BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF036D07

Length=736
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHJ60264.1|  phenylalanine ammonia-lyase 1                           390   4e-128   Ipomoea purpurea
sp|Q42858.1|PAL2_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       379   9e-124   Ipomoea batatas [batate]
ref|XP_009629066.1|  PREDICTED: phenylalanine ammonia-lyase             351   1e-112   Nicotiana tomentosiformis
dbj|BAF98438.1|  phenylalanine ammonia-lyase                            335   6e-112   Glehnia littoralis
gb|AAG49585.1|AF325496_1  phenylalanine ammonia-lyase                   348   1e-111   Ipomoea nil [qian niu]
dbj|BAF98437.1|  phenylalanine ammonia-lyase                            333   1e-111   Glehnia littoralis
gb|ABG75911.1|  phenylalanine ammonia-lyase 2                           348   3e-111   Nicotiana attenuata
sp|P14166.1|PAL1_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       347   5e-111   Ipomoea batatas [batate]
gb|ABG75910.1|  phenylalanine ammonia-lyase 1                           346   1e-110   Nicotiana attenuata
gb|AIB08913.1|  phenylalanine ammonia-lyase                             330   2e-110   Angelica sinensis [Chinese angelica]
gb|AAC33966.1|  phenylalanine ammonia-lyase                             340   2e-110   Capsicum chinense [bonnet pepper]
sp|P35512.1|PALY_MALDO  RecName: Full=Phenylalanine ammonia-lyase       329   2e-110   Malus domestica [apple tree]
sp|P35513.2|PAL2_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       345   3e-110   Nicotiana tabacum [American tobacco]
ref|XP_009625397.1|  PREDICTED: phenylalanine ammonia-lyase             345   3e-110   Nicotiana tomentosiformis
gb|AGT63063.1|  phenylalanine ammonia-lyase                             345   4e-110   Solanum tuberosum [potatoes]
gb|AET41698.1|  phenylalanine ammonia-lyase                             331   6e-110   Prunus salicina [Japanese plum]
dbj|BAF98439.1|  phenylalanine ammonia-lyase                            329   9e-110   Glehnia littoralis
ref|XP_009766905.1|  PREDICTED: phenylalanine ammonia-lyase             343   9e-110   Nicotiana sylvestris
ref|XP_004246650.1|  PREDICTED: phenylalanine ammonia-lyase-like        343   2e-109   
ref|XP_009781653.1|  PREDICTED: phenylalanine ammonia-lyase             342   3e-109   Nicotiana sylvestris
ref|XP_004249558.1|  PREDICTED: phenylalanine ammonia-lyase             342   4e-109   Solanum lycopersicum
ref|XP_004246649.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    342   4e-109   Solanum lycopersicum
gb|ACF17667.1|  putative phenylalanine ammonia-lyase                    342   5e-109   Capsicum annuum
emb|CDP06747.1|  unnamed protein product                                337   5e-109   Coffea canephora [robusta coffee]
gb|ACR56688.1|  phenylalanine ammonia-lyase                             340   2e-108   Scutellaria viscidula [zhan mao huang qin]
sp|P45733.1|PAL3_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       340   3e-108   Nicotiana tabacum [American tobacco]
gb|AFC37247.1|  phenylalanine ammonia-lyase                             327   3e-108   Camellia chekiangoleosa
gb|AEO92028.1|  phenylalanine ammonia-lyase 2                           339   5e-108   Coffea canephora [robusta coffee]
gb|AIA66448.1|  PAL1                                                    338   7e-108   Capsicum annuum
gb|AEL21617.1|  phenylalanine ammonia lyase 2                           338   1e-107   Coffea arabica [arabica coffee]
dbj|BAA95629.1|  phenylalanine ammonia lyase                            338   1e-107   Catharanthus roseus [chatas]
emb|CDP20698.1|  unnamed protein product                                337   2e-107   Coffea canephora [robusta coffee]
gb|AEY94464.1|  phenylalanine ammonia-lyase                             326   2e-107   Prunella vulgaris
ref|XP_011094662.1|  PREDICTED: phenylalanine ammonia-lyase             337   2e-107   Sesamum indicum [beniseed]
gb|ACF94717.1|  phenylalanine ammonia lyase                             324   3e-107   Robinia pseudoacacia [black locust]
ref|XP_006354338.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    337   3e-107   Solanum tuberosum [potatoes]
ref|XP_006354336.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    337   4e-107   
ref|XP_008387584.1|  PREDICTED: phenylalanine ammonia-lyase 1           336   9e-107   
ref|XP_003625662.1|  Phenylalanine ammonia-lyase                        328   1e-106   
gb|AFG30054.1|  phenylalanine ammonialyase                              335   1e-106   Malus hybrid cultivar
dbj|BAC56977.1|  phenylalanine ammonia-lyase                            335   2e-106   Daucus carota [carrots]
dbj|BAF36975.1|  phenylalanine ammonia-lyase                            322   2e-106   Lotus japonicus
gb|AGF50184.1|  phenylalanine ammonia lyase                             321   2e-106   Salvia virgata
ref|XP_006367534.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      327   2e-106   
sp|P45726.1|PALY_CAMSI  RecName: Full=Phenylalanine ammonia-lyase       334   3e-106   Camellia sinensis [black tea]
dbj|BAG31930.1|  phenylalanine ammonia-lyase                            334   3e-106   Daucus carota [carrots]
emb|CBJ23826.1|  phenylalanine ammonia-lyase                            334   3e-106   Melissa officinalis [sweet balm]
gb|AFP24940.1|  phenylalanine ammonia lyase                             334   3e-106   Prunus salicina [Japanese plum]
gb|ADI40166.1|  phenylalanine ammonia-lyase                             335   3e-106   Morus alba
ref|XP_006364021.1|  PREDICTED: phenylalanine ammonia-lyase-like        335   3e-106   Solanum tuberosum [potatoes]
sp|O64963.1|PAL1_PRUAV  RecName: Full=Phenylalanine ammonia-lyase 1     334   3e-106   Prunus avium [gean]
gb|AGF50183.1|  phenylalanine ammonia lyase                             320   4e-106   Salvia hypoleuca
sp|P45729.1|PAL3_PETCR  RecName: Full=Phenylalanine ammonia-lyase 3     334   5e-106   Petroselinum crispum
gb|AEZ01784.1|  phenylalanine ammonia-lyase                             334   6e-106   Pyrus x bretschneideri [bai li]
gb|ADF59061.1|  phenylalanine ammonia-lyase 1 precursor                 333   6e-106   Pyrus x bretschneideri [bai li]
ref|XP_008243955.1|  PREDICTED: phenylalanine ammonia-lyase 1           333   8e-106   Prunus mume [ume]
gb|AAU08174.1|  phenylalanine ammonia-lyase                             333   8e-106   Camellia sinensis [black tea]
ref|XP_009373523.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    333   8e-106   Pyrus x bretschneideri [bai li]
ref|XP_009342990.1|  PREDICTED: phenylalanine ammonia-lyase 1           333   1e-105   
gb|AGL50914.1|  phenylalanine ammonia lyase                             333   1e-105   Pyrus communis
gb|ADN32767.1|  phenylalanine ammonia-lyase 1                           333   1e-105   Scutellaria baicalensis [Baikal skullcap]
gb|AGL81344.1|  phenylalanine ammonia lyase                             333   1e-105   Pyrus communis
ref|XP_006354339.1|  PREDICTED: phenylalanine ammonia-lyase-like        333   1e-105   Solanum tuberosum [potatoes]
gb|ABB70117.2|  phenylalanine ammonia lyase                             332   2e-105   Pyrus communis
ref|XP_008355619.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    332   2e-105   
dbj|BAF36972.1|  phenylalanine ammonia-lyase                            331   2e-105   Lotus japonicus
gb|AEA72280.1|  phenylalanine ammonia-lyase                             332   2e-105   Angelica gigas
ref|XP_008369679.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      332   2e-105   
gb|AAK60273.1|AF383150_1  phenylalanine ammonia-lyase 3                 319   3e-105   Manihot esculenta [manioc]
emb|CAA34715.1|  unnamed protein product                                328   3e-105   Petroselinum crispum
ref|XP_004246651.1|  PREDICTED: phenylalanine ammonia-lyase             332   3e-105   
ref|XP_011031723.1|  PREDICTED: phenylalanine ammonia-lyase G4          332   4e-105   Populus euphratica
gb|ABV71917.1|  PAL                                                     316   4e-105   Plectranthus scutellarioides
gb|AEZ67457.1|  phenylalanine ammonia-lyase                             331   7e-105   Perilla frutescens [beefsteak-mint]
ref|XP_004493977.1|  PREDICTED: phenylalanine ammonia-lyase-like        331   7e-105   Cicer arietinum [garbanzo]
gb|AAK84225.1|AF401636_1  phenylalanine ammonia-lyase                   330   1e-104   Rehmannia glutinosa [Chinese foxglove]
gb|ACF94716.1|  phenylalanine ammonia lyase                             330   1e-104   Robinia pseudoacacia [black locust]
sp|P26600.1|PAL5_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    330   1e-104   Solanum lycopersicum
gb|ACF94715.1|  phenylalanine ammonia lyase                             318   1e-104   Robinia pseudoacacia [black locust]
ref|XP_003635685.1|  PREDICTED: phenylalanine ammonia-lyase             317   1e-104   Vitis vinifera
ref|XP_007208432.1|  hypothetical protein PRUPE_ppa002099mg             330   2e-104   Prunus persica
dbj|BAF36973.1|  phenylalanine ammonia-lyase                            326   2e-104   Lotus japonicus
pir||JQ1070  phenylalanine ammonia-lyase (EC 4.3.1.5) - soybean  ...    321   2e-104   Glycine max [soybeans]
ref|XP_011077338.1|  PREDICTED: phenylalanine ammonia-lyase             330   2e-104   Sesamum indicum [beniseed]
gb|AHY94892.1|  phenylalanine ammonia lyase                             329   2e-104   Prunella vulgaris
gb|AHZ31605.1|  phenylalanine ammonia-lyase                             329   3e-104   Olea europaea
sp|P24481.1|PAL1_PETCR  RecName: Full=Phenylalanine ammonia-lyase 1     329   4e-104   Petroselinum crispum
pdb|1W27|A  Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petro...    329   4e-104   Petroselinum crispum
gb|AAN52280.1|AF480620_1  phenylalanine ammonia-lyase                   328   4e-104   Populus tremuloides
ref|XP_007009873.1|  Phenylalanine ammonia-lyase 2                      328   6e-104   
gb|ABV44808.1|  phenylalanine ammonia lyase 1                           316   9e-104   Eriobotrya japonica [loquat]
ref|XP_006358655.1|  PREDICTED: phenylalanine ammonia-lyase-like        328   9e-104   Solanum tuberosum [potatoes]
sp|O23865.1|PAL1_DAUCA  RecName: Full=Phenylalanine ammonia-lyase 1     328   1e-103   Daucus carota [carrots]
gb|AFZ78651.1|  phenylalanine ammonia-lyase                             328   1e-103   Populus tomentosa [Chinese white poplar]
ref|XP_006364022.1|  PREDICTED: phenylalanine ammonia-lyase-like        328   1e-103   Solanum tuberosum [potatoes]
ref|XP_002312013.1|  phenylalanine ammonia-lyase family protein         327   1e-103   Populus trichocarpa [western balsam poplar]
dbj|BAF36971.1|  phenylalanine ammonia-lyase                            328   1e-103   Lotus japonicus
ref|XP_002531677.1|  Phenylalanine ammonia-lyase, putative              328   1e-103   Ricinus communis
ref|XP_007162755.1|  hypothetical protein PHAVU_001G1777000g            312   1e-103   Phaseolus vulgaris [French bean]
sp|P45732.1|PALY_STYHU  RecName: Full=Phenylalanine ammonia-lyase       327   2e-103   Stylosanthes humilis [alfafinha do nordeste]
sp|P45735.1|PALY_VITVI  RecName: Full=Phenylalanine ammonia-lyase       318   2e-103   Vitis vinifera
gb|KEH24018.1|  phenylalanine ammonia-lyase-like protein                327   2e-103   Medicago truncatula
ref|XP_006354337.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    327   2e-103   Solanum tuberosum [potatoes]
gb|AAA34179.2|  phenylalanine ammonia lyase                             327   3e-103   Solanum lycopersicum
gb|AFZ94859.1|  phenylalanine ammonia-lyase                             327   3e-103   Plectranthus scutellarioides
dbj|BAF36969.1|  phenylalanine ammonia-lyase                            318   3e-103   Lotus japonicus
sp|O23924.1|PALY_DIGLA  RecName: Full=Phenylalanine ammonia-lyase       327   3e-103   Digitalis lanata [Grecian foxglove]
sp|P35511.1|PAL1_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    326   3e-103   Solanum lycopersicum
gb|AGF50182.1|  phenylalanine ammonia lyase                             313   3e-103   Salvia officinalis
ref|XP_004253518.1|  PREDICTED: phenylalanine ammonia-lyase-like        323   4e-103   
gb|KHN17149.1|  Phenylalanine ammonia-lyase 2                           323   4e-103   Glycine soja [wild soybean]
gb|AJO53273.1|  phenylalanine ammonia-lyase                             326   5e-103   Pogostemon cablin
dbj|BAD94354.1|  phenylalanine ammonia lyase                            315   5e-103   Arabidopsis thaliana [mouse-ear cress]
gb|KHG26972.1|  Phenylalanine ammonia-lyase                             325   8e-103   Gossypium arboreum [tree cotton]
gb|AFK47120.1|  unknown                                                 309   9e-103   Lotus japonicus
sp|P45728.1|PAL2_PETCR  RecName: Full=Phenylalanine ammonia-lyase 2     325   1e-102   Petroselinum crispum
gb|EYU38541.1|  hypothetical protein MIMGU_mgv1a001582mg                327   1e-102   Erythranthe guttata [common monkey flower]
ref|XP_003590471.1|  Phenylalanine ammonia-lyase                        325   1e-102   Medicago truncatula
ref|XP_010107519.1|  Phenylalanine ammonia-lyase                        320   1e-102   
gb|ABD73282.1|  phenylalanine ammonia-lyase                             325   1e-102   Salvia miltiorrhiza [Chinese salvia]
gb|AAK62030.1|  phenylalanine ammonia-lyase 1                           325   2e-102   Manihot esculenta [manioc]
sp|Q42667.1|PALY_CITLI  RecName: Full=Phenylalanine ammonia-lyase       325   2e-102   Citrus limon [lemon]
ref|XP_006436446.1|  hypothetical protein CICLE_v10030821mg             325   2e-102   Citrus clementina [clementine]
gb|KDO46246.1|  hypothetical protein CISIN_1g004955mg                   325   2e-102   Citrus sinensis [apfelsine]
sp|P31425.1|PAL1_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 1     324   2e-102   Solanum tuberosum [potatoes]
gb|AID16077.1|  phenylalanine ammonium lyase                            324   3e-102   Morus alba
gb|KHN39030.1|  Phenylalanine ammonia-lyase class 2                     321   3e-102   Glycine soja [wild soybean]
emb|CDX74991.1|  BnaA05g07370D                                          314   3e-102   
gb|KHN00850.1|  Phenylalanine ammonia-lyase 2                           321   3e-102   Glycine soja [wild soybean]
dbj|BAF36970.1|  phenylalanine ammonia-lyase                            323   4e-102   Lotus japonicus
sp|P27990.1|PALY_MEDSA  RecName: Full=Phenylalanine ammonia-lyase       324   4e-102   Medicago sativa [alfalfa]
gb|KJB62426.1|  hypothetical protein B456_009G416300                    324   4e-102   Gossypium raimondii
dbj|BAF36974.1|  phenylalanine ammonia-lyase                            323   5e-102   Lotus japonicus
sp|Q04593.1|PAL2_PEA  RecName: Full=Phenylalanine ammonia-lyase 2       324   5e-102   Pisum sativum [garden pea]
ref|XP_006589419.1|  PREDICTED: phenylalanine ammonia-lyase 2-lik...    323   5e-102   Glycine max [soybeans]
ref|NP_001236956.1|  phenylalanine ammonia-lyase 2                      323   5e-102   
gb|AJO53274.1|  phenylalanine ammonia-lyase                             323   5e-102   Pogostemon cablin
gb|ACC63889.1|  phenylalanine ammonia-lyase                             323   6e-102   Populus trichocarpa [western balsam poplar]
gb|AJR20994.1|  phenylalanine ammonia-lyase                             323   6e-102   Populus szechuanica
dbj|BAF36968.1|  phenylalanine ammonia-lyase                            322   6e-102   Lotus japonicus
gb|AHZ30594.1|  phenylalanine ammonia lyase-2                           323   7e-102   Prunus domestica
sp|Q01861.1|PAL1_PEA  RecName: Full=Phenylalanine ammonia-lyase 1       323   7e-102   Pisum sativum [garden pea]
gb|AFN85669.1|  phenylalanine ammonia-lyase                             323   7e-102   Hibiscus cannabinus [bimli-jute]
prf||2001451A  Phe ammonia lyase                                        323   8e-102   Pisum sativum [garden pea]
gb|KHG29664.1|  Phenylalanine ammonia-lyase                             323   1e-101   Gossypium arboreum [tree cotton]
emb|CAL91038.1|  phenylalanine ammonia-lyase 4                          311   1e-101   Cynara cardunculus var. scolymus [artichoke]
gb|KJB36583.1|  hypothetical protein B456_006G166000                    322   1e-101   Gossypium raimondii
ref|XP_006439143.1|  hypothetical protein CICLE_v10010874mg             310   2e-101   
gb|AGA84059.1|  phenylalanine ammonia lyase                             322   2e-101   Picrorhiza kurrooa
gb|AAQ74878.1|  phenylalanine ammonia lyase                             322   2e-101   Populus trichocarpa x Populus deltoides
ref|XP_003542541.1|  PREDICTED: phenylalanine ammonia-lyase class...    322   2e-101   
gb|AEX32790.1|  phenylalanine ammonia-lyase                             322   2e-101   Vitis vinifera
ref|XP_002281799.1|  PREDICTED: phenylalanine ammonia-lyase             322   2e-101   Vitis vinifera
ref|XP_004234632.2|  PREDICTED: phenylalanine ammonia-lyase             322   2e-101   
ref|XP_002519521.1|  Phenylalanine ammonia-lyase, putative              322   2e-101   Ricinus communis
ref|XP_007027354.1|  PHE ammonia lyase 1                                322   2e-101   Theobroma cacao [chocolate]
gb|AEX32784.1|  phenylalanine ammonia-lyase                             322   2e-101   Vitis vinifera
gb|KEH24019.1|  phenylalanine ammonia-lyase-like protein                322   2e-101   Medicago truncatula
dbj|BAF36967.1|  phenylalanine ammonia-lyase                            322   2e-101   Lotus japonicus
gb|AFQ92048.1|  phenylalanine ammonia-lyase                             306   3e-101   Pyrus pyrifolia [sha li]
ref|NP_001266106.1|  phenylalanine ammonia-lyase 2                      322   3e-101   Cicer arietinum [garbanzo]
gb|AAN52279.1|AF480619_1  phenylalanine ammonia-lyase                   321   3e-101   Populus tremuloides
gb|AEE81750.1|  phenylalanine ammonia lyase                             322   3e-101   Morus alba var. multicaulis
ref|XP_003635657.2|  PREDICTED: phenylalanine ammonia-lyase-like        321   3e-101   Vitis vinifera
ref|XP_006290660.1|  hypothetical protein CARUB_v10016752mg             321   4e-101   Capsella rubella
gb|AIL23235.1|  phenylalanine ammonia-lyase                             321   4e-101   Astragalus chrysochlorus
sp|P45730.1|PALY_POPTR  RecName: Full=Phenylalanine ammonia-lyase       321   4e-101   Populus trichocarpa [western balsam poplar]
gb|AAF40224.1|AF237955_1  phenylalanine ammonia-lyase 2                 322   4e-101   Rubus idaeus [European raspberry]
gb|AFZ78653.1|  phenylalanine ammonia-lyase                             321   4e-101   Populus tomentosa [Chinese white poplar]
ref|XP_002315308.1|  phenylalanine ammonia-lyase family protein         321   4e-101   Populus trichocarpa [western balsam poplar]
gb|KHG18863.1|  Phenylalanine ammonia-lyase                             321   4e-101   Gossypium arboreum [tree cotton]
ref|XP_002322884.2|  phenylalanine ammonia-lyase family protein         321   4e-101   Populus trichocarpa [western balsam poplar]
gb|KJB73539.1|  hypothetical protein B456_011G238400                    321   5e-101   Gossypium raimondii
gb|AAK60275.1|AF383152_1  phenylalanine ammonia-lyase 2                 321   5e-101   Manihot esculenta [manioc]
emb|CDX91331.1|  BnaC04g08190D                                          311   5e-101   
dbj|BAA21643.1|  phenylalanine ammonia-lyase                            320   6e-101   Populus sieboldii x Populus grandidentata
gb|AIY26016.1|  PAL                                                     320   6e-101   Jasminum sambac [Arabian jasmine]
sp|Q40910.1|PAL4_POPKI  RecName: Full=Phenylalanine ammonia-lyase G4    317   6e-101   Populus sieboldii x Populus grandidentata
ref|XP_010426963.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      320   7e-101   Camelina sativa [gold-of-pleasure]
gb|KDO36715.1|  hypothetical protein CISIN_1g016039mg                   311   7e-101   Citrus sinensis [apfelsine]
pir||S60043  phenylalanine ammonia-lyase (EC 4.3.1.5) 4 - Japanes...    317   8e-101   Populus sieboldii x Populus grandidentata
gb|ADO64252.1|  PAL                                                     320   8e-101   Epimedium sagittatum
gb|AGW27206.1|  phenylalanine ammonia-lyase 3                           321   8e-101   Salvia miltiorrhiza [Chinese salvia]
ref|XP_004497516.1|  PREDICTED: phenylalanine ammonia-lyase-like        320   9e-101   Cicer arietinum [garbanzo]
ref|XP_003556238.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      320   1e-100   Glycine max [soybeans]
ref|XP_002268256.1|  PREDICTED: phenylalanine ammonia-lyase             320   1e-100   Vitis vinifera
gb|AFZ78650.1|  phenylalanine ammonia-lyase                             320   1e-100   Populus tomentosa [Chinese white poplar]
ref|XP_003633987.1|  PREDICTED: phenylalanine ammonia-lyase-like        320   1e-100   Vitis vinifera
gb|ADN32768.1|  phenylalanine ammonia-lyase 2                           320   1e-100   Scutellaria baicalensis [Baikal skullcap]
gb|KJB46526.1|  hypothetical protein B456_007G373700                    318   1e-100   Gossypium raimondii
gb|ABM67591.1|  phenylalanin ammonia-lyase                              320   1e-100   Vitis vinifera
gb|ACM44926.1|  phenylalanine ammonia-lyase                             320   1e-100   Euphorbia pulcherrima
ref|XP_002268181.1|  PREDICTED: phenylalanine ammonia-lyase             320   1e-100   Vitis vinifera
ref|XP_003633986.1|  PREDICTED: phenylalanine ammonia-lyase-like        320   1e-100   Vitis vinifera
gb|ACS71953.1|  phenylalanine ammonia-lyase                             320   2e-100   Euphorbia pulcherrima
gb|KJB46525.1|  hypothetical protein B456_007G373600                    320   2e-100   Gossypium raimondii
sp|P45731.1|PAL1_POPKI  RecName: Full=Phenylalanine ammonia-lyase G1    318   2e-100   Populus sieboldii x Populus grandidentata
ref|XP_010515816.1|  PREDICTED: phenylalanine ammonia-lyase 2           320   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_006381441.1|  phenylalanine ammonia-lyase family protein         319   2e-100   Populus trichocarpa [western balsam poplar]
dbj|BAE71252.1|  putative phenylalanine ammonia lyase                   319   2e-100   Trifolium pratense [peavine clover]
gb|ACE95170.1|  phenylalanine ammonia-lyase                             319   2e-100   Populus tomentosa [Chinese white poplar]
ref|XP_010662075.1|  PREDICTED: phenylalanine ammonia-lyase             319   2e-100   Vitis vinifera
ref|XP_003633985.1|  PREDICTED: phenylalanine ammonia-lyase-like        319   3e-100   Vitis vinifera
gb|ABR14606.1|  phenylalanine ammonia-lyase                             319   3e-100   Salvia miltiorrhiza [Chinese salvia]
ref|XP_007144370.1|  hypothetical protein PHAVU_007G150500g             319   3e-100   Phaseolus vulgaris [French bean]
gb|AGY49231.1|  phenylalanine ammonia lyase                             319   3e-100   Ricinus communis
gb|AFU90757.1|  phenylalanine ammonia-lyase                             319   3e-100   Epimedium sagittatum
emb|CDY18464.1|  BnaA04g21230D                                          310   3e-100   Brassica napus [oilseed rape]
gb|AAZ29733.1|  phenylalanine ammonia lyase                             318   3e-100   Trifolium pratense [peavine clover]
ref|XP_006403711.1|  hypothetical protein EUTSA_v10010153mg             319   3e-100   Eutrema salsugineum [saltwater cress]
ref|XP_002267953.1|  PREDICTED: phenylalanine ammonia-lyase             318   4e-100   Vitis vinifera
ref|XP_010658395.1|  PREDICTED: phenylalanine ammonia-lyase G1          319   4e-100   Vitis vinifera
emb|CAN61378.1|  hypothetical protein VITISV_032212                     318   4e-100   Vitis vinifera
ref|XP_011048535.1|  PREDICTED: phenylalanine ammonia-lyase-like        318   5e-100   Populus euphratica
gb|ABV44807.1|  phenylalanine ammonia lyase 2                           306   5e-100   Eriobotrya japonica [loquat]
sp|O49835.1|PAL1_LITER  RecName: Full=Phenylalanine ammonia-lyase...    318   5e-100   Lithospermum erythrorhizon
gb|AGE10589.1|  phenylalanine amononia-lyase                            318   6e-100   Lonicera japonica [Japanese honeysuckle]
ref|XP_002268732.1|  PREDICTED: phenylalanine ammonia-lyase             318   7e-100   Vitis vinifera
gb|AAK15640.1|AF326116_1  phenylalanine ammonia-lyase                   318   7e-100   Agastache rugosa
gb|AAC18870.1|  phenylalanine ammonia lyase                             318   7e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004304440.1|  PREDICTED: phenylalanine ammonia-lyase 1           318   7e-100   Fragaria vesca subsp. vesca
gb|AIB06732.1|  phenylalanine ammonia lyase                             318   8e-100   Mangifera indica
ref|NP_181241.1|  phenylalanine ammonia-lyase 1                         318   8e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002315309.2|  hypothetical protein POPTR_0010s23110g             317   8e-100   
gb|KHN02334.1|  Phenylalanine ammonia-lyase 1                           315   8e-100   Glycine soja [wild soybean]
ref|XP_010107516.1|  Phenylalanine ammonia-lyase 1                      312   9e-100   
ref|XP_010504083.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      318   9e-100   Camelina sativa [gold-of-pleasure]
gb|ADL09136.1|  phenylanlanine ammonia-lyase                            318   1e-99    Brassica oleracea var. botrytis [cauliflower]
emb|CAN77065.1|  hypothetical protein VITISV_009233                     317   1e-99    Vitis vinifera
ref|XP_006293761.1|  hypothetical protein CARUB_v10022721mg             317   1e-99    Capsella rubella
ref|XP_011010447.1|  PREDICTED: phenylalanine ammonia-lyase             317   1e-99    Populus euphratica
gb|ACA30407.1|  phenylalanine ammonia-lyase                             317   2e-99    Stylosanthes guianensis [stylo]
dbj|BAH20339.1|  AT3G53260                                              313   2e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010516949.1|  PREDICTED: phenylalanine ammonia-lyase 1           317   2e-99    Camelina sativa [gold-of-pleasure]
gb|KDO50672.1|  hypothetical protein CISIN_1g037382mg                   312   2e-99    Citrus sinensis [apfelsine]
ref|XP_010325983.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    317   2e-99    
ref|XP_009103852.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      317   2e-99    Brassica rapa
sp|P19142.1|PAL2_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    316   3e-99    Phaseolus vulgaris [French bean]
prf||2006271A  Phe ammonia lyase                                        317   3e-99    Trifolium subterraneum
ref|XP_004246652.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    316   3e-99    
ref|XP_003521397.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      316   3e-99    
sp|P45734.1|PALY_TRISU  RecName: Full=Phenylalanine ammonia-lyase       317   3e-99    Trifolium subterraneum
gb|ADR78835.1|  phenylalanine ammonia lyase                             312   3e-99    Ziziphus jujuba [Chinese jujube]
gb|ACV30588.1|  phenylalanine ammonia-lyase                             302   3e-99    Carica papaya [mamon]
gb|ACM62741.1|  phenylalanine ammonia-lyase                             316   3e-99    Garcinia mangostana [mangosteen]
ref|XP_002881488.1|  hypothetical protein ARALYDRAFT_482690             316   3e-99    
gb|AEW43005.1|  phenylalanine ammonia lyase                             305   4e-99    Leucaena leucocephala [cassie]
pir||A24727  phenylalanine ammonia-lyase (EC 4.3.1.5) - kidney be...    310   4e-99    Phaseolus vulgaris [French bean]
gb|KHN09507.1|  Phenylalanine ammonia-lyase 1                           315   4e-99    Glycine soja [wild soybean]
ref|XP_010262867.1|  PREDICTED: phenylalanine ammonia-lyase             316   4e-99    Nelumbo nucifera [Indian lotus]
emb|CAL91169.1|  phenylalanine ammonia-lyase 3                          316   4e-99    Cynara cardunculus var. scolymus [artichoke]
ref|XP_010253912.1|  PREDICTED: phenylalanine ammonia-lyase             316   4e-99    Nelumbo nucifera [Indian lotus]
sp|P07218.2|PAL1_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    310   4e-99    Phaseolus vulgaris [French bean]
gb|AAX84839.1|  phenylalanine ammonia-lyase                             316   4e-99    Astragalus mongholicus
gb|ABE03772.1|  phenylalanine ammonia-lyase                             315   4e-99    Arnebia euchroma
gb|KHG30005.1|  Phenylalanine ammonia-lyase                             316   5e-99    Gossypium arboreum [tree cotton]
gb|AIZ76770.1|  PAL2                                                    305   5e-99    Pyrus pyrifolia [sha li]
gb|AIZ76768.1|  PAL2                                                    305   5e-99    Pyrus pyrifolia [sha li]
gb|ABC69916.1|  phenylalanine ammonia-lyase                             316   5e-99    Brassica napus [oilseed rape]
gb|AAZ29732.1|  phenylalanine ammonia lyase                             316   5e-99    Trifolium pratense [peavine clover]
gb|ABD42947.1|  phenylalanine ammonia lyase                             315   5e-99    Acacia auriculiformis x Acacia mangium
ref|XP_003554382.1|  PREDICTED: phenylalanine ammonia-lyase 1-lik...    315   5e-99    
gb|AEV53411.1|  phenylalanine ammonia-lyase 3                           315   6e-99    Populus tomentosa [Chinese white poplar]
ref|XP_010107520.1|  Phenylalanine ammonia-lyase                        315   6e-99    Morus notabilis
ref|XP_009141625.1|  PREDICTED: phenylalanine ammonia-lyase 1           315   6e-99    Brassica rapa
ref|XP_006481493.1|  PREDICTED: phenylalanine ammonia-lyase-like        315   7e-99    Citrus sinensis [apfelsine]
emb|CAB42793.1|  phenylalanine-ammonia lyase                            315   7e-99    Citrus clementina x Citrus reticulata
dbj|BAO01110.1|  phenylalanine ammonia-lyase                            315   8e-99    Vigna radiata [mung bean]
gb|ABY89691.1|  phenylalanine ammonialyase 2 protein                    315   8e-99    Brassica rapa subsp. oleifera [biennial turnip rape]
dbj|BAM28965.1|  phenylalanine ammonia lyase                            302   9e-99    Lilium hybrid division I
gb|AGH13333.1|  phenylalanine ammonia-lyase                             315   1e-98    Rhus chinensis
gb|ABF50788.1|  phenylalanine ammonia-lyase                             315   1e-98    Isatis tinctoria [woad]
ref|XP_007162756.1|  hypothetical protein PHAVU_001G177800g             315   1e-98    Phaseolus vulgaris [French bean]
gb|AAZ29734.1|  phenylalanine ammonia lyase                             315   1e-98    Trifolium pratense [peavine clover]
ref|XP_009116020.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    315   1e-98    Brassica rapa
ref|XP_008449240.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      314   2e-98    Cucumis melo [Oriental melon]
gb|AAZ29735.1|  phenylalanine ammonia lyase                             315   2e-98    Trifolium pratense [peavine clover]
gb|ABQ63094.1|  phenylalanine ammonia-lyase                             314   2e-98    Astragalus membranaceus
sp|P27991.1|PAL1_SOYBN  RecName: Full=Phenylalanine ammonia-lyase 1     314   2e-98    Glycine max [soybeans]
gb|AAM12956.1|  phenylalanine ammonia-lyase                             314   2e-98    
gb|AAX22055.1|  phenylalanine ammonia-lyase                             314   2e-98    
ref|XP_008366650.1|  PREDICTED: phenylalanine ammonia-lyase 1           314   2e-98    
ref|XP_003591877.1|  Phenylalanine ammonia-lyase                        314   2e-98    
gb|AAX22053.1|  phenylalanine ammonia-lyase                             314   2e-98    
gb|AAC18871.1|  phenylalanine ammonia lyase                             314   2e-98    
gb|AAR31107.1|  phenylalanine ammonia-lyase                             314   2e-98    
ref|XP_011041027.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    314   2e-98    
ref|XP_009143533.1|  PREDICTED: phenylalanine ammonia-lyase 1           314   2e-98    
ref|NP_190894.1|  phenylalanine ammonia-lyase 2                         314   2e-98    
ref|XP_010107518.1|  Phenylalanine ammonia-lyase                        315   2e-98    
gb|ABI33979.1|  phenylalanine ammonia lyase                             314   2e-98    
ref|XP_011041025.1|  PREDICTED: phenylalanine ammonia-lyase G2B         314   2e-98    
ref|XP_010509401.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      314   2e-98    
ref|XP_003521396.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      314   3e-98    
gb|ADF59062.1|  phenylalanine ammonia-lyase 2 precursor                 314   3e-98    
ref|XP_006428758.1|  hypothetical protein CICLE_v10011134mg             314   4e-98    
gb|AAY82485.1|  phenylalanine ammonia-lyase                             308   4e-98    
ref|XP_006488063.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      313   4e-98    
gb|ADA81868.1|  phenylalanine ammonia-lyase                             313   4e-98    
gb|KFK34576.1|  hypothetical protein AALP_AA5G163700                    313   5e-98    
gb|AIA24411.1|  phenylalanine ammonia-lyase                             313   5e-98    
gb|KJB16792.1|  hypothetical protein B456_002G248000                    313   6e-98    
gb|KHG04887.1|  Phenylalanine ammonia-lyase                             313   6e-98    
ref|XP_002877909.1|  phenylalanine ammonia-lyase 2                      313   6e-98    
gb|ABY89690.1|  phenylalanine ammonialyase 1 protein                    313   6e-98    
ref|XP_006424538.1|  hypothetical protein CICLE_v10027913mg             313   7e-98    
ref|XP_006424540.1|  hypothetical protein CICLE_v10027912mg             312   7e-98    
gb|AER12109.1|  PAL                                                     313   8e-98    
dbj|BAF36976.1|  phenylalanine ammonia-lyase                            313   8e-98    
gb|ACT32033.1|  phenylalanine ammonia-lyase                             312   8e-98    
ref|XP_011041026.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    313   8e-98    
gb|KFK36594.1|  hypothetical protein AALP_AA4G144000                    313   9e-98    
dbj|BAJ17655.1|  phenylalanine ammonia lyase                            313   9e-98    
ref|XP_010505261.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      312   1e-97    
gb|ABN79671.2|  phenylalanine ammonia-lyase                             312   1e-97    
gb|AGV54597.1|  phenylalanine ammonia-lyase                             312   1e-97    
gb|ACZ36441.1|  phenylalanine ammonialyase                              312   1e-97    
gb|AIZ76769.1|  PAL2                                                    306   1e-97    
gb|EYU34451.1|  hypothetical protein MIMGU_mgv1a002104mg                312   1e-97    
gb|ADY02660.1|  phenylalanine ammonia lyase                             311   2e-97    
ref|XP_006410883.1|  hypothetical protein EUTSA_v10016314mg             311   2e-97    
ref|XP_010553331.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      311   3e-97    
gb|KGN48161.1|  hypothetical protein Csa_6G445740                       306   3e-97    
gb|ACR15762.1|  phenylalanine ammonia-lyase                             311   3e-97    
gb|ABC69917.1|  phenylalanine ammonia-lyase                             311   3e-97    
gb|ACT53399.1|  phenylalanine ammonia-lyase 2                           311   4e-97    
ref|XP_010935894.1|  PREDICTED: phenylalanine ammonia-lyase             311   4e-97    
gb|AFG26322.1|  phenylalanine ammonia-lyase                             310   4e-97    
gb|AAD45384.1|  phenylalanine ammonia-lyase                             309   5e-97    
gb|ADY02661.1|  phenylalanine ammonia lyase                             309   7e-97    
gb|AIZ76767.1|  PAL2                                                    306   7e-97    
ref|XP_010684079.1|  PREDICTED: phenylalanine ammonia-lyase             310   8e-97    
ref|XP_009606373.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     310   9e-97    
ref|XP_009794410.1|  PREDICTED: phenylalanine ammonia-lyase-like        310   1e-96    
gb|KDO50673.1|  hypothetical protein CISIN_1g005031mg                   309   1e-96    
gb|KDP29132.1|  hypothetical protein JCGZ_16521                         309   2e-96    
ref|XP_004143255.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      309   2e-96    
gb|KGN52971.1|  hypothetical protein Csa_4G008250                       295   2e-96    
ref|XP_006428759.1|  hypothetical protein CICLE_v10011175mg             309   2e-96    
ref|XP_008449239.1|  PREDICTED: phenylalanine ammonia-lyase-like        309   2e-96    
sp|P45727.1|PALY_PERAE  RecName: Full=Phenylalanine ammonia-lyase       306   2e-96    
gb|AAL55242.1|AF299330_1  phenylalanine ammonia-lyase                   308   2e-96    
gb|AAP34199.1|  phenylalanine ammonia-lyase                             308   2e-96    
ref|XP_004156289.1|  PREDICTED: phenylalanine ammonia-lyase-like        308   2e-96    
gb|AAY82486.1|  phenylalanine ammonia-lyase                             306   3e-96    
ref|XP_007220629.1|  hypothetical protein PRUPE_ppa002328mg             306   3e-96    
gb|AFJ80777.1|  phenylalanine ammonia-lyase                             308   3e-96    
gb|AAN32867.1|AF460204_1  phenylalanine ammonia-lyase 2                 306   3e-96    
gb|AFP86474.1|  phenylalanine ammonia-lyase                             309   4e-96    
gb|ADY02662.1|  phenylalanine ammonia lyase                             307   5e-96    
gb|ADD82537.1|  phenylalanine ammonia-lyase                             304   7e-96    
gb|AFI71896.1|  phenylalanine ammonia-lyase                             307   7e-96    
gb|AID51445.1|  phenylalanine ammonia-lyase 2                           307   7e-96    
gb|AID51446.1|  phenylalanine ammonia-lyase 3                           307   8e-96    
ref|XP_007220630.1|  hypothetical protein PRUPE_ppa002328mg             306   9e-96    
sp|Q43052.1|PAL2_POPKI  RecName: Full=Phenylalanine ammonia-lyase...    307   9e-96    
gb|AEH02821.1|  phenylalanine ammonia lyase                             307   1e-95    
gb|ADD12041.1|  phenylalanine ammonia lyase                             306   1e-95    
ref|XP_008805217.1|  PREDICTED: phenylalanine ammonia-lyase             306   1e-95    
emb|CAB42794.1|  phenylalanine-ammonia lyase                            306   1e-95    
ref|XP_004156293.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    306   1e-95    
ref|XP_004143256.1|  PREDICTED: phenylalanine ammonia-lyase-like        306   2e-95    
ref|XP_002285277.1|  PREDICTED: phenylalanine ammonia-lyase             306   2e-95    
ref|XP_008233304.1|  PREDICTED: phenylalanine ammonia-lyase 1           306   2e-95    
ref|XP_007143727.1|  hypothetical protein PHAVU_007G096300g             306   3e-95    
gb|ADC34597.1|  phenylalanine ammonia-lyase                             306   3e-95    
gb|ACT21093.1|  phenylalanine ammonia-lyase                             305   3e-95    
gb|AEJ88223.1|  phenylalanine ammonia lyase                             306   3e-95    
gb|AGU91428.1|  phenylalanine ammonia-lyase                             305   4e-95    
gb|EPS61109.1|  phenylalanine ammonia-lyase                             305   4e-95    
gb|AEL21616.1|  phenylalanine ammonia lyase 1                           305   4e-95    
gb|AAN32866.1|AF460203_1  phenylalanine ammonia-lyase 1                 305   4e-95    
gb|AFP49806.1|  phenylalanine ammonialyase 1                            305   4e-95    
gb|ADQ28104.1|  phenylalanine ammonia-lyase                             305   5e-95    
dbj|BAM28963.1|  phenylalanine ammonia lyase                            305   5e-95    
sp|Q42609.1|PALY_BROFI  RecName: Full=Phenylalanine ammonia-lyase       305   6e-95    
gb|AAM28276.1|  phenylalanine ammonia-lyase                             292   8e-95    
ref|XP_007016787.1|  PHE ammonia lyase 1                                305   8e-95    
emb|CAL91037.1|  phenylalanine ammonia-lyase 1                          304   9e-95    
gb|KDP44384.1|  hypothetical protein JCGZ_20064                         304   1e-94    
ref|XP_010528074.1|  PREDICTED: phenylalanine ammonia-lyase 1           304   1e-94    
dbj|BAM28964.1|  phenylalanine ammonia lyase                            304   2e-94    
ref|XP_009399473.1|  PREDICTED: phenylalanine ammonia-lyase             303   2e-94    
ref|XP_011077265.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    303   3e-94    
gb|ACG56648.1|  phenylalanine ammonia lyase                             303   3e-94    
dbj|BAG70992.1|  phenylalanine ammonia-lyase                            303   4e-94    
ref|XP_002529414.1|  Phenylalanine ammonia-lyase, putative              303   4e-94    
ref|XP_009392118.1|  PREDICTED: phenylalanine ammonia-lyase-like        303   4e-94    
gb|ACT68010.1|  phenylalanine ammonia-lyase                             303   5e-94    
ref|XP_008449238.1|  PREDICTED: phenylalanine ammonia-lyase             302   6e-94    
gb|AGE10591.1|  phenylalanine amononia-lyase                            302   7e-94    
gb|AGC23439.1|  phenylalanine ammonia-lyase                             302   1e-93    
sp|O49836.1|PAL2_LITER  RecName: Full=Phenylalanine ammonia-lyase...    301   1e-93    
gb|ACG56647.1|  phenylalanine ammonia lyase                             301   1e-93    
gb|AHG06397.1|  phenylalanine ammonia lyase 62                          301   2e-93    
ref|XP_010529727.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      301   2e-93    
gb|ACM61988.1|  phenylalanine ammonia-lyase                             300   3e-93    
gb|AGE10605.1|  phenylalanine amononia-lyase                            286   9e-93    
ref|XP_010031967.1|  PREDICTED: phenylalanine ammonia-lyase-like        299   9e-93    
ref|XP_008454138.1|  PREDICTED: phenylalanine ammonia-lyase-like        298   2e-92    
ref|XP_008785254.1|  PREDICTED: phenylalanine ammonia-lyase-like        298   2e-92    
gb|ACG80829.1|  phenylalanine ammonia lyase                             295   2e-92    
gb|AID69536.1|  phenylalanine ammonia-lyase                             293   2e-92    
gb|AAW78932.1|  phenylalanine-ammonia lyase                             298   3e-92    
gb|AEO92029.1|  phenylalanine ammonia-lyase 3                           297   4e-92    
gb|AFP49807.1|  phenylalanine ammonialyase 4                            297   5e-92    
ref|XP_004173358.1|  PREDICTED: phenylalanine ammonia-lyase-like        294   5e-92    
gb|AIC66437.1|  phenylalanine ammonia lyase                             297   6e-92    
gb|KGN48162.1|  hypothetical protein Csa_6G445750                       297   7e-92    
ref|XP_004143257.1|  PREDICTED: phenylalanine ammonia-lyase-like        296   8e-92    
gb|AFS28702.1|  putative phenylalanine ammonia-lyase                    291   1e-91    
ref|XP_010906526.1|  PREDICTED: phenylalanine ammonia-lyase-like        296   1e-91    
gb|ACG80828.1|  phenylalanine ammonia lyase                             293   1e-91    
ref|XP_004167356.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    295   2e-91    
ref|XP_008463969.1|  PREDICTED: phenylalanine ammonia-lyase-like        295   2e-91    
ref|XP_008449237.1|  PREDICTED: phenylalanine ammonia-lyase-like        295   2e-91    
gb|KGN48165.1|  hypothetical protein Csa_6G445780                       286   3e-91    
ref|XP_004152158.1|  PREDICTED: phenylalanine ammonia-lyase-like        295   3e-91    
ref|XP_010934327.1|  PREDICTED: phenylalanine ammonia-lyase-like        295   5e-91    
ref|XP_008454139.1|  PREDICTED: phenylalanine ammonia-lyase-like        294   6e-91    
ref|XP_004145752.1|  PREDICTED: phenylalanine ammonia-lyase-like        294   7e-91    
gb|AAR19393.1|  phenylalanine ammonia-lyase                             293   9e-91    
ref|XP_010067318.1|  PREDICTED: phenylalanine ammonia-lyase             294   1e-90    
gb|AAO13347.1|  phenylalanine ammonia-lyase2                            293   2e-90    
ref|XP_002862326.1|  predicted protein                                  278   2e-90    
ref|XP_008454137.1|  PREDICTED: phenylalanine ammonia-lyase-like        293   2e-90    
gb|ACZ51372.1|  phenylalanine ammonia-lyase                             293   3e-90    
ref|XP_009401948.1|  PREDICTED: phenylalanine ammonia-lyase-like        292   4e-90    
dbj|BAM28966.1|  phenylalanine ammonia lyase                            292   4e-90    
ref|XP_008449236.1|  PREDICTED: phenylalanine ammonia-lyase-like        292   4e-90    
gb|AIE16710.1|  phenylalanine ammonia-lyase                             277   7e-90    
ref|XP_004143356.1|  PREDICTED: phenylalanine ammonia-lyase-like        291   8e-90    
ref|XP_004152155.1|  PREDICTED: phenylalanine ammonia-lyase-like        291   9e-90    
gb|KGN48164.1|  hypothetical protein Csa_6G445770                       291   1e-89    
gb|AEM63671.1|  phenylalanine ammonia lyase 2                           291   1e-89    
gb|KGN52973.1|  hypothetical protein Csa_4G008760                       283   1e-89    
dbj|BAM28967.1|  phenylalanine ammonia lyase                            291   1e-89    
gb|AGE10617.1|  phenylalanine amononia-lyase                            288   1e-89    
gb|AJO53272.1|  phenylalanine ammonia-lyase                             291   2e-89    
dbj|BAM05604.1|  phenylalanine ammonia lyase                            281   3e-89    
ref|XP_009759945.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     290   3e-89    
gb|AHA42443.1|  phenylalanine ammonia lyase                             290   3e-89    
dbj|BAB19128.1|  phenylalanine ammonia-lyase                            288   3e-89    
emb|CAA53733.1|  phenylanaline ammonia-lyase                            288   3e-89    
gb|AEM63670.1|  phenylalanine ammonia lyase 1                           290   4e-89    
gb|AIE16718.1|  phenylalanine ammonia-lyase                             275   4e-89    
ref|XP_009413725.1|  PREDICTED: phenylalanine ammonia-lyase-like        289   5e-89    
gb|AHF20178.1|  phenylalanine ammonia lyase                             286   6e-89    
gb|AAV98199.1|  phenylalanine ammonialyase 1                            289   6e-89    
gb|ADQ39192.1|  phenylalanine ammonia lyase 6                           289   6e-89    
gb|AEC11891.1|  PAL1                                                    289   7e-89    
gb|AAW51923.2|  phenylalanine ammonia-lyase 2                           289   7e-89    
ref|XP_010067316.1|  PREDICTED: phenylalanine ammonia-lyase             289   9e-89    
ref|XP_004143258.1|  PREDICTED: phenylalanine ammonia-lyase-like        288   1e-88    
ref|XP_002882662.1|  hypothetical protein ARALYDRAFT_897210             288   1e-88    
ref|XP_009146849.1|  PREDICTED: phenylalanine ammonia-lyase 4           288   1e-88    
gb|AGE10590.1|  phenylalanine amononia-lyase                            288   2e-88    
gb|ADA72013.1|  phenylalanine ammonia-lyase                             288   2e-88    
emb|CDY08611.1|  BnaA05g28470D                                          288   2e-88    
sp|Q9M568.1|PAL1_RUBID  RecName: Full=Phenylalanine ammonia-lyase...    287   3e-88    
gb|ADN32766.1|  phenylalanine ammonia-lyase                             287   3e-88    
gb|AHG06396.1|  phenylalanine ammonia lyase 2                           287   4e-88    
ref|XP_009596642.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     287   4e-88    
gb|AAD47085.1|AF167487_1  phenylalanine ammonia lyase                   278   4e-88    
ref|XP_010032174.1|  PREDICTED: phenylalanine ammonia-lyase-like        287   5e-88    
ref|XP_004143259.1|  PREDICTED: phenylalanine ammonia-lyase-like        286   6e-88    
ref|XP_004307376.1|  PREDICTED: phenylalanine ammonia-lyase 1           286   6e-88    
ref|XP_006407581.1|  hypothetical protein EUTSA_v10020168mg             286   8e-88    
gb|ACX31148.1|  phenylalanine ammonialyase                              284   1e-87    
ref|XP_006407580.1|  hypothetical protein EUTSA_v10020168mg             286   1e-87    
emb|CDY00922.1|  BnaC05g42780D                                          286   1e-87    
ref|XP_010067317.1|  PREDICTED: phenylalanine ammonia-lyase-like        286   1e-87    
gb|AGZ95690.1|  phenylalanine ammonia-lyase                             285   2e-87    
gb|AAS48415.1|  phenylalanine lyase                                     285   3e-87    
gb|ACZ44834.1|  phenylalanine ammonia-lyase                             285   3e-87    
dbj|BAL49995.1|  phenylalanine ammonia-lyase                            285   4e-87    
gb|ADT63058.1|  phenylalanine ammonia-lyase                             284   5e-87    
ref|XP_010482945.1|  PREDICTED: phenylalanine ammonia-lyase 4-like      283   8e-87    
gb|AAK60274.1|AF383151_1  phenylalanine ammonia-lyase 1                 283   8e-87    
ref|XP_009421282.1|  PREDICTED: phenylalanine ammonia-lyase-like        283   1e-86    
emb|CAA68064.1|  phenylalanine ammonia-lyase                            272   2e-86    
gb|ACT22906.1|  phenylalanine ammonia-lyase                             279   3e-86    
gb|ACT53398.1|  phenylalanine ammonia-lyase 1                           282   3e-86    
ref|NP_187645.1|  phenylalanine ammonia-lyase 4                         281   6e-86    
dbj|BAF93189.1|  putative phenylalanine ammonia-lyase                   275   1e-85    
ref|XP_006297083.1|  hypothetical protein CARUB_v10013086mg             280   1e-85    
gb|KFK38414.1|  hypothetical protein AALP_AA3G110100                    280   1e-85    
dbj|BAC10907.1|  phenylalanine ammonia-lyase 1                          270   1e-85    
ref|XP_010464706.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    280   2e-85    
gb|KFK38413.1|  hypothetical protein AALP_AA3G110100                    280   2e-85    
ref|XP_010543544.1|  PREDICTED: phenylalanine ammonia-lyase 4           280   2e-85    
gb|AER58180.1|  phenylalanine ammonia lyase                             280   2e-85    
gb|AFU82540.1|  phenylalanine ammonia-lyase                             262   4e-85    
gb|ADO24189.1|  phenylalanine ammonia-lyase                             279   5e-85    
dbj|BAJ85028.1|  predicted protein                                      276   8e-85    
ref|XP_010067315.1|  PREDICTED: phenylalanine ammonia-lyase             278   1e-84    
ref|XP_003580144.1|  PREDICTED: phenylalanine ammonia-lyase             278   1e-84    
gb|AII00960.1|  phenylalanine ammonia lyase                             268   2e-84    
ref|XP_004149916.1|  PREDICTED: phenylalanine ammonia-lyase-like        276   3e-84    
dbj|BAM28968.1|  phenylalanine ammonia lyase                            276   4e-84    



