKLRF A + RT V F ST YH +SD+  SLCGPV+D V+LVSVRNP
Sbjct  317  VRYMSKGKGGFKRAKLRFTAISRRTGVRFLSTNYHMKSDNSGSLCGPVIDDVRLVSVRNP  376


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 81/189 (43%), Gaps = 34/189 (18%)
 Frame = -1

Query  680  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWT----VESLKAVKYIDAEHFSVP  513
            LL N +FE+GP       T V+ P      H+ +P W     VE +K+ +        VP
Sbjct  31   LLPNGNFEQGPKPSQMKHTIVINP------HA-IPHWELSGYVEYIKSGQMQGDMLLPVP  83

Query  512  HGRRAVELVAGKESAV-TQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST----  348
             G  AV L  G+++++ T++     G FY L+F+    +  C     L     PS     
Sbjct  84   QGDFAVRL--GEDASLKTKVVNVTKGTFYALSFVF---ARTCAQEERLNVSVTPSKEPKD  138

Query  347  -----LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVK  183
                 L+  Y S G   Y      F A AN   ++      H  + +    CGP++DFV 
Sbjct  139  WGMLPLQTMYSSDGWDTYS---WGFFAEANVIEIVL-----HNPAREKDPACGPLIDFVA  190

Query  182  LVSVRNPHR  156
            L +++ PHR
Sbjct  191  LKALKTPHR  199



>ref|XP_004252488.1| PREDICTED: uncharacterized protein LOC101250580 [Solanum lycopersicum]
Length=380

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 136/174 (78%), Gaps = 0/174 (0%)
 Frame = -1

Query  683  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFSVPHGR  504
            N+LKN +FEEGPY+FP    GVL PP  EDDH PLP W VESLKAVKY+DA+HF+VP G+
Sbjct  204  NMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHCPLPGWIVESLKAVKYVDADHFTVPEGK  263

Query  503  RAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYESK  324
            RA+ELVAG+ESA+ Q   T  G+ YDL F VGDA+N CEGSMV+EAFAG   L+  Y SK
Sbjct  264  RAIELVAGRESAIAQQVITKTGRIYDLIFSVGDANNACEGSMVVEAFAGNVALQFQYVSK  323

Query  323  GQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            G+GG+K AKLRF A + RTRV F S+YYH +SD+  SLCGPV+D V+LVSVRNP
Sbjct  324  GKGGFKRAKLRFTAMSQRTRVRFLSSYYHMKSDNSGSLCGPVIDDVRLVSVRNP  377


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 78/188 (41%), Gaps = 31/188 (16%)
 Frame = -1

Query  680  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWT----VESLKAVKYIDAEHFSVP  513
            LL N +FE+GP      +T V+ P      H+ +P W     VE +K+ +        VP
Sbjct  31   LLPNGNFEQGPKSSQMKNTRVIDP------HA-IPHWELSGYVEYIKSGQMQGDMLLPVP  83

Query  512  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST-----  348
             G  AV L  G  S  T++     G FY L+F+    +  C     L     P++     
Sbjct  84   QGDYAVRLGEGA-SLKTKVTSVTKGTFYSLSFVF---ARTCAQEERLNVSVSPNSEPKDW  139

Query  347  ----LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  180
                L+  Y S G   Y      F A AN   ++  +   H +       CGP++DFV L
Sbjct  140  GMLPLQTMYSSDGWDTYS---WGFLAEANEIDIVLHNPIAHEKD----PACGPLIDFVAL  192

Query  179  VSVRNPHR  156
             +++  HR
Sbjct  193  KALKTTHR  200



>ref|XP_009333642.1| PREDICTED: uncharacterized protein LOC103926567 [Pyrus x bretschneideri]
Length=373

 Score =   244 bits (622),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 137/179 (77%), Gaps = 0/179 (0%)
 Frame = -1

Query  704  LPRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  525
             P+ T  NLLKN +FEEGPYVFP    GVL PP  EDDHSPLP W +ESLKAVKYID++H
Sbjct  192  FPKRTRANLLKNGNFEEGPYVFPNTSWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDSKH  251

Query  524  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  345
            FSVP GRRA+ELVAGKESA+ Q+  T+ GK Y LTF VGD++N CEGS+ +EAFAG  TL
Sbjct  252  FSVPEGRRAIELVAGKESALAQVVFTLPGKLYALTFTVGDSNNACEGSLAVEAFAGKDTL  311

Query  344  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            KV Y+SKGQGG+K A+  F A   RTRVMF+S +Y   +D   SLCGPV+D VKL+SVR
Sbjct  312  KVLYQSKGQGGFKRARFLFTAVGPRTRVMFYSMFYTMAADHSGSLCGPVIDDVKLLSVR  370



>gb|EMS52012.1| hypothetical protein TRIUR3_31218 [Triticum urartu]
Length=312

 Score =   242 bits (617),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 142/179 (79%), Gaps = 1/179 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NL+KN DFEEGPY+ P    GVL P    D+HSPLP W VESLKAVKYID++HF
Sbjct  127  PRRTNKNLVKNGDFEEGPYIIPGTKWGVLIPSRMVDEHSPLPGWMVESLKAVKYIDSDHF  186

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP GRRAVEL+AG+ESA+ Q+ RTV GK Y L+F VGDASN C GS+++EA+AG  + K
Sbjct  187  AVPRGRRAVELLAGRESAIAQVIRTVPGKQYALSFSVGDASNTCRGSLMVEAYAGRESTK  246

Query  341  VPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VPYES GQGG  K A L FRAT++RTRV+FFS++Y+TR+DD  SLCGPV+D V +VSVR
Sbjct  247  VPYESAGQGGAAKRAVLPFRATSSRTRVVFFSSFYNTRTDDMSSLCGPVIDDVAVVSVR  305



>ref|XP_011466736.1| PREDICTED: uncharacterized protein LOC101306247 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=373

 Score =   243 bits (621),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 139/183 (76%), Gaps = 0/183 (0%)
 Frame = -1

Query  704  LPRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  525
            +P+ T  NLLKN +FEEGPYVFP    GVL PP  EDDHSPLP W +ESLKAVKYID++H
Sbjct  190  IPKRTRANLLKNGNFEEGPYVFPNTSWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDSKH  249

Query  524  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  345
            F+VP GRRA+EL+AGKESA+ Q+  T  G+ Y LTF VGD +N CEGS+ +EAFAG  T+
Sbjct  250  FAVPEGRRAIELIAGKESALAQVVFTKPGRRYTLTFSVGDGNNGCEGSLFIEAFAGKETV  309

Query  344  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  165
            KVPYESKG+GG+K A+L F A + RTRVMF ST Y   SD   SLCGPV+D VKL+S+R 
Sbjct  310  KVPYESKGKGGFKKARLFFTAVSPRTRVMFLSTMYTMTSDHSGSLCGPVIDDVKLLSIRG  369

Query  164  PHR  156
              R
Sbjct  370  RPR  372



>ref|XP_011035644.1| PREDICTED: uncharacterized protein LOC105133377 [Populus euphratica]
Length=373

 Score =   243 bits (620),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 139/184 (76%), Gaps = 0/184 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+    NLLKN +FEEGPY+FP  D GVL PP  EDD  PLP W V+SLKAVKYID+EHF
Sbjct  190  PKRARDNLLKNGNFEEGPYMFPNTDWGVLIPPHNEDDQCPLPGWIVDSLKAVKYIDSEHF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+RAVEL+AGKESA++QI +T+  K Y LTF VGD SN C GSMV+E +AG    +
Sbjct  250  TVPEGKRAVELIAGKESAISQIVKTIINKIYVLTFNVGDTSNSCVGSMVVEVYAGKDRTQ  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPY+S G+GG+K AK  F+A +N TR+ F S++Y  +SD+  SLCGPV+D VKLVSVRNP
Sbjct  310  VPYKSNGKGGFKRAKFVFKAVSNHTRITFLSSFYTMKSDNSGSLCGPVLDDVKLVSVRNP  369

Query  161  HRRL  150
             R L
Sbjct  370  RRHL  373



>ref|NP_001242447.1| uncharacterized protein LOC100802444 precursor [Glycine max]
 gb|ACU22816.1| unknown [Glycine max]
Length=370

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 141/186 (76%), Gaps = 2/186 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTED--DHSPLPAWTVESLKAVKYIDAE  528
            PR TN N+LKN  FEEG YVFP   +GVL PP   D  +HSPLP W VESLKAV+YID++
Sbjct  183  PRLTNKNVLKNGGFEEGLYVFPNTSSGVLIPPNIVDHIEHSPLPGWMVESLKAVRYIDSD  242

Query  527  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  348
            HFSVP G+RAVEL+ GKESA+ Q+ART+ GK Y L F VGDA N  EGS+ +EA+ G  +
Sbjct  243  HFSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDAGNSSEGSLSVEAYVGKES  302

Query  347  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            +KVPYESKG+GG+K A L+F A + RT ++F ST+Y+ RSDD  SLCGPV+D V L+S+R
Sbjct  303  VKVPYESKGKGGFKRATLKFVAVSTRTHILFLSTFYNMRSDDLASLCGPVIDDVTLISLR  362

Query  167  NPHRRL  150
             PHRR 
Sbjct  363  KPHRRF  368



>ref|XP_008347484.1| PREDICTED: uncharacterized protein LOC103410579 [Malus domestica]
Length=374

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ T  NLLKN +FEEGPYV P    G L PP  EDDHSPLP W +ESLKAVKYID+EHF
Sbjct  193  PKRTRANLLKNGNFEEGPYVSPNTSWGTLIPPHIEDDHSPLPGWIIESLKAVKYIDSEHF  252

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP GRRA+ELV GKESA+TQ+  T  GK Y LTF VGD++N CEGS+V+EAFAG  TLK
Sbjct  253  FVPEGRRAIELVTGKESALTQVVFTKPGKLYALTFSVGDSNNSCEGSLVVEAFAGKDTLK  312

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VPY+SKG+GG+K A+L F A   RTR+MF+ST+Y   +D   SLCGP++D VKL+SVR
Sbjct  313  VPYQSKGKGGFKRARLIFTAVGPRTRIMFYSTFYTMVADHSGSLCGPIIDDVKLLSVR  370



>gb|EYU24667.1| hypothetical protein MIMGU_mgv1a008541mg [Erythranthe guttata]
Length=370

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 138/182 (76%), Gaps = 0/182 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR    N+LKN +FE GPY+FP    GVL PP  EDDHSPLP W +ESLKAVKYID+++F
Sbjct  188  PRRPRGNMLKNGNFEAGPYIFPNTKWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDSDNF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP G+RAVELV G+ES V Q+ RT   K YDL F VGD++NKCEGSM++ A+AG   L+
Sbjct  248  RVPEGKRAVELVGGRESVVAQVVRTEPEKVYDLVFSVGDSNNKCEGSMMVVAYAGVDILQ  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYESKG GG+K A++RF+AT+ RTR+ F S YYH +SD+  SLCGPVVD V+LV +R P
Sbjct  308  VPYESKGHGGFKSARMRFKATSTRTRIRFSSEYYHMKSDNSGSLCGPVVDDVRLVRIRYP  367

Query  161  HR  156
             R
Sbjct  368  SR  369



>ref|XP_009348421.1| PREDICTED: uncharacterized protein LOC103940075 [Pyrus x bretschneideri]
Length=374

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ T  NLLKN +FEEGPYV P    GVL PP  EDDHSPLP W +ESLKAVKYID++HF
Sbjct  193  PKRTRANLLKNGNFEEGPYVLPNASWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDSKHF  252

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP GRRA+ELV GKESA+ Q+  T  GK Y LTF VGD++N CEGS+++EAFAG  TLK
Sbjct  253  FVPEGRRAIELVGGKESALAQVVFTKPGKLYALTFSVGDSNNACEGSLIVEAFAGKDTLK  312

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VPY+SKG+GG+K A+L F A   RTR+MF+ST+Y   +D   SLCGP++D VKL+SVR
Sbjct  313  VPYQSKGKGGFKRARLLFTAVGPRTRIMFYSTFYTMSADHSGSLCGPIIDDVKLLSVR  370



>ref|XP_003597843.1| hypothetical protein MTR_2g103170 [Medicago truncatula]
 gb|AES68094.1| plant/F18G18-200 protein [Medicago truncatula]
Length=373

 Score =   241 bits (616),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 138/182 (76%), Gaps = 0/182 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P  T  NLLKN +FEEGPYVFP    GVL PP  ED H PLP W VESLKAVKYID+EHF
Sbjct  190  PIRTRANLLKNGNFEEGPYVFPNASWGVLIPPHIEDAHGPLPGWIVESLKAVKYIDSEHF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+RA+ELVAGKESA+ Q   T  GK Y LTF VGDA+N CEGSM +EAFAG  T++
Sbjct  250  TVPEGKRAIELVAGKESALAQEVFTTIGKVYVLTFAVGDANNACEGSMTVEAFAGRDTVQ  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPY+SKG+GG+   KLRF+A+  RTR+ F ST+Y  ++D+  SLCGPV+D VKL+SVR P
Sbjct  310  VPYQSKGKGGFVRGKLRFKASTRRTRIRFLSTFYTMKNDNSGSLCGPVIDDVKLLSVRYP  369

Query  161  HR  156
            + 
Sbjct  370  NN  371



>ref|XP_008377611.1| PREDICTED: uncharacterized protein LOC103440696 [Malus domestica]
Length=374

 Score =   241 bits (616),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ T  NLLKN +FEEGPYV P    GVL PP  EDDHSPLP W +ESLKAVKYID++HF
Sbjct  193  PKRTRANLLKNGNFEEGPYVLPNTSWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDSQHF  252

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP GR+A+ELV GKESA+ Q+  T  GK Y LTF VGD++N CEGS+++EAFAG  TLK
Sbjct  253  FVPEGRKAIELVGGKESALAQVVFTKPGKLYALTFSVGDSNNACEGSLIVEAFAGKDTLK  312

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VPY+SKG+GG+K A+L F A   RTR+MF+ST+Y   +D   SLCGP++D VKL+SVR
Sbjct  313  VPYQSKGKGGFKRARLLFTAVGPRTRIMFYSTFYTMSADHSGSLCGPIIDDVKLLSVR  370



>ref|XP_008228640.1| PREDICTED: uncharacterized protein LOC103328032 [Prunus mume]
Length=375

 Score =   241 bits (616),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 135/178 (76%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ T  NLLKN DFEEGPYVFP    GVL PP  EDDHSPLP W +ESLKAVKYID+ HF
Sbjct  194  PKRTRANLLKNGDFEEGPYVFPNTSWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDSNHF  253

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+RA+ELVAGKESA+ Q+  T  G+ Y LTF VGD+ N CEGS+V+EAFAG  TLK
Sbjct  254  AVPEGQRAIELVAGKESALAQVVFTKPGRLYALTFSVGDSKNSCEGSLVVEAFAGKDTLK  313

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VPYES G+GG+K A+L F A    TRVMF S++Y   +D   SLCGPV+D VKL+SVR
Sbjct  314  VPYESMGKGGFKRARLLFTAVETHTRVMFLSSFYTMSADHSGSLCGPVIDDVKLLSVR  371



>ref|XP_002298115.2| hypothetical protein POPTR_0001s17430g [Populus trichocarpa]
 gb|EEE82920.2| hypothetical protein POPTR_0001s17430g [Populus trichocarpa]
Length=389

 Score =   242 bits (617),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 137/184 (74%), Gaps = 0/184 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+    NLLKN +FEEGPY+FP  D GVL PP  EDD  PLP W V+SLKAVKYID EHF
Sbjct  206  PKRARDNLLKNGNFEEGPYMFPNTDWGVLIPPHIEDDQCPLPGWIVDSLKAVKYIDREHF  265

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+RAVELVAGKESA++Q  +T+  K Y LTF VGD SN C GSMV+E +AG    +
Sbjct  266  TVPEGKRAVELVAGKESAISQTVKTIINKIYVLTFYVGDTSNSCVGSMVVEVYAGKDRTQ  325

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPYES G+GG+K AK  F+A +N TR+ F S++Y  +SD+  SLCGPV+D VKLVSVRNP
Sbjct  326  VPYESNGKGGFKRAKFVFKAVSNHTRITFLSSFYTMKSDNSGSLCGPVLDDVKLVSVRNP  385

Query  161  HRRL  150
             R L
Sbjct  386  RRHL  389



>gb|KHN44154.1| hypothetical protein glysoja_031815 [Glycine soja]
Length=374

 Score =   241 bits (616),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ T  NLLKN + EEGPY+FP    G L PP  ED H PLP W VESLKAVKYID++HF
Sbjct  192  PKRTRANLLKNGNLEEGPYIFPNSSWGALIPPHIEDSHGPLPGWIVESLKAVKYIDSDHF  251

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+RA+ELVAGKESA+ Q+  T  GK YDLTF VGDA+N+CE SM++EAFAG +T++
Sbjct  252  AVPEGKRAIELVAGKESALAQVVITTIGKTYDLTFAVGDANNECEASMMVEAFAGANTVQ  311

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            VPY+SKG+GG+   KLRF+A + RTR+ F ST+Y  +SD+  SLCGPV+D VKL+ VR P
Sbjct  312  VPYQSKGKGGFVRGKLRFKAVSTRTRLRFLSTFYTMKSDNSGSLCGPVIDDVKLLGVRYP  371


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 78/188 (41%), Gaps = 31/188 (16%)
 Frame = -1

Query  683  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH------F  522
             LL N +FE+GP   P    G +        H  +P WT+     V+YI +         
Sbjct  26   GLLPNGNFEQGPK--PSQLKGSVV-----TGHDAIPNWTISGF--VEYIKSGQKQGDMLL  76

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP G  AV L  G E+++ Q  + + G FY +TF    A+  C     L     P+T K
Sbjct  77   VVPEGDYAVRL--GNEASIKQKLKLIKGSFYSITF---SAARTCAQEEKLNVSVVPTTEK  131

Query  341  -----VPYESK-GQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  180
                 +P ++  G  G++     FRA     +++      H    +    CGP++D V L
Sbjct  132  RDWGIIPIQTMYGSNGWESFTCGFRADFPEAQIVI-----HNPGKEEDPACGPLIDSVAL  186

Query  179  VSVRNPHR  156
              +  P R
Sbjct  187  KVLYPPKR  194



>ref|XP_007217604.1| hypothetical protein PRUPE_ppa018156mg [Prunus persica]
 gb|EMJ18803.1| hypothetical protein PRUPE_ppa018156mg [Prunus persica]
Length=375

 Score =   241 bits (616),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ T  NLLKN +FEEGP+VFP    GVL PP  EDDHSPLP W +ESLKAVKYID+ HF
Sbjct  194  PKRTRANLLKNGNFEEGPFVFPNTSWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDSTHF  253

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+RA+ELVAGKESA+ Q+  T  G+ Y LTF VGD+ N CEGS+V+EAFAG  TLK
Sbjct  254  AVPEGQRAIELVAGKESALAQVVFTKPGRLYALTFSVGDSKNACEGSLVVEAFAGKDTLK  313

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VPYESKG+GG+K A+L F A    TRVMF ST+Y   +D   SLCGPV+D VKL+SVR
Sbjct  314  VPYESKGKGGFKRARLLFTAVETHTRVMFLSTFYTMSADHSGSLCGPVIDDVKLLSVR  371



>gb|EMT16005.1| hypothetical protein F775_13621 [Aegilops tauschii]
Length=340

 Score =   240 bits (612),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 142/179 (79%), Gaps = 1/179 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NL+KN DFEEGPY+ P    GVL P    D+HSPLP W VESLKAVKYID++HF
Sbjct  155  PRRTNKNLVKNGDFEEGPYIIPGTKWGVLIPSRMVDEHSPLPGWMVESLKAVKYIDSDHF  214

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F VG+ASN C GS+++EA+AG  + K
Sbjct  215  AVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFSVGNASNTCRGSLMVEAYAGRESTK  274

Query  341  VPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VPYES GQGG  K A L FRAT++RTRV+FFS++Y+TR+DD  SLCGPV+D V +VSVR
Sbjct  275  VPYESAGQGGAAKRAVLPFRATSSRTRVVFFSSFYNTRTDDMSSLCGPVIDDVAVVSVR  333



>dbj|BAD16016.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD38436.1| unknown protein [Oryza sativa Japonica Group]
Length=302

 Score =   238 bits (606),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 139/179 (78%), Gaps = 1/179 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NL+KN DFEEGPY+ P    GVL P    D+HSPLP W VESLKAVKYID++HF
Sbjct  115  PRRTNKNLVKNGDFEEGPYIIPGTRWGVLIPSMVVDEHSPLPGWMVESLKAVKYIDSDHF  174

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F VGDASN CEGS+V+EA+AG  + +
Sbjct  175  AVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNGCEGSLVVEAYAGRESTR  234

Query  341  VPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            V +ES G+GG  K A L FRA A RTRV+FFS++Y TRSDD  SLCGPV+D V +VSVR
Sbjct  235  VAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDDMSSLCGPVIDDVAVVSVR  293



>gb|KJB70570.1| hypothetical protein B456_011G080200 [Gossypium raimondii]
Length=203

 Score =   234 bits (596),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 140/185 (76%), Gaps = 1/185 (1%)
 Frame = -1

Query  707  ILPRXTNVNLLKNWDFEEGPYVFPKVDT-GVLCPPFTEDDHSPLPAWTVESLKAVKYIDA  531
            I     + NLLKN +FEEGPY+FP + + G++ PP  EDDHSPLP W +ESLKA+KYID+
Sbjct  18   IASSAKDANLLKNGNFEEGPYIFPILTSEGLIIPPEIEDDHSPLPGWIIESLKAIKYIDS  77

Query  530  EHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPS  351
            EH SVP G+ A+EL+AGKESAV QI +T  G+ Y L+F+VGDA+N CEG M++EAFAG +
Sbjct  78   EHLSVPQGKWAIELIAGKESAVAQIVKTTIGRNYVLSFVVGDANNGCEGPMMVEAFAGKN  137

Query  350  TLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
             + V Y SKG+GG+K A+L FRA + RTR+MF+ST Y  +SD+  SLCGPV+D V L+SV
Sbjct  138  MVMVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTIYTIKSDNSGSLCGPVLDDVMLLSV  197

Query  170  RNPHR  156
            R  H 
Sbjct  198  RKLHH  202



>gb|EEE56530.1| hypothetical protein OsJ_05823 [Oryza sativa Japonica Group]
Length=379

 Score =   239 bits (609),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 139/179 (78%), Gaps = 1/179 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NL+KN DFEEGPY+ P    GVL P    D+HSPLP W VESLKAVKYID++HF
Sbjct  192  PRRTNKNLVKNGDFEEGPYIIPGTRWGVLIPSMVVDEHSPLPGWMVESLKAVKYIDSDHF  251

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F VGDASN CEGS+V+EA+AG  + +
Sbjct  252  AVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNGCEGSLVVEAYAGRESTR  311

Query  341  VPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            V +ES G+GG  K A L FRA A RTRV+FFS++Y TRSDD  SLCGPV+D V +VSVR
Sbjct  312  VAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDDMSSLCGPVIDDVAVVSVR  370



>ref|XP_002453515.1| hypothetical protein SORBIDRAFT_04g007160 [Sorghum bicolor]
 gb|EES06491.1| hypothetical protein SORBIDRAFT_04g007160 [Sorghum bicolor]
Length=364

 Score =   238 bits (607),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 138/182 (76%), Gaps = 0/182 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NL+KN DFEEGPY+ P    GVL P    DDHSPLP W VESLKA+KYID++ F
Sbjct  182  PRRTNKNLVKNGDFEEGPYIIPGTKWGVLIPSRVVDDHSPLPGWMVESLKAIKYIDSDSF  241

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F VGDASN C GS+++EA+AG  + K
Sbjct  242  AVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNACRGSLMVEAYAGRESTK  301

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
            V YES G+GG K A L FRA + RTR++FFS++Y TRSDD  SLCGPV+D V +VSVR  
Sbjct  302  VAYESAGKGGVKRAVLPFRAASARTRLVFFSSFYSTRSDDLSSLCGPVLDDVAVVSVRTT  361

Query  161  HR  156
             R
Sbjct  362  KR  363



>ref|XP_010088264.1| hypothetical protein L484_005140 [Morus notabilis]
 gb|EXB33248.1| hypothetical protein L484_005140 [Morus notabilis]
Length=378

 Score =   238 bits (608),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 136/183 (74%), Gaps = 0/183 (0%)
 Frame = -1

Query  704  LPRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  525
            LP+ T  NLLKN +FEEGPYVFP    GVL PP  +D HSPLP W ++SLKAVKYID++H
Sbjct  192  LPKRTRANLLKNGNFEEGPYVFPNAPWGVLIPPHIDDAHSPLPGWIIDSLKAVKYIDSDH  251

Query  524  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  345
            F VP G+RA+ELV GKES++ QI RT  GK Y LTF VGDA N C GS+ +EAFAG  T 
Sbjct  252  FHVPEGKRAIELVGGKESSIAQIVRTEPGKEYVLTFAVGDAKNSCVGSLGIEAFAGNGTT  311

Query  344  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  165
            KV Y S G GG+K AKLRF+AT  RTRVMFFST+Y   SD+  +LCGP +D VKL+SVR 
Sbjct  312  KVVYVSTGSGGFKRAKLRFKATQWRTRVMFFSTFYTMTSDNSGTLCGPTLDDVKLISVRT  371

Query  164  PHR  156
            P R
Sbjct  372  PPR  374



>gb|EYU21602.1| hypothetical protein MIMGU_mgv1a008411mg [Erythranthe guttata]
Length=374

 Score =   238 bits (607),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = -1

Query  683  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFSVPHGR  504
            N+LKN +FEEGPY+FP    G L PP  EDDHSPLP W +ESLKAVKY+D++H+ VP G+
Sbjct  198  NMLKNGNFEEGPYIFPNTTYGCLIPPNIEDDHSPLPGWIIESLKAVKYVDSDHYGVPEGK  257

Query  503  RAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYESK  324
            RAVELVAG+ESA+ QI +TV GK YDL FL+GDA N CEG M +EA AG ++L+  YESK
Sbjct  258  RAVELVAGRESALAQIVKTVPGKTYDLYFLLGDAKNSCEGMMTVEAAAGKNSLQFHYESK  317

Query  323  GQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHR  156
            G GG++ +KLRF+A + RTRV F S  YH +SD+  SLCGPV+D V+LV VRNP R
Sbjct  318  GAGGFQRSKLRFKAVSVRTRVRFLSMLYHMKSDNTGSLCGPVIDDVRLVGVRNPGR  373



>gb|KHG21630.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=374

 Score =   238 bits (607),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 140/182 (77%), Gaps = 1/182 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFP-KVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  525
            P+ T  NLLKN +FEEGPY+FP     GV+ PP  EDDHSPLP W +ESLKA+K+ID+EH
Sbjct  191  PKRTRANLLKNGNFEEGPYIFPIPTSEGVIIPPEIEDDHSPLPGWIIESLKAIKHIDSEH  250

Query  524  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  345
            FSVP G+RA+EL+AGKES V QI +T  G+ Y L+F+VGDA+N CEG M++EAFAG + +
Sbjct  251  FSVPQGKRAIELIAGKESTVVQIVKTSIGRNYLLSFVVGDANNGCEGPMMVEAFAGKNMV  310

Query  344  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  165
             V Y SKG+GG+K A+L FRA + RTR+ F+ST Y  +SD+  SLCGPV+D VKL+SVR 
Sbjct  311  MVSYNSKGKGGFKAARLAFRAESTRTRITFYSTIYTIKSDNSGSLCGPVLDDVKLLSVRK  370

Query  164  PH  159
             H
Sbjct  371  LH  372


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 75/188 (40%), Gaps = 33/188 (18%)
 Frame = -1

Query  680  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWT----VESLKAVKYIDAEHFSVP  513
            LL N +FE+GP       T V+           +P W     VE +K+ +  D     VP
Sbjct  26   LLPNGNFEQGPKASELKGTKVMS-------GKSIPNWEICGYVEYIKSGQKQDDMLLIVP  78

Query  512  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST-----  348
             G  AV L  G  + + Q  R +   FY LTF    AS  C     L     P+      
Sbjct  79   QGAFAVRL--GNGALIKQKIRVIKDMFYSLTF---SASRTCAQEERLNVSVSPNNEQNDS  133

Query  347  ----LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  180
                ++  Y S G   Y  A   F+A A+   +       H  S +  ++CGP++D + L
Sbjct  134  GLFPIQTMYSSNGWDSYAWA---FQADAHVIEISI-----HNPSVEEDAVCGPIIDSIAL  185

Query  179  VSVRNPHR  156
             ++  P R
Sbjct  186  KTLYYPKR  193



>gb|EEC72709.1| hypothetical protein OsI_06304 [Oryza sativa Indica Group]
Length=379