>gb|AHJ60264.1| phenylalanine ammonia-lyase 1 [Ipomoea purpurea]
Length=707

 Score =   390 bits (1003),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 184/186 (99%), Positives = 185/186 (99%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCS NYPLM
Sbjct  522  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSENYPLM  581

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN
Sbjct  582  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  641

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLYKFIREELGTE+LTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG
Sbjct  642  RITECRSYPLYKFIREELGTEMLTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  701

Query  195  APLPIC  178
            APLPIC
Sbjct  702  APLPIC  707



>sp|Q42858.1|PAL2_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 dbj|BAA11459.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=708

 Score =   379 bits (974),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 176/186 (95%), Positives = 185/186 (99%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+NAV+NTV+QVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPL 
Sbjct  523  NLKNAVRNTVNQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLF  582

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKA+LPKEVEGARSA+ENGNPAIPN
Sbjct  583  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKAVLPKEVEGARSAIENGNPAIPN  642

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLYKF+REELGTE+LTGEKV+SPGEVCDKVFTAVCDGGIIDPLLECLKSW+G
Sbjct  643  RITECRSYPLYKFVREELGTEMLTGEKVKSPGEVCDKVFTAVCDGGIIDPLLECLKSWDG  702

Query  195  APLPIC  178
            APLPIC
Sbjct  703  APLPIC  708



>ref|XP_009629066.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
 sp|P25872.1|PAL1_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 gb|AAA34122.1| phenylalanine ammonia lyase [Nicotiana tabacum]
 dbj|BAA22948.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=715

 Score =   351 bits (900),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+NAVKNTVSQVAKRTLTMG NGELHP+RFCEK+LLR+VDREY+FAYADDPCS NYPLM
Sbjct  530  NLKNAVKNTVSQVAKRTLTMGANGELHPARFCEKELLRIVDREYLFAYADDPCSCNYPLM  589

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHA+ NGE EKNV++SIFQKI AFEDELKA+LPKEVE AR+ALE+GNPAIPN
Sbjct  590  QKLRQVLVDHAMNNGESEKNVNSSIFQKIGAFEDELKAVLPKEVESARAALESGNPAIPN  649

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLY+F+R+ELGTE+LTGEKV+SPGE CDKVFTA+C+G IIDP+LECLKSWNG
Sbjct  650  RITECRSYPLYRFVRKELGTELLTGEKVRSPGEECDKVFTAMCNGQIIDPMLECLKSWNG  709

Query  195  APLPIC  178
            APLPIC
Sbjct  710  APLPIC  715



>dbj|BAF98438.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   335 bits (858),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQVAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLM
Sbjct  82   NLKSTVKNTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLM  141

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLR+ LV+HAL NG+ E+N+STSIFQKIAAFEDELKALLPKEVE AR+ALE+GNPAIPN
Sbjct  142  QKLRETLVEHALNNGDKERNLSTSIFQKIAAFEDELKALLPKEVESARAALESGNPAIPN  201

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGTE LTGEKV+SPGE  DKVFTA+  G IIDPLLECL+SWNG
Sbjct  202  RIKECRSYPLYKFVREELGTEYLTGEKVRSPGEEFDKVFTAMSRGEIIDPLLECLESWNG  261

Query  195  APLPIC  178
            APLPIC
Sbjct  262  APLPIC  267



>gb|AAG49585.1|AF325496_1 phenylalanine ammonia-lyase [Ipomoea nil]
Length=711

 Score =   348 bits (893),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRNAVKN V+QVAKRTLTMG NGELHP+RFCEKDLLRVVDREYVFAYADDPCSANYPLM
Sbjct  526  NLRNAVKNAVTQVAKRTLTMGANGELHPARFCEKDLLRVVDREYVFAYADDPCSANYPLM  585

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQ LVDHALQNGE EKN  TSIF K+AAFEDELKA+LPKEVE AR A+E+GNPAIPN
Sbjct  586  QKLRQALVDHALQNGESEKNTGTSIFLKVAAFEDELKAVLPKEVEAARIAVESGNPAIPN  645

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+RE LGTE+LTGEKV+SPGE CDKVFTA+C+G IIDPLLECLKSW+G
Sbjct  646  RIKECRSYPLYKFVREGLGTELLTGEKVRSPGEECDKVFTAMCEGSIIDPLLECLKSWDG  705

Query  195  APLPIC  178
            APLPIC
Sbjct  706  APLPIC  711



>dbj|BAF98437.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   333 bits (855),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQVAK+ LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLM
Sbjct  82   NLKSTVKNTVSQVAKKVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLM  141

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL+NGE EKN+STSIFQKIAAFEDELK LLPKEVE AR+ LE+GNPA+PN
Sbjct  142  QKLRQVLVEHALKNGETEKNLSTSIFQKIAAFEDELKTLLPKEVESARAVLESGNPAVPN  201

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKFIREELGT  LTGEKV SPGE  DKVFTA+C G IIDPL+ECL+SWNG
Sbjct  202  RIKECRSYPLYKFIREELGTVYLTGEKVTSPGEEFDKVFTAMCKGQIIDPLMECLQSWNG  261

Query  195  APLPI  181
            APLPI
Sbjct  262  APLPI  266



>gb|ABG75911.1| phenylalanine ammonia-lyase 2 [Nicotiana attenuata]
Length=717

 Score =   348 bits (892),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+NAVKNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREY+FAYADDPCS NYPLM
Sbjct  532  NLKNAVKNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYLFAYADDPCSCNYPLM  591

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHA++NGE EKNV++SIFQKI AFEDELKA+LPKEVE AR+ALE+GNPAI N
Sbjct  592  QKLRQVLVDHAMKNGESEKNVNSSIFQKIGAFEDELKAVLPKEVENARAALESGNPAIAN  651

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLY+F+R+ELGTE+LTGE+V+SPGE CDKVFTA+C+G IIDP+LECLKSWNG
Sbjct  652  RITECRSYPLYRFVRKELGTELLTGERVRSPGEECDKVFTAMCNGQIIDPMLECLKSWNG  711

Query  195  APLPIC  178
            APLPIC
Sbjct  712  APLPIC  717



>sp|P14166.1|PAL1_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 gb|AAA33389.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=707

 Score =   347 bits (889),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRNAVKN V+QVAKRTLT+G NGELHP+RFCEKDLLRVVDREYVFAYADDPCSANYPLM
Sbjct  522  NLRNAVKNAVTQVAKRTLTVGANGELHPARFCEKDLLRVVDREYVFAYADDPCSANYPLM  581

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQ LVDHALQNGE+EKN  TSIF K+AAFEDELKA+LPKEVE AR A+E+GNPAIPN
Sbjct  582  QKLRQALVDHALQNGENEKNTGTSIFLKVAAFEDELKAVLPKEVEAARIAVESGNPAIPN  641

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+RE LGTE+LTGEKV+SPGE CDKVFTA+C+G IIDPLLECLKSW+G
Sbjct  642  RIKECRSYPLYKFVREGLGTELLTGEKVRSPGEECDKVFTAMCEGSIIDPLLECLKSWDG  701

Query  195  APLPIC  178
            APLPIC
Sbjct  702  APLPIC  707



>gb|ABG75910.1| phenylalanine ammonia-lyase 1 [Nicotiana attenuata]
Length=712

 Score =   346 bits (887),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRNAVKNTVSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAYADD CSANYPLM
Sbjct  527  NLRNAVKNTVSQVAKRTLTMGANGELHPSRFCEKDLLRVVDREYVFAYADDACSANYPLM  586

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHALQNGE+EKN ++SIFQKI AFEDELKA+LPKEVE AR ALE+GNPAI N
Sbjct  587  QKLRQVLVDHALQNGENEKNANSSIFQKILAFEDELKAVLPKEVESARIALESGNPAIAN  646

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLY+F+REELG E+LTGEKV+SPGE CDKVFTA+C+G IID LLECLK WNG
Sbjct  647  RIKECRSYPLYRFVREELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNG  706

Query  195  APLPIC  178
            APLPIC
Sbjct  707  APLPIC  712



>gb|AIB08913.1| phenylalanine ammonia-lyase, partial [Angelica sinensis]
Length=233

 Score =   330 bits (845),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQVAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLM
Sbjct  49   NLKSTVKNTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLM  108

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLR+ LV+HAL NG+ E+N+STSIFQKIAAFEDELK LLPKEVE AR+ALE+GNPAIPN
Sbjct  109  QKLRETLVEHALNNGDKERNLSTSIFQKIAAFEDELKTLLPKEVESARAALESGNPAIPN  168

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGTE LTGEKV+SPGE  DKVFTA+  G IIDPLLECL+SWNG
Sbjct  169  RIKECRSYPLYKFVREELGTEYLTGEKVRSPGEEFDKVFTAMSKGEIIDPLLECLESWNG  228

Query  195  APLPI  181
            APLPI
Sbjct  229  APLPI  233



>gb|AAC33966.1| phenylalanine ammonia-lyase [Capsicum chinense]
Length=532

 Score =   340 bits (871),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+NAVKNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREY+FAYADDPCS+ YPLM
Sbjct  347  NLKNAVKNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYLFAYADDPCSSTYPLM  406

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE EKNV++SIFQKIAAFEDELKA+LPKEVE AR  LE+GNP+IPN
Sbjct  407  QKLRQVLVDHALNNGESEKNVNSSIFQKIAAFEDELKAVLPKEVESARITLESGNPSIPN  466

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLY+ +R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G +IDPLLECLKSWNG
Sbjct  467  RITECRSYPLYRLVRKELGTELLTGERVRSPGEEIDKVFTAMCNGQVIDPLLECLKSWNG  526

Query  195  APLPIC  178
            APLPIC
Sbjct  527  APLPIC  532



>sp|P35512.1|PALY_MALDO RecName: Full=Phenylalanine ammonia-lyase, partial [Malus domestica]
 emb|CAA48231.1| phenylalanine ammonia-lyase [Malus sp.]
Length=235

 Score =   329 bits (844),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLM
Sbjct  50   NLRNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLM  109

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLR+VL++HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E GN A+PN
Sbjct  110  QKLREVLIEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIEGGNAAVPN  169

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNG
Sbjct  170  RIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNG  229

Query  195  APLPIC  178
            APLPIC
Sbjct  230  APLPIC  235



>sp|P35513.2|PAL2_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22947.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22963.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   345 bits (884),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRNAVKNTVSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAYADD CSANYPLM
Sbjct  527  NLRNAVKNTVSQVAKRTLTMGTNGELHPSRFCEKDLLRVVDREYVFAYADDACSANYPLM  586

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHALQNGE+EKN ++SIFQKI AFEDELKA+LPKEVE AR+ALE+GNPAI N
Sbjct  587  QKLRQVLVDHALQNGENEKNANSSIFQKILAFEDELKAVLPKEVESARAALESGNPAIAN  646

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLY+F+R ELG E+LTGEKV+SPGE CDKVFTA+C+G IID LLECLK WNG
Sbjct  647  RIKECRSYPLYRFVRGELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNG  706

Query  195  APLPIC  178
            APLPIC
Sbjct  707  APLPIC  712



>ref|XP_009625397.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
Length=712

 Score =   345 bits (884),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRNAVKNTVSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAYADD CSANYPLM
Sbjct  527  NLRNAVKNTVSQVAKRTLTMGTNGELHPSRFCEKDLLRVVDREYVFAYADDACSANYPLM  586

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHALQNGE+EKN ++SIFQKI AFEDELKA+LPKEVE AR+ALE+GNPAI N
Sbjct  587  QKLRQVLVDHALQNGENEKNANSSIFQKILAFEDELKAVLPKEVESARAALESGNPAIAN  646

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLY+F+R ELG E+LTGEKV+SPGE CDKVFTA+C+G IID LLECLK WNG
Sbjct  647  RIKECRSYPLYRFVRGELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNG  706

Query  195  APLPIC  178
            APLPIC
Sbjct  707  APLPIC  712



>gb|AGT63063.1| phenylalanine ammonia-lyase [Solanum tuberosum]
Length=722

 Score =   345 bits (884),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRNAVKNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREYVFAYADDPCS+ YPLM
Sbjct  537  NLRNAVKNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYVFAYADDPCSSTYPLM  596

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHA+ NGE EKNV++SIFQKI AFEDELKA+LPKEVE AR+ LE+GNP+IPN
Sbjct  597  QKLRQVLVDHAMNNGESEKNVNSSIFQKIVAFEDELKAMLPKEVESARAVLESGNPSIPN  656

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLYK +R+ELG+E+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECL+SWNG
Sbjct  657  RITECRSYPLYKLVRQELGSELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLQSWNG  716

Query  195  APLPIC  178
            APLPIC
Sbjct  717  APLPIC  722



>gb|AET41698.1| phenylalanine ammonia-lyase [Prunus salicina]
Length=317

 Score =   331 bits (849),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLM
Sbjct  132  NLRNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLM  191

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE+EKN STSIFQKI AFE+ELK LLPKEV+ AR+AL++G+  +PN
Sbjct  192  QKLRQVLVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPN  251

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLYKF+REELG E LTGEKV+SPGE CDKVF+A+C+G IIDP+LECL+ WNG
Sbjct  252  RITECRSYPLYKFVREELGAEYLTGEKVRSPGEECDKVFSAICEGKIIDPILECLEGWNG  311

Query  195  APLPIC  178
            APLPIC
Sbjct  312  APLPIC  317



>dbj|BAF98439.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   329 bits (843),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQVAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLM
Sbjct  82   NLKSTVKNTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLM  141

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQ LV+HAL NG++E+N+STSIFQKIA FEDELKALLPKEVE AR+ALE+GNPAIPN
Sbjct  142  QKLRQTLVEHALTNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPN  201

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REEL T+ LTGEKV+SPGE  DKVFTA+  G IIDPLL CL+SWNG
Sbjct  202  RIEECRSYPLYKFVREELATDYLTGEKVRSPGEEFDKVFTAMSKGEIIDPLLACLESWNG  261

Query  195  APLPIC  178
            APLPIC
Sbjct  262  APLPIC  267



>ref|XP_009766905.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
 gb|ACJ66297.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
 gb|ACJ66298.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
Length=717

 Score =   343 bits (881),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+NAVKNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREY+FAYADDPCS NYPLM
Sbjct  532  NLKNAVKNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYLFAYADDPCSCNYPLM  591

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHA+ NGE EKNV++SIFQKI AFEDELKA+LPKEVE AR+ALE GNPAI N
Sbjct  592  QKLRQVLVDHAMNNGESEKNVNSSIFQKIGAFEDELKAVLPKEVESARAALECGNPAIAN  651

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLY+F+R+ELGTE+LTGE+V+SPGE C+KVFTA+C+G IIDP+LECLKSWNG
Sbjct  652  RITECRSYPLYRFVRKELGTELLTGERVRSPGEECEKVFTAMCNGQIIDPMLECLKSWNG  711

Query  195  APLPIC  178
            APLPIC
Sbjct  712  APLPIC  717



>ref|XP_004246650.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum lycopersicum]
Length=721

 Score =   343 bits (879),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR+AVKNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREYVFAYADDPCS+ YPLM
Sbjct  536  NLRSAVKNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYVFAYADDPCSSTYPLM  595

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHA++NGE EKNV++SIFQKI AFEDELKA+LPKEVE AR+ +E+GNPAIPN
Sbjct  596  QKLRQVLVDHAMKNGESEKNVNSSIFQKIVAFEDELKAVLPKEVESARAVVESGNPAIPN  655

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLY+ +R+ELG+E+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNG
Sbjct  656  RITECRSYPLYRLVRQELGSELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNG  715

Query  195  APLPIC  178
            APLPIC
Sbjct  716  APLPIC  721



>ref|XP_009781653.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
Length=712

 Score =   342 bits (878),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRNAVKNTVSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAYADD CSANYPLM
Sbjct  527  NLRNAVKNTVSQVAKRTLTMGANGELHPSRFCEKDLLRVVDREYVFAYADDACSANYPLM  586

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL+NGE+EKN ++SIFQKI AFE ELKA+LPKEVE AR +LENGNPAI N
Sbjct  587  QKLRQVLVDHALENGENEKNANSSIFQKILAFEGELKAVLPKEVESARISLENGNPAIAN  646

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLY+F+REELG E+LTGEKV+SPGE CDKVFTA+C+G IID LLECLK WNG
Sbjct  647  RIKECRSYPLYRFVREELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNG  706

Query  195  APLPIC  178
            APLPIC
Sbjct  707  APLPIC  712



>ref|XP_004249558.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=711

 Score =   342 bits (876),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRNAVKNTV QVAKRTLTMG NGELHPSRFCEKDLLR+VDREY+FAYADDPCSANYPLM
Sbjct  526  NLRNAVKNTVCQVAKRTLTMGANGELHPSRFCEKDLLRIVDREYLFAYADDPCSANYPLM  585

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HALQNGE+EKN S+SIFQKI AFE+ELK++LP+EVE AR ALE+GNPAI N
Sbjct  586  QKLRQVLVEHALQNGENEKNASSSIFQKIVAFEEELKSVLPREVESARVALESGNPAIAN  645

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGTE+LTGE+V+SPGE CDKVFTA+C+G IID LLECLK WNG
Sbjct  646  RINECRSYPLYKFVREELGTELLTGERVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNG  705

Query  195  APLPIC  178
            APLP+C
Sbjct  706  APLPVC  711



>ref|XP_004246649.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
lycopersicum]
Length=721

 Score =   342 bits (877),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR+AVKNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREYVFAYADDPCS+ YPLM
Sbjct  536  NLRSAVKNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYVFAYADDPCSSTYPLM  595

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHA++NGE EKNV++SIFQKI AFEDELKA LPKEVE AR+ +E+GNPAIPN
Sbjct  596  QKLRQVLVDHAMKNGESEKNVNSSIFQKIVAFEDELKAALPKEVESARAVVESGNPAIPN  655

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLY+ +R+ELG+E+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNG
Sbjct  656  RITECRSYPLYRLVRQELGSELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNG  715

Query  195  APLPIC  178
            APLPIC
Sbjct  716  APLPIC  721



>gb|ACF17667.1| putative phenylalanine ammonia-lyase [Capsicum annuum]
Length=717

 Score =   342 bits (876),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+NAVKNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREY+FAYADDPCS+ YPLM
Sbjct  532  NLKNAVKNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYLFAYADDPCSSTYPLM  591

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE EKNV++SIFQKIAAFEDELKA+LPKEVE AR  LE+GNP+IPN
Sbjct  592  QKLRQVLVDHALNNGESEKNVNSSIFQKIAAFEDELKAVLPKEVESARITLESGNPSIPN  651

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLY+ +R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G IIDPLLECLKSWNG
Sbjct  652  RITECRSYPLYRLVRKELGTELLTGERVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNG  711

Query  195  APLPIC  178
            APLPIC
Sbjct  712  APLPIC  717



>emb|CDP06747.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   337 bits (864),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+NAVKN VSQVAKRTLTMG NGELHPSRFC+KDLLRVVDREY FAY DDPCSA YPLM
Sbjct  372  NLKNAVKNIVSQVAKRTLTMGANGELHPSRFCDKDLLRVVDREYAFAYVDDPCSATYPLM  431

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL+NG+ EKNV+TSIFQKIAAFEDELKA+LPKEVE ARSA+E+GNPAIPN
Sbjct  432  QKLRQVLVDHALKNGDQEKNVNTSIFQKIAAFEDELKAVLPKEVESARSAVESGNPAIPN  491

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+RE LGTE+L+GEK QSPGEV D+VFTA+  G I+DPLLECL+ WNG
Sbjct  492  RIRECRSYPLYKFVREVLGTELLSGEKAQSPGEVFDQVFTAMSKGQIVDPLLECLQEWNG  551

Query  195  APLPIC  178
            APLPIC
Sbjct  552  APLPIC  557



>gb|ACR56688.1| phenylalanine ammonia-lyase [Scutellaria viscidula]
Length=711

 Score =   340 bits (871),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR AVKNTVSQ+AKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAY DDPCSANYPLM
Sbjct  526  NLRLAVKNTVSQLAKRTLTMGANGELHPSRFCEKDLLRVVDREYVFAYIDDPCSANYPLM  585

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL+NGE+EKN STSIFQKI AFE+ELKALLPKEVE AR ALE GNPA+PN
Sbjct  586  QKLRQVLVDHALKNGENEKNASTSIFQKIEAFEEELKALLPKEVESARMALEAGNPAVPN  645

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLYKFIREE GTE LTGEKV SPGE CDKVFTA+ +G IID LL CL++WNG
Sbjct  646  RITECRSYPLYKFIREEAGTEFLTGEKVTSPGEECDKVFTALTNGFIIDSLLTCLEAWNG  705

Query  195  APLPIC  178
            APLPIC
Sbjct  706  APLPIC  711



>sp|P45733.1|PAL3_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 emb|CAA55075.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   340 bits (871),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRNAVKNTVSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREYVF YADD CSANYPLM
Sbjct  527  NLRNAVKNTVSQVAKRTLTMGANGELHPSRFCEKDLLRVVDREYVFRYADDACSANYPLM  586

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL+NGE+EKN ++SIFQKI AFE ELKA+LPKEVE AR +LENGNPAI N
Sbjct  587  QKLRQVLVDHALENGENEKNANSSIFQKILAFEGELKAVLPKEVESARISLENGNPAIAN  646

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLY+F+REELG E+LTGEKV+SPGE CDKVFTA+C+G IID LLECLK WNG
Sbjct  647  RIKECRSYPLYRFVREELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNG  706

Query  195  APLPIC  178
            APLPIC
Sbjct  707  APLPIC  712



>gb|AFC37247.1| phenylalanine ammonia-lyase [Camellia chekiangoleosa]
Length=308

 Score =   327 bits (838),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKN+VSQVAKRTLTMGVNGELHPSRFCEK+LLRVVDRE+VF Y DDPCSA YPLM
Sbjct  123  NLRNTVKNSVSQVAKRTLTMGVNGELHPSRFCEKELLRVVDREHVFEYIDDPCSATYPLM  182

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL+NG+ EKNVSTSIFQKI AFE+EL ALLPKEVE AR A+E+GNP IPN
Sbjct  183  QKLRQVLVEHALKNGDAEKNVSTSIFQKIRAFEEELMALLPKEVESARRAVESGNPGIPN  242

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT  LTGEK  SPGE  DKVFTA+C+G +IDPLL+CLKSWNG
Sbjct  243  RIKECRSYPLYKFVREELGTGFLTGEKALSPGEEFDKVFTAMCEGQVIDPLLDCLKSWNG  302

Query  195  APLPIC  178
            APLPIC
Sbjct  303  APLPIC  308



>gb|AEO92028.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
 gb|AEO94540.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
Length=711

 Score =   339 bits (869),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+NAVKN VSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREY FAY DDPCSA YPLM
Sbjct  526  NLKNAVKNIVSQVAKRTLTMGANGELHPSRFCEKDLLRVVDREYAFAYVDDPCSATYPLM  585

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL+NG+ EKNV+TSIFQKIAAFEDELKA+LPKEVE ARSA+E+GNPAIPN
Sbjct  586  QKLRQVLVDHALKNGDQEKNVNTSIFQKIAAFEDELKAVLPKEVESARSAVESGNPAIPN  645

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+RE LGTE+L+GEK QSPGEV D+VFTA+  G I+DPLLECL+ WNG
Sbjct  646  RIRECRSYPLYKFVREVLGTELLSGEKAQSPGEVFDQVFTAMSKGQIVDPLLECLQEWNG  705

Query  195  APLPIC  178
            APLPIC
Sbjct  706  APLPIC  711



>gb|AIA66448.1| PAL1 [Capsicum annuum]
Length=717

 Score =   338 bits (868),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+NAVKNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREY+FAYADD CS+ YPLM
Sbjct  532  NLKNAVKNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYLFAYADDTCSSTYPLM  591

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE EKNV++SIFQKIAAFEDELKA+LPKEVE AR  LE+GNP+IPN
Sbjct  592  QKLRQVLVDHALNNGESEKNVNSSIFQKIAAFEDELKAVLPKEVESARITLESGNPSIPN  651

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLY+ +R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G IIDPLLECLKSWNG
Sbjct  652  RITECRSYPLYRLVRKELGTELLTGERVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNG  711

Query  195  APLPIC  178
            APLPIC
Sbjct  712  APLPIC  717



>gb|AEL21617.1| phenylalanine ammonia lyase 2 [Coffea arabica]
Length=711

 Score =   338 bits (866),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+NAVKN VSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREY FAY DDPCSA YPLM
Sbjct  526  NLKNAVKNIVSQVAKRTLTMGANGELHPSRFCEKDLLRVVDREYAFAYVDDPCSATYPLM  585

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL+NG+ EKNV+TSIFQKIAAFEDELKA+LPKEVE ARSA+E+GNPAIPN
Sbjct  586  QKLRQVLVDHALKNGDQEKNVNTSIFQKIAAFEDELKAVLPKEVESARSAVESGNPAIPN  645

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+RE LGT +LTGEK QSPGEV D+VFTA+  G I+DPLLECL+ WNG
Sbjct  646  RIRECRSYPLYKFVREVLGTGLLTGEKAQSPGEVFDQVFTAMSKGQIVDPLLECLQEWNG  705

Query  195  APLPIC  178
            APLPIC
Sbjct  706  APLPIC  711



>dbj|BAA95629.1| phenylalanine ammonia lyase [Catharanthus roseus]
Length=716

 Score =   338 bits (866),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+NAVKNTVSQVAKRTLT+GVNGELHPSRFCEKDL+RVVDREYVFAY DDPCS  YPLM
Sbjct  531  NLKNAVKNTVSQVAKRTLTVGVNGELHPSRFCEKDLIRVVDREYVFAYVDDPCSGTYPLM  590

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            +KLRQV+VDHALQNGE EKNV+TSIFQKIAAFEDELK +LPKEVE AR+ALENGNPAIPN
Sbjct  591  EKLRQVIVDHALQNGESEKNVNTSIFQKIAAFEDELKTVLPKEVESARTALENGNPAIPN  650

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+RE++G E LTGEK +SPGE  DKVFTA+C+  IIDPLLECLK WNG
Sbjct  651  RIKECRSYPLYKFVREDVGAEFLTGEKDRSPGEEFDKVFTAMCNEKIIDPLLECLKEWNG  710

Query  195  APLPIC  178
            APLPIC
Sbjct  711  APLPIC  716



>emb|CDP20698.1| unnamed protein product [Coffea canephora]
Length=674

 Score =   337 bits (863),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+NAVKN VSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREY FAY DDPCSA YPLM
Sbjct  489  NLKNAVKNIVSQVAKRTLTMGANGELHPSRFCEKDLLRVVDREYAFAYVDDPCSATYPLM  548

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL+NG+ EKNV+TSIFQKIAAFEDELKA+LPKEVE ARSA+ENGNPAIPN
Sbjct  549  QKLRQVLVDHALKNGDQEKNVNTSIFQKIAAFEDELKAVLPKEVESARSAVENGNPAIPN  608

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI +CRSYPLYKF+RE LGT +LTGEK QSPGEV D+VFTA+  G I+DPLLECL+ WNG
Sbjct  609  RIRKCRSYPLYKFVREVLGTGLLTGEKAQSPGEVFDQVFTAMNKGQIVDPLLECLQEWNG  668

Query  195  APLPIC  178
            APLPIC
Sbjct  669  APLPIC  674



>gb|AEY94464.1| phenylalanine ammonia-lyase, partial [Prunella vulgaris]
Length=349

 Score =   326 bits (836),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+ AVKNTVSQVAKRTLTMG NGELHPSRFCEK+L+RVVDREYVFAYADDPCSA YPLM
Sbjct  164  NLKLAVKNTVSQVAKRTLTMGANGELHPSRFCEKELIRVVDREYVFAYADDPCSATYPLM  223

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL+NG+ EKNVSTSIF KI AFE+ELKALLPKEVE AR ALE+G PA+ N
Sbjct  224  QKLRQVLVDHALKNGDGEKNVSTSIFHKIEAFEEELKALLPKEVESARIALESGAPAVAN  283

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKFIRE LGT  LTGEK  SPGE CDKVFTA+CDG I+DPLLECL+ WNG
Sbjct  284  RIAECRSYPLYKFIREGLGTGFLTGEKAVSPGEECDKVFTALCDGLIVDPLLECLQGWNG  343

Query  195  APLPIC  178
             PLPIC
Sbjct  344  EPLPIC  349



>ref|XP_011094662.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=711

 Score =   337 bits (865),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR AVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAY DDPCSA YPLM
Sbjct  526  NLRLAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYIDDPCSATYPLM  585

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL+NG+ EK++STSIFQKI AFEDELKALLPKEVE AR ALE+GNPAI N
Sbjct  586  QKLRQVLVDHALKNGDGEKSLSTSIFQKIEAFEDELKALLPKEVESARIALESGNPAIAN  645

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLYKFIREELGT  LTGEKV SPGE CDKVFTA+  G I+DPLL+CL  WNG
Sbjct  646  RITECRSYPLYKFIREELGTNFLTGEKVTSPGEECDKVFTALSKGLIVDPLLKCLDGWNG  705

Query  195  APLPIC  178
            APLPIC
Sbjct  706  APLPIC  711



>gb|ACF94717.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=311

 Score =   324 bits (831),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+++ KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLM
Sbjct  126  NLKSSAKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLM  185

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE+EKN++TSIFQKIA FE+ELKALLPKEVE AR+A E+GN AIPN
Sbjct  186  QKLRQVLVDHALVNGENEKNLNTSIFQKIATFEEELKALLPKEVESARAAYESGNAAIPN  245

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGEKV+SPGE  DK+FTA+C G IIDPLLECL  WNG
Sbjct  246  KINECRSYPLYKFVREELGTGLLTGEKVRSPGEEFDKLFTAMCQGKIIDPLLECLGEWNG  305

Query  195  APLPIC  178
            APLPIC
Sbjct  306  APLPIC  311



>ref|XP_006354338.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
tuberosum]
Length=723

 Score =   337 bits (864),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRNAVKNTVSQVAKRTLTMG NGELHP+RFC+K+LL+VVD+EY+FAY DDPC++NYPLM
Sbjct  538  NLRNAVKNTVSQVAKRTLTMGANGELHPARFCKKELLQVVDKEYLFAYVDDPCNSNYPLM  597

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHA+ NGE EKNV++SIFQKI AFEDELK +LPKEVE AR  +E+GNPAIPN
Sbjct  598  QKLRQVLVDHAMNNGESEKNVNSSIFQKIVAFEDELKVVLPKEVESARVVVESGNPAIPN  657

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLY+ +REELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNG
Sbjct  658  RITECRSYPLYRLVREELGTEVLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNG  717

Query  195  APLPIC  178
            APLPIC
Sbjct  718  APLPIC  723



>ref|XP_006354336.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
tuberosum]
Length=719

 Score =   337 bits (863),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRNAVKNTVSQVAKRTLTMG NGELHP+RFC+K+LL+VVD+EY+FAY DDPC++NYPLM
Sbjct  534  NLRNAVKNTVSQVAKRTLTMGANGELHPARFCKKELLQVVDKEYLFAYVDDPCNSNYPLM  593

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHA+ NGE EKNV++SIFQKI AFEDELK +LPKEVE AR  +E+GNPAIPN
Sbjct  594  QKLRQVLVDHAMNNGESEKNVNSSIFQKIVAFEDELKVVLPKEVESARVVVESGNPAIPN  653

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLY+ +REELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNG
Sbjct  654  RITECRSYPLYRLVREELGTEVLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNG  713

Query  195  APLPIC  178
            APLPIC
Sbjct  714  APLPIC  719



>ref|XP_008387584.1| PREDICTED: phenylalanine ammonia-lyase 1 [Malus domestica]
Length=720

 Score =   336 bits (861),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLM
Sbjct  535  NLRNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLM  594

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PN
Sbjct  595  QKLRQVLVEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPN  654

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNG
Sbjct  655  RIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNG  714

Query  195  APLPIC  178
            APLPIC
Sbjct  715  APLPIC  720



>ref|XP_003625662.1| Phenylalanine ammonia-lyase [Medicago truncatula]
Length=456

 Score =   328 bits (840),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N+VKNTVSQVAK+TLTMGVNGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPL 
Sbjct  271  NLKNSVKNTVSQVAKKTLTMGVNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLS  330

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE EKN++TSIFQKIA FE+ELK+LLPKEVE AR+A E+GNP IPN
Sbjct  331  QKLRQVLVDHALVNGESEKNLNTSIFQKIATFEEELKSLLPKEVESARTAYESGNPTIPN  390

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I  CRSYPLYKF+REELGT +LTGE V SPGEVCDK+FTA+C G IIDPLLECL  WNG
Sbjct  391  KINGCRSYPLYKFVREELGTGLLTGENVISPGEVCDKLFTAMCQGKIIDPLLECLGEWNG  450

Query  195  APLPIC  178
            APLPIC
Sbjct  451  APLPIC  456



>gb|AFG30054.1| phenylalanine ammonialyase [Malus hybrid cultivar]
Length=720

 Score =   335 bits (860),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLM
Sbjct  535  NLRNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLM  594

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PN
Sbjct  595  QKLRQVLVEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPN  654

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNG
Sbjct  655  RIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNG  714

Query  195  APLPIC  178
            APLPIC
Sbjct  715  APLPIC  720



>dbj|BAC56977.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   335 bits (859),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQVAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLM
Sbjct  530  NLKSTVKNTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLM  589

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLR+ LV+HAL NG+ E+N+STSIFQKIAAFEDELKALLPKEVE AR+A+E+GNPAIPN
Sbjct  590  QKLRETLVEHALNNGDKERNLSTSIFQKIAAFEDELKALLPKEVESARAAVESGNPAIPN  649

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGTE LTGEKV SPGE  DKVFTA+  G IIDPLLECL+SWNG
Sbjct  650  RIKECRSYPLYKFVREELGTEYLTGEKVTSPGEEFDKVFTAMTKGEIIDPLLECLQSWNG  709

Query  195  APLPIC  178
            APLPIC
Sbjct  710  APLPIC  715



>dbj|BAF36975.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=311

 Score =   322 bits (826),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+ +VK+TVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDRE +FAY DDPC A YPLM
Sbjct  126  NLKYSVKSTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDRETLFAYIDDPCLATYPLM  185

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE+EK+  TSIFQKIA FEDELK+LLPKEVE AR+A E+GNPA+PN
Sbjct  186  QKLRQVLVDHALVNGEYEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPAMPN  245

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+R+ELGTE+LTGEK +SPGE CDK+FTA+C G IIDPLLECL  WNG
Sbjct  246  KINECRSYPLYKFVRKELGTELLTGEKTRSPGEECDKLFTAICQGKIIDPLLECLGEWNG  305

Query  195  APLPIC  178
            APLPIC
Sbjct  306  APLPIC  311



>gb|AGF50184.1| phenylalanine ammonia lyase, partial [Salvia virgata]
Length=282

 Score =   321 bits (823),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++AVKNTVSQVAKR LTMG NGELHPSRFCEKDL+RVVDREYVF+Y DDPC A YPLM
Sbjct  97   NLKHAVKNTVSQVAKRALTMGANGELHPSRFCEKDLIRVVDREYVFSYVDDPCLATYPLM  156

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL+NGE EKN STSIFQKI  FE+ELKALLPKEVE AR ALE+G+PA+PN
Sbjct  157  QKLRQVLVEHALKNGEGEKNASTSIFQKIEQFEEELKALLPKEVEAARLALESGSPAVPN  216

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELG   LTGEK  SPGE CDKVFTA+C+G I+DPLL+CLK WNG
Sbjct  217  RIAECRSYPLYKFVREELGAGFLTGEKAVSPGEECDKVFTALCNGLIVDPLLDCLKGWNG  276

Query  195  APLPIC  178
             PLPIC
Sbjct  277  QPLPIC  282



>ref|XP_006367534.1| PREDICTED: phenylalanine ammonia-lyase 1-like, partial [Solanum 
tuberosum]
Length=441

 Score =   327 bits (837),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQVAKRTLT+G  GELHP+RFCEK+LLRVVDREY+F YADDPCS+ YPLM
Sbjct  256  NLKSVVKNTVSQVAKRTLTIGAIGELHPARFCEKELLRVVDREYLFTYADDPCSSTYPLM  315

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHA++NGE EKN+++SIFQKI AFEDEL A+LPKEVE AR+ LE+GNP+IPN
Sbjct  316  QKLRQVLVDHAMKNGESEKNINSSIFQKIGAFEDELNAVLPKEVESARALLESGNPSIPN  375

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLY+ +R+ELGTE+LTGEKV+SPGE  +KVFTA+C+G IIDPLLECLKSWNG
Sbjct  376  RITECRSYPLYRLVRQELGTELLTGEKVRSPGEEIEKVFTAMCNGQIIDPLLECLKSWNG  435

Query  195  APLPIC  178
            APLPIC
Sbjct  436  APLPIC  441



>sp|P45726.1|PALY_CAMSI RecName: Full=Phenylalanine ammonia-lyase [Camellia sinensis]
 dbj|BAA05643.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   334 bits (857),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VK+TVSQVAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLM
Sbjct  529  NLRNTVKSTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLM  588

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL+NGE EKN+STSIFQKI AFE+E+K LLPKEVE  R+A+ENGN AIPN
Sbjct  589  QKLRQVLVEHALKNGESEKNLSTSIFQKIRAFEEEIKTLLPKEVESTRAAIENGNSAIPN  648

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGTE+LTGEKV+SPGE  DKVFTA+C G +IDPL++CLK WNG
Sbjct  649  RIKECRSYPLYKFVREELGTELLTGEKVRSPGEEFDKVFTALCKGEMIDPLMDCLKEWNG  708

Query  195  APLPIC  178
            APLPIC
Sbjct  709  APLPIC  714



>dbj|BAG31930.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   334 bits (857),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            N+++ VKNTVSQVAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLM
Sbjct  530  NMKSTVKNTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLM  589

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLR+ LV+HAL NG+ E+N+STSIFQKIAAFEDELKALLPKEVE AR+A+E+GNPAIPN
Sbjct  590  QKLRETLVEHALNNGDKERNLSTSIFQKIAAFEDELKALLPKEVESARAAVESGNPAIPN  649

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGTE LTGEKV SPGE  DKVFTA+  G IIDPLLECL+SWNG
Sbjct  650  RIKECRSYPLYKFVREELGTEYLTGEKVTSPGEEFDKVFTAMTKGEIIDPLLECLQSWNG  709

Query  195  APLPIC  178
            APLPIC
Sbjct  710  APLPIC  715



>emb|CBJ23826.1| phenylalanine ammonia-lyase [Melissa officinalis]
Length=709

 Score =   334 bits (857),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++AVKNTVSQVAKRTLTMG NGELHPSRFCEKDL+RVVDREYVFAY DDPCSA YPLM
Sbjct  524  NLKHAVKNTVSQVAKRTLTMGANGELHPSRFCEKDLIRVVDREYVFAYIDDPCSATYPLM  583

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL+NGE EKN STSIFQKI AFE+ELK LLPKEVE AR+ALE+GNPAI N
Sbjct  584  QKLRQVLVEHALKNGEGEKNASTSIFQKIEAFEEELKTLLPKEVESARTALESGNPAIAN  643

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKFIREELG + LTGEKV SPGE CDKVFTA+ +G IIDPLLECL+ WNG
Sbjct  644  RIAECRSYPLYKFIREELGADFLTGEKVVSPGEECDKVFTALSNGLIIDPLLECLQGWNG  703

Query  195  APLPIC  178
            APLPIC
Sbjct  704  APLPIC  709



>gb|AFP24940.1| phenylalanine ammonia lyase [Prunus salicina]
Length=717

 Score =   334 bits (857),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLM
Sbjct  532  NLRNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLM  591

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE+EKN STSIFQKI AFE+ELK LLPKEV+ AR+AL++G+  +PN
Sbjct  592  QKLRQVLVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPN  651

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLYKF+REELG E LTGEKV+SPGE CDKVF+A+C+G IIDP+LECL+ WNG
Sbjct  652  RITECRSYPLYKFVREELGAEYLTGEKVRSPGEECDKVFSAICEGKIIDPILECLEGWNG  711

Query  195  APLPIC  178
            APLPIC
Sbjct  712  APLPIC  717



>gb|ADI40166.1| phenylalanine ammonia-lyase [Morus alba]
Length=726

 Score =   335 bits (858),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLM
Sbjct  541  NLRNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLM  600

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE+EKN STSIFQKI AFE+ELK LLPKEV+ AR+AL++G+  +PN
Sbjct  601  QKLRQVLVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPN  660

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLYKF+REELG E LTGEKV+SPGE CDKVFTA+C+G IIDP+L+CL+ WNG
Sbjct  661  RITECRSYPLYKFVREELGAEYLTGEKVRSPGEECDKVFTAICEGKIIDPILDCLEGWNG  720

Query  195  APLPIC  178
            APLPIC
Sbjct  721  APLPIC  726



>ref|XP_006364021.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   335 bits (858),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++AVKNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREY+FAYADDPCS+NYPLM
Sbjct  538  NLKSAVKNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYLFAYADDPCSSNYPLM  597

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVD A++NGE EKNV++SIFQKI AFEDEL A+LPKEVE  R+ +E+GNP+IPN
Sbjct  598  QKLRQVLVDQAMKNGESEKNVNSSIFQKIGAFEDELIAVLPKEVESVRAVVESGNPSIPN  657

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLY+ +R+ELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNG
Sbjct  658  RITECRSYPLYRLVRQELGTELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNG  717

Query  195  APLPIC  178
            APLPIC
Sbjct  718  APLPIC  723



>sp|O64963.1|PAL1_PRUAV RecName: Full=Phenylalanine ammonia-lyase 1 [Prunus avium]
 gb|AAC78457.1| phenylalanine ammonia-lyase [Prunus avium]
Length=717

 Score =   334 bits (857),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLM
Sbjct  532  NLRNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLM  591

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE+EKN STSIFQKI AFE+ELK LLPKEV+ AR+AL++G+  +PN
Sbjct  592  QKLRQVLVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPN  651

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLYKF+REELG E LTGEKV+SPGE CDKVFTA+C+G IIDP+L+CL+ WNG
Sbjct  652  RITECRSYPLYKFVREELGAEYLTGEKVRSPGEECDKVFTAICEGKIIDPILDCLEGWNG  711

Query  195  APLPIC  178
            APLPIC
Sbjct  712  APLPIC  717



>gb|AGF50183.1| phenylalanine ammonia lyase, partial [Salvia hypoleuca]
Length=282

 Score =   320 bits (821),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++AVKNTVSQVAKRTLTMG NGELHPSRFCEKDL+RVVDREYVF+Y DDPC A YPLM
Sbjct  97   NLKHAVKNTVSQVAKRTLTMGANGELHPSRFCEKDLIRVVDREYVFSYVDDPCLATYPLM  156

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL+NGE EKN STSIF KI  FE+ELKALLPKEVE AR ALE+G+PA+PN
Sbjct  157  QKLRQVLVEHALKNGEGEKNASTSIFHKIEQFEEELKALLPKEVEAARMALESGSPAVPN  216

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+RE+LG   LTGEK  SPGE CDKVFTA+C+G I+DPLL+CLK WNG
Sbjct  217  RIAECRSYPLYKFVREQLGAGFLTGEKAVSPGEECDKVFTALCNGLIVDPLLDCLKGWNG  276

Query  195  APLPIC  178
             PLPIC
Sbjct  277  QPLPIC  282



>sp|P45729.1|PAL3_PETCR RecName: Full=Phenylalanine ammonia-lyase 3 [Petroselinum crispum]
 emb|CAA57057.1| phenylalanine ammonia-lyase 3 [Petroselinum crispum]
Length=718

 Score =   334 bits (856),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQVAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLM
Sbjct  533  NLKSTVKNTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLM  592

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLR+ LV+HAL NG+ E+N+STSIFQKIAAFEDELKALLPKEVE AR+ALE+GNPAIPN
Sbjct  593  QKLRETLVEHALNNGDKERNLSTSIFQKIAAFEDELKALLPKEVETARAALESGNPAIPN  652

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGTE LTGEKV+SPGE  +KVFTA+  G IIDPLLECL+SWNG
Sbjct  653  RIKECRSYPLYKFVREELGTEYLTGEKVRSPGEEFEKVFTAMSKGEIIDPLLECLESWNG  712

Query  195  APLPIC  178
            APLPIC
Sbjct  713  APLPIC  718



>gb|AEZ01784.1| phenylalanine ammonia-lyase [Pyrus x bretschneideri]
Length=719

 Score =   334 bits (856),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLM
Sbjct  534  NLRNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLM  593

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLR+VLV+HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PN
Sbjct  594  QKLREVLVEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPN  653

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNG
Sbjct  654  RIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNG  713

Query  195  APLPIC  178
            APLPIC
Sbjct  714  APLPIC  719



>gb|ADF59061.1| phenylalanine ammonia-lyase 1 precursor [Pyrus x bretschneideri]
Length=719

 Score =   333 bits (855),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLM
Sbjct  534  NLRNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLM  593

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLR+VLV+HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PN
Sbjct  594  QKLREVLVEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPN  653

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNG
Sbjct  654  RIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNG  713

Query  195  APLPIC  178
            APLPIC
Sbjct  714  APLPIC  719



>ref|XP_008243955.1| PREDICTED: phenylalanine ammonia-lyase 1 [Prunus mume]
Length=717

 Score =   333 bits (855),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLM
Sbjct  532  NLRNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLM  591

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE+EKN STSIFQKI AFE+ELK LLPKEV+ AR+AL++G+  +PN
Sbjct  592  QKLRQVLVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPN  651

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLYKF+REELG E LTGEKV+SPGE CDKVF+A+C+G IIDP+L+CL+ WNG
Sbjct  652  RITECRSYPLYKFVREELGAEYLTGEKVRSPGEECDKVFSAICEGKIIDPILDCLEGWNG  711

Query  195  APLPIC  178
            APLPIC
Sbjct  712  APLPIC  717



>gb|AAU08174.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   333 bits (854),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VK+TVSQVAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLM
Sbjct  529  NLRNTVKSTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLM  588

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL+NGE EKN+STSIFQKI AFE+E+K LLPKEVE  R+A+ENGN AIPN
Sbjct  589  QKLRQVLVEHALKNGESEKNLSTSIFQKIRAFEEEIKTLLPKEVESTRAAIENGNSAIPN  648

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGTE+LTGEKV+SPGE  DKVFTA+C G +IDPL++CLK WNG
Sbjct  649  RIKECRSYPLYKFVREELGTELLTGEKVRSPGEEFDKVFTALCKGEMIDPLMDCLKEWNG  708

Query  195  APLPIC  178
            APLPIC
Sbjct  709  APLPIC  714



>ref|XP_009373523.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Pyrus x bretschneideri]
Length=719

 Score =   333 bits (855),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLM
Sbjct  534  NLRNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLM  593

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLR+VLV+HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PN
Sbjct  594  QKLREVLVEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPN  653

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNG
Sbjct  654  RIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNG  713

Query  195  APLPIC  178
            APLPIC
Sbjct  714  APLPIC  719



>ref|XP_009342990.1| PREDICTED: phenylalanine ammonia-lyase 1 [Pyrus x bretschneideri]
Length=720

 Score =   333 bits (853),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLM
Sbjct  535  NLRNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLM  594

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE EKN STSIFQKI AFE+ELK LLPKEVE ARSA+E+GN A+PN
Sbjct  595  QKLRQVLVEHALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPN  654