 Score =   238 bits (607),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 139/179 (78%), Gaps = 1/179 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NL+KN DFEEGPY+ P    GVL P    D+HSPLP W VESLKAVKYID++HF
Sbjct  192  PRRTNKNLVKNGDFEEGPYIIPGTRWGVLIPSMVVDEHSPLPGWMVESLKAVKYIDSDHF  251

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F VGDASN CEGS+V+EA+AG  + +
Sbjct  252  AVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNGCEGSLVVEAYAGRESTR  311

Query  341  VPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            V +ES G+GG  K A L FRA A RTRV+FFS++Y TRSDD  SLCGPV+D V +VSVR
Sbjct  312  VAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDDMSSLCGPVIDDVAVVSVR  370



>ref|NP_001046247.2| Os02g0205200 [Oryza sativa Japonica Group]
 dbj|BAF08161.2| Os02g0205200, partial [Oryza sativa Japonica Group]
Length=365

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 139/179 (78%), Gaps = 1/179 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NL+KN DFEEGPY+ P    GVL P    D+HSPLP W VESLKAVKYID++HF
Sbjct  178  PRRTNKNLVKNGDFEEGPYIIPGTRWGVLIPSMVVDEHSPLPGWMVESLKAVKYIDSDHF  237

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F VGDASN CEGS+V+EA+AG  + +
Sbjct  238  AVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNGCEGSLVVEAYAGRESTR  297

Query  341  VPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            V +ES G+GG  K A L FRA A RTRV+FFS++Y TRSDD  SLCGPV+D V +VSVR
Sbjct  298  VAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDDMSSLCGPVIDDVAVVSVR  356



>ref|XP_006465391.1| PREDICTED: uncharacterized protein LOC102618171 [Citrus sinensis]
Length=374

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ T VN+LKN +FEEGPYVFP    GVL PP  EDDHSPLP W +ESLKAVKYID +HF
Sbjct  190  PKRTGVNMLKNGNFEEGPYVFPNASWGVLIPPKIEDDHSPLPGWIIESLKAVKYIDLKHF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GRRAVELVAGKESA+TQ+ +T   K Y L+F VGDA N C G++ +EA+AG   +K
Sbjct  250  SVPEGRRAVELVAGKESALTQVVKTEVNKTYALSFAVGDAGNGCAGTLGVEAYAGRDNVK  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            V Y SKG+GG+K A LRF+A + RTR+MF ST+Y+ +SD   SLCGPV+D VKL+  R
Sbjct  310  VTYASKGKGGFKKALLRFKAVSPRTRIMFLSTFYNMQSDSSGSLCGPVIDDVKLLVAR  367



>ref|XP_010539514.1| PREDICTED: uncharacterized protein LOC104813570 [Tarenaya hassleriana]
Length=365

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 132/179 (74%), Gaps = 0/179 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR    N++KN +FEEGPYVFP V  GVL PPF EDD+S LP W VESLKAVKY+D  HF
Sbjct  184  PRFLRNNMIKNGNFEEGPYVFPNVKWGVLIPPFIEDDNSALPGWIVESLKAVKYVDKAHF  243

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G RA+ELV GKES+V QI RT   KFY LTF VGDA N CEG M +EAFAG   + 
Sbjct  244  AVPEGHRAIELVGGKESSVAQIVRTTPNKFYKLTFAVGDAGNSCEGPMAVEAFAGRGRIS  303

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  165
            V Y S G+GG KPA+L F+A + RTRV F ST+YHT+SD   SLCGPV+D V+LV VR+
Sbjct  304  VDYVSSGKGGSKPARLMFKAISARTRVTFLSTFYHTKSDHSGSLCGPVIDDVRLVPVRS  362



>emb|CDO98109.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 134/178 (75%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P  T  NLLKN +FEEGPY+FP    G L PP  EDDHSPLP W +ESLKAVKY+D+EHF
Sbjct  151  PLKTRGNLLKNGNFEEGPYIFPNTTWGALIPPNIEDDHSPLPGWIIESLKAVKYVDSEHF  210

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+RAVEL+AG+ESA+ QI +T+ G +YDL F VGDA N CEGSM++EA AG  TL+
Sbjct  211  SVPEGKRAVELIAGRESAIAQIVKTIPGWWYDLVFSVGDAKNGCEGSMLIEASAGKVTLQ  270

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VPY+S G+G +  A  RFRA + RTRV F S  YH RSD+  +LCGPV+D V+L S+R
Sbjct  271  VPYQSSGKGKFIRATHRFRAVSRRTRVRFLSINYHMRSDNTGTLCGPVIDDVRLYSLR  328



>gb|KFK42429.1| hypothetical protein AALP_AA2G255100 [Arabis alpina]
Length=368

 Score =   236 bits (601),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 134/178 (75%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR    NL+KN +FEEGPYVFP    GVL PPF EDD+SPLP W +ESLKAVKY+D  HF
Sbjct  188  PRFIGNNLIKNGNFEEGPYVFPTAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKAHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G RA+ELVAGKESA++QI RT   +FY LTF VGDA + CEG M++EAFAG S + 
Sbjct  248  AVPEGHRAIELVAGKESAISQIVRTSLNQFYALTFNVGDARDTCEGPMIVEAFAGRSKIM  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            V Y SKG+GG+   KL F+A + RTRV F ST+YH +SD   SLCGPV+D V+LV++R
Sbjct  308  VDYVSKGKGGFTQGKLVFKAVSTRTRVTFLSTFYHMKSDHSGSLCGPVIDDVRLVAIR  365



>ref|XP_004951511.1| PREDICTED: uncharacterized protein LOC101755979 [Setaria italica]
Length=374

 Score =   235 bits (600),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 135/178 (76%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NL+KN DFEEGPY+ P    GVL P    DDHSPLP W VESLKAV+Y+D   F
Sbjct  193  PRRTNRNLVKNGDFEEGPYILPGTKWGVLIPSRVVDDHSPLPGWMVESLKAVRYVDGGSF  252

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP GRRAVEL+AG+E AV Q+ RTV G+ Y L+F VGDA N C GS+V+EA+AG  ++K
Sbjct  253  AVPRGRRAVELLAGREGAVAQVVRTVPGRRYALSFTVGDAGNACRGSLVVEAYAGRESVK  312

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            V YES+G+GG + A L FRA A RTR++FFS++Y TRSDD  SLCGPV+D V +VSVR
Sbjct  313  VAYESEGKGGARRAVLPFRAAAARTRIVFFSSFYSTRSDDLSSLCGPVLDDVAVVSVR  370



>ref|XP_002887838.1| hypothetical protein ARALYDRAFT_340195 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64097.1| hypothetical protein ARALYDRAFT_340195 [Arabidopsis lyrata subsp. 
lyrata]
Length=371

 Score =   235 bits (599),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 134/178 (75%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR +  NL+KN +FEEGPYVFP   +GVL PPF EDD+SPLP W +ESLKAVKY+D  HF
Sbjct  190  PRFSGYNLIKNGNFEEGPYVFPTAKSGVLIPPFIEDDNSPLPGWMIESLKAVKYVDKAHF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G RA+ELV GKESA++QI RT   KFY LTF VGDA + CEG M +EAFAG   + 
Sbjct  250  AVPEGHRAIELVGGKESAISQIVRTSLNKFYALTFSVGDARDGCEGPMTVEAFAGQGKVM  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            V Y SKG+GG++  +L F+A + RTRV F ST+YH +SD   SLCGPV+D V+LV+VR
Sbjct  310  VDYASKGKGGFRRGRLVFKAVSARTRVTFLSTFYHMKSDHSGSLCGPVIDDVRLVAVR  367



>ref|XP_010417734.1| PREDICTED: uncharacterized protein LOC104703420 [Camelina sativa]
Length=369

 Score =   233 bits (593),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 133/177 (75%), Gaps = 0/177 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR ++ NL+KN +FEEGPYVFPK   GVL PPF EDD+SPLP W +ESLKAVKY+D  HF
Sbjct  188  PRFSSNNLIKNGNFEEGPYVFPKAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKAHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G RA+ELVAGKESA++QI RT   KFY LTF VGDA + CEG M +EA AG     
Sbjct  248  AVPEGHRAIELVAGKESAISQIVRTSVNKFYALTFNVGDARDGCEGPMTVEALAGRGKAM  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
            V Y SKG+GG+K  +L F+A + RTRV F ST+YH +SD   SLCGPV+D V+LV+V
Sbjct  308  VDYASKGKGGFKRGRLVFKAASARTRVTFLSTFYHMKSDHSGSLCGPVIDDVRLVAV  364



>ref|XP_006427179.1| hypothetical protein CICLE_v10025880mg [Citrus clementina]
 gb|ESR40419.1| hypothetical protein CICLE_v10025880mg [Citrus clementina]
Length=374

 Score =   233 bits (593),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ T VN+LKN +FEEGPYVFP    GVL PP  EDDHSPLP W +ESLKAVKYID +HF
Sbjct  190  PKRTGVNILKNGNFEEGPYVFPNASWGVLIPPKIEDDHSPLPGWIIESLKAVKYIDLKHF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP GRRA+ELVAGKESA+TQ+ +T   K Y L+F VGDA N C G++ +EA+AG   +K
Sbjct  250  FVPEGRRAIELVAGKESALTQVVKTEVNKTYALSFAVGDAGNGCAGTLGVEAYAGRENVK  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLV  177
            V Y SKG+GG+K A LRF+A + RTR+MF ST+Y+ +SD   SLCGPV+D VKL+
Sbjct  310  VTYASKGKGGFKKALLRFKAVSPRTRIMFLSTFYNMQSDSSGSLCGPVIDDVKLL  364



>ref|XP_010429991.1| PREDICTED: uncharacterized protein LOC104714356 [Camelina sativa]
Length=369

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 132/177 (75%), Gaps = 0/177 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR +  NL+KN +FEEGPYVFPK   GVL PPF EDD+SPLP W +ESLKAVKY+D  HF
Sbjct  188  PRFSGNNLIKNGNFEEGPYVFPKAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKAHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G RA+ELV GKESA++QI RT   KFY LTF VGDA + CEG M++EA AG     
Sbjct  248  AVPEGHRAIELVGGKESAISQIVRTSVNKFYALTFNVGDARDGCEGPMIVEALAGRGKTM  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
            V Y SKG+GG+K  +L F+A + RTRV F ST+YH +SD   SLCGPV+D V+LV+V
Sbjct  308  VDYASKGKGGFKRGRLVFKAASARTRVTFLSTFYHMKSDHSGSLCGPVIDGVRLVAV  364



>ref|NP_178141.1| protein DUF642 L-GALL RESPONSIVE GENE 1 [Arabidopsis thaliana]
 gb|AAD55477.1|AC009322_17 Unknown protein [Arabidopsis thaliana]
 gb|ACD85595.1| At1g80240 [Arabidopsis thaliana]
 gb|AEE36374.1| uncharacterized protein AT1G80240 [Arabidopsis thaliana]
Length=370

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 133/177 (75%), Gaps = 0/177 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR +  NL+KN +FEEGPYVFP    GVL PPF EDD+SPLP W +ESLKAVKY+D  HF
Sbjct  189  PRFSGYNLIKNGNFEEGPYVFPTAKWGVLIPPFIEDDNSPLPGWMIESLKAVKYVDKAHF  248

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G RA+ELV GKESA++QI RT   KFY LTF VGDA + CEG M++EAFAG   + 
Sbjct  249  AVPEGHRAIELVGGKESAISQIVRTSLNKFYALTFNVGDARDGCEGPMIVEAFAGQGKVM  308

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
            V Y SKG+GG++  +L F+A + RTRV F ST+YH +SD   SLCGPV+D V+LV+V
Sbjct  309  VDYASKGKGGFRRGRLVFKAVSARTRVTFLSTFYHMKSDHSGSLCGPVIDDVRLVAV  365



>ref|XP_006301335.1| hypothetical protein CARUB_v10021745mg [Capsella rubella]
 gb|EOA34233.1| hypothetical protein CARUB_v10021745mg [Capsella rubella]
Length=378

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 133/178 (75%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR +  NL+KN +FEEGPYVFPK   GVL PPF EDD+SPLP W +ESLKAVKY+D  HF
Sbjct  197  PRFSGNNLIKNGNFEEGPYVFPKAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKAHF  256

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP G+RA+ELV GKESA++QI RT     Y LTF VGDA + CEG M++EAFAG   + 
Sbjct  257  YVPEGQRAIELVGGKESAISQIVRTSVNNLYSLTFNVGDARDGCEGPMMVEAFAGGRKIM  316

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            V Y SKG+GG+K  +L F+A + RTRV F ST+YH +SD   S+CGPV+D V+LV+VR
Sbjct  317  VDYASKGKGGFKRGRLVFKAASARTRVTFLSTFYHMKSDHSGSMCGPVIDDVRLVAVR  374



>ref|XP_010472958.1| PREDICTED: uncharacterized protein LOC104752499 [Camelina sativa]
Length=369

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 131/177 (74%), Gaps = 0/177 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR +  NL+KN +FEEGPYVFPK   GVL PPF EDD+SPLP W +ESLKAVKY+D  HF
Sbjct  188  PRFSGNNLIKNGNFEEGPYVFPKAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKAHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G RA+ELV GKESA++QI RT   KFY LTF VGDA + CEG M++EA AG     
Sbjct  248  AVPEGHRAIELVGGKESAISQIVRTSVNKFYALTFNVGDARDGCEGPMIVEALAGRGKTM  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
            V Y SKG+GG+K  +L F+A + RTRV F ST+YH +SD   SLCGPV+D V+LV V
Sbjct  308  VDYASKGKGGFKRGRLVFKAASARTRVTFLSTFYHMKSDHSGSLCGPVIDDVRLVVV  364



>gb|KDO83473.1| hypothetical protein CISIN_1g017636mg [Citrus sinensis]
Length=291

 Score =   228 bits (580),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 135/178 (76%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P  T  NL+KN  FEEGP+       GVL PP  ED  SPLP W +ESLKAVK+IDA+HF
Sbjct  113  PMPTRDNLVKNPGFEEGPHRLVNTTNGVLLPPRQEDLTSPLPGWIIESLKAVKFIDAKHF  172

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP+G  AVELVAG+ESA+ QI RTV  K Y+LTF +GDA N C GSM +EAFAG  T+ 
Sbjct  173  NVPYGHAAVELVAGRESAIAQILRTVPNKEYNLTFTIGDAKNGCHGSMRVEAFAGKDTVA  232