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELG E LTGEKV+SPGE CD+VF A+C G IIDP+L CL+ WNG
Sbjct  655  RIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILGCLEGWNG  714

Query  195  APLPIC  178
            APLPIC
Sbjct  715  APLPIC  720



>gb|AGL50914.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   333 bits (853),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLM
Sbjct  535  NLRNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLM  594

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE EKN STSIFQKI AFE+ELK LLPKEVE ARSA+E+GN A+PN
Sbjct  595  QKLRQVLVEHALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPN  654

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELG E LTGEKV+SPGE CD+VF A+C G IIDP+L CL+ WNG
Sbjct  655  RIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILGCLEGWNG  714

Query  195  APLPIC  178
            APLPIC
Sbjct  715  APLPIC  720



>gb|ADN32767.1| phenylalanine ammonia-lyase 1 [Scutellaria baicalensis]
Length=711

 Score =   333 bits (853),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR AVKNTVSQ+AKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAY DDPCSANYPLM
Sbjct  526  NLRLAVKNTVSQLAKRTLTMGANGELHPSRFCEKDLLRVVDREYVFAYIDDPCSANYPLM  585

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL+NGE+EKN STSI Q+I AFE+ELKALLPKEVE AR ALE GNPA+PN
Sbjct  586  QKLRQVLVDHALKNGENEKNASTSILQEIEAFEEELKALLPKEVESARMALEAGNPAVPN  645

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLYKFIR E GTE LTGEKV SPGE CDKVFTA+ +G IID LL CL++WNG
Sbjct  646  RITECRSYPLYKFIRGEAGTEFLTGEKVTSPGEECDKVFTALTNGFIIDQLLTCLEAWNG  705

Query  195  APLPIC  178
            APLPIC
Sbjct  706  APLPIC  711



>gb|AGL81344.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   333 bits (853),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLM
Sbjct  535  NLRNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLM  594

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE EKN STSIFQKI AFE+ELK LLPKEVE ARSA+E+GN A+PN
Sbjct  595  QKLRQVLVEHALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPN  654

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELG E LTGEKV+SPGE CD+VF A+C G IIDP+L CL+ WNG
Sbjct  655  RIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILGCLEGWNG  714

Query  195  APLPIC  178
            APLPIC
Sbjct  715  APLPIC  720



>ref|XP_006354339.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=722

 Score =   333 bits (853),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+NAVKNTVSQVAK+TLTMG NGELHP+RFCEK+LL+VV+REY+F YADDPCS  YPLM
Sbjct  537  NLKNAVKNTVSQVAKKTLTMGANGELHPARFCEKELLQVVEREYLFTYADDPCSCTYPLM  596

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHA++NGE E NV++SIFQKI AFEDELKA+LPKEVE AR  LE+GNP IPN
Sbjct  597  QKLRQVLVDHAMKNGESESNVNSSIFQKIVAFEDELKAVLPKEVESARVVLESGNPVIPN  656

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLY+F+R+ELGTE+LTGEK++SPGE  DKVFTA C+G IIDPLLECLKSWNG
Sbjct  657  RITECRSYPLYRFVRKELGTEVLTGEKIRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNG  716

Query  195  APLPIC  178
            APLPIC
Sbjct  717  APLPIC  722



>gb|ABB70117.2| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   332 bits (852),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLM
Sbjct  535  NLRNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLM  594

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE EKN STSIFQKI AFE+ELK LLPKEVE ARSA+E+GN A+PN
Sbjct  595  QKLRQVLVEHALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPN  654

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELG E LTGEKV+SPGE CD+VF A+C G IIDP+L CL+ WNG
Sbjct  655  RIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILGCLEGWNG  714

Query  195  APLPIC  178
            APLPIC
Sbjct  715  APLPIC  720



>ref|XP_008355619.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Malus domestica]
Length=720

 Score =   332 bits (852),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLM
Sbjct  535  NLRNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLM  594

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLR+VL +HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PN
Sbjct  595  QKLREVLXEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPN  654

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNG
Sbjct  655  RIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNG  714

Query  195  APLPIC  178
            APLPIC
Sbjct  715  APLPIC  720



>dbj|BAF36972.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=688

 Score =   331 bits (849),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+ +VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDRE VFAY DDPCSA YPLM
Sbjct  503  NLKYSVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDRETVFAYIDDPCSATYPLM  562

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL N E+EKN++TSIFQKIA FEDELK+LLPKEVE AR+A E+GNPAIPN
Sbjct  563  QKLRQVLVDHALVNEENEKNMNTSIFQKIATFEDELKSLLPKEVESARAAYESGNPAIPN  622

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+RE LGTE+LTGEKV+SPGE CDK+FTA+C+G IIDPLLECL  WNG
Sbjct  623  KINECRSYPLYKFVREGLGTELLTGEKVRSPGEECDKLFTAICEGKIIDPLLECLGEWNG  682

Query  195  APLPIC  178
            APLPIC
Sbjct  683  APLPIC  688



>gb|AEA72280.1| phenylalanine ammonia-lyase, partial [Angelica gigas]
Length=699

 Score =   332 bits (850),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++AVKNTVSQVAKR LT GVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLM
Sbjct  514  NLKSAVKNTVSQVAKRVLTTGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLM  573

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQ LV+HAL NG++E+N+STSIFQKIA FEDELKALLPKEVE AR+ALE+GNPAIPN
Sbjct  574  QKLRQTLVEHALTNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPN  633

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGTE LTGEK +SPGE  DKVFTA+  G IIDPLL CL+SWNG
Sbjct  634  RIEECRSYPLYKFVREELGTEYLTGEKARSPGEEFDKVFTAMSRGEIIDPLLACLESWNG  693

Query  195  APLPIC  178
            APLPIC
Sbjct  694  APLPIC  699



>ref|XP_008369679.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Malus domestica]
Length=720

 Score =   332 bits (851),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLM
Sbjct  535  NLRNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLM  594

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLR+VL +HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PN
Sbjct  595  QKLREVLXEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPN  654

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNG
Sbjct  655  RIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNG  714

Query  195  APLPIC  178
            APLPIC
Sbjct  715  APLPIC  720



>gb|AAK60273.1|AF383150_1 phenylalanine ammonia-lyase 3 [Manihot esculenta]
Length=315

 Score =   319 bits (818),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++AVKNTVSQVAKR LT G +GELHPSRFCEKDLL+VVDRE VF+Y DD CSA YPLM
Sbjct  130  NLKHAVKNTVSQVAKRILTTGASGELHPSRFCEKDLLKVVDREQVFSYVDDACSATYPLM  189

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE EKN STSIFQKI AFE+ELKALLPKEVE AR A ENGNPAI N
Sbjct  190  QKLRQVLVDHALANGESEKNASTSIFQKIRAFEEELKALLPKEVESAREAYENGNPAIAN  249

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REE+GT +LTGEKV+SPGE  DKVFTA+C G IIDP+L+CLK WNG
Sbjct  250  KIKECRSYPLYKFVREEIGTGLLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLDCLKEWNG  309

Query  195  APLPIC  178
            APLPIC
Sbjct  310  APLPIC  315



>emb|CAA34715.1| unnamed protein product [Petroselinum crispum]
Length=580

 Score =   328 bits (840),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVS VAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLM
Sbjct  395  NLKSTVKNTVSSVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLM  454

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQ LV+HAL+NG++E+N+STSIFQKIA FEDELKALLPKEVE AR+ALE+GNPAIPN
Sbjct  455  QKLRQTLVEHALKNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPN  514

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+R+ELGTE LTGEKV SPGE  +KVF A+  G IIDPLLECL+SWNG
Sbjct  515  RIEECRSYPLYKFVRKELGTEYLTGEKVTSPGEEFEKVFIAMSKGEIIDPLLECLESWNG  574

Query  195  APLPIC  178
            APLPIC
Sbjct  575  APLPIC  580



>ref|XP_004246651.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   332 bits (851),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+NAVKNTVSQVAK+TL MG NGELHP+RFCEK+LL+VV+REY+F YADDPCS+ YPLM
Sbjct  536  NLKNAVKNTVSQVAKKTLAMGANGELHPARFCEKELLQVVEREYLFTYADDPCSSTYPLM  595

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHA++NGE EKNV++SIFQKI AFEDELKA+LPKEVE AR+ +E+GNPAIPN
Sbjct  596  QKLRQVLVDHAMKNGESEKNVNSSIFQKIVAFEDELKAVLPKEVESARAVVESGNPAIPN  655

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLY+ +R+E+GTE+LTGEKV+SPGE  DKVFTA C+G IIDPLLECLKSWNG
Sbjct  656  RITECRSYPLYRLVRQEVGTELLTGEKVRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNG  715

Query  195  APLPIC  178
            AP+PIC
Sbjct  716  APIPIC  721



>ref|XP_011031723.1| PREDICTED: phenylalanine ammonia-lyase G4 [Populus euphratica]
Length=711

 Score =   332 bits (850),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDRE+VF Y DDPCSA YPLM
Sbjct  526  NLKNTVKNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREHVFTYIDDPCSATYPLM  585

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE E N STSIFQKI AFE+ELKALLPKEVE AR  LENGNPAIPN
Sbjct  586  QKLRQVLVDHALMNGEKEHNSSTSIFQKIGAFEEELKALLPKEVESARHELENGNPAIPN  645

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLYKF+REELGT +LTGEKV SPGE  DKVFTA+C G +IDP+LECLK WNG
Sbjct  646  RITECRSYPLYKFVREELGTILLTGEKVGSPGEEFDKVFTAICAGKLIDPMLECLKEWNG  705

Query  195  APLPIC  178
            APLP+C
Sbjct  706  APLPLC  711



>gb|ABV71917.1| PAL [Solenostemon scutellarioides]
Length=233

 Score =   316 bits (809),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+ AV+NTVSQVAKRTLTMG NGELHPSRFCEKDL+RVVDREYVFAY DDPCSA YPLM
Sbjct  50   NLKQAVRNTVSQVAKRTLTMGANGELHPSRFCEKDLIRVVDREYVFAYIDDPCSATYPLM  109

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHALQNGE+EKNV TSIF KI +FE+ELKALLPKE E AR +LE+GNPAI N
Sbjct  110  QKLRQVLVDHALQNGENEKNVGTSIFHKIESFEEELKALLPKEDESARISLESGNPAIAN  169

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKFIR ELG   LTGEK  SPGE C+KVFTA+  G I+DPLLECL+ WNG
Sbjct  170  RIAECRSYPLYKFIRGELGASFLTGEKATSPGEECEKVFTALSKGLIVDPLLECLQGWNG  229

Query  195  APLP  184
            APLP
Sbjct  230  APLP  233



>gb|AEZ67457.1| phenylalanine ammonia-lyase [Perilla frutescens]
Length=711

 Score =   331 bits (848),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+ AVKNTVSQVAKRTLTMGVNGELHPSRFCEKDL+ VVDREYVFAY DDPCSA YPLM
Sbjct  526  NLKQAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLISVVDREYVFAYIDDPCSATYPLM  585

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL+NGE EKNVSTSIF KI AFE+ELKALLPKEVE AR ALE GNPAI N
Sbjct  586  QKLRQVLVDHALKNGETEKNVSTSIFHKIEAFEEELKALLPKEVESARIALEGGNPAIAN  645

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI+ECRSYPLYKFIREELG   LTGEK  SPGE CD+VFTA+ +G I+DPLL CL+ WNG
Sbjct  646  RISECRSYPLYKFIREELGASFLTGEKTTSPGEECDRVFTALSNGLIVDPLLNCLQGWNG  705

Query  195  APLPIC  178
            APLPIC
Sbjct  706  APLPIC  711



>ref|XP_004493977.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=723

 Score =   331 bits (849),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N+VKN VSQVAKRTLT GVNGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLM
Sbjct  538  NLKNSVKNIVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLM  597

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE+EKN++TSIFQKIA FEDELK LLPKEVE AR+A E+GNPAIPN
Sbjct  598  QKLRQVLVDHALVNGENEKNLNTSIFQKIATFEDELKTLLPKEVESARAAYESGNPAIPN  657

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I  CRSYPLYKF+REELGT +LTGEKV SPGE CDK+FTA+C G IIDPLLECL  WNG
Sbjct  658  KINGCRSYPLYKFVREELGTSLLTGEKVISPGEECDKLFTAMCQGKIIDPLLECLGEWNG  717

Query  195  APLPIC  178
            APLP+C
Sbjct  718  APLPVC  723



>gb|AAK84225.1|AF401636_1 phenylalanine ammonia-lyase [Rehmannia glutinosa]
Length=708

 Score =   330 bits (846),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR +VKNTVSQVAKRTLTMG+NGELHPSRFCEKDLLRVVDREYVFAY DDPCS  YPLM
Sbjct  523  NLRLSVKNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYIDDPCSGTYPLM  582

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE EKNVSTSIFQKI AFE ELKA+LPKEVE AR ALE+GNPAI N
Sbjct  583  QKLRQVLVDHALNNGESEKNVSTSIFQKIEAFEVELKAILPKEVESARIALESGNPAIGN  642

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLYKFIREELGT  LTGEKV SPGE CDKVFTA+  G I+DPLL+CL+ WNG
Sbjct  643  RITECRSYPLYKFIREELGTNYLTGEKVVSPGEECDKVFTALSKGLIVDPLLKCLEGWNG  702

Query  195  APLPIC  178
            AP PIC
Sbjct  703  APPPIC  708



>gb|ACF94716.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=719

 Score =   330 bits (847),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+++ KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLM
Sbjct  534  NLKSSAKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLM  593

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE+EKN++TSIFQKIA FEDELKALLPKEVE AR+A E+GNPAIPN
Sbjct  594  QKLRQVLVDHALVNGEYEKNLNTSIFQKIATFEDELKALLPKEVESARAAYESGNPAIPN  653

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGEKV+SPG   DK+FTA+C G IIDPLLECL  WNG
Sbjct  654  KIKECRSYPLYKFVREELGTGLLTGEKVRSPGGEFDKLFTAMCRGKIIDPLLECLGEWNG  713

Query  195  APLPIC  178
            APLPIC
Sbjct  714  APLPIC  719



>sp|P26600.1|PAL5_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
 gb|AAA34176.1| phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   330 bits (847),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+NAVKNTVSQVAK+TL MG NGELHP+RFCEK+LL+VV+REY+F YADDPCS+ YPLM
Sbjct  536  NLKNAVKNTVSQVAKKTLAMGANGELHPARFCEKELLQVVEREYLFTYADDPCSSTYPLM  595

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHA++NGE EKN+++SIFQKI AFEDELKA+LPKEVE AR+ +E+GNPAIPN
Sbjct  596  QKLRQVLVDHAMKNGESEKNLNSSIFQKIVAFEDELKAVLPKEVESARAVVESGNPAIPN  655

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLY+ +R+E+GTE+LTGEKV+SPGE  DKVFTA C+G IIDPLLECLKSWNG
Sbjct  656  RITECRSYPLYRLVRQEVGTELLTGEKVRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNG  715

Query  195  APLPIC  178
            AP+PIC
Sbjct  716  APIPIC  721



>gb|ACF94715.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=332

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKNTVSQ+AKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DD CSA YPLM
Sbjct  147  NLKNTVKNTVSQIAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYVDDACSATYPLM  206

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL N + EKN++TSIFQKI  FE+ELK LLPKEVE AR A ENG  AIPN
Sbjct  207  QKLRQVLVDHALANADGEKNLNTSIFQKITTFEEELKTLLPKEVESARVAYENGQCAIPN  266

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGEKV SPGE CDK+FTA+C G IIDPLLECL  WNG
Sbjct  267  KIEECRSYPLYKFVREELGTGLLTGEKVISPGEECDKLFTAMCQGKIIDPLLECLGEWNG  326

Query  195  APLPIC  178
            APLPIC
Sbjct  327  APLPIC  332



>ref|XP_003635685.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=308

 Score =   317 bits (813),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VK TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLM
Sbjct  123  NLKSTVKKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLM  182

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QK+RQVLV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPN
Sbjct  183  QKVRQVLVEHALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPN  242

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNG
Sbjct  243  RIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNG  302

Query  195  APLPIC  178
            APLPIC
Sbjct  303  APLPIC  308



>ref|XP_007208432.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
 gb|EMJ09631.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
Length=717

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPC+A YPLM
Sbjct  532  NLRNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCNATYPLM  591

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE+EKN STSIFQKI AFE+ELK LLPKEV+ AR+AL++G   +PN
Sbjct  592  QKLRQVLVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGTAGVPN  651

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLYKF+REELG E LTGE+V+SPGE CDKVF+A+C+G IIDP+L+CL+ WNG
Sbjct  652  RITECRSYPLYKFVREELGAEYLTGEEVRSPGEECDKVFSAICEGKIIDPILDCLEGWNG  711

Query  195  APLPIC  178
            APLPIC
Sbjct  712  APLPIC  717



>dbj|BAF36973.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=569

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR +VKNTVSQVAKRTLT  V+GELHPSRFCEKDLL+VVDRE VFAY DDPCSA YPLM
Sbjct  384  NLRYSVKNTVSQVAKRTLTTSVSGELHPSRFCEKDLLKVVDREVVFAYIDDPCSATYPLM  443

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL N E+EKN +TSIFQKI+ FEDELK+LLPKEVE AR+A E+GNP IPN
Sbjct  444  QKLRQVLVDHALVNAENEKNQNTSIFQKISTFEDELKSLLPKEVESARNAYESGNPVIPN  503

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGTE+LTGEKV+SPGE CDK+FTA+C G IIDPLLECL  WNG
Sbjct  504  KINECRSYPLYKFVREELGTELLTGEKVRSPGEECDKLFTAICQGKIIDPLLECLGEWNG  563

Query  195  APLPIC  178
            APLPIC
Sbjct  564  APLPIC  569



>pir||JQ1070 phenylalanine ammonia-lyase (EC 4.3.1.5) - soybean  (fragment)
Length=416

 Score =   321 bits (822),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKN VSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREY FAY DDPCS  YPLM
Sbjct  231  NLKNTVKNVVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYTFAYIDDPCSGTYPLM  290

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVD+AL NGE+EKN +TSIFQKIA+FE+ELK LLPKEVEGAR A EN   AIPN
Sbjct  291  QKLRQVLVDYALANGENEKNTNTSIFQKIASFEEELKTLLPKEVEGARVAYENDQCAIPN  350

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGE+V SPGE CDKVFTA+C G IIDPLLECL  WNG
Sbjct  351  KIKECRSYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGNIIDPLLECLGEWNG  410

Query  195  APLPIC  178
            APLPIC
Sbjct  411  APLPIC  416



>ref|XP_011077338.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=712

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR AVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAY DDPCS NYPLM
Sbjct  527  NLRLAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYVDDPCSENYPLM  586

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL+NG++EKN+STSIFQKI AFEDELKALLPKEVE AR ALE+GNPAI N
Sbjct  587  QKLRQVLVEHALKNGDNEKNLSTSIFQKIGAFEDELKALLPKEVESARIALESGNPAIAN  646

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLY+FIREELGT  LTGEKV SPGE  DKVFTA+  G I+DPLL+CL+ W+G
Sbjct  647  RIKECRSYPLYRFIREELGTGFLTGEKVTSPGEEGDKVFTALSKGLIVDPLLKCLEGWSG  706

Query  195  APLPIC  178
            +PLPIC
Sbjct  707  SPLPIC  712



>gb|AHY94892.1| phenylalanine ammonia lyase [Prunella vulgaris]
Length=710

 Score =   329 bits (844),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+ AVKNTVSQVAKRTLTMG NGELHPSRFCEK+L+RVVDREYVFAYADDPCSA YPLM
Sbjct  525  NLKLAVKNTVSQVAKRTLTMGANGELHPSRFCEKELIRVVDREYVFAYADDPCSATYPLM  584

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL+NG+ EKNVSTSIF KI AFE+ELKALLPKEVE AR ALE+G PA+ N
Sbjct  585  QKLRQVLVDHALKNGDGEKNVSTSIFHKIEAFEEELKALLPKEVESARIALESGAPAVAN  644

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKFIRE LGT  LTGEK  SPGE CDKVFTA+CDG I+DPLLECL+ WNG
Sbjct  645  RIAECRSYPLYKFIREGLGTGFLTGEKAVSPGEECDKVFTALCDGLIVDPLLECLQGWNG  704

Query  195  APLPIC  178
             PLPIC
Sbjct  705  EPLPIC  710



>gb|AHZ31605.1| phenylalanine ammonia-lyase [Olea europaea]
 gb|AHZ31606.1| phenylalanine ammonia-lyase [Olea europaea]
Length=713

 Score =   329 bits (844),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRNAVKNTVS VAK+TLT+GVNGELHPSRFCEKDLLRVVDREYVFAY DDPCSA YPLM
Sbjct  528  NLRNAVKNTVSLVAKKTLTVGVNGELHPSRFCEKDLLRVVDREYVFAYIDDPCSATYPLM  587

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL+NGE EK  +TSIFQKI AFEDEL A LPKEVE AR ALE+GNPAIPN
Sbjct  588  QKLRQVLVEHALKNGETEKEANTSIFQKIGAFEDELIANLPKEVESARIALESGNPAIPN  647

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGTE+LTGEKV+SPGE CDKVFTA+  G IIDPLLECL  WNG
Sbjct  648  KINECRSYPLYKFVREELGTELLTGEKVRSPGEECDKVFTAMSKGLIIDPLLECLNGWNG  707

Query  195  APLPIC  178
             PLPIC
Sbjct  708  EPLPIC  713



>sp|P24481.1|PAL1_PETCR RecName: Full=Phenylalanine ammonia-lyase 1 [Petroselinum crispum]
 emb|CAA68938.1| PAL1 protein [Petroselinum crispum]
Length=716

 Score =   329 bits (843),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVS VAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLM
Sbjct  531  NLKSTVKNTVSSVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLM  590

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQ LV+HAL+NG++E+N+STSIFQKIA FEDELKALLPKEVE AR+ALE+GNPAIPN
Sbjct  591  QKLRQTLVEHALKNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPN  650

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+R+ELGTE LTGEKV SPGE  +KVF A+  G IIDPLLECL+SWNG
Sbjct  651  RIEECRSYPLYKFVRKELGTEYLTGEKVTSPGEEFEKVFIAMSKGEIIDPLLECLESWNG  710

Query  195  APLPIC  178
            APLPIC
Sbjct  711  APLPIC  716



>pdb|1W27|A Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
 pdb|1W27|B Chain B, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
Length=714

 Score =   329 bits (843),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVS VAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLM
Sbjct  529  NLKSTVKNTVSSVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLM  588

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQ LV+HAL+NG++E+N+STSIFQKIA FEDELKALLPKEVE AR+ALE+GNPAIPN
Sbjct  589  QKLRQTLVEHALKNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPN  648

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+R+ELGTE LTGEKV SPGE  +KVF A+  G IIDPLLECL+SWNG
Sbjct  649  RIEECRSYPLYKFVRKELGTEYLTGEKVTSPGEEFEKVFIAMSKGEIIDPLLECLESWNG  708

Query  195  APLPIC  178
            APLPIC
Sbjct  709  APLPIC  714



>gb|AAN52280.1|AF480620_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=711

 Score =   328 bits (842),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKNTVSQVAKR LTMG NGELHPSR CEKDLL+VVDRE+VF Y DDPCSA YPLM
Sbjct  526  NLKNTVKNTVSQVAKRVLTMGFNGELHPSRICEKDLLKVVDREHVFTYIDDPCSATYPLM  585

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE E N STSIFQKI  FEDELKALLPKEVE AR  LENGNPAIPN
Sbjct  586  QKLRQVLVDHALMNGEKEHNSSTSIFQKIGVFEDELKALLPKEVESARLELENGNPAIPN  645

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLYKF+REELGT +LTGEKV SPGE  DKVFTA+C G +IDP+LECLK WNG
Sbjct  646  RITECRSYPLYKFVREELGTILLTGEKVGSPGEEFDKVFTAICAGKLIDPMLECLKEWNG  705

Query  195  APLPIC  178
            APLP+C
Sbjct  706  APLPLC  711



>ref|XP_007009873.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
 gb|EOY18683.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
Length=713

 Score =   328 bits (842),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKNTVSQVAKR LTMG NGELHPSRFCEKDLLRVVDREY++AY DDPCSA YPLM
Sbjct  528  NLKNTVKNTVSQVAKRVLTMGSNGELHPSRFCEKDLLRVVDREYLYAYVDDPCSATYPLM  587

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NG+ EKN +TSIFQKI AFE+ELK LLPKEVEGAR   ENGN AIPN
Sbjct  588  QKLRQVLVDHALMNGDREKNSTTSIFQKIGAFEEELKTLLPKEVEGARIEFENGNAAIPN  647

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+RE LGT +LTGEKV SPGE CDKVF+A+C G +IDPLLECLK WNG
Sbjct  648  RIEECRSYPLYKFVREVLGTSLLTGEKVISPGEECDKVFSAMCAGKLIDPLLECLKEWNG  707

Query  195  APLPIC  178
            APLPIC
Sbjct  708  APLPIC  713



>gb|ABV44808.1| phenylalanine ammonia lyase 1 [Eriobotrya japonica]
Length=330

 Score =   316 bits (810),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VK TVSQVAKR LTMG NGELHPSRFCEKDLL+VVDREYVF Y DDPCSA YPLM
Sbjct  145  NLKSTVKTTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREYVFTYIDDPCSATYPLM  204

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLR VLV+HAL NG+ E++ STSIFQKIAAFE+ELKALLPKEVE  R+  ENG  AIPN
Sbjct  205  QKLRHVLVEHALSNGDKERSTSTSIFQKIAAFEEELKALLPKEVETTRAEYENGKTAIPN  264

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT++LTGEKV+SPGE CDKVF+A+C G +IDPLL+CLK WNG
Sbjct  265  RIKECRSYPLYKFVREELGTDLLTGEKVRSPGEECDKVFSAMCAGKLIDPLLDCLKEWNG  324

Query  195  APLPI  181
            APLPI
Sbjct  325  APLPI  329



>ref|XP_006358655.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=709

 Score =   328 bits (840),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+NAVK+TVS+VAKRTLTM  NGELHP+RFCEK+LL VVDREY+FAYADDPCS+NYPLM
Sbjct  524  NLKNAVKDTVSRVAKRTLTMDANGELHPARFCEKELLLVVDREYLFAYADDPCSSNYPLM  583

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVD+A++NGE EKNV++SIFQKI AFEDELK +LP EVE AR  LE+GNP+IPN
Sbjct  584  QKLRQVLVDYAMKNGESEKNVNSSIFQKIGAFEDELKVVLPNEVENARVILESGNPSIPN  643

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLY+F+R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G IIDPLLECLKSWNG
Sbjct  644  RITECRSYPLYRFVRKELGTELLTGERVRSPGEDIDKVFTALCNGQIIDPLLECLKSWNG  703

Query  195  APLPIC  178
            APLPIC
Sbjct  704  APLPIC  709



>sp|O23865.1|PAL1_DAUCA RecName: Full=Phenylalanine ammonia-lyase 1 [Daucus carota]
 dbj|BAA23367.1| phenylalanine ammonia-lyase [Daucus carota]
Length=708

 Score =   328 bits (840),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQVAK+ LTMGVNGELHPSRFCE DLLRVVDREY+FAY DDPCSA YPLM
Sbjct  523  NLKSTVKNTVSQVAKKVLTMGVNGELHPSRFCELDLLRVVDREYIFAYIDDPCSATYPLM  582

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL+NGE EKN+STSIFQKIAAFEDELKALLPKEVE AR+ +E+GNPAIPN
Sbjct  583  QKLRQVLVEHALKNGETEKNLSTSIFQKIAAFEDELKALLPKEVESARAVVESGNPAIPN  642

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKFIREELGT  LTGEKV SPGE  DKVFTA+  G IIDPLL CL+SWNG
Sbjct  643  RIKECRSYPLYKFIREELGTVYLTGEKVTSPGEEFDKVFTAMSKGEIIDPLLACLESWNG  702

Query  195  APLPIC  178
            APLPI 
Sbjct  703  APLPIA  708



>gb|AFZ78651.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   328 bits (840),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDRE+ F Y DDPCSA YPLM
Sbjct  526  NLKNTVKNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREHAFTYIDDPCSATYPLM  585

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE E N STSIFQKI AFE+ELK LLPKEVE AR  LENGNPAIPN
Sbjct  586  QKLRQVLVDHALMNGEKEHNSSTSIFQKIGAFEEELKTLLPKEVENARLELENGNPAIPN  645

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLYKF+REELGT +LTGEKV SPGE  DKVFTA+C G +IDP+LECLK WNG
Sbjct  646  RITECRSYPLYKFVREELGTILLTGEKVGSPGEEFDKVFTAICAGKLIDPMLECLKEWNG  705

Query  195  APLPIC  178
            APLP+C
Sbjct  706  APLPLC  711



>ref|XP_006364022.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   328 bits (840),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++AVKNTVSQVAKRTLT+G NGELHP+RFCEK+LLRVVDREY+FAYADDPCS+NYPLM
Sbjct  538  NLKSAVKNTVSQVAKRTLTVGANGELHPARFCEKELLRVVDREYLFAYADDPCSSNYPLM  597

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVD A++NGE EK+ ++SIFQKI AFEDEL A+LPKEVE  R+ +E+GNP+IPN
Sbjct  598  QKLRQVLVDQAMKNGESEKHFNSSIFQKIGAFEDELIAVLPKEVESVRAVVESGNPSIPN  657

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLY+ +R+ELGTE+LTGEK++SPGE  DKVFTA C+G IIDPLLECLKSWNG
Sbjct  658  RITECRSYPLYRLVRQELGTEVLTGEKIRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNG  717

Query  195  APLPIC  178
            APLPIC
Sbjct  718  APLPIC  723



>ref|XP_002312013.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63890.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEE89380.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   327 bits (839),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDRE+ F Y DDPCSA YPLM
Sbjct  526  NLKNTVKNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREHAFTYIDDPCSATYPLM  585

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE E N STSIFQKI AFE+ELK LLPKEVE AR  LENGNPAIPN
Sbjct  586  QKLRQVLVDHALMNGEKEHNSSTSIFQKIGAFEEELKTLLPKEVENARLELENGNPAIPN  645

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLYKF+REELGT +LTGEKV SPGE  DKVFTA+C G +IDP+LECLK WNG
Sbjct  646  RITECRSYPLYKFVREELGTILLTGEKVGSPGEEFDKVFTAICAGKLIDPMLECLKEWNG  705

Query  195  APLPIC  178
            APLP+C
Sbjct  706  APLPLC  711



>dbj|BAF36971.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=717

 Score =   328 bits (840),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+++VK+TVSQVAKRTLT  VNGELHPSRFCEKDLL+VVDRE +FAY DDPCSA YPLM
Sbjct  532  NLKHSVKSTVSQVAKRTLTTSVNGELHPSRFCEKDLLKVVDRETLFAYIDDPCSATYPLM  591

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE+EKN  TSIFQKIA FEDELK+LLPKEVE AR+A E+GNP IPN
Sbjct  592  QKLRQVLVDHALVNGENEKNSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPTIPN  651

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGTE+LTGEK +SPGE CDK+FTA+C G IIDPLLECL  WNG
Sbjct  652  KINECRSYPLYKFVREELGTELLTGEKTRSPGEECDKLFTAICQGKIIDPLLECLGEWNG  711

Query  195  APLPIC  178
            APLPIC
Sbjct  712  APLPIC  717



>ref|XP_002531677.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF30696.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=719

 Score =   328 bits (840),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDREY+FAY DDPCSA YPLM
Sbjct  534  NLKSTVKNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREYIFAYIDDPCSATYPLM  593

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE EKN STSIFQKI AFE+ELKALLPKEVE AR+  +NGNPAIPN
Sbjct  594  QKLRQVLVDHALLNGEKEKNSSTSIFQKIGAFEEELKALLPKEVENARTEYDNGNPAIPN  653

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGEK++SPGE  DKVF+A+C G +IDP+LECLK WNG
Sbjct  654  KIKECRSYPLYKFVREELGTGLLTGEKIRSPGEEFDKVFSAMCAGKLIDPMLECLKEWNG  713

Query  195  APLPIC  178
            APLPIC
Sbjct  714  APLPIC  719



>ref|XP_007162755.1| hypothetical protein PHAVU_001G1777000g, partial [Phaseolus vulgaris]
 gb|ESW34749.1| hypothetical protein PHAVU_001G1777000g, partial [Phaseolus vulgaris]
Length=240

 Score =   312 bits (800),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+++VKNTVSQV+KRTLT G NGELHPSRFCEKDLL+VVDREYVF+Y DDPCS  YPLM
Sbjct  55   NLKSSVKNTVSQVSKRTLTTGGNGELHPSRFCEKDLLKVVDREYVFSYIDDPCSGTYPLM  114

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL N E+EK+V+TSIFQKIA FE+ELK +LPKEVE  R+A E+G  AIPN
Sbjct  115  QKLRQVLVDHALINAENEKDVNTSIFQKIATFEEELKTILPKEVESTRAAYESGKAAIPN  174

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGEKV+SPGE  DK+FTA+C G IIDPLLECL  WNG
Sbjct  175  KIKECRSYPLYKFVREELGTGLLTGEKVKSPGEEFDKLFTAICQGKIIDPLLECLGEWNG  234

Query  195  APLPIC  178
            APLPIC
Sbjct  235  APLPIC  240



>sp|P45732.1|PALY_STYHU RecName: Full=Phenylalanine ammonia-lyase [Stylosanthes humilis]
 gb|AAA99500.1| phenylalanine ammonia lyase [Stylosanthes humilis]
Length=715

 Score =   327 bits (839),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL++VDREY FAY DDPCSA YPLM
Sbjct  530  NLKNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKIVDREYCFAYIDDPCSATYPLM  589

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL N E+EKNV+TSIFQKI  FE+ELK LLPKEVEGAR A ENG  AIPN
Sbjct  590  QKLRQVLVEHALANAENEKNVNTSIFQKITTFEEELKTLLPKEVEGARIAYENGQSAIPN  649

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGTE+LTGEKV+SPGE CDK+FTA+C G IIDPLLEC+  WNG
Sbjct  650  KIKECRSYPLYKFVREELGTEMLTGEKVRSPGEECDKLFTAMCQGKIIDPLLECIGEWNG  709

Query  195  APLPIC  178
            APLP+C
Sbjct  710  APLPLC  715



>sp|P45735.1|PALY_VITVI RecName: Full=Phenylalanine ammonia-lyase, partial [Vitis vinifera]
 emb|CAA53581.1| phenylalanine ammonium lyase [Vitis vinifera]
Length=416

 Score =   318 bits (815),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VK TVS VAK+TLT+G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLM
Sbjct  231  NLKSTVKKTVSHVAKKTLTIGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLM  290

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QK+RQVLV+HAL NGE EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPN
Sbjct  291  QKVRQVLVEHALNNGESEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPN  350

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNG
Sbjct  351  RIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNG  410

Query  195  APLPIC  178
            APLPIC
Sbjct  411  APLPIC  416



>gb|KEH24018.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   327 bits (839),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N+VKNTVSQVAK+TLT+GVNGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPL 
Sbjct  539  NLKNSVKNTVSQVAKKTLTIGVNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLS  598

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE EKN++TSIFQKIA FE+ELK+LLPKEVE AR+A E+GNP IPN
Sbjct  599  QKLRQVLVDHALVNGESEKNLNTSIFQKIATFEEELKSLLPKEVESARTAYESGNPTIPN  658

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I  CRSYPLYKF+REELGT +LTGE V SPGEVCDK+FTA+C G IIDPLLECL  WNG
Sbjct  659  KINGCRSYPLYKFVREELGTGLLTGENVISPGEVCDKLFTAMCQGKIIDPLLECLGEWNG  718

Query  195  APLPIC  178
            APLPIC
Sbjct  719  APLPIC  724



>ref|XP_006354337.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
tuberosum]
Length=719

 Score =   327 bits (838),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+NAVKNTVSQVAK+TLT+G NGELHP+RFCEK+LL+VV+REY+F YADDPCS+ YPLM
Sbjct  534  NLKNAVKNTVSQVAKKTLTIGANGELHPARFCEKELLQVVEREYLFTYADDPCSSTYPLM  593

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHA++NG  E NV++SIFQKI AFE+ELKA+LPKEVE AR+ LE+GNP+IPN
Sbjct  594  QKLRQVLVDHAMKNGVSETNVNSSIFQKIVAFEEELKAVLPKEVESARAMLESGNPSIPN  653

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLY+ +R+ELGTE+LTGEK++SPGE  DKVFTA C+G IIDPLLECLKSWNG
Sbjct  654  RITECRSYPLYRLVRQELGTEVLTGEKIRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNG  713

Query  195  APLPIC  178
            APLPIC
Sbjct  714  APLPIC  719



>gb|AAA34179.2| phenylalanine ammonia lyase [Solanum lycopersicum]
Length=704

 Score =   327 bits (837),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQVAKRTLTMG NGELHP+RF EK+LLRVVDREY+FAYADDPCS+NYPLM
Sbjct  519  NLKSVVKNTVSQVAKRTLTMGANGELHPARFSEKELLRVVDREYLFAYADDPCSSNYPLM  578

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVD A++NGE EKNV++SIFQKI AFEDEL A+LPKEVE  R+  E+GNP I N
Sbjct  579  QKLRQVLVDQAMKNGESEKNVNSSIFQKIGAFEDELIAVLPKEVESVRAVFESGNPLIRN  638

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLY+ +REELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNG
Sbjct  639  RITECRSYPLYRLVREELGTELLTGEKVRSPGEEIDKVFTAICNGQIIDPLLECLKSWNG  698

Query  195  APLPIC  178
            APLPIC
Sbjct  699  APLPIC  704



>gb|AFZ94859.1| phenylalanine ammonia-lyase [Solenostemon scutellarioides]
Length=711

 Score =   327 bits (837),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR AVKNTVSQVAKRTLTMG+NGELHPSRFCEKDLLRVVDREYVFAY DDPCSANYPLM
Sbjct  526  NLRLAVKNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYIDDPCSANYPLM  585

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL+NG+ EKNV TSIFQKI  FE+EL A+LPKEVE AR ALE GNPAIPN
Sbjct  586  QKLRQVLVDHALKNGDSEKNVGTSIFQKIQVFEEELTAVLPKEVEAARIALEAGNPAIPN  645

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLY FIREELGTE LTGEK  SPGE  +KVFTA+ +G I+DPLL+CL++WNG
Sbjct  646  RIKECRSYPLYSFIREELGTEFLTGEKTVSPGEEGEKVFTALSNGLIVDPLLKCLEAWNG  705

Query  195  APLPIC  178
             PLPIC
Sbjct  706  EPLPIC  711



>dbj|BAF36969.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=437

 Score =   318 bits (816),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+++VK+TVSQVAKRTLT GV+GELHPSRFCEKDLL+VVDRE +FAY DDPC A YPLM
Sbjct  252  NLKHSVKSTVSQVAKRTLTTGVSGELHPSRFCEKDLLKVVDRETLFAYIDDPCLATYPLM  311

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE+EK+  TSIFQKI +FEDELK+LLPKEVE AR+A E+GNPAIPN
Sbjct  312  QKLRQVLVDHALVNGENEKDSKTSIFQKIGSFEDELKSLLPKEVESARAAYESGNPAIPN  371

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGTE+LTGEK +SPGE  DK+FTA+C G IIDPLLECL  WNG
Sbjct  372  KINECRSYPLYKFVREELGTELLTGEKSRSPGEEFDKLFTAICQGKIIDPLLECLGEWNG  431

Query  195  APLPIC  178
            APLPIC
Sbjct  432  APLPIC  437



>sp|O23924.1|PALY_DIGLA RecName: Full=Phenylalanine ammonia-lyase [Digitalis lanata]
 emb|CAA05251.1| phenylalanine ammonia lyase [Digitalis lanata]
Length=713

 Score =   327 bits (837),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR +VKNT+SQVAKRTLT GVNGELHPSRFCE DLLRVVDREYVFAY DDPCSA YPLM
Sbjct  528  NLRLSVKNTISQVAKRTLTTGVNGELHPSRFCELDLLRVVDREYVFAYVDDPCSATYPLM  587

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL+NGE+EKN STSIFQKI AFE ELKA+LPKEVE AR ALE+G PAI N
Sbjct  588  QKLRQVLVEHALKNGENEKNASTSIFQKIEAFEAELKAVLPKEVESARVALEDGKPAIAN  647

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLYKFIREELGT  LTGEKV SPGE CD+VFTA+  G I+DPLL+CL+ WNG
Sbjct  648  RITECRSYPLYKFIREELGTNFLTGEKVMSPGEECDRVFTAMSKGLIVDPLLKCLEGWNG  707

Query  195  APLPIC  178
            APLPIC
Sbjct  708  APLPIC  713



>sp|P35511.1|PAL1_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
Length=704

 Score =   326 bits (836),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQVAKRTLTMG NGELHP+RF EK+LLRVVDREY+FAYADDPCS+NYPLM
Sbjct  519  NLKSVVKNTVSQVAKRTLTMGANGELHPARFSEKELLRVVDREYLFAYADDPCSSNYPLM  578

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVD A++NGE EKNV++SIFQKI AFEDEL A+LPKEVE  R+  E+GNP I N
Sbjct  579  QKLRQVLVDQAMKNGESEKNVNSSIFQKIGAFEDELIAVLPKEVESVRAVFESGNPLIRN  638

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLY+ +REELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNG
Sbjct  639  RITECRSYPLYRLVREELGTELLTGEKVRSPGEEIDKVFTAICNGQIIDPLLECLKSWNG  698

Query  195  APLPIC  178
            APLPIC
Sbjct  699  APLPIC  704



>gb|AGF50182.1| phenylalanine ammonia lyase, partial [Salvia officinalis]
Length=282

 Score =   313 bits (801),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++AVKNTVSQVAKRTLTMG NGELHPSRFCEKDL+RVVDREYVF+Y DDPC A YPLM
Sbjct  97   NLKHAVKNTVSQVAKRTLTMGANGELHPSRFCEKDLIRVVDREYVFSYIDDPCLATYPLM  156

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL+NGE EK+VSTSIF KI  FE+EL ALLPKEVE AR ALE+G+PA+PN
Sbjct  157  QKLRQVLVEHALKNGEGEKSVSTSIFHKIEQFEEELMALLPKEVESARIALESGSPAVPN  216

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKFIRE+LG   LTGEK  SPGE CD VFTA+ +G I+DPLL+CLK+WNG
Sbjct  217  RIAECRSYPLYKFIREDLGAGFLTGEKAVSPGEECDMVFTALSNGLIVDPLLDCLKAWNG  276

Query  195  APLPIC  178
             PLPIC
Sbjct  277  QPLPIC  282



>ref|XP_004253518.1| PREDICTED: phenylalanine ammonia-lyase-like, partial [Solanum 
lycopersicum]
Length=582

 Score =   323 bits (827),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+NAVK+TVSQVAKRTLTM  NGELHP+RFCEK+LL VVDREY+FAYADDPCS+NYPLM
Sbjct  397  NLKNAVKDTVSQVAKRTLTMDANGELHPARFCEKELLLVVDREYLFAYADDPCSSNYPLM  456

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVD+A++NGE EKNV++SIFQKI AFEDELK +LP EVE AR  LE G+P IPN
Sbjct  457  QKLRQVLVDYAMKNGESEKNVNSSIFQKIGAFEDELKVVLPDEVENARVVLEGGSPLIPN  516

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLY+F+R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G IIDPLLECLKSWNG
Sbjct  517  RITECRSYPLYRFVRKELGTELLTGERVRSPGEDVDKVFTALCNGQIIDPLLECLKSWNG  576

Query  195  APLPI  181
            APLPI
Sbjct  577  APLPI  581



>gb|KHN17149.1| Phenylalanine ammonia-lyase 2 [Glycine soja]
Length=619

 Score =   323 bits (829),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKNTVSQVAKR LT+G+NGELHPSRFCEKDLL++VDREYV+AY DDPCSA YPLM
Sbjct  434  NLKNTVKNTVSQVAKRVLTVGINGELHPSRFCEKDLLKIVDREYVYAYIDDPCSATYPLM  493

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLR VLVDHALQNG+ E + STSIFQKI AFE+EL ALLPKEVE AR  +ENGNPAIPN
Sbjct  494  QKLRLVLVDHALQNGDKEASSSTSIFQKIGAFEEELNALLPKEVESARIEVENGNPAIPN  553

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+RE LGT +LTGEKV+SPGE  DKVFTA+C+G  IDPLL+CLK WNG
Sbjct  554  RIKECRSYPLYKFVRENLGTTLLTGEKVKSPGEESDKVFTALCEGKFIDPLLDCLKEWNG  613

Query  195  APLPIC  178
            APLPIC
Sbjct  614  APLPIC  619



>gb|AJO53273.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=711

 Score =   326 bits (835),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR AVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCS NYPLM
Sbjct  526  NLRLAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSENYPLM  585

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NG+ EKN STSIFQKI AFE+ELKA+LPKEVEGAR A+E G   I N
Sbjct  586  QKLRQVLVDHALNNGDKEKNASTSIFQKIQAFEEELKAVLPKEVEGARLAVEGGKEVIGN  645

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKFIREE+GTE LTGEKV SPGE CDKVF A+ +G ++DPL +CL++WNG
Sbjct  646  RIKECRSYPLYKFIREEVGTEFLTGEKVTSPGEECDKVFKALTNGLMVDPLFKCLEAWNG  705

Query  195  APLPIC  178
            APLPIC
Sbjct  706  APLPIC  711



>dbj|BAD94354.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
Length=357

 Score =   315 bits (807),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR  VKNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+
Sbjct  172  NLRQTVKNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLI  231

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPN
Sbjct  232  QKLRQVIVDHALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPN  291

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLY+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNG
Sbjct  292  RIKECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNG  351

Query  195  APLPIC  178
            AP+PIC
Sbjct  352  APIPIC  357



>gb|KHG26972.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=710

 Score =   325 bits (834),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKNTVSQVAKR LTMG NGELHPSRFCEKDLLRVVDREY++AYADDPCSANYPL+
Sbjct  525  NLKNTVKNTVSQVAKRVLTMGSNGELHPSRFCEKDLLRVVDREYLYAYADDPCSANYPLI  584

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NG+ EK+ +TSIFQKI  FE+ELK  LPKEVE AR+  ENGNPAIPN
Sbjct  585  QKLRQVLVDHALMNGDREKDSTTSIFQKIGVFEEELKTHLPKEVESARTEFENGNPAIPN  644

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+RE LGT +LTGEKV SPGE CDKVFTA+C G +IDPLL+CLK WNG
Sbjct  645  KIEECRSYPLYKFVREVLGTNLLTGEKVISPGEECDKVFTAMCAGKLIDPLLDCLKDWNG  704

Query  195  APLPIC  178
            APLPIC
Sbjct  705  APLPIC  710



>gb|AFK47120.1| unknown [Lotus japonicus]
Length=206

 Score =   309 bits (791),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTV+QVAKRTLT GVNGELHPSRFCEKDLL VVDRE VFAY DDPCS  YPLM
Sbjct  21   NLKHTVKNTVNQVAKRTLTTGVNGELHPSRFCEKDLLTVVDREDVFAYIDDPCSGTYPLM  80

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQ LVDHAL+N + EKNV+TSIFQKIA FEDELKA+LPKEVE AR A +NG  AIPN
Sbjct  81   QKLRQSLVDHALENADAEKNVNTSIFQKIAIFEDELKAILPKEVESARVAYDNGESAIPN  140

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGEKV+SPGE  DK+FTA+C G IIDP+LECL  WNG
Sbjct  141  KIKECRSYPLYKFVREELGTGLLTGEKVKSPGEDFDKLFTAMCQGKIIDPILECLGEWNG  200

Query  195  APLPIC  178
            APLPIC
Sbjct  201  APLPIC  206



>sp|P45728.1|PAL2_PETCR RecName: Full=Phenylalanine ammonia-lyase 2 [Petroselinum crispum]
 emb|CAA57056.1| phenylalanine ammonia-lyase 2 [Petroselinum crispum]
Length=716

 Score =   325 bits (834),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVS VAKR LTMGVNGELHPSRFCEKDLLR VDREY+FAY DDPCSA YPLM
Sbjct  531  NLKSTVKNTVSSVAKRVLTMGVNGELHPSRFCEKDLLRFVDREYIFAYIDDPCSATYPLM  590

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQ LV+HAL+NG++E+N++TSIFQKIA FEDELKALLPKEVE AR+ALE+GNPAIPN
Sbjct  591  QKLRQTLVEHALKNGDNERNMNTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPN  650

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+R+ELG E LTGEKV SPGE  DKVF A+  G IIDPLLECL+SWNG
Sbjct  651  RIEECRSYPLYKFVRKELGIEYLTGEKVTSPGEEFDKVFIAMSKGEIIDPLLECLESWNG  710

Query  195  APLPIC  178
            APLPIC
Sbjct  711  APLPIC  716



>gb|EYU38541.1| hypothetical protein MIMGU_mgv1a001582mg [Erythranthe guttata]
Length=790

 Score =   327 bits (838),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR AVKNTVSQ AK+TLTMGVNGELHPSRFCEKDLLRVVDREYVFAY DDPCS  YPLM
Sbjct  605  NLRLAVKNTVSQAAKKTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYIDDPCSGTYPLM  664

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLR+VLVDHAL+NG+++KN +TSIFQKI AFE+ELKA+LPKEVE ARSA+ENGN A+ N
Sbjct  665  QKLREVLVDHALKNGDNQKNAATSIFQKIEAFEEELKAVLPKEVESARSAVENGNAAVGN  724

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGTE LTGEK+ SPGE CDKVFTA+  G I+DPLLECL+ WNG
Sbjct  725  RIKECRSYPLYKFMREELGTEFLTGEKLTSPGEECDKVFTALSKGLIVDPLLECLEGWNG  784

Query  195  APLPIC  178
            APLPIC
Sbjct  785  APLPIC  790



>ref|XP_003590471.1| Phenylalanine ammonia-lyase [Medicago truncatula]
 gb|AES60722.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=712

 Score =   325 bits (833),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAYADDPC A YPLM
Sbjct  527  NLRNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYADDPCLATYPLM  586

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL N E EKN +TSIFQKIA FEDELKA+LPKEVE AR+A ENG   I N
Sbjct  587  QKLRQVLVDHALVNTEGEKNSNTSIFQKIATFEDELKAILPKEVESARTAYENGQSGISN  646

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGEKV SPGE CDK+FTA+C G I+DPL+ECL  WNG
Sbjct  647  KIKECRSYPLYKFVREELGTALLTGEKVISPGEECDKLFTAMCQGKIVDPLMECLGEWNG  706

Query  195  APLPIC  178
            APLPIC
Sbjct  707  APLPIC  712



>ref|XP_010107519.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC16201.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=535

 Score =   320 bits (820),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+  VKNTVSQVAKR LT GVNGELHPSRFCEKDLL+VVDREYV+AY DDPCSA YPLM
Sbjct  350  NLKQTVKNTVSQVAKRVLTTGVNGELHPSRFCEKDLLKVVDREYVYAYIDDPCSATYPLM  409

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            Q LRQVLV+HAL NGE EKN STSIFQKIAAFE+ELK+LLPKEVE AR A ENGN AI N
Sbjct  410  QTLRQVLVEHALTNGESEKNTSTSIFQKIAAFEEELKSLLPKEVESARIAYENGNAAISN  469

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +ITECRSYPLYKF+REELGT +LTGEKV+SPGE  DKV+TA+C G +IDP+LECL  WNG
Sbjct  470  KITECRSYPLYKFVREELGTSLLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLECLSGWNG  529

Query  195  APLPIC  178
             PLPIC
Sbjct  530  EPLPIC  535



>gb|ABD73282.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   325 bits (832),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++AVKNTVSQVAKRTLTMGVNGELHPSRFCEKDL+RVVDREYVFAY DDPCSA YPLM
Sbjct  526  NLKHAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLIRVVDREYVFAYIDDPCSATYPLM  585

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL+NG+ EKN STSIFQKI AFE+ELKALLPKEVE AR ALE+G+P + N
Sbjct  586  QKLRQVLVDHALKNGDLEKNASTSIFQKIEAFEEELKALLPKEVESARMALESGSPTVAN  645

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKFIRE+LG   LTGEK  SPGE C+KVFTA+ +G IIDPLLECL+ WNG
Sbjct  646  RIAECRSYPLYKFIREQLGAGFLTGEKAVSPGEECEKVFTALSNGLIIDPLLECLQGWNG  705

Query  195  APLPIC  178
             PLPIC
Sbjct  706  QPLPIC  711



>gb|AAK62030.1| phenylalanine ammonia-lyase 1 [Manihot esculenta]
Length=710

 Score =   325 bits (832),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+  VKNTVSQVAKR LTMG+NGELHPSRFCEKDLL+VVDREYV+AY DDPCSA YPLM
Sbjct  525  NLKQTVKNTVSQVAKRVLTMGINGELHPSRFCEKDLLKVVDREYVYAYVDDPCSATYPLM  584

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHA+ NGE EKN STSIFQKI AFE+ELK LLPKEVE AR+  ENGNPAI N
Sbjct  585  QKLRQVLVDHAMMNGEKEKNSSTSIFQKIGAFEEELKTLLPKEVESARTEYENGNPAISN  644

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELG  +LTGEK++SPGE  DKVF+A+C G +IDP+LECLK WNG
Sbjct  645  KIKECRSYPLYKFVREELGCSLLTGEKIRSPGEEFDKVFSAICAGKLIDPMLECLKEWNG  704

Query  195  APLPIC  178
            APLPIC
Sbjct  705  APLPIC  710



>sp|Q42667.1|PALY_CITLI RecName: Full=Phenylalanine ammonia-lyase [Citrus limon]
 gb|AAB67733.1| phenylalanine ammonia-lyase [Citrus limon]
Length=722

 Score =   325 bits (833),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKNTVSQVAKR LTMGVNGELHPSRFCEKDL++VVDREYVFAY DDPCSA+ PLM
Sbjct  535  NLKNTVKNTVSQVAKRVLTMGVNGELHPSRFCEKDLIKVVDREYVFAYIDDPCSASSPLM  594

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NG+ EKN +TSIFQKI AFEDELK LLPKEVE AR+ LE+GN AIPN
Sbjct  595  QKLRQVLVDHALDNGDREKNSTTSIFQKIGAFEDELKTLLPKEVEIARTELESGNAAIPN  654

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYK +RE++GT +LTGEKV+SPGE  DKVFTA+C+G +IDP+LECLK WNG
Sbjct  655  RIKECRSYPLYKIVREDIGTSLLTGEKVRSPGEEFDKVFTAMCEGKLIDPMLECLKEWNG  714

Query  195  APLPIC  178
            APLPIC
Sbjct  715  APLPIC  720



>ref|XP_006436446.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
 ref|XP_006485648.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
 gb|ESR49686.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
Length=722

 Score =   325 bits (832),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKNTVSQVAKR LTMGVNGELHPSRFCEKDL++VVDREYVFAY DDPCSA+YPLM
Sbjct  535  NLKNTVKNTVSQVAKRVLTMGVNGELHPSRFCEKDLIKVVDREYVFAYIDDPCSASYPLM  594

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NG+ EKN +TSIFQKI AFEDELK LLPKEVE AR+ LE+GN AI N
Sbjct  595  QKLRQVLVDHALDNGDREKNSTTSIFQKIGAFEDELKTLLPKEVEIARTELESGNAAIAN  654

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYK +REE+GT +LTGEKV+SPGE  DKVF A+C+G +IDP+LECLK WNG
Sbjct  655  RIKECRSYPLYKIVREEIGTSLLTGEKVRSPGEEFDKVFAAMCEGKLIDPMLECLKEWNG  714

Query  195  APLPIC  178
            APLPIC
Sbjct  715  APLPIC  720



>gb|KDO46246.1| hypothetical protein CISIN_1g004955mg [Citrus sinensis]
Length=722

 Score =   325 bits (832),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKNTVSQVAKR LTMGVNGELHPSRFCEKDL++VVDREYVFAY DDPCSA+YPLM
Sbjct  535  NLKNTVKNTVSQVAKRVLTMGVNGELHPSRFCEKDLIKVVDREYVFAYIDDPCSASYPLM  594

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NG+ EKN +TSIFQKI AFEDELK LLPKEVE AR+ LE+GN AI N
Sbjct  595  QKLRQVLVDHALDNGDREKNSTTSIFQKIGAFEDELKTLLPKEVEIARTELESGNAAIAN  654

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYK +REE+GT +LTGEKV+SPGE  DKVF A+C+G +IDP+LECLK WNG
Sbjct  655  RIKECRSYPLYKIVREEIGTSLLTGEKVRSPGEEFDKVFAAMCEGKLIDPMLECLKEWNG  714

Query  195  APLPIC  178
            APLPIC
Sbjct  715  APLPIC  720



>sp|P31425.1|PAL1_SOLTU RecName: Full=Phenylalanine ammonia-lyase 1 [Solanum tuberosum]
Length=720

 Score =   324 bits (831),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQVAKRTLT+G  GELHP+RFCEK+LLRVVDREY+F YADDPCS+ YPLM
Sbjct  535  NLKSVVKNTVSQVAKRTLTIGAIGELHPARFCEKELLRVVDREYLFTYADDPCSSTYPLM  594

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHA++NGE EKN+++SIFQKI AFEDEL A+LPKEVE AR+ LE+GNP+IPN
Sbjct  595  QKLRQVLVDHAMKNGESEKNINSSIFQKIGAFEDELNAVLPKEVESARALLESGNPSIPN  654

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLY+ +R+ELGTE+LTGEKV+SPGE  +KVFTA+C+G I DPLLECLKSWNG
Sbjct  655  RITECRSYPLYRLVRQELGTELLTGEKVRSPGEEIEKVFTAMCNGQINDPLLECLKSWNG  714

Query  195  APLPIC  178
            APLPIC
Sbjct  715  APLPIC  720



>gb|AID16077.1| phenylalanine ammonium lyase [Morus alba]
Length=726

 Score =   324 bits (831),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQVAKR LT GVNGELHPSRFCEKDLL+VVDREYV+AY DDPCSA YPLM
Sbjct  541  NLKHTVKNTVSQVAKRVLTTGVNGELHPSRFCEKDLLKVVDREYVYAYIDDPCSATYPLM  600

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            Q LRQVLV+HAL NGE EKN STSIFQKIAAFE+ELKALLPKEVE AR+A ENGN AI N
Sbjct  601  QTLRQVLVEHALTNGESEKNTSTSIFQKIAAFEEELKALLPKEVESARTAYENGNAAISN  660

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +ITECRSYPLYKF+RE+LGT +LTGEKV+SPGE  DKV+TA+C G +IDP+LECL+ WNG
Sbjct  661  KITECRSYPLYKFVREQLGTSLLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLECLRGWNG  720

Query  195  APLPIC  178
             PLPIC
Sbjct  721  EPLPIC  726



>gb|KHN39030.1| Phenylalanine ammonia-lyase class 2 [Glycine soja]
Length=619

 Score =   321 bits (823),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKN VSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREY FAY DDPCS  YPLM
Sbjct  434  NLKNTVKNVVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYTFAYIDDPCSGTYPLM  493

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVD+AL NGE+EKN +TSIFQKIA FE+ELK LLPKEVEGAR A EN   AIPN
Sbjct  494  QKLRQVLVDYALANGENEKNTNTSIFQKIATFEEELKTLLPKEVEGARVAYENDQCAIPN  553

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGE+V SPGE CDKVFTA+C G IIDPLLECL  WNG
Sbjct  554  KIKECRSYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNG  613

Query  195  APLPIC  178
            APLPIC
Sbjct  614  APLPIC  619



>emb|CDX74991.1| BnaA05g07370D [Brassica napus]
Length=380

 Score =   314 bits (804),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+  VKNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+
Sbjct  195  NLKQTVKNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLI  254

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LP EVE AR A +NG  AIPN
Sbjct  255  QKLRQVIVDHALVNGESEKNAMTSIFHKIGAFEEELKAVLPDEVEAARVAYDNGTSAIPN  314

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLY+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDPL+ECL  WNG
Sbjct  315  RIKECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPLMECLSEWNG  374

Query  195  APLPIC  178
            AP+PIC
Sbjct  375  APIPIC  380



>gb|KHN00850.1| Phenylalanine ammonia-lyase 2 [Glycine soja]
Length=619

 Score =   321 bits (823),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N V+NTVSQVAKR LT+G+NGELHPSRFCEKDLL++VDREYV+AY DDPCSA YPLM
Sbjct  434  NLKNTVRNTVSQVAKRVLTVGINGELHPSRFCEKDLLKIVDREYVYAYIDDPCSATYPLM  493

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLR VLVDHALQNG+ E N STSIFQKI AFE+EL ALLPKEVE AR  +ENGNPAIPN
Sbjct  494  QKLRLVLVDHALQNGDKEVNSSTSIFQKIGAFEEELNALLPKEVESARIEVENGNPAIPN  553

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+RE LGT +LTGEKV+SPGE  DKVFTA+C+G +IDPLL+CLK W G
Sbjct  554  RIKECRSYPLYKFVRENLGTTLLTGEKVKSPGEEFDKVFTALCEGKLIDPLLDCLKEWKG  613

Query  195  APLPIC  178
            APLPIC
Sbjct  614  APLPIC  619



>dbj|BAF36970.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=704

 Score =   323 bits (829),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+ +VK+TVSQV KRTLT GVNGELHPSRFCEKDLL+VVDRE +F+Y DDPCSA YPLM
Sbjct  519  NLKYSVKSTVSQVVKRTLTTGVNGELHPSRFCEKDLLKVVDRETLFSYIDDPCSATYPLM  578

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE+EK+  TSIFQKIA FEDELK+LLPKEVE AR+A E+GNP IPN
Sbjct  579  QKLRQVLVDHALVNGENEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPTIPN  638

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGTE+LTGEK +SPGE CDK+FTA+C G IIDPLLECL  WNG
Sbjct  639  KINECRSYPLYKFVREELGTELLTGEKTRSPGEECDKLFTAICQGKIIDPLLECLGEWNG  698

Query  195  APLPIC  178
            APLPIC
Sbjct  699  APLPIC  704



>sp|P27990.1|PALY_MEDSA RecName: Full=Phenylalanine ammonia-lyase [Medicago sativa]
 emb|CAA41169.1| phenylalanine ammonia-lyase [Medicago sativa]
Length=725

 Score =   324 bits (830),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N+VKNTVSQVAK+TLTMGVNGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPL 
Sbjct  540  NLKNSVKNTVSQVAKKTLTMGVNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLS  599

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE EKN +TSIFQKIA FE+ELK LLPKEVE AR+A E+GNP IPN
Sbjct  600  QKLRQVLVDHALVNGESEKNFNTSIFQKIATFEEELKTLLPKEVESARTAYESGNPTIPN  659

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I  CRSYPLYKF+REELGT +LTGE V SPGE CDK+F+A+C G IIDPLLECL  WNG
Sbjct  660  KINGCRSYPLYKFVREELGTGLLTGENVISPGEECDKLFSAMCQGKIIDPLLECLGEWNG  719

Query  195  APLPIC  178
            APLPIC
Sbjct  720  APLPIC  725



>gb|KJB62426.1| hypothetical protein B456_009G416300 [Gossypium raimondii]
Length=721

 Score =   324 bits (830),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQ+AK+TLT G NGELHPSRFCEKDLL+ VDREYVFAY DDPCSA YPLM
Sbjct  536  NLRNTVKNTVSQIAKKTLTTGANGELHPSRFCEKDLLKAVDREYVFAYIDDPCSATYPLM  595

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE EKN STSIFQKI  FE+EL+A+LPKEVE AR  LENGN AIPN
Sbjct  596  QKLRQVLVEHALTNGESEKNTSTSIFQKITDFEEELQAVLPKEVESARVTLENGNAAIPN  655

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
             I +CRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G IIDP+LECLK WNG
Sbjct  656  MIKDCRSYPLYKFVREELGTGLLTGEKVKSPGEEFDKVFTAMCQGKIIDPMLECLKEWNG  715

Query  195  APLPIC  178
            APLPIC
Sbjct  716  APLPIC  721



>dbj|BAF36974.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=684

 Score =   323 bits (827),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+++VK+TVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDRE +FAY DDPC A YPLM
Sbjct  499  NLKHSVKSTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDRETLFAYIDDPCLATYPLM  558

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE+EK+  TSIFQKIA FEDELK+LLPKEVE AR+A E+GNPAIPN
Sbjct  559  QKLRQVLVDHALVNGENEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPAIPN  618

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGTE+LTGEK +SPGE  DK+FTA+C G IIDPL+ECL  WNG
Sbjct  619  KINECRSYPLYKFVREELGTELLTGEKTRSPGEEFDKLFTAICQGKIIDPLMECLGEWNG  678

Query  195  APLPIC  178
            APLPIC
Sbjct  679  APLPIC  684



>sp|Q04593.1|PAL2_PEA RecName: Full=Phenylalanine ammonia-lyase 2 [Pisum sativum]
 dbj|BAA00887.1| phenylalanine ammonia-lyase [Pisum sativum]
Length=724

 Score =   324 bits (830),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N+VKN VS VAKRTLT G+NGELHPSRFCEKDLLRVVDRE+VF+Y DDPCSA YPLM
Sbjct  539  NLKNSVKNMVSHVAKRTLTTGINGELHPSRFCEKDLLRVVDREHVFSYIDDPCSATYPLM  598

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE EKN++TSIFQKIA FEDELK LLPKEVE AR A ENGN  I N
Sbjct  599  QKLRQVLVDHALVNGESEKNLNTSIFQKIATFEDELKTLLPKEVESARGAYENGNTTISN  658

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGEKV SPGE CDK+FTA+C G IIDPLLECL  WNG
Sbjct  659  KIKECRSYPLYKFVREELGTSLLTGEKVISPGEECDKLFTAICQGKIIDPLLECLGDWNG  718

Query  195  APLPIC  178
            APLPI 
Sbjct  719  APLPIS  724



>ref|XP_006589419.1| PREDICTED: phenylalanine ammonia-lyase 2-like isoform X1 [Glycine 
max]
 ref|XP_006589420.1| PREDICTED: phenylalanine ammonia-lyase 2-like isoform X2 [Glycine 
max]
Length=717

 Score =   323 bits (829),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKNTVSQVAKR LT+G+NGELHPSRFCEKDLL++VDREYV+AY DDPCSA YPLM
Sbjct  532  NLKNTVKNTVSQVAKRVLTVGINGELHPSRFCEKDLLKIVDREYVYAYIDDPCSATYPLM  591