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VP+ESKG+GG+K A L+F+A A RTR+ FFSTYYHT+ +DF SLCGPV+D V+++S+R
Sbjct  233  VPFESKGKGGFKSASLKFKAIAARTRITFFSTYYHTKINDFGSLCGPVLDEVRVLSIR  290



>emb|CDY54317.1| BnaC06g43150D [Brassica napus]
Length=370

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 131/178 (74%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR +  NL+KN +FEEGPYVFP    GVL PPF EDD+SPLP W +ESLKAVKY+D  HF
Sbjct  189  PRFSGYNLIKNGNFEEGPYVFPTAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKAHF  248

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP G RA+ELV GKESAV+QI RT   KFY LTF VGDA + CEG M +EAFAG     
Sbjct  249  FVPEGHRAIELVGGKESAVSQIVRTSPNKFYALTFNVGDARDACEGPMAVEAFAGRGNTL  308

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            V Y SKG+GG+K  +L F+A + RTRV F ST+YH ++D   SLCGPVVD V+LV+V+
Sbjct  309  VDYMSKGKGGFKQGRLVFKAVSARTRVTFLSTFYHMKNDHSGSLCGPVVDDVRLVAVK  366



>ref|XP_008362680.1| PREDICTED: uncharacterized protein LOC103426358 [Malus domestica]
Length=361

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 133/172 (77%), Gaps = 1/172 (1%)
 Frame = -1

Query  683  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFSVPHGR  504
            NLLKN ++EEGPYVFP    GVL PP  ED+HSPLP W +ESLKAVKYID++HFSVP G 
Sbjct  188  NLLKNGNYEEGPYVFPNTSWGVLIPPHIEDNHSPLPGWIIESLKAVKYIDSKHFSVPEGW  247

Query  503  RAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYESK  324
            RA+ELV GKESA+ Q+  T+ GK Y LTF VGD++N CEGS+V+EAFAG   LKVPY+SK
Sbjct  248  RAIELV-GKESALAQVVFTLPGKLYALTFTVGDSNNACEGSLVVEAFAGKDILKVPYQSK  306

Query  323  GQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            G+GG+K  +  F A   RTR+MF+ST+Y   +D   SLCGPV+D VKL+SVR
Sbjct  307  GRGGFKRXRFLFTAVGPRTRIMFYSTFYTMAADHSGSLCGPVIDDVKLLSVR  358



>ref|XP_006439076.1| hypothetical protein CICLE_v10031881mg [Citrus clementina]
 ref|XP_006482850.1| PREDICTED: uncharacterized protein LOC102610407 [Citrus sinensis]
 gb|ESR52316.1| hypothetical protein CICLE_v10031881mg [Citrus clementina]
 gb|KDO83472.1| hypothetical protein CISIN_1g017636mg [Citrus sinensis]
Length=368

 Score =   227 bits (579),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 135/178 (76%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P  T  NL+KN  FEEGP+       GVL PP  ED  SPLP W +ESLKAVK+IDA+HF
Sbjct  190  PMPTRDNLVKNPGFEEGPHRLVNTTNGVLLPPRQEDLTSPLPGWIIESLKAVKFIDAKHF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP+G  AVELVAG+ESA+ QI RTV  K Y+LTF +GDA N C GSM +EAFAG  T+ 
Sbjct  250  NVPYGHAAVELVAGRESAIAQILRTVPNKEYNLTFTIGDAKNGCHGSMRVEAFAGKDTVA  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VP+ESKG+GG+K A L+F+A A RTR+ FFSTYYHT+ +DF SLCGPV+D V+++S+R
Sbjct  310  VPFESKGKGGFKSASLKFKAIAARTRITFFSTYYHTKINDFGSLCGPVLDEVRVLSIR  367



>emb|CDO98108.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 136/182 (75%), Gaps = 3/182 (2%)
 Frame = -1

Query  704  LPRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  525
            LP+ +  ++L+N +FEEGPYV P    G+L PP  EDDHSPL  W VESLKAV+YID++H
Sbjct  189  LPKKSR-DILQNGNFEEGPYVLPNTSWGILIPPNVEDDHSPLVGWMVESLKAVRYIDSDH  247

Query  524  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  345
            F+VP G+RAVELVAG+ES+V Q+ +TV GK YDL F VGDA N CEGSM++E  A  ST 
Sbjct  248  FAVPEGKRAVELVAGRESSVAQVVKTVPGKDYDLEFYVGDARNMCEGSMLVEVNASNSTF  307

Query  344  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  165
             VPYESKG+GG K A LRF+A   RTR+ F S+YYH +SD   SLCGPVVD V+L  VR 
Sbjct  308  YVPYESKGKGGSKLALLRFKAETGRTRIRFLSSYYHMKSDFSGSLCGPVVDGVRL--VRV  365

Query  164  PH  159
            PH
Sbjct  366  PH  367



>emb|CDY57694.1| BnaA07g38340D [Brassica napus]
Length=370

 Score =   225 bits (574),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 130/178 (73%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR +  NL+KN +FEEGPYVF     GVL PPF EDD+SPLP W +ESLKAVKY+D  HF
Sbjct  189  PRFSGYNLIKNGNFEEGPYVFSTAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKAHF  248

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP G RA+ELV GKESAV+QI RT   KFY LTF VGDA + CEG M +EAFAG     
Sbjct  249  FVPEGHRAIELVGGKESAVSQIVRTSPNKFYALTFNVGDARDACEGPMAVEAFAGRGKTL  308

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            V Y SKG+GG+K  +L F+A + RTRV F ST+YH ++D   SLCGPVVD V+LV+V+
Sbjct  309  VEYVSKGKGGFKRGRLVFKAVSARTRVTFLSTFYHMKNDHSGSLCGPVVDDVRLVAVK  366



>ref|XP_009104452.1| PREDICTED: uncharacterized protein LOC103830427 [Brassica rapa]
Length=404

 Score =   226 bits (575),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 130/178 (73%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR +  NL+KN +FEEGPYVF     GVL PPF EDD+SPLP W +ESLKAVKY+D  HF
Sbjct  188  PRFSGYNLIKNGNFEEGPYVFSTAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKAHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP G RA+ELV GKESAV+QI RT   KFY LTF VGDA + CEG M +EAFAG     
Sbjct  248  FVPEGHRAIELVGGKESAVSQIVRTSPNKFYALTFNVGDARDGCEGPMAVEAFAGRGKTL  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            V Y SKG+GG+K  +L F+A + RTRV F ST+YH ++D   SLCGPVVD V+LV+V+
Sbjct  308  VEYVSKGKGGFKRGRLVFKAVSARTRVTFLSTFYHMKNDHSGSLCGPVVDDVRLVAVK  365



>ref|NP_001140426.1| hypothetical protein precursor [Zea mays]
 gb|ACF83808.1| unknown [Zea mays]
 gb|ACR34644.1| unknown [Zea mays]
 gb|AFW70605.1| hypothetical protein ZEAMMB73_168025 [Zea mays]
Length=371

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR TN NL+KN DFEEGPY+ P    GVL P    +DHSPLP W VESLKA+KYID E F
Sbjct  190  PRRTNKNLVKNGDFEEGPYIIPGTKWGVLIPSRVVEDHSPLPGWMVESLKAIKYIDGESF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F +GDASN C GS+++EA+AG  + K
Sbjct  250  AVPRGRRAVELLAGRESAIAQVIRTVPGRQYVLSFTIGDASNACRGSLMVEAYAGRESTK  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGP  201
            V YES G+GG K A L FRA + RTR++FFS++Y TRSDD  SLCGP
Sbjct  310  VAYESAGKGGVKRAVLPFRAASARTRLVFFSSFYSTRSDDLSSLCGP  356



>dbj|BAD52536.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD61499.1| unknown protein [Oryza sativa Japonica Group]
Length=299

 Score =   221 bits (562),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 129/186 (69%), Gaps = 4/186 (2%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P     N+LKN  FEEGPY  P    GVL PP  EDDHSPLPAW + S KAVKY+DA HF
Sbjct  114  PTLAKGNMLKNGGFEEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIMSSKAVKYVDAAHF  173

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G RAVELV GKESA+ Q  RTV G  Y L+F VGDA + C GSMV EA+A  +++K
Sbjct  174  AVPQGARAVELVGGKESALVQEVRTVPGWTYRLSFAVGDARDGCAGSMVAEAYAARASIK  233

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR--  168
            VPYESKG GGYK A L F A ANRTRV+F ST+YHT +D   SLCGPV+D   LV +R  
Sbjct  234  VPYESKGTGGYKRAVLEFAAIANRTRVVFQSTFYHTMTDG--SLCGPVIDDASLVGLRKK  291

Query  167  NPHRRL  150
               RRL
Sbjct  292  TAGRRL  297



>ref|XP_010241207.1| PREDICTED: uncharacterized protein LOC104585883 [Nelumbo nucifera]
Length=365

 Score =   223 bits (567),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 130/177 (73%), Gaps = 0/177 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P  T  NL++N  FEEGP++      GVL PP  ED  SPLP W +ESLKAVK+ID+ HF
Sbjct  187  PMPTRDNLVRNGGFEEGPHLLKNSTNGVLLPPKQEDATSPLPGWIIESLKAVKFIDSAHF  246

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP+G  AVELVAGKESA+ Q+ RTV  K Y+LTF VGDA N C GSM +EAFAG  TLK
Sbjct  247  NVPYGSAAVELVAGKESAIAQVIRTVPNKLYNLTFTVGDARNGCHGSMSVEAFAGAETLK  306

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
            VP+ESKG+GG+K    +F+A   RTR+ FFS++YHTR DD+ SLCGP++D V++  V
Sbjct  307  VPFESKGKGGFKAVSFKFKAVGARTRITFFSSFYHTRVDDYGSLCGPILDQVRVFPV  363



>ref|XP_010257157.1| PREDICTED: uncharacterized protein LOC104597377 [Nelumbo nucifera]
Length=366

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 132/178 (74%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P  T  NL+KN  FEEGP++      GVL PP  ED  SPLP W +ESLKAVK+ID+ HF
Sbjct  188  PMATKDNLVKNSGFEEGPHLLQNSTNGVLLPPKQEDSTSPLPGWIIESLKAVKFIDSAHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP+G +AVELVAG+ESA+ QI RTV  + Y ++F VGDA N C GSM++EAFA   TLK
Sbjct  248  NVPYGFKAVELVAGRESAIAQIIRTVPNRLYGVSFTVGDARNGCHGSMMVEAFAAKETLK  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VPYES G+GG+K A  +F+A   RTR+ F+S++YHTR DD+ SLCGP++D V++V VR
Sbjct  308  VPYESHGKGGFKTASFKFKAIEPRTRITFYSSFYHTRVDDYGSLCGPILDQVRVVPVR  365



>gb|ABF99456.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAH00287.1| unnamed protein product [Oryza sativa Japonica Group]
Length=295

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 128/174 (74%), Gaps = 0/174 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P  T  NL+KN  FE GP VF     GVL PP  +D  SPLP W +ESLKAV++IDA HF
Sbjct  117  PYPTKDNLIKNEGFEIGPQVFKNSTVGVLLPPKQKDATSPLPGWIIESLKAVRFIDAAHF  176

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+ AVELVAG+ESA+ Q+ RTVA + Y+L+F+VGDA N C GSM++EAFAG  T K
Sbjct  177  SVPAGQYAVELVAGRESAIAQVIRTVANRAYNLSFVVGDAKNGCHGSMLVEAFAGNVTQK  236

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  180
            VP+ES G GG+KPA  RF A   RTRV F+S+YYHT+  D VSLCGPV+D VK+
Sbjct  237  VPFESVGNGGFKPASFRFVAAGVRTRVTFYSSYYHTKVSDGVSLCGPVLDQVKV  290



>ref|XP_010534242.1| PREDICTED: uncharacterized protein LOC104809851 [Tarenaya hassleriana]
Length=365

 Score =   220 bits (561),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 129/178 (72%), Gaps = 0/178 (0%)
 Frame = -1

Query  704  LPRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  525
             P  T  NL++N  FEEGP+       GVL PP  ED  SPLP W +ESLKAVK+ID++H
Sbjct  187  FPLPTRDNLVRNPGFEEGPHRLVNSTGGVLLPPKQEDSTSPLPGWIIESLKAVKFIDSKH  246

Query  524  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  345
            F+VP+G  A+ELVAGKESA+ Q+ RTV  K Y L+F VGDA N C GSMV+EAFAG  TL
Sbjct  247  FNVPYGEAAIELVAGKESAIAQVIRTVPNKVYSLSFAVGDARNGCHGSMVVEAFAGKDTL  306

Query  344  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
            KVP+ S G G YK A L+F+A   RTR+ FFSTYYHT+ DDF SLCGP++D +++V V
Sbjct  307  KVPHNSVGAGHYKTASLKFKALEARTRITFFSTYYHTKKDDFGSLCGPIIDDIRVVPV  364



>dbj|BAB21293.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB93263.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ12659.1| hypothetical protein OsJ_02574 [Oryza sativa Japonica Group]
 dbj|BAG93001.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87537.1| unnamed protein product [Oryza sativa Japonica Group]
Length=373

 Score =   220 bits (561),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 129/186 (69%), Gaps = 4/186 (2%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P     N+LKN  FEEGPY  P    GVL PP  EDDHSPLPAW + S KAVKY+DA HF
Sbjct  188  PTLAKGNMLKNGGFEEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIMSSKAVKYVDAAHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G RAVELV GKESA+ Q  RTV G  Y L+F VGDA + C GSMV EA+A  +++K
Sbjct  248  AVPQGARAVELVGGKESALVQEVRTVPGWTYRLSFAVGDARDGCAGSMVAEAYAARASIK  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR--  168
            VPYESKG GGYK A L F A ANRTRV+F ST+YHT +D   SLCGPV+D   LV +R  
Sbjct  308  VPYESKGTGGYKRAVLEFAAIANRTRVVFQSTFYHTMTDG--SLCGPVIDDASLVGLRKK  365

Query  167  NPHRRL  150
               RRL
Sbjct  366  TAGRRL  371



>ref|NP_001043549.2| Os01g0611000 [Oryza sativa Japonica Group]
 dbj|BAF05463.2| Os01g0611000, partial [Oryza sativa Japonica Group]
Length=399

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 129/186 (69%), Gaps = 4/186 (2%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P     N+LKN  FEEGPY  P    GVL PP  EDDHSPLPAW + S KAVKY+DA HF
Sbjct  214  PTLAKGNMLKNGGFEEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIMSSKAVKYVDAAHF  273

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G RAVELV GKESA+ Q  RTV G  Y L+F VGDA + C GSMV EA+A  +++K
Sbjct  274  AVPQGARAVELVGGKESALVQEVRTVPGWTYRLSFAVGDARDGCAGSMVAEAYAARASIK  333

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR--  168
            VPYESKG GGYK A L F A ANRTRV+F ST+YHT +D   SLCGPV+D   LV +R  
Sbjct  334  VPYESKGTGGYKRAVLEFAAIANRTRVVFQSTFYHTMTDG--SLCGPVIDDASLVGLRKK  391

Query  167  NPHRRL  150
               RRL
Sbjct  392  TAGRRL  397



>ref|XP_006389772.1| hypothetical protein EUTSA_v10018730mg [Eutrema salsugineum]
 gb|ESQ27058.1| hypothetical protein EUTSA_v10018730mg [Eutrema salsugineum]
Length=372

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 134/178 (75%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR +  NL+KN  FEEGPYVFPK   GVL PPF ED++SPLP W +ESLKAVKY+D  HF
Sbjct  191  PRFSRYNLIKNGKFEEGPYVFPKAKWGVLIPPFIEDENSPLPGWMIESLKAVKYVDKAHF  250

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP G RA+ELV GKESA++QI RT   KFY LTF VGDA + CEG M +EAFAG S + 
Sbjct  251  FVPEGHRAIELVGGKESALSQIVRTSLNKFYALTFNVGDARDACEGPMAVEAFAGRSKVM  310

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            V Y SKG+GG++  +L F+A + RTRV F ST+YHT+SD   SLCGP++D V+LV+VR
Sbjct  311  VEYASKGRGGFRRGRLVFKAVSPRTRVTFISTFYHTKSDHSGSLCGPIIDDVRLVAVR  368



>emb|CDP07813.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 129/178 (72%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ T  NL+KN DFEEGPY       GVL PP  ED  SPLP W +ESLKAVK+IDA HF
Sbjct  199  PKPTRANLVKNGDFEEGPYRLINSSHGVLLPPSQEDRTSPLPGWIIESLKAVKFIDAMHF  258

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP GR A+EL+ G+ES + QI RTV  K Y+LTF VGD  N C GSM++EAFA  STLK
Sbjct  259  NVPSGRAAIELLGGRESVIAQIIRTVPNKEYNLTFSVGDGKNGCHGSMMVEAFAAKSTLK  318

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VP++S G+G YK    +F A + RTR+ FFS++YHT+ DD+ +LCGPV+D VK+V+ R
Sbjct  319  VPFQSVGKGQYKTVSFKFTAISARTRLTFFSSFYHTKIDDYGALCGPVLDNVKVVTAR  376



>gb|EAY92272.1| hypothetical protein OsI_13995 [Oryza sativa Indica Group]
Length=363

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 128/174 (74%), Gaps = 0/174 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P  T  NL+KN  FE GP VF     GVL PP  +D  SPLP W +ESLKAV++IDA HF
Sbjct  185  PYPTKDNLIKNEGFEIGPQVFKNSTVGVLLPPKQKDATSPLPGWIIESLKAVRFIDAAHF  244

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+ AVELVAG+ESA+ Q+ RTVA + Y+L+F+VGDA N C GSM++EAFAG  T K
Sbjct  245  SVPAGQYAVELVAGRESAIAQVIRTVANRAYNLSFVVGDAKNGCHGSMLVEAFAGNVTQK  304

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  180
            VP+ES G GG+KPA  RF A   RTRV F+S+YYHT+  D VSLCGPV+D VK+
Sbjct  305  VPFESVGNGGFKPASFRFVAAGVRTRVTFYSSYYHTKVSDGVSLCGPVLDQVKV  358



>ref|XP_003564086.1| PREDICTED: uncharacterized protein LOC100845370 [Brachypodium 
distachyon]
Length=393

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 128/174 (74%), Gaps = 0/174 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P  T  NL+KN  FE GP VF     GVL PP  +D  SPLP W +ESLKAV+YIDA HF
Sbjct  215  PYPTKENLIKNEGFEIGPQVFKNSTVGVLLPPKQKDATSPLPGWIIESLKAVRYIDAAHF  274

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G  AVELVAG+ESA+ Q+ RTV  + Y+++F VGDA N C GSM++EAFAG  TLK
Sbjct  275  SVPSGNYAVELVAGRESAIAQVIRTVPNRAYNVSFAVGDAKNGCHGSMLVEAFAGNVTLK  334

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  180
            VP+ES G+GG+K A LRF A   RTRV F+S+YYHT++ D VSLCGPV+D VK+
Sbjct  335  VPFESAGKGGFKTASLRFVAGGVRTRVTFYSSYYHTKATDGVSLCGPVLDQVKI  388



>ref|XP_006826721.1| hypothetical protein AMTR_s00264p00012960 [Amborella trichopoda]
 gb|ERM93958.1| hypothetical protein AMTR_s00264p00012960 [Amborella trichopoda]
Length=372

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 130/175 (74%), Gaps = 0/175 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+    NLLKN DFEEGPY  P    GVL PP   D +SPLP WT+ SLK+V+YID+ HF
Sbjct  190  PKANRGNLLKNGDFEEGPYFLPNNLDGVLIPPNQIDRNSPLPGWTILSLKSVRYIDSPHF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP GR+AVEL+AGKES ++Q A TV   +Y LTFLVGDA+N C+GSM +EA+AG  +LK
Sbjct  250  SVPEGRKAVELLAGKESIISQTATTVPKAYYVLTFLVGDANNTCKGSMAVEAYAGRGSLK  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLV  177
            V YESKG GG+K AKL F A    TR +F+ST+Y TR+DD  SLCGPV+D V+LV
Sbjct  310  VDYESKGLGGFKRAKLVFVALEKVTRFVFYSTFYMTRTDDLSSLCGPVIDDVRLV  364



>ref|XP_004149718.1| PREDICTED: uncharacterized protein LOC101216438 [Cucumis sativus]
 ref|XP_004164153.1| PREDICTED: uncharacterized LOC101216438 [Cucumis sativus]
 gb|KGN58580.1| hypothetical protein Csa_3G689790 [Cucumis sativus]
Length=368

 Score =   218 bits (554),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 132/176 (75%), Gaps = 0/176 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P  T  NL++N  FE GP+       GVL PP  ED  SPLP W +ESLKAVK+ID++HF
Sbjct  191  PLPTRDNLVRNPSFEVGPHRLVNSTNGVLLPPRQEDVTSPLPGWIIESLKAVKFIDSKHF  250

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G  A+ELVAG+ESAV QI RT+  K Y LTF VGDA N C GSM++EAFA   T+K
Sbjct  251  NVPVGLAAIELVAGRESAVAQIIRTIPNKVYSLTFKVGDAKNGCHGSMMVEAFAAKETVK  310

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVS  174
            VP++S+G+G YK A L+F+AT+ RTR+ FFS+YYHTR+DDF SLCGPV+D V+++S
Sbjct  311  VPFQSQGKGLYKNAILKFKATSRRTRITFFSSYYHTRTDDFGSLCGPVLDDVRVIS  366



>gb|KJB24990.1| hypothetical protein B456_004G171200 [Gossypium raimondii]
Length=385

 Score =   218 bits (555),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 130/176 (74%), Gaps = 0/176 (0%)
 Frame = -1

Query  707  ILPRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  528
            + PR T  NL+KN  FEEGP+       GVL PP  ED  SPLP W +ESLKAVK+IDA+
Sbjct  206  VRPRATRYNLVKNNGFEEGPHRLVNSTNGVLLPPRQEDFTSPLPGWIIESLKAVKFIDAK  265

Query  527  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  348
            HF+VP G  AVELVAG+ESA+ QI RT+  K Y++TF++GDA N C G M++EAFA   T
Sbjct  266  HFNVPAGHSAVELVAGRESAIAQILRTIPNKSYNMTFIIGDARNGCNGEMMVEAFAAKHT  325

Query  347  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  180
            +KVP+ S+G+G +K A L F+A   RTRV F+S+YYHTRSDDF SLCGPV+D V++
Sbjct  326  VKVPFTSRGKGEFKAASLMFKADTARTRVTFYSSYYHTRSDDFGSLCGPVLDEVRV  381



>ref|XP_008245331.1| PREDICTED: uncharacterized protein LOC103343457 [Prunus mume]
Length=373

 Score =   218 bits (554),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 132/182 (73%), Gaps = 1/182 (1%)
 Frame = -1

Query  707  ILP-RXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDA  531
            ILP +     L+KN  FE GP+VF    TG+L PP  +D  SPLP W +ESLK VKYID 
Sbjct  191  ILPLKYIRGTLVKNGGFESGPHVFKNFSTGILLPPKAKDQISPLPGWIIESLKPVKYIDK  250

Query  530  EHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPS  351
            +HFSVP G  A+ELVAG+ESA+ QI RT+  KFY+LTF +GDA N C GSM++EAFAG  
Sbjct  251  KHFSVPGGLAAIELVAGRESAIAQIIRTIPNKFYNLTFTIGDAKNACHGSMMVEAFAGKE  310

Query  350  TLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
            TLKVPY S+G+GG+K A  +F+AT+ RTR+ F+S YYHT+  DF  +CGPV+D V ++ V
Sbjct  311  TLKVPYTSQGKGGFKTASFKFQATSPRTRITFYSAYYHTKLHDFGHMCGPVLDNVIVLPV  370

Query  170  RN  165
             +
Sbjct  371  SS  372



>dbj|BAK03627.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=371

 Score =   217 bits (553),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 130/186 (70%), Gaps = 4/186 (2%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P  +  N+LKN  FEEGPY  P    GVL PP  EDDHSPLPAW + S KAVKY+DA HF
Sbjct  186  PTLSKGNMLKNGGFEEGPYFLPNASWGVLIPPNIEDDHSPLPAWMIMSSKAVKYVDAAHF  245

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G RAVELV GKESA+ Q  RTV G  Y L+F VGD+ + C+GSMV EA+A  STLK
Sbjct  246  SVPEGARAVELVGGKESALVQEVRTVPGWAYRLSFAVGDSGHDCKGSMVAEAYAARSTLK  305

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN-  165
            VPYESKG GGYK A L F A  +RTRV+F S +YH ++D   +LCGPV+D  KLV +R  
Sbjct  306  VPYESKGAGGYKRAVLDFVAVRDRTRVVFQSAFYHMKADG--TLCGPVIDDAKLVGLRKK  363

Query  164  -PHRRL  150
               RRL
Sbjct  364  PAARRL  369



>ref|NP_001051644.1| Os03g0807700 [Oryza sativa Japonica Group]
 gb|AAP21410.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF99455.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13558.1| Os03g0807700 [Oryza sativa Japonica Group]
 gb|EAZ28993.1| hypothetical protein OsJ_13041 [Oryza sativa Japonica Group]
 dbj|BAG86944.1| unnamed protein product [Oryza sativa Japonica Group]
Length=393

 Score =   218 bits (555),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 128/174 (74%), Gaps = 0/174 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P  T  NL+KN  FE GP VF     GVL PP  +D  SPLP W +ESLKAV++IDA HF
Sbjct  215  PYPTKDNLIKNEGFEIGPQVFKNSTVGVLLPPKQKDATSPLPGWIIESLKAVRFIDAAHF  274

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+ AVELVAG+ESA+ Q+ RTVA + Y+L+F+VGDA N C GSM++EAFAG  T K
Sbjct  275  SVPAGQYAVELVAGRESAIAQVIRTVANRAYNLSFVVGDAKNGCHGSMLVEAFAGNVTQK  334

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  180
            VP+ES G GG+KPA  RF A   RTRV F+S+YYHT+  D VSLCGPV+D VK+
Sbjct  335  VPFESVGNGGFKPASFRFVAAGVRTRVTFYSSYYHTKVSDGVSLCGPVLDQVKV  388



>gb|KHG12815.1| DNA-directed RNA polymerase subunit beta'' [Gossypium arboreum]
Length=385

 Score =   218 bits (554),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 130/176 (74%), Gaps = 0/176 (0%)
 Frame = -1

Query  707  ILPRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  528
            + PR T  NL+KN  FEEGP+       GVL PP  ED  SPLP W +ESLKAVK+IDA+
Sbjct  206  VRPRATRYNLVKNSGFEEGPHRLVNSTNGVLLPPRQEDFTSPLPGWIIESLKAVKFIDAK  265

Query  527  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  348
            HF+VP G  AVELVAG+ESA+ QI RT+  K Y++TF++GDA N C G M++EAFA   T
Sbjct  266  HFNVPAGHSAVELVAGRESAIAQILRTIPNKSYNMTFVIGDARNGCNGEMMVEAFAAKHT  325

Query  347  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  180
            +KVP+ S+G+G +K A L F+A   RTR+ F+S+YYHTRSDDF SLCGPV+D V++
Sbjct  326  VKVPFTSRGKGEFKAASLMFKADTARTRITFYSSYYHTRSDDFGSLCGPVLDEVRV  381



>gb|KJB24991.1| hypothetical protein B456_004G171200 [Gossypium raimondii]
Length=414

 Score =   218 bits (555),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 130/176 (74%), Gaps = 0/176 (0%)
 Frame = -1

Query  707  ILPRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  528
            + PR T  NL+KN  FEEGP+       GVL PP  ED  SPLP W +ESLKAVK+IDA+
Sbjct  235  VRPRATRYNLVKNNGFEEGPHRLVNSTNGVLLPPRQEDFTSPLPGWIIESLKAVKFIDAK  294

Query  527  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  348
            HF+VP G  AVELVAG+ESA+ QI RT+  K Y++TF++GDA N C G M++EAFA   T
Sbjct  295  HFNVPAGHSAVELVAGRESAIAQILRTIPNKSYNMTFIIGDARNGCNGEMMVEAFAAKHT  354

Query  347  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  180
            +KVP+ S+G+G +K A L F+A   RTRV F+S+YYHTRSDDF SLCGPV+D V++
Sbjct  355  VKVPFTSRGKGEFKAASLMFKADTARTRVTFYSSYYHTRSDDFGSLCGPVLDEVRV  410



>ref|XP_004969140.1| PREDICTED: uncharacterized protein LOC101755969 [Setaria italica]
Length=372

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 125/178 (70%), Gaps = 2/178 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P     N+LKN  FEEGPY  P    GVL PP  EDDHSPLPAW + S KAVKY+DA HF
Sbjct  186  PTLVRGNMLKNGGFEEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIVSSKAVKYVDAAHF  245

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP G RAVELV G+ESA+ Q  RTV G  Y L+F VGDA + C GSMV EAFA  +T+K
Sbjct  246  KVPQGARAVELVGGRESALVQEVRTVPGWSYRLSFAVGDAGDGCTGSMVAEAFAARATVK  305