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLR VLVDHALQNG+ E + STSIFQKI AFE+EL ALLPKEVE AR  +ENGNPAIPN
Sbjct  592  QKLRLVLVDHALQNGDKEASSSTSIFQKIGAFEEELNALLPKEVESARIEVENGNPAIPN  651

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+RE LGT +LTGEKV+SPGE  DKVFTA+C+G  IDPLL+CLK WNG
Sbjct  652  RIKECRSYPLYKFVRENLGTTLLTGEKVKSPGEESDKVFTALCEGKFIDPLLDCLKEWNG  711

Query  195  APLPIC  178
            APLPIC
Sbjct  712  APLPIC  717



>ref|NP_001236956.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACS88364.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACU30058.1| phenylalanine ammonia-lyase 2 [Glycine max]
Length=717

 Score =   323 bits (829),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKN VSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREY FAY DDPCS  YPLM
Sbjct  532  NLKNTVKNVVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYTFAYIDDPCSGTYPLM  591

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVD+AL NGE+EKN STSIFQKIA FE+ELK LLPKEVEGAR A EN   AIPN
Sbjct  592  QKLRQVLVDYALANGENEKNTSTSIFQKIATFEEELKTLLPKEVEGARVAYENDQCAIPN  651

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGE+V SPGE CDKVFTA+C G IIDPLLECL  WNG
Sbjct  652  KIKECRSYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNG  711

Query  195  APLPIC  178
            APLPIC
Sbjct  712  APLPIC  717



>gb|AJO53274.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=715

 Score =   323 bits (829),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR+AVKNTVSQ+AKRTLTMGVNGELHPSRFCEKDL+RVVDREYVFAY DDPCSA YPLM
Sbjct  530  NLRHAVKNTVSQLAKRTLTMGVNGELHPSRFCEKDLIRVVDREYVFAYIDDPCSATYPLM  589

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL+NG+ EK VSTSIFQKI +FE+ELKALLPKEVE AR A+E GN AI N
Sbjct  590  QKLRQVLVEHALKNGDGEKTVSTSIFQKIESFEEELKALLPKEVESARMAVEGGNLAISN  649

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKFIREELG+E LTGEK  SPGE C+KVFTA+  G ++DPLL+C+K WNG
Sbjct  650  RIAECRSYPLYKFIREELGSEFLTGEKTTSPGEECEKVFTALSKGLMVDPLLKCVKGWNG  709

Query  195  APLPIC  178
            APLPIC
Sbjct  710  APLPIC  715



>gb|ACC63889.1| phenylalanine ammonia-lyase [Populus trichocarpa]
Length=711

 Score =   323 bits (828),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCSA YPLM
Sbjct  526  NLKSTVKNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLM  585

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE E+N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPN
Sbjct  586  QKLRQVLVEHALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPN  645

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+G
Sbjct  646  RIKECRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDG  705

Query  195  APLPIC  178
            APLPIC
Sbjct  706  APLPIC  711



>gb|AJR20994.1| phenylalanine ammonia-lyase [Populus szechuanica]
Length=711

 Score =   323 bits (828),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCSA YPLM
Sbjct  526  NLKSTVKNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLM  585

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE E+N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPN
Sbjct  586  QKLRQVLVEHALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPN  645

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+G
Sbjct  646  RIKECRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDG  705

Query  195  APLPIC  178
            APLPIC
Sbjct  706  APLPIC  711



>dbj|BAF36968.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=690

 Score =   322 bits (826),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+++VK+TVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDRE +FAY DDPC A YPLM
Sbjct  505  NLKHSVKSTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDRETLFAYIDDPCLATYPLM  564

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE+EK+  TSIFQKIA FEDELK+LLPKEVE AR+A E+GNPAIPN
Sbjct  565  QKLRQVLVDHALVNGENEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPAIPN  624

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGTE+LTGEK +SPGE  DK+FTA+C G IIDPL+ECL  WNG
Sbjct  625  KINECRSYPLYKFVREELGTELLTGEKTRSPGEEFDKLFTAICQGKIIDPLMECLGEWNG  684

Query  195  APLPIC  178
            APLPIC
Sbjct  685  APLPIC  690



>gb|AHZ30594.1| phenylalanine ammonia lyase-2, partial [Prunus domestica]
Length=701

 Score =   323 bits (827),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLM
Sbjct  519  NLRNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLM  578

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE+EKN STSIFQKI AFE+ELK LLPKEV+  R+AL++G+  +PN
Sbjct  579  QKLRQVLVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSXRAALDSGSAGVPN  638

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECR YPLYKF+REELG E LTGEKV+SPGE CDKVF+A+C+G IIDP+LECL+ WNG
Sbjct  639  RITECRFYPLYKFVREELGAEYLTGEKVRSPGEECDKVFSAICEGKIIDPILECLEGWNG  698

Query  195  APL  187
            APL
Sbjct  699  APL  701



>sp|Q01861.1|PAL1_PEA RecName: Full=Phenylalanine ammonia-lyase 1 [Pisum sativum]
 dbj|BAA00885.1| phenylalanine ammonia-lyase [Pisum sativum]
 dbj|BAA00886.1| phenylalanine ammonia-lyase [Pisum sativum]
Length=723

 Score =   323 bits (828),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N+VKN VSQVAKRTLT GVNGELHPSRFCEKDLLRVVDRE+VFAY DDPCSA YPLM
Sbjct  538  NLKNSVKNIVSQVAKRTLTTGVNGELHPSRFCEKDLLRVVDREHVFAYIDDPCSATYPLM  597

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE EKN++TSIFQKIA FEDELK LLPKEVE  R+A E+GNP +PN
Sbjct  598  QKLRQVLVDHALVNGESEKNLNTSIFQKIATFEDELKTLLPKEVESTRAAYESGNPTVPN  657

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I  CRSYPLY+F+R+ELGT +LTGEKV SPGE CDK+FTA+C G IIDPLL+CL  WNG
Sbjct  658  KINGCRSYPLYRFVRQELGTGLLTGEKVISPGEECDKLFTAICQGKIIDPLLQCLGDWNG  717

Query  195  APLPIC  178
            APLPI 
Sbjct  718  APLPIS  723



>gb|AFN85669.1| phenylalanine ammonia-lyase [Hibiscus cannabinus]
Length=715

 Score =   323 bits (828),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQ+ K+TLT G NGELHPSRF EKDLL+VVD EYVFAY DDPCSA YPLM
Sbjct  530  NLRNTVKNTVSQIVKKTLTTGANGELHPSRFSEKDLLKVVDCEYVFAYVDDPCSATYPLM  589

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE+EKN STSIFQKIAAFE+ELK +LPKEVE AR +LENGN AIPN
Sbjct  590  QKLRQVLVEHALTNGENEKNTSTSIFQKIAAFEEELKVVLPKEVESARVSLENGNAAIPN  649

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI +CRSYPLYKF+REE+GT +LTGEKV+SPGE  DKVFTA+C G IIDP+LECLK WNG
Sbjct  650  RIKDCRSYPLYKFVREEIGTGLLTGEKVKSPGEEFDKVFTAICQGKIIDPMLECLKEWNG  709

Query  195  APLPIC  178
            APLPIC
Sbjct  710  APLPIC  715



>prf||2001451A Phe ammonia lyase
Length=723

 Score =   323 bits (828),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N+VKN VSQVAKRTLT GVNGELHPSRFCEKDLLRVVDRE+VFAY DDPCSA YPLM
Sbjct  538  NLKNSVKNIVSQVAKRTLTTGVNGELHPSRFCEKDLLRVVDREHVFAYIDDPCSATYPLM  597

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE EKN++TSIFQKIA FEDELK LLPKEVE  R+A E+GNP +PN
Sbjct  598  QKLRQVLVDHALVNGESEKNLNTSIFQKIATFEDELKTLLPKEVESTRAAYESGNPTVPN  657

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I  CRSYPLY+F+R+ELGT +LTGEKV SPGE CDK+FTA+C G IIDPLL+CL  WNG
Sbjct  658  KINGCRSYPLYRFVRQELGTGLLTGEKVISPGEECDKLFTAICQGKIIDPLLQCLGDWNG  717

Query  195  APLPIC  178
            APLPI 
Sbjct  718  APLPIS  723



>gb|KHG29664.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=721

 Score =   323 bits (827),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQ+AK+TLT G NGELHPSRFCEKDLL+ VDREYVF Y DDPCSA YPLM
Sbjct  536  NLRNTVKNTVSQIAKKTLTTGANGELHPSRFCEKDLLKAVDREYVFVYIDDPCSATYPLM  595

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE EKN STSIFQKIA FE+EL A+LPKEVE AR  LENGN AIPN
Sbjct  596  QKLRQVLVEHALTNGESEKNTSTSIFQKIADFEEELHAVLPKEVESARVTLENGNAAIPN  655

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
             I +CRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G IIDP+LECLK WNG
Sbjct  656  MIKDCRSYPLYKFVREELGTGLLTGEKVKSPGEEFDKVFTAMCQGKIIDPMLECLKEWNG  715

Query  195  APLPIC  178
            APLPIC
Sbjct  716  APLPIC  721



>emb|CAL91038.1| phenylalanine ammonia-lyase 4 [Cynara cardunculus var. scolymus]
Length=339

 Score =   311 bits (796),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            N+++ VKNTVSQVAK+ LTMGVNGELHPSRFCEKDLLRVVDREYVFAY DDPCSA YPLM
Sbjct  154  NMKSTVKNTVSQVAKKVLTMGVNGELHPSRFCEKDLLRVVDREYVFAYIDDPCSATYPLM  213

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            Q+LRQVLVDHAL NGE EKN +TSIFQKIA FEDELKA+LPKEVE  R+A E  + +IPN
Sbjct  214  QRLRQVLVDHALNNGETEKNTNTSIFQKIATFEDELKAILPKEVESVRTAYETDSLSIPN  273

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI  CRSYPLY+F+REELG   LTGEKV SPGE  DKVFTA+C G +IDPLLEC++ WNG
Sbjct  274  RIKACRSYPLYRFVREELGGGFLTGEKVTSPGEEFDKVFTAMCKGELIDPLLECVEGWNG  333

Query  195  APLPIC  178
            APLPIC
Sbjct  334  APLPIC  339



>gb|KJB36583.1| hypothetical protein B456_006G166000 [Gossypium raimondii]
Length=720

 Score =   322 bits (826),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR+ VKNTVSQ+AK+ LT G NGELHPSRFCEKDLL+ VDREYVFAY DDPCSA YPLM
Sbjct  535  NLRSTVKNTVSQIAKKVLTTGANGELHPSRFCEKDLLKAVDREYVFAYIDDPCSATYPLM  594

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE+EKN STSIFQKIAAFE+ELKA+LPKEVE AR+++ENGN AIPN
Sbjct  595  QKLRQVLVEHALTNGENEKNASTSIFQKIAAFEEELKAVLPKEVESARASVENGNAAIPN  654

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRS+PLYKF+REELGT +LTGE V SPGE  DKVFTA+C G IIDP+LECL+ WNG
Sbjct  655  KIKECRSFPLYKFVREELGTGLLTGENVMSPGEEFDKVFTAMCQGRIIDPMLECLEEWNG  714

Query  195  APLPIC  178
            APLPIC
Sbjct  715  APLPIC  720



>ref|XP_006439143.1| hypothetical protein CICLE_v10010874mg [Citrus clementina]
 gb|ESR52383.1| hypothetical protein CICLE_v10010874mg [Citrus clementina]
Length=308

 Score =   310 bits (793),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNT+SQ AK+ LTMGVNGELHPSRFCEKDLL+VVDREYVF+YADDPCSA YPLM
Sbjct  123  NLKSTVKNTISQAAKKVLTMGVNGELHPSRFCEKDLLKVVDREYVFSYADDPCSATYPLM  182

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            +KLRQVLVDHAL N E  KN + SIF KI AFE+ELK LLPKEVE ARSA E+GN  IPN
Sbjct  183  RKLRQVLVDHALTNNEDLKNANASIFLKIGAFEEELKTLLPKEVESARSAFESGNLEIPN  242

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLY+F+REELG   LTGEK  SPGE CDKVFTA+C G IIDPLLECLK W+G
Sbjct  243  RIKECRSYPLYRFVREELGARYLTGEKAISPGEECDKVFTAICQGKIIDPLLECLKEWDG  302

Query  195  APLPIC  178
            +PLPIC
Sbjct  303  SPLPIC  308



>gb|AGA84059.1| phenylalanine ammonia lyase [Picrorhiza kurrooa]
Length=713

 Score =   322 bits (825),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR AVKNT+SQVAKRTLTMG NGELHPSRF E DLLRVVDREYVFAY DDPCSA YPLM
Sbjct  528  NLRLAVKNTLSQVAKRTLTMGANGELHPSRFSELDLLRVVDREYVFAYVDDPCSATYPLM  587

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVD+AL+NGE EKN STSIF KI AFE+ELK+LLPKEVE AR ALE GNPAI N
Sbjct  588  QKLRQVLVDNALKNGESEKNASTSIFHKIEAFEEELKSLLPKEVESARIALEAGNPAIGN  647

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKFIREELGTE LTGEKV SPGE CDK+FTA+  G I+DPLL+CL+ WNG
Sbjct  648  RIKECRSYPLYKFIREELGTEYLTGEKVISPGEECDKIFTAISKGLIVDPLLKCLEGWNG  707

Query  195  APLPIC  178
            APLPIC
Sbjct  708  APLPIC  713



>gb|AAQ74878.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=711

 Score =   322 bits (825),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCSA YPLM
Sbjct  526  NLKSTVKNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLM  585

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE E N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPN
Sbjct  586  QKLRQVLVEHALVNGERETNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPN  645

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+G
Sbjct  646  RIKECRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDG  705

Query  195  APLPIC  178
            APLPIC
Sbjct  706  APLPIC  711



>ref|XP_003542541.1| PREDICTED: phenylalanine ammonia-lyase class 2-like [Glycine 
max]
Length=716

 Score =   322 bits (825),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKN VSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREY FAY DDPCS  YPLM
Sbjct  531  NLKNTVKNVVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYTFAYIDDPCSGTYPLM  590

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVD+AL NGE+EKN +TSIFQKIA FE+ELK LLPKEVEGAR A EN   AIPN
Sbjct  591  QKLRQVLVDYALANGENEKNTNTSIFQKIATFEEELKTLLPKEVEGARVAYENDQCAIPN  650

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGE+V SPGE CDKVFTA+C G IIDPLLECL  WNG
Sbjct  651  KIKECRSYPLYKFVREELGTALLTGERVVSPGEECDKVFTAMCQGKIIDPLLECLGEWNG  710

Query  195  APLPIC  178
            APLPIC
Sbjct  711  APLPIC  716



>gb|AEX32790.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   322 bits (825),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++AVK TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLM
Sbjct  525  NLKSAVKKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLM  584

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QK+RQVLV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPN
Sbjct  585  QKVRQVLVEHALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPN  644

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNG
Sbjct  645  RIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAICEGKIIDPLLDCLSAWNG  704

Query  195  APLPIC  178
            APLPIC
Sbjct  705  APLPIC  710



>ref|XP_002281799.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   322 bits (825),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+  VKNT+S +AK+TLT GVNGELHPSRFCEKDLL+VVDREY+FAY DDPCS  YPLM
Sbjct  525  NLKITVKNTISHIAKKTLTTGVNGELHPSRFCEKDLLKVVDREYIFAYIDDPCSETYPLM  584

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QK+RQVLV+HAL NGE+EKNVSTSIFQKI AFE+ELKALLPKEVE  R+ LE+GNP IPN
Sbjct  585  QKVRQVLVEHALNNGENEKNVSTSIFQKIVAFEEELKALLPKEVESTRAGLESGNPFIPN  644

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI +CRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL  WNG
Sbjct  645  RIKDCRSYPLYKFVREELGTGLLTGEKVRSPGEEFDKVFTAMCEGKIIDPLLDCLSGWNG  704

Query  195  APLPIC  178
            APLPIC
Sbjct  705  APLPIC  710



>ref|XP_004234632.2| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=720

 Score =   322 bits (825),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQVAKRTLTMG NGELHP+RF EK+LLRVVDREY+FAY DDPCS+NYPLM
Sbjct  535  NLKSVVKNTVSQVAKRTLTMGANGELHPARFSEKELLRVVDREYLFAYVDDPCSSNYPLM  594

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVD A++NGE EKNV++SIFQKI AFEDEL A+LPKEVE  R+ +E+GNP I N
Sbjct  595  QKLRQVLVDQAMKNGESEKNVNSSIFQKIGAFEDELIAVLPKEVESVRAVVESGNPLIRN  654

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLY+ +REELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLK WNG
Sbjct  655  RITECRSYPLYRLVREELGTELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKRWNG  714

Query  195  APLPIC  178
            APLPIC
Sbjct  715  APLPIC  720



>ref|XP_002519521.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF42935.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=714

 Score =   322 bits (825),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR AVKNTVSQVAKR LT G NGELHPSRFCEKDLL+VVDREYVFAYADDPCSA YPLM
Sbjct  529  NLRQAVKNTVSQVAKRVLTTGANGELHPSRFCEKDLLKVVDREYVFAYADDPCSATYPLM  588

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQ+LV+HAL NGE+EKN  TS+FQKI+AFE+ELK LLPKEVE  R A E+GNPA  N
Sbjct  589  QKLRQILVEHALANGENEKNAGTSVFQKISAFEEELKTLLPKEVESVRIAYESGNPATAN  648

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTG+KV SPGE  DKVFTA+C G IIDP+++CLK WNG
Sbjct  649  RIKECRSYPLYKFVREELGTGLLTGDKVMSPGEEFDKVFTAMCQGKIIDPMMDCLKEWNG  708

Query  195  APLPIC  178
            APLPIC
Sbjct  709  APLPIC  714



>ref|XP_007027354.1| PHE ammonia lyase 1 [Theobroma cacao]
 gb|EOY07856.1| PHE ammonia lyase 1 [Theobroma cacao]
Length=722

 Score =   322 bits (825),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQ+AK+ LT G NGELHPSRF EKDLL+ VD EYVFAY DDPCSA YPLM
Sbjct  537  NLRNTVKNTVSQIAKKILTTGANGELHPSRFSEKDLLKAVDSEYVFAYIDDPCSATYPLM  596

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE+EKN STSIFQK+AAFE+ELKA+LPKEVE AR +LENGN  IPN
Sbjct  597  QKLRQVLVEHALANGENEKNASTSIFQKVAAFEEELKAILPKEVESARLSLENGNAGIPN  656

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGE V+SPGE  DKVFTA+C G IIDP+LECLK WNG
Sbjct  657  RIQECRSYPLYKFVREELGTGLLTGENVKSPGEEFDKVFTAMCQGKIIDPMLECLKEWNG  716

Query  195  APLPIC  178
            APLPIC
Sbjct  717  APLPIC  722



>gb|AEX32784.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   322 bits (824),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VK TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLM
Sbjct  525  NLKSTVKKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLM  584

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QK+RQVLV+HAL NGE+EKN STSIFQKIAAFE+ELKA+LPKEVE AR  +E+GNP+IPN
Sbjct  585  QKVRQVLVEHALNNGENEKNGSTSIFQKIAAFEEELKAVLPKEVESARGGVESGNPSIPN  644

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNG
Sbjct  645  RIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNG  704

Query  195  APLPIC  178
            APLPIC
Sbjct  705  APLPIC  710



>gb|KEH24019.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   322 bits (825),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N+VKNTVSQVAK+TLT+GVNGEL PSR CEKDLL+VVDRE+VFAY DDPCSA YPL 
Sbjct  539  NLKNSVKNTVSQVAKKTLTIGVNGELQPSRLCEKDLLKVVDREHVFAYIDDPCSATYPLS  598

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE EKN++TSIFQKIA FE+ELK+LLPKEVE AR+A E+GNP IPN
Sbjct  599  QKLRQVLVDHALVNGESEKNLNTSIFQKIATFEEELKSLLPKEVESARTAYESGNPTIPN  658

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I  CRSYPLYKF+REELGT +LTGE V SPGEVCDK+FTA+C G IIDPLLECL  WNG
Sbjct  659  KINGCRSYPLYKFVREELGTGLLTGENVISPGEVCDKLFTAMCQGKIIDPLLECLGEWNG  718

Query  195  APLPIC  178
            APLPIC
Sbjct  719  APLPIC  724



>dbj|BAF36967.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=730

 Score =   322 bits (825),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+ +VK+TVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDRE VFAY DDPC A YPLM
Sbjct  545  NLKYSVKSTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREAVFAYIDDPCLATYPLM  604

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE+EK+  TSIFQKIA FEDELK+LLPKEVE AR+A E+GNP I N
Sbjct  605  QKLRQVLVDHALVNGENEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPTISN  664

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGTE+LTGEK +SPGE CDK+FTA+C G IIDPLLECL  WNG
Sbjct  665  KINECRSYPLYKFVREELGTELLTGEKSRSPGEECDKLFTAICQGKIIDPLLECLGEWNG  724

Query  195  APLPIC  178
            APLPIC
Sbjct  725  APLPIC  730



>gb|AFQ92048.1| phenylalanine ammonia-lyase, partial [Pyrus pyrifolia]
Length=234

 Score =   306 bits (784),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 160/185 (86%), Gaps = 0/185 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VK TVSQVAKR LT+G+NGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLM
Sbjct  49   NLKSTVKTTVSQVAKRVLTVGLNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLM  108

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLR VLV+HAL NGE E +  TSIFQKI AFE+ELK LLPKEV+ A +  ENG  AIPN
Sbjct  109  QKLRHVLVEHALSNGEKEISTGTSIFQKITAFEEELKTLLPKEVDNAWAEYENGKTAIPN  168

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT++LTG+KV+SPGE CDKVF A+C G +IDPLL+CLK WNG
Sbjct  169  RIKECRSYPLYKFVREELGTDLLTGDKVRSPGEECDKVFNAMCAGKLIDPLLDCLKEWNG  228

Query  195  APLPI  181
            APLPI
Sbjct  229  APLPI  233



>ref|NP_001266106.1| phenylalanine ammonia-lyase 2 [Cicer arietinum]
 sp|Q9SMK9.1|PAL2_CICAR RecName: Full=Phenylalanine ammonia-lyase 2 [Cicer arietinum]
 emb|CAB60719.1| phenylalanine ammonia-lyase [Cicer arietinum]
Length=718

 Score =   322 bits (824),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQVAKR LT+GVNGELHPSRFCEKDLL VV+REYVFAY DDPCSA YPLM
Sbjct  533  NLKSVVKNTVSQVAKRVLTVGVNGELHPSRFCEKDLLNVVEREYVFAYIDDPCSATYPLM  592

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLR VLVDHAL+NG+ E N STSIFQKI AFE ELK LLPKEVE  R  +ENGNPA+PN
Sbjct  593  QKLRHVLVDHALENGDREGNSSTSIFQKIGAFEQELKTLLPKEVESVRVDVENGNPAVPN  652

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+RE LGT +LTGEK++SPGE CDKVF A+CDG  IDP+L+CLK WNG
Sbjct  653  RIIECRSYPLYKFVRENLGTSLLTGEKIRSPGEECDKVFAALCDGRFIDPMLDCLKEWNG  712

Query  195  APLPIC  178
            APLPIC
Sbjct  713  APLPIC  718



>gb|AAN52279.1|AF480619_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=714

 Score =   321 bits (823),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR+AVKNTVS V+KR LT G NGELHPSRFCEK+LL+VVDRE VFAYADDPCSA YPLM
Sbjct  529  NLRSAVKNTVSHVSKRVLTTGANGELHPSRFCEKELLKVVDREDVFAYADDPCSATYPLM  588

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE+EKN STS+FQKIAAFEDELKALLPKEVE AR+A ++GN AI N
Sbjct  589  QKLRQVLVDHALANGENEKNASTSVFQKIAAFEDELKALLPKEVESARAAYDSGNSAIEN  648

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGE V+SPGE  DKVFTA+C+G IIDP+LECL  WNG
Sbjct  649  KIKECRSYPLYKFVREELGTGLLTGENVRSPGEEFDKVFTAMCEGKIIDPMLECLGEWNG  708

Query  195  APLPIC  178
            APLPIC
Sbjct  709  APLPIC  714



>gb|AEE81750.1| phenylalanine ammonia lyase [Morus alba var. multicaulis]
Length=726

 Score =   322 bits (824),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQVAKR LT GVNGELHPSRFCEKDLL+VVDREYV+AY DDPCSA YPLM
Sbjct  541  NLKHTVKNTVSQVAKRVLTTGVNGELHPSRFCEKDLLKVVDREYVYAYIDDPCSATYPLM  600

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            Q LRQVLV+HAL NGE EKN STSIFQKIAAFE+ELKALLPKEVE AR+A ENGN AI N
Sbjct  601  QTLRQVLVEHALTNGESEKNTSTSIFQKIAAFEEELKALLPKEVESARTAYENGNAAISN  660

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +ITECRSYPLYKF+RE+LGT +LTGEKV+SPGE  DKV+TA+C G +IDP+L CL  WNG
Sbjct  661  KITECRSYPLYKFVREQLGTSLLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLACLSGWNG  720

Query  195  APLPIC  178
             PLPIC
Sbjct  721  EPLPIC  726



>ref|XP_003635657.2| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   321 bits (823),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VK TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLM
Sbjct  525  NLKSTVKKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLM  584

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QK+RQVLV+HAL NGE+EKN STSIFQKIAAFE+ELKA+LPKEVE AR  +E+GNP+IPN
Sbjct  585  QKVRQVLVEHALNNGENEKNGSTSIFQKIAAFEEELKAVLPKEVESARGGVESGNPSIPN  644

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNG
Sbjct  645  RIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNG  704

Query  195  APLPIC  178
            APLPIC
Sbjct  705  APLPIC  710



>ref|XP_006290660.1| hypothetical protein CARUB_v10016752mg [Capsella rubella]
 gb|EOA23558.1| hypothetical protein CARUB_v10016752mg [Capsella rubella]
Length=718

 Score =   321 bits (823),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR  VKNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE VF YADDPCSA YPLM
Sbjct  533  NLRQTVKNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVFTYADDPCSATYPLM  592

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQV+VDHAL NGE EKN  TSIFQKI AFE+ELKA+LPKEVE  R+A  +GN AIPN
Sbjct  593  QKLRQVIVDHALSNGETEKNAGTSIFQKIGAFEEELKAVLPKEVEATRAAYGSGNAAIPN  652

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT++LTGEKV SPGE  DKVFTA+C+G IIDPL++CLK WNG
Sbjct  653  RIKECRSYPLYKFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMDCLKEWNG  712

Query  195  APLPIC  178
            AP+PIC
Sbjct  713  APIPIC  718



>gb|AIL23235.1| phenylalanine ammonia-lyase [Astragalus chrysochlorus]
Length=719

 Score =   321 bits (823),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKNTVSQVAKRTLTMGVNGELHPSRFCEKDLL+VVDREYVFAY DDPC A YP+M
Sbjct  534  NLKNTVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCLATYPMM  593

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL N E EKN++TSIFQKIA FEDELKALLPKEVE  R+A ENG  AIPN
Sbjct  594  QKLRQVLVDHALANAEAEKNMNTSIFQKIATFEDELKALLPKEVENTRAAYENGQCAIPN  653

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+R ELGTE+LTGEKV SPGE  DK+FTA+C G IIDPLLECL  WNG
Sbjct  654  KIKECRSYPLYKFVRGELGTELLTGEKVISPGEEFDKLFTAMCQGKIIDPLLECLGEWNG  713

Query  195  APLPI  181
            APLPI
Sbjct  714  APLPI  718



>sp|P45730.1|PALY_POPTR RecName: Full=Phenylalanine ammonia-lyase [Populus trichocarpa]
 pir||JQ2265 phenylalanine ammonia-lyase (EC 4.3.1.5) - western balsam poplar 
x cottonwood
 gb|AAA33805.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=715

 Score =   321 bits (823),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++AVKNTVSQV+KR LT G NGELHPSRFCEK+LL+VVDREYVFAY DDPCSA YPLM
Sbjct  530  NLKSAVKNTVSQVSKRVLTTGANGELHPSRFCEKELLKVVDREYVFAYVDDPCSATYPLM  589

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQV VDHAL+NGE+EKN STS+FQKI AFE+ELKALLPKEVE AR+A ++GN AI N
Sbjct  590  QKLRQVFVDHALENGENEKNFSTSVFQKIEAFEEELKALLPKEVESARAAYDSGNSAIDN  649

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGEKVQSPGE  DKVFTA+C G IIDP+LECL  WNG
Sbjct  650  KIKECRSYPLYKFVREELGTVLLTGEKVQSPGEEFDKVFTAMCQGKIIDPMLECLGEWNG  709

Query  195  APLPIC  178
            +PLPIC
Sbjct  710  SPLPIC  715



>gb|AAF40224.1|AF237955_1 phenylalanine ammonia-lyase 2 [Rubus idaeus]
Length=730

 Score =   322 bits (824),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQ+AKR LT GVNGELHPSRFCEKDLL VV+REY+FAY DDPCSA YPLM
Sbjct  545  NLKSTVKNTVSQLAKRVLTTGVNGELHPSRFCEKDLLMVVEREYLFAYIDDPCSATYPLM  604

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            Q+LRQVLV+HAL NGE+EKN STSIFQKI AFE+ELK +LPKEVE AR+A E+GN AIPN
Sbjct  605  QRLRQVLVEHALTNGENEKNASTSIFQKITAFEEELKTILPKEVESARAAYESGNAAIPN  664

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELG E LTGEKV+SPGE CDKVFTA+C G IIDP+L+CL  WNG
Sbjct  665  RIVECRSYPLYKFVREELGGEFLTGEKVRSPGEECDKVFTAMCQGNIIDPILDCLSGWNG  724

Query  195  APLPIC  178
             PLPIC
Sbjct  725  EPLPIC  730



>gb|AFZ78653.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   321 bits (823),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCSA YPLM
Sbjct  526  NLKSTVKNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLM  585

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            Q LRQVLV+HAL NGE E+N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPN
Sbjct  586  QNLRQVLVEHALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPN  645

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+G
Sbjct  646  RIKECRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDG  705

Query  195  APLPIC  178
            APLPIC
Sbjct  706  APLPIC  711



>ref|XP_002315308.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63891.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF01479.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   321 bits (823),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCSA YPLM
Sbjct  526  NLKSTVKNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLM  585

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            Q LRQVLV+HAL NGE E+N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPN
Sbjct  586  QNLRQVLVEHALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPN  645

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+G
Sbjct  646  RIKECRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDG  705

Query  195  APLPIC  178
            APLPIC
Sbjct  706  APLPIC  711



>gb|KHG18863.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=720

 Score =   321 bits (823),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR+ VKNTVSQ+AK+ LT G NGELHPSRFCEKDLL+ VDREYVFAY DDPCSA Y +M
Sbjct  535  NLRSTVKNTVSQIAKKVLTTGANGELHPSRFCEKDLLKAVDREYVFAYIDDPCSATYSMM  594

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE+EKN STSIFQKIAAFE+ELKA+LPKEVE AR+++ENGN AIPN
Sbjct  595  QKLRQVLVEHALTNGENEKNASTSIFQKIAAFEEELKAVLPKEVESARASVENGNAAIPN  654

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRS+PLYKF+REELGT +LTGE V SPGE  DKVFTA+C G IIDP+LECLK WNG
Sbjct  655  KIKECRSFPLYKFVREELGTGLLTGENVMSPGEEFDKVFTAMCQGKIIDPMLECLKEWNG  714

Query  195  APLPIC  178
            APLPIC
Sbjct  715  APLPIC  720



>ref|XP_002322884.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63887.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF04645.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=715

 Score =   321 bits (823),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++AVKNTVSQV+KR LT G NGELHPSRFCEK+LL+VVDREYVFAY DDPCSA YPLM
Sbjct  530  NLKSAVKNTVSQVSKRVLTTGANGELHPSRFCEKELLKVVDREYVFAYVDDPCSATYPLM  589

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQV VDHAL+NGE+EKN STS+FQKI AFE+ELKALLPKEVE AR+A ++GN AI N
Sbjct  590  QKLRQVFVDHALENGENEKNFSTSVFQKIEAFEEELKALLPKEVESARAAYDSGNSAIDN  649

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGEKVQSPGE  DKVFTA+C G IIDP+LECL  WNG
Sbjct  650  KIKECRSYPLYKFVREELGTVLLTGEKVQSPGEEFDKVFTAMCQGKIIDPMLECLGEWNG  709

Query  195  APLPIC  178
            +PLPIC
Sbjct  710  SPLPIC  715



>gb|KJB73539.1| hypothetical protein B456_011G238400 [Gossypium raimondii]
Length=710

 Score =   321 bits (822),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKNTVSQVAKR LTMG NGELHPSRFCEKDLLRVVDREY++AYADDPCSANYPL+
Sbjct  525  NLKNTVKNTVSQVAKRVLTMGSNGELHPSRFCEKDLLRVVDREYLYAYADDPCSANYPLI  584

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NG+ EK+ +TSIFQKI  FE+ELK  LPKEVE AR+  ENG+PAI N
Sbjct  585  QKLRQVLVDHALMNGDREKDSTTSIFQKIGVFEEELKTQLPKEVESARTEFENGSPAIAN  644

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+RE LGT +LTGEKV SPGE CDKVFTA+C G +IDPLL+CLK WNG
Sbjct  645  KIEECRSYPLYKFVREVLGTHLLTGEKVISPGEECDKVFTAMCAGKLIDPLLDCLKDWNG  704