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VPYESKG GGYK A L F A ANRTRV+F ST+YH ++D   +LCGP+VD   LV +R
Sbjct  306  VPYESKGTGGYKRAVLDFTAIANRTRVVFQSTFYHMKADG--TLCGPLVDDASLVGLR  361



>ref|XP_002517797.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44604.1| conserved hypothetical protein [Ricinus communis]
Length=365

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 127/174 (73%), Gaps = 0/174 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR T  NL+KN  FEEGP+       GVL PP  ED  SPLP W +ESLKAVK+ID++HF
Sbjct  188  PRPTRDNLVKNPGFEEGPHRLVNTSNGVLLPPRQEDLTSPLPGWIIESLKAVKFIDSKHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G  AVELVAG+ESA+ QI RT+  K YDLTF VGDA N C GSM++EAFA   T K
Sbjct  248  NVPFGLAAVELVAGRESAIAQILRTIPNKVYDLTFSVGDAKNGCHGSMMVEAFAAKDTFK  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  180
            VP+ES+G+G +K     F+A + RTR+ F+S+YYHTR DDF SLCGPV+D V++
Sbjct  308  VPFESQGKGKFKTVSFNFKAVSARTRITFYSSYYHTRIDDFGSLCGPVLDQVRV  361



>ref|XP_010067858.1| PREDICTED: uncharacterized protein LOC104454644 [Eucalyptus grandis]
 gb|KCW66091.1| hypothetical protein EUGRSUZ_G03366 [Eucalyptus grandis]
Length=369

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 131/175 (75%), Gaps = 0/175 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR T  NL+KN  FEEGP+       GVL PP  ED  SPLP W +ESLKAVK+ID +HF
Sbjct  190  PRPTRDNLVKNAGFEEGPHRLINSSNGVLLPPRQEDLTSPLPGWIIESLKAVKFIDKKHF  249

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G  AVELVAG+ESA+ Q+ RT+  K Y+LTF VGDA N C GSM++EAFA   TLK
Sbjct  250  NVPFGLAAVELVAGRESAIAQMIRTLPSKCYNLTFAVGDARNGCHGSMMVEAFAAKDTLK  309

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLV  177
            VP++S+G+G +K A L+F+A + RTR+ FFS++YHTR DDF SLCGPV+D V++V
Sbjct  310  VPFQSQGKGRFKTASLKFKALSARTRLTFFSSFYHTRIDDFGSLCGPVLDEVRVV  364



>ref|XP_007052493.1| F17A17.37 protein [Theobroma cacao]
 gb|EOX96650.1| F17A17.37 protein [Theobroma cacao]
Length=385

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 132/179 (74%), Gaps = 0/179 (0%)
 Frame = -1

Query  707  ILPRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  528
            + P  T  NL+KN  FEEGP+       GVL PP  ED  SPLP W +ESLKAVK+ID++
Sbjct  206  VRPMPTRDNLVKNPGFEEGPHRLVNSTNGVLLPPRQEDSTSPLPGWIIESLKAVKFIDSK  265

Query  527  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  348
            HF+VP G+ AVELVAG+ESA+ QI RTV  + YDLTF++GDA N C G M++EAFA  +T
Sbjct  266  HFNVPAGKAAVELVAGRESAIAQILRTVPNQLYDLTFIIGDARNGCHGEMMVEAFADKNT  325

Query  347  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
            +KVP+ S+G+G +K A L+F+A   RTR+ FFS+YYHTR +DF SLCGPV+D V++  V
Sbjct  326  VKVPFTSRGKGEFKTASLKFKAVTARTRITFFSSYYHTRINDFGSLCGPVLDEVRVSPV  384



>gb|KDP43556.1| hypothetical protein JCGZ_16843 [Jatropha curcas]
Length=365

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 129/177 (73%), Gaps = 0/177 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            PR T  NL+KN  FEEGP++F     GVL PP   D  SPLP W +ESLKAVK+ID++HF
Sbjct  188  PRPTRYNLVKNPGFEEGPHLFVNSSNGVLLPPRQLDLTSPLPGWIIESLKAVKFIDSKHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G  AVELVAG+ESA+ QI RT+  K Y LTF VGDA N C GSM++EAFA   T K
Sbjct  248  NVPFGLAAVELVAGRESAIAQILRTIPNKVYGLTFSVGDAKNGCHGSMMVEAFAAKDTFK  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
            VP+ES+G+G +K    +F+A + RTR+ F+S+YYHTR DDF SLCGPV+D V++  +
Sbjct  308  VPFESQGKGKFKTVSFKFKAVSARTRITFYSSYYHTRIDDFGSLCGPVLDQVRVFPI  364



>ref|XP_006845336.1| hypothetical protein AMTR_s00141p00085330 [Amborella trichopoda]
 gb|ERN07011.1| hypothetical protein AMTR_s00141p00085330 [Amborella trichopoda]
Length=369

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 130/174 (75%), Gaps = 0/174 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P  T  NL+KN  FEEGP+V     +G+L PP   D +SPLP W +ES+KAV+Y+D+ HF
Sbjct  193  PFPTKDNLVKNGGFEEGPHVLKNSTSGILLPPKQNDINSPLPGWIIESIKAVRYLDSHHF  252

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G  AVELVAG+ESA+ Q+ RTV  K Y L+F+VGDA N C GSM++EAFAG  T+K
Sbjct  253  TVPLGAAAVELVAGRESAIAQLIRTVPKKVYTLSFIVGDAKNGCHGSMLVEAFAGKDTVK  312

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  180
            VP+ES+GQGGYK  K+RF A   RTR+ FFS++YHT+ DD  ++CGP+VD VK+
Sbjct  313  VPFESRGQGGYKVGKMRFMALEPRTRITFFSSFYHTKVDDPGTMCGPIVDEVKV  366



>ref|XP_007201993.1| hypothetical protein PRUPE_ppa024647mg [Prunus persica]
 gb|EMJ03192.1| hypothetical protein PRUPE_ppa024647mg [Prunus persica]
Length=384

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 131/182 (72%), Gaps = 1/182 (1%)
 Frame = -1

Query  707  ILP-RXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDA  531
            ILP +     L+KN  FE GP+VF    TG+L PP  +D  SPLP W +ESLK VKYID 
Sbjct  202  ILPLKYIRGTLVKNGGFESGPHVFKNFSTGILLPPKAKDQISPLPGWIIESLKPVKYIDK  261

Query  530  EHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPS  351
            +HF VP G  A+ELVAG+ESA+ QI RT+  KFY+LTF +GDA N C GSM++EAFAG  
Sbjct  262  KHFQVPGGLAAIELVAGRESAIAQIIRTIPNKFYNLTFTIGDAKNACHGSMMVEAFAGKE  321

Query  350  TLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
            TLKVPY S+G+GG+K A  +F+AT+ RTR+ F+S YYHT+  DF  +CGPV+D V ++ V
Sbjct  322  TLKVPYMSQGKGGFKTASFKFQATSPRTRITFYSAYYHTKLHDFGHMCGPVLDNVIVLPV  381

Query  170  RN  165
             +
Sbjct  382  SS  383



>ref|XP_008461812.1| PREDICTED: uncharacterized protein LOC103500323 [Cucumis melo]
Length=368

 Score =   214 bits (546),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 129/176 (73%), Gaps = 0/176 (0%)
 Frame = -1

Query  707  ILPRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  528
            + P  T VNL++N  FE GP+       GVL PP  ED  SPLP W +ESLKAVK+ID++
Sbjct  189  VRPLPTTVNLVRNPSFEVGPHRLGNSTNGVLLPPRQEDVTSPLPGWIIESLKAVKFIDSK  248

Query  527  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  348
            HF+VP G  A+ELVAG+ESAV QI RT+  K Y L F VGDA N C GSM++EAFA   T
Sbjct  249  HFNVPDGEAAIELVAGRESAVAQIIRTIPNKVYSLKFKVGDAKNGCHGSMMVEAFAAKET  308

Query  347  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  180
            +KVP++S+G+G YK A L+F AT+ RTR+ FFS+YYHTR+DDF SLCGPV+D V +
Sbjct  309  VKVPFQSEGKGLYKDAILKFTATSPRTRITFFSSYYHTRTDDFGSLCGPVLDDVSV  364



>gb|EMT06486.1| hypothetical protein F775_26416 [Aegilops tauschii]
Length=370

 Score =   214 bits (546),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 129/186 (69%), Gaps = 4/186 (2%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P  +  N+LKN  FEEGPY  P    GVL PP  EDDHSPLPAW + S KAVKY+DA HF
Sbjct  185  PTLSKGNMLKNGGFEEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIMSSKAVKYVDAAHF  244

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP G RAVELV GKESA+ Q  RTV G  Y L+F VGD+++ C+GSMV EA+A  STLK
Sbjct  245  KVPEGARAVELVGGKESALVQEVRTVPGWAYRLSFAVGDSADGCKGSMVAEAYAARSTLK  304

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN-  165
            VPYES G GGYK A L F A  +RTRV+F S +YH ++D   +LCGPV+D  KLV +R  
Sbjct  305  VPYESNGAGGYKRAVLDFVAVRDRTRVVFQSAFYHMKADG--TLCGPVIDDAKLVGLRKK  362

Query  164  -PHRRL  150
               RRL
Sbjct  363  PSARRL  368



>gb|EMT25156.1| hypothetical protein F775_26385 [Aegilops tauschii]
Length=397

 Score =   215 bits (548),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 130/178 (73%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P  T  NL+KN  FE GP VF     GVL PP  +D  SPLP W +ESLKAV+YIDA HF
Sbjct  219  PYPTKDNLIKNDGFEIGPQVFKNSSVGVLLPPKQKDVTSPLPGWIIESLKAVRYIDAAHF  278

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+ AVELVAG+ESA+ Q+ RTV  + Y+L+++VGDA N C GSM++EAFA   T K
Sbjct  279  SVPAGQYAVELVAGRESAIAQVIRTVPNRAYNLSYVVGDAKNGCHGSMLVEAFAANVTQK  338

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VP+ES G+GG+K A LRF A   RTRV F+S+YYHT+  D VSLCGPV+D VK+V ++
Sbjct  339  VPFESTGKGGFKAASLRFVAAGVRTRVTFYSSYYHTKVTDGVSLCGPVLDQVKIVPMK  396



>dbj|BAJ89665.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=393

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 130/178 (73%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P  T  NL+KN  FE GP VF     GVL PP  +D  SPLP W +ESLKAV+YIDA HF
Sbjct  215  PYPTKDNLIKNDGFEIGPQVFKNSSVGVLLPPKQKDVTSPLPGWIIESLKAVRYIDAAHF  274

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+ AVELVAG+ESA+ Q+ RTV  + Y+L+++VGDA N C GSM++EAFA   T K
Sbjct  275  SVPAGQYAVELVAGRESAIAQVIRTVPNRAYNLSYVVGDAKNGCHGSMLVEAFAANVTQK  334

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VP+ES G+GG+K + LRF A   RTRV F+S+YYHT+  D VSLCGPV+D VK+V ++
Sbjct  335  VPFESTGKGGFKASSLRFVAAGARTRVTFYSSYYHTKVTDGVSLCGPVLDQVKIVPLK  392



>ref|XP_011048055.1| PREDICTED: uncharacterized protein LOC105142230 [Populus euphratica]
Length=365

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 127/173 (73%), Gaps = 0/173 (0%)
 Frame = -1

Query  698  RXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFS  519
            R T  NL+KN  FE GP++F    TGVL PP  +D  SPLP W +ESLK VKYID++HF 
Sbjct  189  RRTIGNLVKNGGFEVGPHMFKNFSTGVLLPPKQQDQISPLPGWIIESLKPVKYIDSKHFF  248

Query  518  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKV  339
            VP G  A+ELVAG+ESAV QI RT+  KFY+LTF VGDA N C GSM++EAFA   T+KV
Sbjct  249  VPEGFAAIELVAGRESAVAQIIRTIPDKFYNLTFTVGDAKNACHGSMMVEAFAAKETVKV  308

Query  338  PYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  180
            PY S+G+GGYK A LRF+A + RTR+ F+S YYHT+  D+  +CGPV+D V +
Sbjct  309  PYVSQGKGGYKTAILRFQAISARTRITFYSAYYHTKLHDYGHMCGPVLDDVSV  361



>ref|XP_011016219.1| PREDICTED: uncharacterized protein LOC105119742 [Populus euphratica]
Length=369

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 128/168 (76%), Gaps = 0/168 (0%)
 Frame = -1

Query  683  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFSVPHGR  504
            NL+KN  FE GP+VF    TG+L PP  +D  SPLP W +ESLK VKYID++HF VP G 
Sbjct  198  NLVKNGVFEVGPHVFKNFSTGILLPPKQQDLISPLPGWIIESLKPVKYIDSKHFFVPTGF  257

Query  503  RAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYESK  324
             A+E+VAG+ESA+ QI RT+  KFY+L+F +GDA N C GSM++EAFAG  TLKVPY S+
Sbjct  258  AAIEMVAGRESAIAQIIRTIPNKFYNLSFTIGDAKNACHGSMMVEAFAGRETLKVPYVSR  317

Query  323  GQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  180
            G+GGYK A LRF+A ++RTR+ F+S YYHT+  D+  +CGPV+D V++
Sbjct  318  GKGGYKTATLRFKAISSRTRITFYSGYYHTKLHDYGHMCGPVLDDVRV  365



>ref|XP_002308027.2| hypothetical protein POPTR_0006s04880g [Populus trichocarpa]
 gb|EEE91550.2| hypothetical protein POPTR_0006s04880g [Populus trichocarpa]
Length=369

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 130/177 (73%), Gaps = 1/177 (1%)
 Frame = -1

Query  707  ILP-RXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDA  531
            +LP + +  NL+KN  FE GP+VF    TG+L PP  +D  SPLP W +ESLK VKYID 
Sbjct  189  MLPLKYSKGNLVKNGGFEVGPHVFKNFSTGILLPPKKQDQISPLPGWIIESLKPVKYIDN  248

Query  530  EHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPS  351
            +HF VP G  A+E+VAG+ESA+ Q+ RT+  KFY+LTF +GDA N C GSM++EAFA   
Sbjct  249  KHFFVPTGFAAIEMVAGRESAIAQVIRTIPDKFYNLTFTIGDAKNACHGSMMVEAFAARE  308

Query  350  TLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  180
            TLKVPY S+G+GGYK A LRFRA + RTR+ F+S YYHT+  D+  +CGPV+D V++
Sbjct  309  TLKVPYVSQGKGGYKTATLRFRAISARTRITFYSAYYHTKLHDYGHMCGPVLDDVRV  365



>ref|XP_007218161.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
 gb|EMJ19360.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
Length=291

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -1

Query  692  TNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFSVP  513
            T  NL++N  FEE P+       GVL PP   D  SPLP W +ESLKAVK+ID++HF+VP
Sbjct  117  TRDNLVRNPGFEEAPHRLFNSSHGVLLPPKQLDVTSPLPGWIIESLKAVKFIDSQHFNVP  176

Query  512  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  333
             G+ AVELVAG+ESA+ Q+ RTV  K YDL+F+VGDA N C GSM++EAFAG  TLKVP+
Sbjct  177  FGKGAVELVAGRESAIAQVLRTVPNKIYDLSFVVGDARNGCHGSMMVEAFAGKDTLKVPF  236

Query  332  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
             S+G+GG+K A L+F+A + RTR+ F+S++YHTR DD+ +LCGP++D V++  V
Sbjct  237  TSQGKGGFKAASLKFKAASPRTRITFYSSFYHTRVDDYGALCGPILDQVRVYPV  290



>ref|XP_004981346.1| PREDICTED: uncharacterized protein LOC101768647 [Setaria italica]
Length=389

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 128/175 (73%), Gaps = 0/175 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P  T  NL+KN  FE GP VF     GVL PP  +D  SPLP W +ESLKAV++IDA HF
Sbjct  209  PYPTKDNLIKNAGFEIGPQVFKNSSVGVLLPPKQKDTTSPLPGWIIESLKAVRFIDAAHF  268

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            SVP G+ AVELVAG+ESA+ Q+ RTV  + Y+L+F VGDA N C GSM++EAFAG  T K
Sbjct  269  SVPEGQYAVELVAGRESAIAQVIRTVPNRAYNLSFAVGDAKNGCHGSMLVEAFAGNVTQK  328

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLV  177
            VP+ES G+G +K A  RF A+  RTR+ F+S+YYHT++ D VSLCGPV+D VK+V
Sbjct  329  VPFESAGKGAFKAAGFRFVASGVRTRLTFYSSYYHTKASDGVSLCGPVLDQVKVV  383



>ref|XP_003569339.1| PREDICTED: uncharacterized protein LOC100821501 [Brachypodium 
distachyon]
Length=370

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 129/186 (69%), Gaps = 4/186 (2%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P  +  N+LKN  FEEGPY  P    GVL PP  EDDHSPLPAW + S KAVKY+D+ HF
Sbjct  185  PTLSKGNMLKNGGFEEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIMSSKAVKYVDSAHF  244

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
             VP G RAVELV GKESA+ Q  RTV G  Y LTF VGDA++ C GSMV EA+A  + +K
Sbjct  245  RVPEGTRAVELVGGKESALVQEVRTVPGWTYRLTFAVGDAADGCTGSMVAEAYAARAIVK  304

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN-  165
            VPY+SKG GG+K A L F A  NRTR++F ST+YH ++D   +LCGPV+D  KLV ++  
Sbjct  305  VPYDSKGAGGFKRAVLDFAAVGNRTRIVFQSTFYHMKADG--TLCGPVIDDAKLVGLKKK  362

Query  164  -PHRRL  150
               RRL
Sbjct  363  PAARRL  368



>ref|XP_002455939.1| hypothetical protein SORBIDRAFT_03g027650 [Sorghum bicolor]
 gb|EES01059.1| hypothetical protein SORBIDRAFT_03g027650 [Sorghum bicolor]
Length=375

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P     N+LKN  FEEGPY  P    GVL PP  EDDHSPLP W + S KAVKY+DA HF
Sbjct  186  PTLARGNMLKNGGFEEGPYFLPNASWGVLVPPNIEDDHSPLPGWMIASSKAVKYVDAAHF  245

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G RAVELV G+ESA+ Q  RTV G  Y L F VGD+ + C GSMV EA+A  +T+K
Sbjct  246  AVPQGARAVELVGGRESALVQEVRTVPGWSYRLAFAVGDSGDGCTGSMVAEAYAARATVK  305

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            VPYESKG GGYK A L F A ANRTRV+F ST+YH ++D   +LCGP+VD   +V +R
Sbjct  306  VPYESKGTGGYKRAVLDFTAVANRTRVVFQSTFYHMKADG--TLCGPLVDDASVVGLR  361



>gb|KJB36028.1| hypothetical protein B456_006G137000 [Gossypium raimondii]
 gb|KJB36029.1| hypothetical protein B456_006G137000 [Gossypium raimondii]
 gb|KJB36030.1| hypothetical protein B456_006G137000 [Gossypium raimondii]
Length=371

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 127/174 (73%), Gaps = 0/174 (0%)
 Frame = -1

Query  692  TNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFSVP  513
            T  NL+KN  FE GP+ F    TGVL PP  +D  SPLP W +ESLK VK+ID +HFSVP
Sbjct  197  TKGNLVKNSGFETGPHTFKNFSTGVLLPPHKQDTISPLPGWIIESLKPVKFIDKKHFSVP  256

Query  512  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  333
             G+ A+E+VAG+ESA+ Q+ RTV  K Y LTF VGDA N C GSM++EAFAG  TLKVPY
Sbjct  257  SGQFAIEMVAGRESAIAQVIRTVPNKDYTLTFTVGDAKNDCHGSMMVEAFAGKGTLKVPY  316

Query  332  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
             S+G+GG+K +  RF+A + RTR+ F+S YYHT+  DF  +CGPV+D VK++ V
Sbjct  317  VSQGKGGFKTSSFRFQAISARTRITFYSAYYHTKLHDFGHMCGPVLDDVKVLPV  370



>ref|XP_010057181.1| PREDICTED: uncharacterized protein LOC104445070 [Eucalyptus grandis]
 gb|KCW90190.1| hypothetical protein EUGRSUZ_A02362 [Eucalyptus grandis]
Length=370

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 131/181 (72%), Gaps = 1/181 (1%)
 Frame = -1

Query  707  ILP-RXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDA  531
            +LP + T  NL+KN  FE GP+VF    TGVL P   +D  SPLP W +ES+K VKY+D 
Sbjct  190  MLPLKYTPGNLIKNGGFEIGPHVFKNFSTGVLLPAKQKDLISPLPGWIIESMKPVKYVDR  249

Query  530  EHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPS  351
            +HF VP G  AVELVAG+ESA+ QI RTV  KFY+LTF VGDA N C GSM++EAFA   
Sbjct  250  KHFFVPSGLAAVELVAGRESAMAQIIRTVPNKFYNLTFTVGDAKNGCHGSMMVEAFAAKD  309

Query  350  TLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
            TLKVPYES  +GG K A L+F+AT+ RTR+ FFS YYHT+  D+  +CGPV+D VK+V V
Sbjct  310  TLKVPYESTSKGGSKTANLKFQATSTRTRITFFSAYYHTKLHDYGHMCGPVLDDVKVVPV  369

Query  170  R  168
            +
Sbjct  370  K  370



>ref|XP_002299934.2| hypothetical protein POPTR_0001s27110g [Populus trichocarpa]
 gb|ABK94155.1| unknown [Populus trichocarpa]
 gb|EEE84739.2| hypothetical protein POPTR_0001s27110g [Populus trichocarpa]
Length=365

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 126/177 (71%), Gaps = 0/177 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P  T  NL+KN  FEEGP+      +GVL PP  ED  SPLP W +ESLKAVK+ID +HF
Sbjct  188  PMPTRDNLVKNHGFEEGPHRLVNTSSGVLLPPRQEDLTSPLPGWMIESLKAVKFIDKKHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G  AVELVAG+ESA+ QI RT+  K Y LTF VGDA N C GSM++EAFA   T K
Sbjct  248  NVPFGLAAVELVAGRESAIAQILRTIPDKVYGLTFTVGDARNGCHGSMMVEAFAAKDTFK  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
            VP+ESKG+G +K    +F+A   RTR+ F+S+YYHTR DDF SLCGP++D V++  +
Sbjct  308  VPFESKGKGEFKTVSFKFKAVTARTRITFYSSYYHTRIDDFGSLCGPILDEVRVFPI  364



>ref|XP_004307221.1| PREDICTED: uncharacterized protein LOC101292742 [Fragaria vesca 
subsp. vesca]
Length=368

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 133/179 (74%), Gaps = 2/179 (1%)
 Frame = -1

Query  707  ILPRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  528
            +LP  T  NL++N  FEE P+       GVL PP   D  SPLP W +ESLKAVK+IDA+
Sbjct  191  VLP--TRDNLVRNPGFEEAPHRLMNSSHGVLLPPKQLDATSPLPGWIIESLKAVKFIDAK  248

Query  527  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  348
            HF+VP G+ AVELVAG+ESA+ Q+ RTV  K Y L+F +GDA N C GSM++EAFAG  T
Sbjct  249  HFNVPFGKGAVELVAGRESAIAQVLRTVPNKLYSLSFTIGDARNGCHGSMMVEAFAGKDT  308

Query  347  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
            LKVP+ S+G+GG+K A  +F+AT+ RTR+ FFS++YHTR+DD+ +LCGP++D VK+  +
Sbjct  309  LKVPFNSQGKGGFKNASFKFKATSFRTRITFFSSFYHTRTDDYGALCGPILDEVKVSPI  367



>ref|XP_006411450.1| hypothetical protein EUTSA_v10016825mg [Eutrema salsugineum]
 gb|ESQ52903.1| hypothetical protein EUTSA_v10016825mg [Eutrema salsugineum]
Length=370

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 130/181 (72%), Gaps = 1/181 (1%)
 Frame = -1

Query  707  ILP-RXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDA  531
            ILP R    N++KN  FE GP+VF    TG+L P   +D  SPLP W VESLK VKYID 
Sbjct  190  ILPLRYNRGNIVKNGGFEVGPHVFKNFSTGILIPAKIQDLISPLPGWIVESLKPVKYIDN  249

Query  530  EHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPS  351
             HF+VP G  A+E++AG+ESA+ QI RTVAGK+Y L+F+VGDA N C GSM++EAFAG S
Sbjct  250  GHFNVPSGHAAIEIIAGRESAIAQIIRTVAGKYYILSFVVGDAHNGCHGSMMVEAFAGRS  309

Query  350  TLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
            T K+ +ES G+G  K  + RFRA +NRTR+ F+S +YHT+  DF  LCGPV+D V++V  
Sbjct  310  TFKLRFESNGKGAVKVGRFRFRADSNRTRITFYSGFYHTKLHDFGHLCGPVLDNVRVVMT  369

Query  170  R  168
            R
Sbjct  370  R  370



>gb|KHG07966.1| Imidazolonepropionase [Gossypium arboreum]
Length=371

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 126/174 (72%), Gaps = 0/174 (0%)
 Frame = -1

Query  692  TNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFSVP  513
            T  NL+KN  FE GP+ F    TGVL PP  +D  SPLP W +ESLK VK+ID +HFSVP
Sbjct  197  TEGNLVKNSGFETGPHTFKNFSTGVLLPPHKQDTISPLPGWIIESLKPVKFIDKKHFSVP  256

Query  512  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  333
             G+ A+E+VAG+ESA+ Q+ RT   K Y LTF VGDA N C GSM++EAFAG  TLKVPY
Sbjct  257  SGQFAIEMVAGRESAIAQVIRTAPNKDYTLTFTVGDAKNDCHGSMMVEAFAGKGTLKVPY  316

Query  332  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
             S+G+GG+K A  RF+A + RTR+ F+S YYHT+  DF  +CGPV+D VK++ V
Sbjct  317  VSQGKGGFKTASFRFQAISARTRITFYSAYYHTKLHDFGHMCGPVLDDVKVLPV  370



>ref|XP_011047367.1| PREDICTED: uncharacterized protein LOC105141733 [Populus euphratica]
Length=365

 Score =   212 bits (540),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 126/177 (71%), Gaps = 0/177 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P  T  NL+KN  FEEGP+      +GVL PP  ED  SPLP W +ESLKAVK+ID +HF
Sbjct  188  PMPTRDNLVKNHGFEEGPHRLVNTSSGVLLPPRQEDLTSPLPGWMIESLKAVKFIDKKHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G  AVELVAG+ESA+ QI RT+  K Y LTF +GDA N C GSM++EAFA   T K
Sbjct  248  NVPFGLAAVELVAGRESAIAQILRTIPDKVYGLTFTIGDARNGCHGSMMVEAFAAKDTFK  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
            VP+ESKG+G +K    +F+A   RTR+ F+S+YYHTR DDF SLCGP++D V++  +
Sbjct  308  VPFESKGKGEFKTVSFKFKAVTARTRITFYSSYYHTRIDDFGSLCGPILDEVRVFPI  364



>ref|XP_011013325.1| PREDICTED: uncharacterized protein LOC105117377 [Populus euphratica]
Length=365

 Score =   212 bits (540),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 126/177 (71%), Gaps = 0/177 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P  T  NL+KN  FEEGP+      +GVL PP  ED  SPLP W +ESLKAVK+ID +HF
Sbjct  188  PMPTRDNLVKNHGFEEGPHRLVNTSSGVLLPPRQEDLTSPLPGWMIESLKAVKFIDKKHF  247

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G  AVELVAG+ESA+ QI RT+  K Y LTF +GDA N C GSM++EAFA   T K
Sbjct  248  NVPFGLAAVELVAGRESAIAQILRTIPDKVYGLTFTIGDARNGCHGSMMVEAFAAKDTFK  307

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
            VP+ESKG+G +K    +F+A   RTR+ F+S+YYHTR DDF SLCGP++D V++  +
Sbjct  308  VPFESKGKGEFKTVSFKFKAVTARTRITFYSSYYHTRIDDFGSLCGPILDEVRVFPI  364



>ref|XP_008392232.1| PREDICTED: uncharacterized protein LOC103454416 [Malus domestica]
Length=366

 Score =   212 bits (540),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 126/169 (75%), Gaps = 0/169 (0%)
 Frame = -1

Query  692  TNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFSVP  513
            T  NL+KN  FE+GP+VF    TG+L PP   D +SPLP W +ESLK VKYID +HF+VP
Sbjct  192  TRGNLVKNGGFEKGPHVFKNFSTGILIPPKVNDPYSPLPGWIIESLKPVKYIDRKHFAVP  251

Query  512  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  333
             G  A+ELVAG+ESA+ QI RTV  K Y+L F +GDA N C GSM++EAFAG  TLKVP+
Sbjct  252  RGLAAIELVAGRESAIAQIIRTVPNKSYNLIFTIGDAKNGCHGSMMVEAFAGKETLKVPF  311