Query  195  APLPIC  178
            APLPIC
Sbjct  705  APLPIC  710



>gb|AAK60275.1|AF383152_1 phenylalanine ammonia-lyase 2 [Manihot esculenta]
Length=712

 Score =   321 bits (822),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++AVKNTVSQVAKR LT G +GELHPSRFCEKDLL+VVDRE VF+Y DD CSA YPLM
Sbjct  527  NLKHAVKNTVSQVAKRILTTGASGELHPSRFCEKDLLKVVDREQVFSYVDDACSATYPLM  586

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE EKN STSIFQKI AFE+ELKALLPKEVE AR A ENGNPAI N
Sbjct  587  QKLRQVLVDHALANGESEKNASTSIFQKIRAFEEELKALLPKEVESAREAYENGNPAIAN  646

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REE+GT +LTGEK++SPGE  DKVFTA+C G IIDP+L+CLK WNG
Sbjct  647  KIKECRSYPLYKFVREEIGTGLLTGEKIRSPGEEFDKVFTAMCQGKIIDPMLDCLKEWNG  706

Query  195  APLPIC  178
            APLPIC
Sbjct  707  APLPIC  712



>emb|CDX91331.1| BnaC04g08190D [Brassica napus]
Length=380

 Score =   311 bits (796),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+  VKNTVSQVAK+ LT G NGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+
Sbjct  195  NLKQTVKNTVSQVAKKVLTTGDNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLI  254

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LP EVE AR A +NG  AIPN
Sbjct  255  QKLRQVIVDHALVNGESEKNAMTSIFHKIGAFEEELKAVLPDEVEAARVAYDNGTSAIPN  314

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLY+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDPL+ECL  WNG
Sbjct  315  RIKECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPLMECLSEWNG  374

Query  195  APLPIC  178
            AP+PIC
Sbjct  375  APIPIC  380



>dbj|BAA21643.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=715

 Score =   320 bits (821),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR+AVKNTVS V+KR LT G NGELHPSRFCEK+LL+VVDRE VFAYADDPCSA YPLM
Sbjct  530  NLRSAVKNTVSHVSKRVLTTGANGELHPSRFCEKELLKVVDREDVFAYADDPCSATYPLM  589

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE+EKN STS+FQKIAAFEDELKALLPKEVE AR+A ++GN AI N
Sbjct  590  QKLRQVLVDHALANGENEKNASTSVFQKIAAFEDELKALLPKEVESARAAYDSGNSAIEN  649

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGE V+SPGE  DKVFTA+C G IIDP+LECL  WNG
Sbjct  650  KIKECRSYPLYKFVREELGTGLLTGENVRSPGEEFDKVFTAMCQGKIIDPMLECLGEWNG  709

Query  195  APLPIC  178
            APLPIC
Sbjct  710  APLPIC  715



>gb|AIY26016.1| PAL [Jasminum sambac]
Length=712

 Score =   320 bits (821),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR  VKNTVSQVAKRTLTMG NGELHPSRF EKDLLRVVDREY+FAY DDPCS  YPLM
Sbjct  527  NLRQTVKNTVSQVAKRTLTMGANGELHPSRFAEKDLLRVVDREYLFAYIDDPCSTTYPLM  586

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL N E+EK+ STSIFQKI AFEDELKA+LPKEVE +R ALE+GNPAIPN
Sbjct  587  QKLRQVLVEHALNNTENEKSGSTSIFQKIEAFEDELKAVLPKEVESSRVALESGNPAIPN  646

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI +CRSYPLYKF+R+EL TE LTGE+V SPGEV DKVFTA+  G +IDP+LECLK WNG
Sbjct  647  RIKDCRSYPLYKFVRDELKTEFLTGERVTSPGEVLDKVFTAMSKGLMIDPMLECLKGWNG  706

Query  195  APLPIC  178
            APLPIC
Sbjct  707  APLPIC  712



>sp|Q40910.1|PAL4_POPKI RecName: Full=Phenylalanine ammonia-lyase G4, partial [Populus 
sieboldii x Populus grandidentata]
 dbj|BAA07861.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=571

 Score =   317 bits (811),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDREYVF Y DDPCSA YPLM
Sbjct  386  NLKNTVKNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREYVFTYIDDPCSATYPLM  445

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE E+N STSIFQKI AFE+ELK LLPKEVE AR  LENGNPAIPN
Sbjct  446  QKLRQVLVDHALMNGEKEQNSSTSIFQKIGAFEEELKILLPKEVESARLELENGNPAIPN  505

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RIT+ RSYPLYKF+REELGT +LTGEKV SPGE  DKVFTA+C G +IDP    LK WNG
Sbjct  506  RITDRRSYPLYKFVREELGTVLLTGEKVGSPGEEFDKVFTAICAGKLIDPCWSVLKEWNG  565

Query  195  APLPIC  178
            APLP+C
Sbjct  566  APLPLC  571



>ref|XP_010426963.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Camelina sativa]
Length=718

 Score =   320 bits (821),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR  VKNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE VF Y DDPCSA YPLM
Sbjct  533  NLRQTVKNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLM  592

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQV+VDHAL NGE EKN  TSIFQKI AFE+ELKA+LPKEVE  R+A  NG  AIPN
Sbjct  593  QKLRQVIVDHALSNGETEKNAGTSIFQKIGAFEEELKAVLPKEVEATRAAYGNGTAAIPN  652

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLYKF+REELGT++LTGEKV SPGE  DKVFTA+C+G +IDPL++CLK WNG
Sbjct  653  RITECRSYPLYKFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKMIDPLMDCLKEWNG  712

Query  195  APLPIC  178
            AP+PIC
Sbjct  713  APIPIC  718



>gb|KDO36715.1| hypothetical protein CISIN_1g016039mg [Citrus sinensis]
Length=396

 Score =   311 bits (796),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNT+SQVAK+ LTMGVNGELHPSRFCEKDLL+VVDREYVF+YADDPCSA YPLM
Sbjct  211  NLKSTVKNTISQVAKKVLTMGVNGELHPSRFCEKDLLKVVDREYVFSYADDPCSATYPLM  270

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            +KLRQVLVDHAL N E  KN + SIF KI AFE+ELK LLPKEVE ARSA E+GN  IPN
Sbjct  271  RKLRQVLVDHALTNNEDLKNANASIFLKIGAFEEELKTLLPKEVESARSAFESGNLEIPN  330

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLY+F+REELG   LTGEK  SPGE CDKVFTA+C G IIDPLLECLK W+G
Sbjct  331  RIKECRSYPLYRFVREELGARYLTGEKAISPGEECDKVFTAICQGKIIDPLLECLKEWDG  390

Query  195  APLPIC  178
            +PLPIC
Sbjct  391  SPLPIC  396



>pir||S60043 phenylalanine ammonia-lyase (EC 4.3.1.5) 4 - Japanese aspen x 
large-toothed aspen (fragment)
Length=582

 Score =   317 bits (811),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDREYVF Y DDPCSA YPLM
Sbjct  397  NLKNTVKNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREYVFTYIDDPCSATYPLM  456

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE E+N STSIFQKI AFE+ELK LLPKEVE AR  LENGNPAIPN
Sbjct  457  QKLRQVLVDHALMNGEKEQNSSTSIFQKIGAFEEELKILLPKEVESARLELENGNPAIPN  516

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RIT+ RSYPLYKF+REELGT +LTGEKV SPGE  DKVFTA+C G +IDP    LK WNG
Sbjct  517  RITDRRSYPLYKFVREELGTVLLTGEKVGSPGEEFDKVFTAICAGKLIDPCWSVLKEWNG  576

Query  195  APLPIC  178
            APLP+C
Sbjct  577  APLPLC  582



>gb|ADO64252.1| PAL [Epimedium sagittatum]
Length=708

 Score =   320 bits (820),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR+ VK+TVSQVAK+ LTMGVNGELHPSRFCEKDLL+V+DREY+FAY DDPCSA YPLM
Sbjct  523  NLRSCVKSTVSQVAKKVLTMGVNGELHPSRFCEKDLLKVIDREYIFAYIDDPCSATYPLM  582

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NG++EK+++TSIFQKI+ FE+ELKALLPKEVE  R+A+E+GNP IPN
Sbjct  583  QKLRQVLVDHALLNGQNEKDLNTSIFQKISTFEEELKALLPKEVESMRTAIESGNPLIPN  642

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGTE+LTGEKV+SPGE  DKVFTA+C G +IDPLL C+  W G
Sbjct  643  RIKECRSYPLYKFVREELGTELLTGEKVRSPGEEIDKVFTAICQGKLIDPLLACVSEWYG  702

Query  195  APLPIC  178
            +PLPIC
Sbjct  703  SPLPIC  708



>gb|AGW27206.1| phenylalanine ammonia-lyase 3 [Salvia miltiorrhiza]
Length=760

 Score =   321 bits (823),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR AVKNTVSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAY DDPC A YPLM
Sbjct  575  NLRLAVKNTVSQVAKRTLTMGANGELHPSRFCEKDLLRVVDREYVFAYVDDPCLATYPLM  634

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL+NG+ EKN STSIFQKI AFE EL+ LLPKEVEGARSALE GNPAI N
Sbjct  635  QKLRQVLVDHALKNGDGEKNPSTSIFQKIEAFEAELEVLLPKEVEGARSALEAGNPAIGN  694

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELG E LTGEK  SPGE  +KVFTA+ +G ++DPLL+CL+SWNG
Sbjct  695  RIKECRSYPLYKFVREELGAEFLTGEKATSPGEEGEKVFTALSNGLLVDPLLKCLESWNG  754

Query  195  APLPIC  178
             PLPIC
Sbjct  755  EPLPIC  760



>ref|XP_004497516.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=715

 Score =   320 bits (820),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPC + YPLM
Sbjct  530  NLKNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYVDDPCLSTYPLM  589

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL N + EKN++TSIFQKIA FEDELK LLPKEVE AR A ENG   IPN
Sbjct  590  QKLRQVLVDHALVNVDGEKNLNTSIFQKIATFEDELKTLLPKEVESARIAYENGQCGIPN  649

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGTE+LTGEKV SPGE CDK+FTA+C G I+DPLLECL  WNG
Sbjct  650  KIKECRSYPLYKFVREELGTELLTGEKVISPGEECDKLFTAMCQGKIVDPLLECLGEWNG  709

Query  195  APLPIC  178
            +PLPIC
Sbjct  710  SPLPIC  715



>ref|XP_003556238.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Glycine max]
Length=717

 Score =   320 bits (820),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N V+NTVSQVAKR LT+G+NGELHPSRFCEKDLL++VDREYV+AY DDPCSA YPLM
Sbjct  532  NLKNTVRNTVSQVAKRVLTVGINGELHPSRFCEKDLLKIVDREYVYAYIDDPCSATYPLM  591

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLR VLVDHALQNG+ E N STSIFQKI AFE+EL ALLPKEVE +R  +ENGNPAIPN
Sbjct  592  QKLRLVLVDHALQNGDKEVNSSTSIFQKIGAFEEELNALLPKEVESSRIEVENGNPAIPN  651

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+RE LGT +LTGEKV+SPGE  DKVFTA+C+G +IDPLL+CLK W G
Sbjct  652  RIKECRSYPLYKFVRENLGTTLLTGEKVKSPGEEFDKVFTALCEGKLIDPLLDCLKEWKG  711

Query  195  APLPIC  178
            APLPIC
Sbjct  712  APLPIC  717



>ref|XP_002268256.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   320 bits (820),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VK TVS VAK+TLT+G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLM
Sbjct  525  NLKSTVKKTVSHVAKKTLTIGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLM  584

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QK+RQVLV+HAL NGE EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPN
Sbjct  585  QKVRQVLVEHALNNGESEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPN  644

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNG
Sbjct  645  RIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNG  704

Query  195  APLPIC  178
            APLPIC
Sbjct  705  APLPIC  710



>gb|AFZ78650.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   320 bits (820),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++AVKNTVSQV+KR LT G NGELHPSRFCEK+LL+VVDRE VFAYADDPCSA YPLM
Sbjct  529  NLKSAVKNTVSQVSKRVLTTGANGELHPSRFCEKELLKVVDREDVFAYADDPCSATYPLM  588

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQV VDHAL+NGE+EKN STS+FQKI AFE+ELKALLPKEVE AR+A ++GN AI N
Sbjct  589  QKLRQVFVDHALENGENEKNFSTSVFQKIEAFEEELKALLPKEVESARAAYDSGNSAIDN  648

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGEKVQSPGE  DKVFTA+C G IIDP+LECL  WNG
Sbjct  649  KIKECRSYPLYKFVREELGTVLLTGEKVQSPGEEFDKVFTAMCQGKIIDPMLECLGEWNG  708

Query  195  APLPIC  178
            APLPIC
Sbjct  709  APLPIC  714



>ref|XP_003633987.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   320 bits (819),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VK TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLM
Sbjct  525  NLKSTVKKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLM  584

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QK+RQVLV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPN
Sbjct  585  QKVRQVLVEHALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPN  644

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNG
Sbjct  645  RIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNG  704

Query  195  APLPIC  178
            APLPIC
Sbjct  705  APLPIC  710



>gb|ADN32768.1| phenylalanine ammonia-lyase 2 [Scutellaria baicalensis]
Length=708

 Score =   320 bits (819),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR AVKNTVSQVAKRTLTMG NGELHPSRFCEKDL+RVVDREYVFAY DDPCS  YPLM
Sbjct  523  NLRVAVKNTVSQVAKRTLTMGPNGELHPSRFCEKDLIRVVDREYVFAYVDDPCSGTYPLM  582

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL+NGE EKN S+SIFQKI AFE+ELK+LLPKEVE AR ALE+GNP I N
Sbjct  583  QKLRQVLVDHALKNGEAEKNPSSSIFQKIEAFEEELKSLLPKEVESARVALESGNPTIAN  642

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLY+F+REELGT +LTGEKV SPGE  DKVF A+  G I+DPLLECL++WNG
Sbjct  643  RIRECRSYPLYRFVREELGTGLLTGEKVISPGEESDKVFVALSKGLIVDPLLECLQTWNG  702

Query  195  APLPIC  178
             PLPIC
Sbjct  703  QPLPIC  708



>gb|KJB46526.1| hypothetical protein B456_007G373700 [Gossypium raimondii]
Length=670

 Score =   318 bits (816),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKN VSQVAK+TLT G NGELHPSRFCEKDLL+ VD EYVF+Y DDPCSA YPLM
Sbjct  485  NLKNTVKNIVSQVAKKTLTTGPNGELHPSRFCEKDLLKAVDHEYVFSYIDDPCSATYPLM  544

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NG +E N STSIFQKIAAFE+ELK LLPKEVE +R ++ENGNPAIPN
Sbjct  545  QKLRQVLVEHALSNGNNENNASTSIFQKIAAFEEELKTLLPKEVENSRVSIENGNPAIPN  604

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +IT+CRSYPLYKF+REELGT +LTGEKV+SPGE  DKVF A+C G +IDP+LECLK WNG
Sbjct  605  KITKCRSYPLYKFVREELGTGLLTGEKVKSPGEEFDKVFIAMCQGKVIDPMLECLKEWNG  664

Query  195  APLPIC  178
            APLPIC
Sbjct  665  APLPIC  670



>gb|ABM67591.1| phenylalanin ammonia-lyase [Vitis vinifera]
Length=710

 Score =   320 bits (819),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VK TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLM
Sbjct  525  NLKSTVKKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLM  584

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QK+RQVLV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPN
Sbjct  585  QKVRQVLVEHALNNGENEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPN  644

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNG
Sbjct  645  RIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNG  704

Query  195  APLPIC  178
            APLPIC
Sbjct  705  APLPIC  710



>gb|ACM44926.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   320 bits (820),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR  VKNTVSQVAKR LT G NGELHPSRFCEK+LL+VVDREYVFAYADDPCS+ YPLM
Sbjct  536  NLRQTVKNTVSQVAKRVLTTGANGELHPSRFCEKELLKVVDREYVFAYADDPCSSTYPLM  595

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQV+VDHAL NG++EKN +TSIFQKI+AFE ELK LLPKEVE AR+A E+GN  IPN
Sbjct  596  QKLRQVIVDHALLNGDNEKNANTSIFQKISAFEAELKTLLPKEVEAARAAYESGNAPIPN  655

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REE GT ILTG+KV+SPGE  DKVFTA+C G IIDPL++CLK WNG
Sbjct  656  RIMECRSYPLYKFVREEQGTGILTGDKVRSPGEEFDKVFTAMCQGKIIDPLMDCLKEWNG  715

Query  195  APLPIC  178
            APLPIC
Sbjct  716  APLPIC  721



>ref|XP_002268181.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
 ref|XP_010662070.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   320 bits (819),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VK TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLM
Sbjct  525  NLKSTVKKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLM  584

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QK+RQVLV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPN
Sbjct  585  QKVRQVLVEHALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPN  644

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNG
Sbjct  645  RIRECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNG  704

Query  195  APLPIC  178
            APLPIC
Sbjct  705  APLPIC  710



>ref|XP_003633986.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   320 bits (819),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VK TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLM
Sbjct  525  NLKSTVKKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLM  584

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QK+RQVLV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPN
Sbjct  585  QKVRQVLVEHALNNGENEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPN  644

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNG
Sbjct  645  RIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNG  704

Query  195  APLPIC  178
            APLPIC
Sbjct  705  APLPIC  710



>gb|ACS71953.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   320 bits (819),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR  VKNTVSQVAKR LT G NGELHPSRFCEK+LL+VVDREYVFAYADDPCS+ YPLM
Sbjct  536  NLRQTVKNTVSQVAKRVLTTGANGELHPSRFCEKELLKVVDREYVFAYADDPCSSTYPLM  595

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQV+VDHAL NG++EKN +TSIFQKI+AFE ELK LLPKEVE AR+A E+GN  IPN
Sbjct  596  QKLRQVIVDHALLNGDNEKNANTSIFQKISAFEAELKTLLPKEVEAARAAYESGNAPIPN  655

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REE GT ILTG+KV+SPGE  DKVFTA+C G IIDPL++CLK WNG
Sbjct  656  RIMECRSYPLYKFVREEQGTGILTGDKVRSPGEEFDKVFTAMCQGKIIDPLMDCLKEWNG  715

Query  195  APLPIC  178
            APLPIC
Sbjct  716  APLPIC  721



>gb|KJB46525.1| hypothetical protein B456_007G373600 [Gossypium raimondii]
Length=718

 Score =   320 bits (819),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKN VSQVAK+TLT G NGELHPSRFCEKDLL+ VD EYVF+Y DDPCSA YPLM
Sbjct  533  NLKNTVKNIVSQVAKKTLTTGPNGELHPSRFCEKDLLKAVDHEYVFSYIDDPCSATYPLM  592

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NG +E N STSIFQKIAAFE+ELK LLPKEVE +R +++NGNPAIPN
Sbjct  593  QKLRQVLVEHALSNGNNENNASTSIFQKIAAFEEELKTLLPKEVENSRVSIQNGNPAIPN  652

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +ITECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVF A+C G +IDP+LECLK WNG
Sbjct  653  KITECRSYPLYKFVREELGTGLLTGEKVKSPGEEFDKVFIAMCQGKVIDPMLECLKEWNG  712

Query  195  APLPIC  178
            APLPIC
Sbjct  713  APLPIC  718



>sp|P45731.1|PAL1_POPKI RecName: Full=Phenylalanine ammonia-lyase G1 [Populus sieboldii 
x Populus grandidentata]
 dbj|BAA06337.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=682

 Score =   318 bits (816),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKNTVSQVAKR LTMG NGELHPSR CEKDLL++VD+E+VFAY DDPCSA YPLM
Sbjct  497  NLKNTVKNTVSQVAKRVLTMGFNGELHPSRLCEKDLLKLVDKEHVFAYIDDPCSATYPLM  556

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE E N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNP +PN
Sbjct  557  QKLRQVLVEHALVNGERETNSTTSIFQKIRSFEEELKTLLPKEVESARLEVENGNPVVPN  616

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G ++DPLLECLK WNG
Sbjct  617  RIKECRSYPLYKFVREELGTSLLTGEKVKSPGEDFDKVFTAICAGKLMDPLLECLKEWNG  676

Query  195  APLPIC  178
            APLPIC
Sbjct  677  APLPIC  682



>ref|XP_010515816.1| PREDICTED: phenylalanine ammonia-lyase 2 [Camelina sativa]
Length=718

 Score =   320 bits (819),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR  VKNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE VF Y DDPCSA YPLM
Sbjct  533  NLRQTVKNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLM  592

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQV+VDHAL NGE EKN  TSIFQKI AFE+ELKA+LPKEVE  R+A  NG  AIPN
Sbjct  593  QKLRQVIVDHALSNGETEKNAGTSIFQKIGAFEEELKAVLPKEVEATRAAYGNGTAAIPN  652

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLY+F+REELGT++LTGEKV SPGE  DKVFTA+C+G +IDPL++CLK WNG
Sbjct  653  RITECRSYPLYRFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNG  712

Query  195  APLPIC  178
            AP+PIC
Sbjct  713  APIPIC  718



>ref|XP_006381441.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63888.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|ERP59238.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=714

 Score =   319 bits (818),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR+AVKNTVS V+KR LT G NGELHPSRFCEK+LL+VVDRE VFAYADDPCSA YPLM
Sbjct  529  NLRSAVKNTVSHVSKRVLTTGANGELHPSRFCEKELLKVVDREDVFAYADDPCSATYPLM  588

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE+EKN STS+FQKI AFE+ELKALLPKEVE AR+A ++GN AI N
Sbjct  589  QKLRQVLVDHALANGENEKNTSTSVFQKITAFEEELKALLPKEVESARAAYDSGNSAIEN  648

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G IIDP+LECL  WNG
Sbjct  649  KIKECRSYPLYKFVREELGTGLLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLECLGEWNG  708

Query  195  APLPIC  178
            APLPIC
Sbjct  709  APLPIC  714



>dbj|BAE71252.1| putative phenylalanine ammonia lyase [Trifolium pratense]
Length=712

 Score =   319 bits (818),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAYADDPC A YPLM
Sbjct  527  NLRNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYADDPCLATYPLM  586

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL N + EKN +TSIFQKIA FEDELKA+LPKEVE  R A ENG   I N
Sbjct  587  QKLRQVLVDHALVNVDGEKNSNTSIFQKIATFEDELKAILPKEVESTRVAYENGQCGISN  646

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGEKV SPGE CDK+FTA+C G I+DPLLECL  WNG
Sbjct  647  KIKECRSYPLYKFVREELGTALLTGEKVISPGEECDKLFTAMCQGKIVDPLLECLGEWNG  706

Query  195  APLPIC  178
            APLPIC
Sbjct  707  APLPIC  712



>gb|ACE95170.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   319 bits (817),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR+AVKNTVS V+KR LT G NGELHPSRFCEK+LL+VVDRE VFAYADDPCSA YPLM
Sbjct  529  NLRSAVKNTVSHVSKRVLTTGANGELHPSRFCEKELLKVVDREDVFAYADDPCSATYPLM  588

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE+EKN STS+FQKIA FE+ELKALLPKEVE AR+A ++GN AI N
Sbjct  589  QKLRQVLVDHALANGENEKNASTSVFQKIATFEEELKALLPKEVESARAAYDSGNSAIEN  648

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G IIDP+LECL  WNG
Sbjct  649  KIKECRSYPLYKFVREELGTGLLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLECLGEWNG  708

Query  195  APLPIC  178
            APLPIC
Sbjct  709  APLPIC  714



>ref|XP_010662075.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   319 bits (817),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VK TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLM
Sbjct  525  NLKSTVKKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLM  584

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QK+RQVLV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPN
Sbjct  585  QKVRQVLVEHALNNGENEKNGSTSIFQKILAFEEELKAVLPKEVESARGGVESGNPSIPN  644

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNG
Sbjct  645  RIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNG  704

Query  195  APLPIC  178
            APLPIC
Sbjct  705  APLPIC  710



>ref|XP_003633985.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   319 bits (817),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VK TVS VAK+TLT G NG LHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLM
Sbjct  525  NLKSTVKKTVSHVAKKTLTTGANGGLHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLM  584

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPN
Sbjct  585  QKLRQVLVEHALSNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPN  644

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNG
Sbjct  645  RIKECRSYPLYKFVREELGTGLLTGEKVRSPGEEFDKVFTAMCEGKIIDPLLDCLSAWNG  704

Query  195  APLPIC  178
            APLPIC
Sbjct  705  APLPIC  710



>gb|ABR14606.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   319 bits (817),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++AVKNTVSQVAKRTLTMGVNGELHPSRFCEKDL+RVVDREYVFAY DDP SA YPLM
Sbjct  526  NLKHAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLIRVVDREYVFAYIDDPSSATYPLM  585

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL+NG+ EKN STSIFQKI AFE+ELKALLPKEV  AR ALE+G+P + N
Sbjct  586  QKLRQVLVDHALKNGDLEKNASTSIFQKIEAFEEELKALLPKEVGSARMALESGSPTVAN  645

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKFIRE+LG   LTGEK  SPGE C+KVFTA+ +G IIDPLLECL+ WNG
Sbjct  646  RIAECRSYPLYKFIREQLGAGFLTGEKAVSPGEECEKVFTALSNGLIIDPLLECLQGWNG  705

Query  195  APLPIC  178
             PLPIC
Sbjct  706  QPLPIC  711



>ref|XP_007144370.1| hypothetical protein PHAVU_007G150500g [Phaseolus vulgaris]
 gb|ESW16364.1| hypothetical protein PHAVU_007G150500g [Phaseolus vulgaris]
Length=712

 Score =   319 bits (817),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKN VSQVAKRTLT GVNGELHPSRFCEKDLL+VV+REY FAY DDPCS  YPLM
Sbjct  527  NLKNTVKNVVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVEREYTFAYIDDPCSGTYPLM  586

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVD+AL NGE+EKN++TSIFQKIA+FE+ELK LLPKEVEGAR A EN   AIPN
Sbjct  587  QKLRQVLVDYALANGENEKNLNTSIFQKIASFEEELKTLLPKEVEGARLAYENDQCAIPN  646

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I +CRSYPLYKF+REELGT +LTGEKV SPGE CDKVF+A+C G IIDPLLECL  WNG
Sbjct  647  KIKDCRSYPLYKFVREELGTSLLTGEKVISPGEECDKVFSAMCQGKIIDPLLECLGEWNG  706

Query  195  APLPIC  178
            APLPIC
Sbjct  707  APLPIC  712



>gb|AGY49231.1| phenylalanine ammonia lyase [Ricinus communis]
Length=714

 Score =   319 bits (817),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR AVKNTVSQVAKR LT G NGELHPSRFCEKDLL+VVDREYVFAYADDPCSA YPLM
Sbjct  529  NLRQAVKNTVSQVAKRVLTAGANGELHPSRFCEKDLLKVVDREYVFAYADDPCSATYPLM  588

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQ+LV+HAL NGE+EKN  TS+FQKI+AFE+ELK LLPKEVE  R A E+GNPA  N
Sbjct  589  QKLRQILVEHALANGENEKNAGTSVFQKISAFEEELKTLLPKEVESVRIAYESGNPATAN  648

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTG+KV S GE  DKVFTA+C G IIDP+++CLK WNG
Sbjct  649  RIKECRSYPLYKFVREELGTGLLTGDKVMSSGEEFDKVFTAMCQGKIIDPMMDCLKEWNG  708

Query  195  APLPIC  178
            APLPIC
Sbjct  709  APLPIC  714



>gb|AFU90757.1| phenylalanine ammonia-lyase [Epimedium sagittatum]
Length=716

 Score =   319 bits (817),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++AVK+TVSQVAK+ LTMGVNGELHPSRFCEKDLL+VVDREYV+AY DDPCSA YPLM
Sbjct  531  NLKSAVKSTVSQVAKKVLTMGVNGELHPSRFCEKDLLQVVDREYVYAYIDDPCSAVYPLM  590

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE+EKN STSIFQKI+ FE+ELK LLPKEVE ARSA+E+ N AIPN
Sbjct  591  QKLRQVLVEHALSNGENEKNSSTSIFQKISLFEEELKVLLPKEVESARSAVESDNAAIPN  650

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I +CRSYPLY+FIR ELGT +LTGEKV SPGE  DKVFTA+C+G +IDPLLECLK WNG
Sbjct  651  QIKDCRSYPLYRFIRGELGTALLTGEKVVSPGEEIDKVFTAMCEGKLIDPLLECLKEWNG  710

Query  195  APLPIC  178
            APLPIC
Sbjct  711  APLPIC  716



>emb|CDY18464.1| BnaA04g21230D [Brassica napus]
Length=423

 Score =   310 bits (794),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+  VKNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+
Sbjct  238  NLKQTVKNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLI  297

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LP EVE AR A +NG  AIPN
Sbjct  298  QKLRQVIVDHALVNGESEKNAMTSIFHKIGAFEEELKAVLPDEVEAARVAYDNGTSAIPN  357

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLY+F+REELGTE+LTGEK  SPGE  DKVFTA+C+G IIDPL+ECL  WNG
Sbjct  358  RIKECRSYPLYRFVREELGTELLTGEKATSPGEEFDKVFTAICEGKIIDPLMECLDEWNG  417

Query  195  APLPIC  178
            AP+PIC
Sbjct  418  APIPIC  423



>gb|AAZ29733.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=712

 Score =   318 bits (816),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAYADDPC A YPLM
Sbjct  527  NLRNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYADDPCLATYPLM  586

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL N + EKN +TSIFQKIA FEDELKA+LPKEVE  R A ENG   I N
Sbjct  587  QKLRQVLVDHALVNVDGEKNSNTSIFQKIATFEDELKAILPKEVESTRVAYENGQCGISN  646

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGEKV SPGE CDK+FTA+C G I+DPLLEC+  WNG
Sbjct  647  KIKECRSYPLYKFVREELGTALLTGEKVISPGEECDKLFTAMCQGKIVDPLLECMGEWNG  706

Query  195  APLPIC  178
            APLPIC
Sbjct  707  APLPIC  712



>ref|XP_006403711.1| hypothetical protein EUTSA_v10010153mg [Eutrema salsugineum]
 dbj|BAJ33750.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45164.1| hypothetical protein EUTSA_v10010153mg [Eutrema salsugineum]
Length=725

 Score =   319 bits (817),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR  VKNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE VF Y DDPCSA YPLM
Sbjct  540  NLRQTVKNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLM  599

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQV+VDHAL NGE EKNV+TSIFQKI AFE+ELKA LPKEVE  R+A  NG  AIPN
Sbjct  600  QKLRQVIVDHALCNGETEKNVATSIFQKIGAFEEELKATLPKEVEATRAAFGNGTAAIPN  659

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT++LTGEKV SPGE  DKVFTA+C+G IIDPL++CLK WNG
Sbjct  660  RIKECRSYPLYKFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMDCLKEWNG  719

Query  195  APLPIC  178
            AP+PIC
Sbjct  720  APIPIC  725



>ref|XP_002267953.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   318 bits (816),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VK TVS VAK+TLT G NG LHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLM
Sbjct  525  NLKSTVKKTVSHVAKKTLTTGANGGLHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLM  584

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR A+E+GNP+ PN
Sbjct  585  QKLRQVLVEHALSNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGAVESGNPSTPN  644

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNG
Sbjct  645  RIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNG  704

Query  195  APLPIC  178
            APLPIC
Sbjct  705  APLPIC  710



>ref|XP_010658395.1| PREDICTED: phenylalanine ammonia-lyase G1 [Vitis vinifera]
Length=723

 Score =   319 bits (817),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKNTVSQVAKR LT+G NGELHPSRFCEKDLL++VDRE+VFAY DDPCS+ YPLM
Sbjct  538  NLKNTVKNTVSQVAKRVLTIGFNGELHPSRFCEKDLLKIVDREHVFAYIDDPCSSTYPLM  597

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE EKN STSIFQKI AFEDELKALLPKEVE  R   ENGN AI N
Sbjct  598  QKLRQVLVEHALINGEREKNSSTSIFQKIVAFEDELKALLPKEVESTRIDYENGNSAISN  657

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI +CRSYPLYKF+REELG   LTGEK  SPGE CDKVFTA+C G +IDPLL+CLK WNG
Sbjct  658  RIKDCRSYPLYKFVREELGASFLTGEKTTSPGEECDKVFTAMCAGKLIDPLLDCLKEWNG  717

Query  195  APLPIC  178
            APLPIC
Sbjct  718  APLPIC  723



>emb|CAN61378.1| hypothetical protein VITISV_032212 [Vitis vinifera]
Length=686

 Score =   318 bits (814),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VK TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLM
Sbjct  501  NLKSTVKKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLM  560

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            Q +RQVLV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPN
Sbjct  561  QNVRQVLVEHALNNGENEKNGSTSIFQKILAFEEELKAVLPKEVESARGGVESGNPSIPN  620

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNG
Sbjct  621  RIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNG  680

Query  195  APLPIC  178
            APLPIC
Sbjct  681  APLPIC  686



>ref|XP_011048535.1| PREDICTED: phenylalanine ammonia-lyase-like [Populus euphratica]
Length=714

 Score =   318 bits (815),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++AVKNTVS V+KR LT G NGELHPSRFCEK+LL+VVDRE VFAYADDPCSANYPLM
Sbjct  529  NLKSAVKNTVSHVSKRILTTGANGELHPSRFCEKELLKVVDREDVFAYADDPCSANYPLM  588

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            +KLRQVLVDHAL NGE+EKN STS+FQKI AFE+ELKALLPKEVE AR+A ++GN AI N
Sbjct  589  KKLRQVLVDHALANGENEKNASTSVFQKIGAFEEELKALLPKEVESARAAYDSGNSAIEN  648