Query  332  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFV  186
             S G+GG+K A L+F+AT+ RTR+ F+S YYHT+ DD+  +CGPV+D V
Sbjct  312  VSAGKGGFKTAILKFQATSFRTRLTFYSAYYHTKLDDYGHMCGPVLDNV  360



>ref|XP_002308942.2| hypothetical protein POPTR_0006s04890g [Populus trichocarpa]
 gb|EEE92465.2| hypothetical protein POPTR_0006s04890g [Populus trichocarpa]
Length=373

 Score =   212 bits (540),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 126/173 (73%), Gaps = 0/173 (0%)
 Frame = -1

Query  698  RXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFS  519
            R T  NL+KN  FE GP++F    TGVL PP  +D  SPLP W +ESLK VKYID++HF 
Sbjct  197  RRTIGNLVKNGGFEVGPHMFKNFSTGVLLPPKQQDQISPLPGWIIESLKPVKYIDSKHFF  256

Query  518  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKV  339
            VP G  A+ELVAG+ESA+ Q+ RT+  KFY+LTF VGDA N C GSM++EAFA   T+KV
Sbjct  257  VPEGFAAIELVAGRESAIAQVIRTIPDKFYNLTFTVGDAKNACHGSMMVEAFAAKETVKV  316

Query  338  PYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  180
            PY S+G+GGYK A LRF+A + RTR+ F+S YYH +  D+  +CGPV+D V +
Sbjct  317  PYVSQGKGGYKTAILRFQAVSARTRITFYSAYYHNKQHDYGHMCGPVLDDVSV  369



>ref|XP_002276894.1| PREDICTED: uncharacterized protein LOC100258445 [Vitis vinifera]
Length=368

 Score =   212 bits (539),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 128/180 (71%), Gaps = 0/180 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P  T  NL+KN  FEEGP++      GVL PP  ED  SPLP W +ESLKAVK+ID +HF
Sbjct  189  PMPTRDNLVKNSGFEEGPHLLINSSNGVLLPPKQEDLTSPLPGWIIESLKAVKFIDKKHF  248

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G  AVEL+AG+ESA+ Q+ RTV  K Y+LTF +GD  N C G M++EAFA   + K
Sbjct  249  NVPFGLAAVELLAGRESAIAQVLRTVPNKLYNLTFSIGDGKNGCHGDMMIEAFAAKDSFK  308

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  162
             P++S+G+G +K    +F+A A RTR+ FFS++YHTR DDF SLCGPV+D V++ S+R P
Sbjct  309  APFKSRGKGEFKTVSFKFKAIAARTRLTFFSSFYHTRIDDFGSLCGPVLDQVRVFSIRKP  368


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 74/184 (40%), Gaps = 32/184 (17%)
 Frame = -1

Query  683  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYI------DAEHF  522
             LL N +FEE P       T +            LP W +    +V+YI          F
Sbjct  28   GLLPNGNFEESPKPTDLKKTVI-------KGKYSLPKWEING--SVEYIAGGPQPGGMFF  78

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +V HG  AV L  G E++++Q      G  Y LTF    AS  C    VL     P T  
Sbjct  79   AVAHGVHAVRL--GNEASISQTIPVKPGSLYALTF---GASRTCAQDEVLRVSVPPQTGD  133

Query  341  VP----YESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVS  174
            +P    Y+S G   Y      FRAT+N  +V F +T            CGP++D V +  
Sbjct  134  LPLQTLYDSFGGDVYA---WGFRATSNEAKVTFHNTGVQED-----PACGPLLDAVAIKE  185

Query  173  VRNP  162
            +  P
Sbjct  186  LFPP  189



>ref|XP_010241208.1| PREDICTED: uncharacterized protein LOC104585885 [Nelumbo nucifera]
Length=366

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 129/179 (72%), Gaps = 0/179 (0%)
 Frame = -1

Query  707  ILPRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  528
            I P  T  NL+KN DFE GP++F    TGVL PP  +D  SPLP W +ESLKAVKYID++
Sbjct  187  ISPLPTGGNLVKNGDFENGPHLFKNFSTGVLIPPKQQDLISPLPGWIIESLKAVKYIDSK  246

Query  527  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  348
            HFSVP G  A+ELVAG+ESA+ Q+ RTV GK Y+LTF VGDA N C GSM++EAFA   T
Sbjct  247  HFSVPSGFAAIELVAGRESAIAQVLRTVPGKLYELTFTVGDAKNGCYGSMMVEAFAANET  306

Query  347  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
            LKVP++S     +K A L+F+A   RTR+ F+S +YHT+  D+ +LCGPV+D V++  V
Sbjct  307  LKVPFQSHASSRFKTASLKFKALEPRTRITFYSGFYHTKLHDYGTLCGPVLDHVRVFPV  365


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 79/183 (43%), Gaps = 32/183 (17%)
 Frame = -1

Query  680  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE------HFS  519
            LL N +FEEGP     +   V+   ++      LP W ++ L  V+YI          ++
Sbjct  29   LLPNGNFEEGPNP-SNLKKTVIIGKYS------LPKWEIDGL--VEYISGGPQPGGFFYA  79

Query  518  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEA----FAGPS  351
            VP G  A  L  G E++++Q      G FY LTF     +  C    VL      F+G  
Sbjct  80   VPRGVHAARL--GNEASISQSIAVKPGSFYALTF---GTTRTCAQDEVLRVSVPPFSGDL  134

Query  350  TLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
             ++  Y S G   Y  A   F+AT+N  ++ F     H         CGP++D V +  +
Sbjct  135  PIQTLYSSNGGDTYAWA---FKATSNVAKITF-----HNLGIQEDPACGPLLDAVAIKEI  186

Query  170  RNP  162
             +P
Sbjct  187  ISP  189



>gb|KJB19256.1| hypothetical protein B456_003G091800 [Gossypium raimondii]
Length=307

 Score =   209 bits (533),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 120/167 (72%), Gaps = 0/167 (0%)
 Frame = -1

Query  692  TNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFSVP  513
            T  NL+KN  FE GP+ F    TGVL PP   D  SPL  W +ESLK VKYID +HFSVP
Sbjct  133  TRGNLVKNGGFETGPHTFKNFSTGVLLPPKKLDRISPLVGWIIESLKPVKYIDKKHFSVP  192

Query  512  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  333
             G  AVELVAG+ESA+ QI RTV  KFY LTF VGDA N C GSM+++AFAG  TL+VPY
Sbjct  193  SGLFAVELVAGRESAIAQIIRTVPNKFYTLTFTVGDAKNGCHGSMMVQAFAGKETLQVPY  252

Query  332  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVD  192
             S+G+GG K A  RF+A + RTR+ FFS YYHT+ DD+  +CGPV+D
Sbjct  253  VSQGKGGLKTASFRFQAISARTRITFFSAYYHTKLDDYGHICGPVLD  299



>ref|XP_002466246.1| hypothetical protein SORBIDRAFT_01g004270 [Sorghum bicolor]
 gb|EER93244.1| hypothetical protein SORBIDRAFT_01g004270 [Sorghum bicolor]
Length=386

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 127/175 (73%), Gaps = 0/175 (0%)
 Frame = -1

Query  692  TNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFSVP  513
            T  NL+KN  FE GP V      GVL PP  +D  SPLP W +ESLKAV++IDA HFSVP
Sbjct  211  TKDNLIKNDGFEIGPQVLKNSTVGVLLPPKQKDATSPLPGWIIESLKAVRFIDAAHFSVP  270

Query  512  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  333
             G+ AVELVAG+ESA+ Q+ RTV  + Y+L+F VGDA N C GSM++EAFAG  T KVP+
Sbjct  271  AGQYAVELVAGRESAIAQVIRTVPNRAYNLSFAVGDAKNGCHGSMLVEAFAGNVTQKVPF  330

Query  332  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            ES G+GG+K A  RF A   RTR+ F+S+YYHT+  D VSLCGPV+D VK+V V+
Sbjct  331  ESAGKGGFKAAAFRFVAAGARTRLTFYSSYYHTKVTDGVSLCGPVLDQVKVVPVK  385



>ref|XP_009355525.1| PREDICTED: uncharacterized protein LOC103946533 [Pyrus x bretschneideri]
Length=367

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 125/169 (74%), Gaps = 0/169 (0%)
 Frame = -1

Query  692  TNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFSVP  513
            T  NL+KN  FE+GP+VF    TG+L PP   D +SPLP W VESLK VKYID +HF+VP
Sbjct  193  TRGNLVKNGGFEKGPHVFKNYSTGILIPPKVNDPYSPLPGWIVESLKPVKYIDRKHFAVP  252

Query  512  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  333
             G  A+ELVAG+ESA+ QI RTV  K Y+L F +GDA N C GSM++EAFAG  TLK P+
Sbjct  253  RGLAAIELVAGRESAIAQIIRTVPNKSYNLIFTIGDAKNGCHGSMMVEAFAGKETLKAPF  312

Query  332  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFV  186
             S G+GG+K A L+F+AT+ RTR+ F+S YYHT+ DD+  +CGPV+D V
Sbjct  313  VSAGKGGFKTAILKFQATSIRTRLTFYSAYYHTKLDDYGHMCGPVLDNV  361



>gb|AFK44456.1| unknown [Lotus japonicus]
Length=177

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 124/174 (71%), Gaps = 0/174 (0%)
 Frame = -1

Query  692  TNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFSVP  513
            T  NL+KN  FEEGP+       GVL PP  +D  SPLP W +ESLKAVK+IDA+HF+VP
Sbjct  3    TRANLVKNPSFEEGPFPIFNSTNGVLLPPQQQDRFSPLPGWIIESLKAVKFIDAKHFNVP  62

Query  512  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  333
             G  AVELVAG+ESA+ QI RT A K Y++TF VGDA N C GSM++EAFA   T KVP+
Sbjct  63   FGLGAVELVAGRESAIAQIIRTEANKVYNITFSVGDAKNGCHGSMMVEAFAAKDTFKVPF  122

Query  332  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
            +S G+G +      F+A A RTR+ F+S+YYHTR+DDF SLCGPV+D V +  V
Sbjct  123  KSVGKGKFVTVSFEFKAIAPRTRLTFYSSYYHTRTDDFGSLCGPVLDRVIVFPV  176



>ref|XP_009418805.1| PREDICTED: uncharacterized protein LOC103998920 [Musa acuminata 
subsp. malaccensis]
Length=363

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 132/178 (74%), Gaps = 0/178 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P  T+ NL+KN  FEEGP+VF    TGVL PP  ED  SPLP W +ESLKAV++IDA H+
Sbjct  185  PMPTHDNLVKNGGFEEGPHVFKNSTTGVLLPPKQEDSTSPLPGWIIESLKAVRFIDAAHY  244

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            ++P G+ A+ELVAG+ESA+ Q+ RT +   Y+L+F+VGDA N C GSM++EAFAG  T K
Sbjct  245  AIPSGQFAIELVAGRESAIAQVIRTASNTTYNLSFVVGDAKNGCHGSMLVEAFAGNGTAK  304

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  168
            V ++S+G+GG+K A L F AT +RTR+ F+S+YYHT   +  SLCGP++D V++  ++
Sbjct  305  VSFQSQGKGGFKAASLNFTATGSRTRITFYSSYYHTSVSNPGSLCGPLLDQVRVYPLK  362



>ref|XP_007218160.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
 gb|EMJ19359.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
Length=367

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -1

Query  692  TNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFSVP  513
            T  NL++N  FEE P+       GVL PP   D  SPLP W +ESLKAVK+ID++HF+VP
Sbjct  193  TRDNLVRNPGFEEAPHRLFNSSHGVLLPPKQLDVTSPLPGWIIESLKAVKFIDSQHFNVP  252

Query  512  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  333
             G+ AVELVAG+ESA+ Q+ RTV  K YDL+F+VGDA N C GSM++EAFAG  TLKVP+
Sbjct  253  FGKGAVELVAGRESAIAQVLRTVPNKIYDLSFVVGDARNGCHGSMMVEAFAGKDTLKVPF  312

Query  332  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  171
             S+G+GG+K A L+F+A + RTR+ F+S++YHTR DD+ +LCGP++D V++  V
Sbjct  313  TSQGKGGFKAASLKFKAASPRTRITFYSSFYHTRVDDYGALCGPILDQVRVYPV  366



>ref|XP_010695068.1| PREDICTED: uncharacterized protein LOC104907775 [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 126/168 (75%), Gaps = 0/168 (0%)
 Frame = -1

Query  683  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFSVPHGR  504
            NL++N  FEEGPY       G+L PP  ED +SPLP W +ESLKAVKYID  HF+VP GR
Sbjct  197  NLIRNGGFEEGPYRILNTSNGILLPPKQEDINSPLPGWVIESLKAVKYIDKRHFNVPFGR  256

Query  503  RAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYESK  324
             A+ELVAG+ESA+ Q+ RTV  K Y+LTF +GDA N C+GSM++EAFAG  TLK P+ S+
Sbjct  257  SAIELVAGRESAIAQVIRTVPNKVYNLTFTIGDAKNSCKGSMLVEAFAGRDTLKAPFLSQ  316

Query  323  GQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  180
            G G ++   ++F+A ++RTR+ FFS+YYH+++D F  LCGPV+D V++
Sbjct  317  GLGKFQTVSMKFKAISDRTRITFFSSYYHSKADGFGILCGPVLDEVRV  364



>gb|EYU43005.1| hypothetical protein MIMGU_mgv1a011073mg [Erythranthe guttata]
Length=293

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 130/174 (75%), Gaps = 0/174 (0%)
 Frame = -1

Query  701  PRXTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  522
            P+ + VNL+KN  FEEGP++      GVL PP  ED  SPLP W +ESLKAVK+ID++HF
Sbjct  114  PKPSRVNLVKNEGFEEGPHLLMNSSHGVLLPPKQEDLTSPLPGWIIESLKAVKFIDSKHF  173

Query  521  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  342
            +VP G+ AVELVAG+ESA+ QI RTV  K Y+L+F+VGDA N C GSM++EAFA  +T K
Sbjct  174  NVPFGKSAVELVAGRESAIAQIIRTVPNKVYNLSFVVGDAKNGCHGSMLVEAFAAKTTSK  233

Query  341  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  180
              ++S+G+G +     +F A ++RTR+ FFS++YHTR DDF SLCGPV+D V++
Sbjct  234  AQFKSEGKGKFSTYNFQFTAVSDRTRLTFFSSFYHTRIDDFGSLCGPVLDEVRV  287



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1219970116365