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G IIDP+LECL  WNG
Sbjct  649  KIKECRSYPLYKFVREELGTGLLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLECLGEWNG  708

Query  195  APLPIC  178
            APLPIC
Sbjct  709  APLPIC  714



>gb|ABV44807.1| phenylalanine ammonia lyase 2 [Eriobotrya japonica]
Length=330

 Score =   306 bits (785),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLRN VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLM
Sbjct  146  NLRNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLM  205

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE EKN STSIFQKI AFE+ELK LLPKEVE ARSA+E+GN A+PN
Sbjct  206  QKLRQVLVEHALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPN  265

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLEC  214
            RI ECRSYPLYKF+REELG E LTGEKV+SPGE CD+VF A+C G IIDP+L C
Sbjct  266  RIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILGC  319



>sp|O49835.1|PAL1_LITER RecName: Full=Phenylalanine ammonia-lyase 1; Short=PAL-1 [Lithospermum 
erythrorhizon]
 dbj|BAA24928.1| phenylalanine ammonia-lyase [Lithospermum erythrorhizon]
Length=710

 Score =   318 bits (815),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            N+R AVKNTVSQVAKRTLT GVNGELHPSRF EKDLLRVVDREYVFAYADDPC   YPLM
Sbjct  525  NVRLAVKNTVSQVAKRTLTTGVNGELHPSRFSEKDLLRVVDREYVFAYADDPCLTTYPLM  584

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLR+ LV HAL NGE+EK+V+TSIF KIA FE+ELKA+LPKEVE AR+++ENG PAI N
Sbjct  585  QKLRETLVGHALDNGENEKDVNTSIFHKIAIFEEELKAILPKEVENARASVENGIPAISN  644

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGTE+LTGEKV+SPGE  DKVFTA+C+G ++DPLL CL++WNG
Sbjct  645  RIEECRSYPLYKFVREELGTELLTGEKVRSPGEELDKVFTAMCEGKLVDPLLACLEAWNG  704

Query  195  APLPIC  178
            APLPIC
Sbjct  705  APLPIC  710



>gb|AGE10589.1| phenylalanine amononia-lyase [Lonicera japonica]
Length=714

 Score =   318 bits (815),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR  VKNTVS VAKR LTMG NGELHPSRFCEKDLLRVVDREYVFAY DDPCSA YPLM
Sbjct  529  NLRTTVKNTVSLVAKRVLTMGANGELHPSRFCEKDLLRVVDREYVFAYIDDPCSATYPLM  588

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            +KLRQVLV+HAL+N   EKNVSTSIFQKI AFE+ELKALLPKEVE  R+ +E+GN  I N
Sbjct  589  EKLRQVLVEHALKNEVSEKNVSTSIFQKIGAFEEELKALLPKEVESTRALIESGNGGIAN  648

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI +CRSYPLYKF+REELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL SWNG
Sbjct  649  RIKDCRSYPLYKFVREELGTELLTGEKVRSPGEEFDKVFTAMCEGKIIDPLLDCLTSWNG  708

Query  195  APLPIC  178
            +PLPIC
Sbjct  709  SPLPIC  714



>ref|XP_002268732.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   318 bits (814),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VK TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLM
Sbjct  525  NLKSTVKKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLM  584

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QK+RQVLV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPN
Sbjct  585  QKVRQVLVEHALNNGENEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPN  644

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGE V+SPGE  DKVFTA+C+G IIDPLL+CL +WNG
Sbjct  645  RIKECRSYPLYKFVREELGTGLLTGETVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNG  704

Query  195  APLPIC  178
            APLPIC
Sbjct  705  APLPIC  710



>gb|AAK15640.1|AF326116_1 phenylalanine ammonia-lyase [Agastache rugosa]
Length=716

 Score =   318 bits (814),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            N++ AVKNTVSQVAKRTLTMGVNGELHPSRFCEK+L+RVVDREYVF Y DDPC A YPLM
Sbjct  531  NMKLAVKNTVSQVAKRTLTMGVNGELHPSRFCEKELIRVVDREYVFTYIDDPCLATYPLM  590

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL+NGE EKNVSTSIF KI AFE+ELKALLPKEVE AR ALE+G+PA+ N
Sbjct  591  QKLRQVLVDHALKNGESEKNVSTSIFHKIEAFEEELKALLPKEVESARIALESGSPAVAN  650

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRS+PLYKFIREELGT  LTGEK  SPGE C+KVF A+ +G IIDPLLECL+ WNG
Sbjct  651  RIEECRSFPLYKFIREELGTGFLTGEKAVSPGEECEKVFAALSNGLIIDPLLECLQGWNG  710

Query  195  APLPIC  178
             PLPIC
Sbjct  711  EPLPIC  716



>gb|AAC18870.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
Length=725

 Score =   318 bits (815),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR  VKNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+
Sbjct  540  NLRQTVKNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLI  599

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPN
Sbjct  600  QKLRQVIVDHALVNGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPN  659

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLY+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNG
Sbjct  660  RIKECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNG  719

Query  195  APLPIC  178
            AP+PIC
Sbjct  720  APIPIC  725



>ref|XP_004304440.1| PREDICTED: phenylalanine ammonia-lyase 1 [Fragaria vesca subsp. 
vesca]
Length=724

 Score =   318 bits (815),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQ+AKR LT GVNGELHPSRFCEKDLL VV+REY+FAY DDPCSA YPLM
Sbjct  539  NLKSTVKNTVSQLAKRLLTTGVNGELHPSRFCEKDLLMVVEREYLFAYIDDPCSATYPLM  598

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            Q+LRQVLV+HAL NGE+EKN +TSIFQKI+AFE+ELK +LPKEVE AR+A E+GN AIPN
Sbjct  599  QRLRQVLVEHALTNGENEKNANTSIFQKISAFEEELKTILPKEVESARAACESGNAAIPN  658

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELG E LTGEKV+SPGE CDKVFTA+C G IIDP+L+CL  WNG
Sbjct  659  RIIECRSYPLYKFVREELGGEFLTGEKVRSPGEECDKVFTAMCQGKIIDPILDCLSGWNG  718

Query  195  APLPIC  178
             PLPIC
Sbjct  719  EPLPIC  724



>gb|AIB06732.1| phenylalanine ammonia lyase [Mangifera indica]
Length=707

 Score =   318 bits (814),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKNTVSQVAKR LTMG NGELHPSRFCEKDL++VVDREYVFAY DDPCSA YPLM
Sbjct  522  NLKNTVKNTVSQVAKRVLTMGFNGELHPSRFCEKDLIKVVDREYVFAYIDDPCSATYPLM  581

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HA+ NGE EK  STSIFQKI AFE+ELK LLPKEVE  R  +ENGN A+PN
Sbjct  582  QKLRQVLVEHAMANGEREKKSSTSIFQKIGAFEEELKTLLPKEVESTRIEIENGNAAVPN  641

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELG   LTGEKV+SPGE  DKVF+A+C G +IDP++ECLK WNG
Sbjct  642  KIKECRSYPLYKFVREELGASFLTGEKVKSPGEEFDKVFSAICAGKLIDPMMECLKEWNG  701

Query  195  APLPIC  178
            APLP+C
Sbjct  702  APLPLC  707



>ref|NP_181241.1| phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 sp|P35510.3|PAL1_ARATH RecName: Full=Phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 gb|AAK76593.1| putative phenylalanine ammonia lyase PAL1 [Arabidopsis thaliana]
 gb|AAL85094.1| putative phenylalanine ammonia lyase PAL1 [Arabidopsis thaliana]
 gb|AAM15324.1| phenylalanine ammonia lyase (PAL1) [Arabidopsis thaliana]
 gb|AAO29949.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP59438.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
 gb|AEC09341.1| phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 gb|AGA15805.1| PAL1 [Expression vector pUDE172]
Length=725

 Score =   318 bits (815),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR  VKNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+
Sbjct  540  NLRQTVKNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLI  599

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPN
Sbjct  600  QKLRQVIVDHALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPN  659

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLY+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNG
Sbjct  660  RIKECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNG  719

Query  195  APLPIC  178
            AP+PIC
Sbjct  720  APIPIC  725



>ref|XP_002315309.2| hypothetical protein POPTR_0010s23110g [Populus trichocarpa]
 gb|EEF01480.2| hypothetical protein POPTR_0010s23110g [Populus trichocarpa]
Length=707

 Score =   317 bits (813),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQVAKR L MG NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCSA YPLM
Sbjct  522  NLKSTVKNTVSQVAKRVLAMGFNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLM  581

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE E+N +T+I QKI +FE+ELK LLPKEVE AR  +ENGNPAIPN
Sbjct  582  QKLRQVLVEHALVNGERERNSTTTILQKIGSFEEELKTLLPKEVESARLEVENGNPAIPN  641

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+G
Sbjct  642  RIKECRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDG  701

Query  195  APLPIC  178
            APLPIC
Sbjct  702  APLPIC  707



>gb|KHN02334.1| Phenylalanine ammonia-lyase 1 [Glycine soja]
Length=619

 Score =   315 bits (807),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N+VKNTVSQV+KR LT GVNGELHPSRFCEKDLL+VVDREYVF+Y DDPCSA YPLM
Sbjct  434  NLKNSVKNTVSQVSKRILTTGVNGELHPSRFCEKDLLKVVDREYVFSYIDDPCSATYPLM  493

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL N E+EK+++TSIFQKIA FE+ELK  LPKEVE AR A E+G  AIPN
Sbjct  494  QKLRQVLVDHALVNAENEKDMNTSIFQKIANFEEELKNFLPKEVESARVAYESGKAAIPN  553

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGEKV+SPGE  DK+FTA+C G IIDPLLECL  WNG
Sbjct  554  KIQECRSYPLYKFVREELGTGLLTGEKVRSPGEEFDKLFTAMCQGKIIDPLLECLGEWNG  613

Query  195  APLPIC  178
            APLPIC
Sbjct  614  APLPIC  619



>ref|XP_010107516.1| Phenylalanine ammonia-lyase 1 [Morus notabilis]
 gb|EXC16198.1| Phenylalanine ammonia-lyase 1 [Morus notabilis]
Length=534

 Score =   312 bits (800),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQV KR LT GVNGEL+PSRFCEKDLL+VVDREYV+ Y DDPCSA YPLM
Sbjct  349  NLKHTVKNTVSQVVKRVLTTGVNGELNPSRFCEKDLLKVVDREYVYTYIDDPCSATYPLM  408

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            Q LRQVLV+HAL NGE EKN STSIFQKIAAFE+ELK+ LPKEVE AR A ENGN AI N
Sbjct  409  QTLRQVLVEHALTNGESEKNTSTSIFQKIAAFEEELKSFLPKEVESARIAYENGNAAISN  468

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +ITECRSYPLYKF+REELGT +LTGEKV+SPGE  DKV+TA+C G +IDP+LECL  WNG
Sbjct  469  KITECRSYPLYKFVREELGTSLLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLECLSGWNG  528

Query  195  APLPIC  178
             PLPIC
Sbjct  529  EPLPIC  534



>ref|XP_010504083.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Camelina sativa]
Length=718

 Score =   318 bits (814),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR  VKNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE VF Y DDPCSA YPLM
Sbjct  533  NLRQTVKNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLM  592

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQV+VDHAL NGE EKN  TSIFQKI AFE+ELKA+LPKEVE  R+A  NG  AIPN
Sbjct  593  QKLRQVIVDHALSNGETEKNAGTSIFQKIGAFEEELKAVLPKEVEATRAAYGNGTAAIPN  652

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLY+F+REELGT++LTGEKV SPGE  DKVFTA+C+G +IDPL++CLK WNG
Sbjct  653  RIAECRSYPLYRFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNG  712

Query  195  APLPIC  178
            AP+PIC
Sbjct  713  APIPIC  718



>gb|ADL09136.1| phenylanlanine ammonia-lyase [Brassica oleracea var. botrytis]
Length=723

 Score =   318 bits (814),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR  VKNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE VF Y DDPCSA YPLM
Sbjct  538  NLRQTVKNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLM  597

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQV+VDHAL NGE EKN  TSIFQKI AFE+ELK +LPKEV+ AR A  NG  AIPN
Sbjct  598  QKLRQVIVDHALSNGETEKNAVTSIFQKIGAFEEELKMVLPKEVDAAREAYGNGTAAIPN  657

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT++LTGEKV SPGE  DKVFTA+C+G IIDPL+ECLK WNG
Sbjct  658  RIKECRSYPLYKFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMECLKEWNG  717

Query  195  APLPIC  178
            AP+PIC
Sbjct  718  APIPIC  723



>emb|CAN77065.1| hypothetical protein VITISV_009233 [Vitis vinifera]
Length=707

 Score =   317 bits (812),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VK TVS VAK+TLT G NGELHPSRFCEK LL+VVDRE+VFAY DDPCSA YPLM
Sbjct  522  NLKSTVKKTVSHVAKKTLTTGANGELHPSRFCEKXLLKVVDREHVFAYIDDPCSATYPLM  581

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QK+RQVLV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPN
Sbjct  582  QKVRQVLVEHALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPN  641

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNG
Sbjct  642  RIRECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNG  701

Query  195  APLPIC  178
            APLPIC
Sbjct  702  APLPIC  707



>ref|XP_006293761.1| hypothetical protein CARUB_v10022721mg [Capsella rubella]
 gb|EOA26659.1| hypothetical protein CARUB_v10022721mg [Capsella rubella]
Length=726

 Score =   317 bits (813),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+  VKNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+
Sbjct  541  NLKQTVKNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLI  600

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPN
Sbjct  601  QKLRQVIVDHALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPN  660

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLY+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNG
Sbjct  661  RIKECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNG  720

Query  195  APLPIC  178
            APLPIC
Sbjct  721  APLPIC  726



>ref|XP_011010447.1| PREDICTED: phenylalanine ammonia-lyase [Populus euphratica]
Length=715

 Score =   317 bits (812),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++AVKNTVSQV+KR LT G NGELHPSRFCEK+LL+VVDREYVFAY DDPCSA YPLM
Sbjct  530  NLKSAVKNTVSQVSKRVLTTGANGELHPSRFCEKELLKVVDREYVFAYVDDPCSATYPLM  589

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL+NGE+EKN+STS+FQKI AFE+ELKALLPKEVE AR+A ++GN AI N
Sbjct  590  QKLRQVLVDHALENGENEKNLSTSVFQKIGAFEEELKALLPKEVESARAAYDSGNSAIDN  649

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELG  +LTGEKVQSPGE  DKVF A+C G IIDP+LECL  WNG
Sbjct  650  KIKECRSYPLYKFVREELGAVLLTGEKVQSPGEEFDKVFAAMCQGKIIDPMLECLGEWNG  709

Query  195  APLPIC  178
            +PLPI 
Sbjct  710  SPLPIS  715



>gb|ACA30407.1| phenylalanine ammonia-lyase [Stylosanthes guianensis]
Length=717

 Score =   317 bits (812),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKNTVSQVAKRTLT GVNGELHPSRFCEKDLL++VDREY FAY DDPCS  YPLM
Sbjct  529  NLKNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKIVDREYCFAYIDDPCSGTYPLM  588

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL N E+ KNV+TSIFQKI  FE+ELK LLPKEVEGAR A  NG  AIPN
Sbjct  589  QKLRQVLVEHALANAENGKNVNTSIFQKITTFEEELKTLLPKEVEGARIAYGNGQSAIPN  648

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGTE+LTGEKV+SPGE CDK+FTA+C G IIDPLLEC+  WNG
Sbjct  649  KIKECRSYPLYKFVREELGTEMLTGEKVRSPGEECDKLFTAMCQGKIIDPLLECVGEWNG  708

Query  195  APLP  184
            APLP
Sbjct  709  APLP  712



>dbj|BAH20339.1| AT3G53260 [Arabidopsis thaliana]
Length=579

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR  VKNTVSQVAK+ LT G+NGELHPSRFCEKDLL+VVDRE VF Y DDPCSA YPLM
Sbjct  394  NLRQTVKNTVSQVAKKVLTTGINGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLM  453

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            Q+LRQV+VDHAL NGE EKN  TSIFQKI AFE+ELKA+LPKEVE AR+A  NG   IPN
Sbjct  454  QRLRQVIVDHALSNGETEKNAVTSIFQKIGAFEEELKAVLPKEVEAARAAYGNGTAPIPN  513

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLY+F+REELGT++LTGEKV SPGE  DKVFTA+C+G +IDPL++CLK WNG
Sbjct  514  RIKECRSYPLYRFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNG  573

Query  195  APLPIC  178
            AP+PIC
Sbjct  574  APIPIC  579



>ref|XP_010516949.1| PREDICTED: phenylalanine ammonia-lyase 1 [Camelina sativa]
Length=727

 Score =   317 bits (812),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR  VKNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+
Sbjct  542  NLRQTVKNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLI  601

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPN
Sbjct  602  QKLRQVIVDHALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPN  661

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLY+F+REE+GTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNG
Sbjct  662  RIKECRSYPLYRFVREEIGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNG  721

Query  195  APLPIC  178
            AP+PIC
Sbjct  722  APIPIC  727



>gb|KDO50672.1| hypothetical protein CISIN_1g037382mg [Citrus sinensis]
Length=555

 Score =   312 bits (800),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VK+TVSQVA++ LT+G NGELHPSRFCEKDLL+  DRE+VFAY DDPCSA YPLM
Sbjct  370  NLKHTVKDTVSQVARKVLTVGANGELHPSRFCEKDLLKAADREHVFAYIDDPCSATYPLM  429

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLV+HAL NGE+EKN ++SIFQKIAAFE+ELKA+LPKEVE AR  +ENGNP IPN
Sbjct  430  QKLRQVLVEHALNNGENEKNANSSIFQKIAAFEEELKAVLPKEVENARQTVENGNPTIPN  489

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLY+ +REELGT  LTGEKV SPGE  DKVFTA+C G IIDP+LECL  WNG
Sbjct  490  RIKECRSYPLYRLVREELGTNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLWEWNG  549

Query  195  APLPIC  178
            APLPIC
Sbjct  550  APLPIC  555



>ref|XP_010325983.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
lycopersicum]
Length=718

 Score =   317 bits (811),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 171/186 (92%), Gaps = 3/186 (2%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL NAVKNTVSQVAKRTLT+G NGELHP+RFCEK+L +VVDREY+FAY DDPC++ YPL+
Sbjct  536  NLSNAVKNTVSQVAKRTLTVGANGELHPARFCEKELPQVVDREYLFAYVDDPCNSTYPLI  595

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHA++N   EKNV++SIFQKI AFEDELKA+LPKEVE AR+ +E+GNPAIPN
Sbjct  596  QKLRQVLVDHAMKN---EKNVNSSIFQKIVAFEDELKAVLPKEVENARAVVESGNPAIPN  652

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLYK +R++LGTE+LTGEKV+SPGE  +KVFTA+C+G IIDPLLECLK+WNG
Sbjct  653  RITECRSYPLYKLVRQQLGTELLTGEKVRSPGEDIEKVFTAICNGEIIDPLLECLKNWNG  712

Query  195  APLPIC  178
            AP+PIC
Sbjct  713  APIPIC  718



>ref|XP_009103852.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Brassica rapa]
Length=718

 Score =   317 bits (811),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NLR AVKNTVSQVAK+ LT GVNGE+HPSRFCE+DLL+VVDRE VF Y DDPCSA+YPLM
Sbjct  533  NLRQAVKNTVSQVAKKVLTTGVNGEMHPSRFCERDLLKVVDREQVFTYVDDPCSASYPLM  592

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQV+VDHAL NGE EKNV TSIFQKI AFE+ELK +LPKEV+ AR A  NGN AIPN
Sbjct  593  QKLRQVIVDHALANGETEKNVETSIFQKIGAFEEELKTVLPKEVDAAREAYGNGNAAIPN  652

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+R ELGT++LTGEKV SPGE  DKVFTA+C+G IIDPL++CLK WNG
Sbjct  653  RIKECRSYPLYKFVRGELGTKLLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMDCLKEWNG  712

Query  195  APLPIC  178
            AP+P+C
Sbjct  713  APIPLC  718



>sp|P19142.1|PAL2_PHAVU RecName: Full=Phenylalanine ammonia-lyase class 2; AltName: Full=Phenylalanine 
ammonia-lyase class II [Phaseolus vulgaris]
 prf||1807329A Phe ammonia lyase
Length=712

 Score =   316 bits (810),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKN VSQVAKRTLT GVNGELHPSRFCEK LL+VV+REY FAY DDPCS  YPLM
Sbjct  527  NLKNTVKNVVSQVAKRTLTTGVNGELHPSRFCEKALLKVVEREYTFAYIDDPCSGTYPLM  586

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVD+AL NGE+EKN++TSIFQKIA+FE+ELK LLPKEVEGAR A EN   AIPN
Sbjct  587  QKLRQVLVDYALANGENEKNLNTSIFQKIASFEEELKTLLPKEVEGARLAYENDQCAIPN  646

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I +CRSYPLYKF+REELGT +LTGEKV SPGE CDKVF+A+C G IIDPLLECL  WNG
Sbjct  647  KIKDCRSYPLYKFVREELGTSLLTGEKVISPGEECDKVFSAMCQGKIIDPLLECLGEWNG  706

Query  195  APLPIC  178
            APLPIC
Sbjct  707  APLPIC  712



>prf||2006271A Phe ammonia lyase
Length=725

 Score =   317 bits (811),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N+VKNTVSQVAK+TLT+GV+GELHPSRFCEKDLL+VVDRE+VF+Y DDPCSA YPL 
Sbjct  540  NLKNSVKNTVSQVAKKTLTIGVSGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLA  599

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE EKN +TSIFQKIA FE+ELK LLPKEVE AR+A ENGN  I N
Sbjct  600  QKLRQVLVDHALVNGESEKNSNTSIFQKIATFEEELKTLLPKEVESARTAYENGNSTIAN  659

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I  CRSYPLYKF+REELGT +LTGE+V SPGE CDK+FTA+C G IIDPLL+CL  WNG
Sbjct  660  KINGCRSYPLYKFVREELGTSLLTGERVISPGEECDKLFTAMCQGKIIDPLLKCLGEWNG  719

Query  195  APLPIC  178
            APLPIC
Sbjct  720  APLPIC  725



>ref|XP_004246652.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
lycopersicum]
Length=719

 Score =   316 bits (810),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 171/186 (92%), Gaps = 3/186 (2%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL NAVKNTVSQVAKRTLT+G NGELHP+RFCEK+L +VVDREY+FAY DDPC++ YPL+
Sbjct  537  NLSNAVKNTVSQVAKRTLTVGANGELHPARFCEKELPQVVDREYLFAYVDDPCNSTYPLI  596

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHA++N   EKNV++SIFQKI AFEDELKA+LPKEVE AR+ +E+GNPAIPN
Sbjct  597  QKLRQVLVDHAMKN---EKNVNSSIFQKIVAFEDELKAVLPKEVENARAVVESGNPAIPN  653

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RITECRSYPLYK +R++LGTE+LTGEKV+SPGE  +KVFTA+C+G IIDPLLECLK+WNG
Sbjct  654  RITECRSYPLYKLVRQQLGTELLTGEKVRSPGEDIEKVFTAICNGEIIDPLLECLKNWNG  713

Query  195  APLPIC  178
            AP+PIC
Sbjct  714  APIPIC  719



>ref|XP_003521397.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Glycine max]
Length=713

 Score =   316 bits (810),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N+VKNTVSQV+KR LT GVNGELHPSRFCEKDLL+VVDREY+F+Y DDPCSA YPLM
Sbjct  528  NLKNSVKNTVSQVSKRILTTGVNGELHPSRFCEKDLLKVVDREYIFSYIDDPCSATYPLM  587

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL N E EK+V++SIFQKIA FE+ELK LLPKEVEGAR+A E+G  AIPN
Sbjct  588  QKLRQVLVDHALVNAESEKDVNSSIFQKIAIFEEELKNLLPKEVEGARAAYESGKAAIPN  647

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGEKV+SPGE  DK+FTA+C G IIDPL+ECL  WNG
Sbjct  648  KIQECRSYPLYKFVREELGTGLLTGEKVRSPGEEFDKLFTAMCQGKIIDPLMECLGEWNG  707

Query  195  APLPIC  178
            APLPI 
Sbjct  708  APLPIS  713



>sp|P45734.1|PALY_TRISU RecName: Full=Phenylalanine ammonia-lyase [Trifolium subterraneum]
 gb|AAA17993.1| phenylalanine ammonia-lyase [Trifolium subterraneum]
Length=725

 Score =   317 bits (811),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N+VKNTVSQVAK+TLT+GV+GELHPSRFCEKDLL+VVDRE+VF+Y DDPCSA YPL 
Sbjct  540  NLKNSVKNTVSQVAKKTLTIGVSGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLA  599

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE EKN +TSIFQKIA FE+ELK LLPKEVE AR+A ENGN  I N
Sbjct  600  QKLRQVLVDHALVNGESEKNSNTSIFQKIATFEEELKTLLPKEVESARTAYENGNSTIAN  659

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I  CRSYPLYKF+REELGT +LTGE+V SPGE CDK+FTA+C G IIDPLL+CL  WNG
Sbjct  660  KINGCRSYPLYKFVREELGTSLLTGERVISPGEECDKLFTAMCQGKIIDPLLKCLGEWNG  719

Query  195  APLPIC  178
            APLPIC
Sbjct  720  APLPIC  725



>gb|ADR78835.1| phenylalanine ammonia lyase [Ziziphus jujuba]
Length=559

 Score =   312 bits (799),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  732  LRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQ  553
            L+N VKNTV QVAKR LT+G NGELHPSRFCEK+LL+VVDREYVFAY DDPCSA YPLMQ
Sbjct  375  LKNTVKNTVGQVAKRVLTLGSNGELHPSRFCEKELLQVVDREYVFAYIDDPCSATYPLMQ  434

Query  552  KLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNR  373
            KLRQV+V+HAL+NGE+E+N STSIFQKIAAFE+ELK LLPKEVE AR+  ENGNPAIPN+
Sbjct  435  KLRQVIVEHALKNGENERNASTSIFQKIAAFEEELKTLLPKEVESARAEYENGNPAIPNK  494

Query  372  ITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGA  193
            I E RSYPLYKF+REELG  +LTGEK +SPGE CDKVF+A+  G +IDP+LECLK WNGA
Sbjct  495  IKERRSYPLYKFVREELGAGLLTGEKARSPGEECDKVFSAIYAGKLIDPMLECLKEWNGA  554

Query  192  PLPIC  178
            PLPI 
Sbjct  555  PLPIS  559



>gb|ACV30588.1| phenylalanine ammonia-lyase [Carica papaya]
Length=268

 Score =   302 bits (774),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKN+VSQV ++ L MG NGELHPSRFCEKDLL+VVDREY+FAYADDPCSA YPLM
Sbjct  83   NLKNTVKNSVSQVIRKVLFMGDNGELHPSRFCEKDLLKVVDREYLFAYADDPCSATYPLM  142

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL N + +KN  +SIF KI AFE+ELK LLPKEVEG R  +E GN AIPN
Sbjct  143  QKLRQVLVDHALINADRDKNSGSSIFHKIGAFEEELKTLLPKEVEGTRLEVEAGNAAIPN  202

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVF+A+C G +IDPLL+CLK WNG
Sbjct  203  RIKECRSYPLYKFVREELGTGLLTGEKVRSPGEEFDKVFSAMCAGKMIDPLLDCLKEWNG  262

Query  195  APLPI  181
            APLPI
Sbjct  263  APLPI  267



>gb|ACM62741.1| phenylalanine ammonia-lyase [Garcinia mangostana]
Length=718

 Score =   316 bits (810),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL++ VKNTVSQVAKR LT G NGELHPSRFCEKDLL+VVDREYVFAYADDPCSA YPLM
Sbjct  533  NLKSTVKNTVSQVAKRVLTTGANGELHPSRFCEKDLLKVVDREYVFAYADDPCSATYPLM  592

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL NGE E+N +TS+FQKIAAFE+ELK LLPKE+EG R A E+GN AIPN
Sbjct  593  QKLRQVLVDHALANGEGERNPNTSVFQKIAAFEEELKDLLPKEIEGVRLAYESGNTAIPN  652

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLYKF+RE  GT +LTGEKV SPGE  DKVFTA+C G IIDP+L+CL+ W+G
Sbjct  653  RIKECRSYPLYKFVREVAGTSLLTGEKVTSPGEELDKVFTAICQGKIIDPILDCLEEWDG  712

Query  195  APLPIC  178
             PLPIC
Sbjct  713  TPLPIC  718



>ref|XP_002881488.1| hypothetical protein ARALYDRAFT_482690 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57747.1| hypothetical protein ARALYDRAFT_482690 [Arabidopsis lyrata subsp. 
lyrata]
Length=725

 Score =   316 bits (810),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+  VKNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+
Sbjct  540  NLKQTVKNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLI  599

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPN
Sbjct  600  QKLRQVIVDHALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPN  659

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLY+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNG
Sbjct  660  RIKECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNG  719

Query  195  APLPIC  178
            AP+PIC
Sbjct  720  APIPIC  725



>gb|AEW43005.1| phenylalanine ammonia lyase, partial [Leucaena leucocephala]
Length=365

 Score =   305 bits (782),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N VKN V+QVAK+ LTMGVNGEL PSRFCEKDLL VVDRE+VF Y DDPCSA YPLM
Sbjct  180  NLKNTVKNAVNQVAKKVLTMGVNGELLPSRFCEKDLLTVVDREHVFDYIDDPCSATYPLM  239

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHALQNG  E + +TSIF KIAAFE ELK LLPKEVE AR  +ENG  AIPN
Sbjct  240  QKLRQVLVDHALQNGNRENDANTSIFLKIAAFEKELKTLLPKEVESARIEVENGKSAIPN  299

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            RI ECRSYPLY+F+REELGT +LTGEKV+SPGE  DKVFTA+C+G +IDPLL+CLK WNG
Sbjct  300  RIKECRSYPLYRFVREELGTGLLTGEKVRSPGEEFDKVFTAMCEGKLIDPLLDCLKGWNG  359

Query  195  APLPIC  178
            APLP+C
Sbjct  360  APLPLC  365



>pir||A24727 phenylalanine ammonia-lyase (EC 4.3.1.5) - kidney bean  (fragment)
 gb|AAA33770.1| phenylalanine ammonia-lyase (EC 4.3.1.5), partial [Phaseolus 
vulgaris]
 prf||1111326A ammonia lyase,Phe
Length=505

 Score =   310 bits (794),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+++VKNTVSQV+KRTLT G NGELHPSRFCEKDLL+VVDREYVF+Y DDP S  YPLM
Sbjct  320  NLKSSVKNTVSQVSKRTLTTGGNGELHPSRFCEKDLLKVVDREYVFSYIDDPYSGTYPLM  379

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL N E+EK+V+TSIFQKIA FE+ELK +LPKEVE  R+A E+G  AIPN
Sbjct  380  QKLRQVLVDHALINAENEKDVNTSIFQKIATFEEELKTILPKEVESTRAAYESGKAAIPN  439

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGEKV+SPGE  DK+FTA+C G IIDPLLECL  WNG
Sbjct  440  KIKECRSYPLYKFVREELGTGLLTGEKVKSPGEEFDKLFTAICQGKIIDPLLECLGEWNG  499

Query  195  APLPIC  178
            APLPIC
Sbjct  500  APLPIC  505



>gb|KHN09507.1| Phenylalanine ammonia-lyase 1 [Glycine soja]
Length=701

 Score =   315 bits (808),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  735  NLRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLM  556
            NL+N+VKNTVSQV+KR LT GVNGELHPSRFCEKDLL+VVDREY+F+Y DDPCSA YPLM
Sbjct  516  NLKNSVKNTVSQVSKRILTTGVNGELHPSRFCEKDLLKVVDREYIFSYIDDPCSATYPLM  575

Query  555  QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPN  376
            QKLRQVLVDHAL N E EK+V++SIFQKIA FE+ELK LLPKEVEGAR+A E+G  AIPN
Sbjct  576  QKLRQVLVDHALVNAESEKDVNSSIFQKIAIFEEELKNLLPKEVEGARAAYESGKAAIPN  635

Query  375  RITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNG  196
            +I ECRSYPLYKF+REELGT +LTGEKV+SPGE  DK+FTA+C G IIDPL+ECL  WNG
Sbjct  636  KIQECRSYPLYKFVREELGTGLLTGEKVRSPGEEFDKLFTAMCQGKIIDPLMECLGEWNG  695

Query  195  APLPIC  178
            APLPI 
Sbjct  696  APLPIS  701



>ref|XP_010262867.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=715

 Score =   316 bits (809),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = -2

Query  732  LRNAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQ  553
            L++ VKNTV Q+AKR LTMGVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQ
Sbjct  531  LKSTVKNTVGQLAKRVLTMGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQ  590

Query  552  KLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNR  373
             LRQVLV HAL NGE+EKN +TSIFQKI AFE+ELKALLPKEVEGAR A E+G+PA+PNR
Sbjct  591  NLRQVLVQHALLNGENEKNSNTSIFQKITAFEEELKALLPKEVEGARIAYESGSPAVPNR  650

Query  372  ITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGA  193
            I ECRSYP+YKF+RE+L T +LTGEKV+SPGE  DKVF+A+C+G +IDPLL+CL+ WNGA
Sbjct  651  IKECRSYPIYKFVREQLHTGLLTGEKVRSPGEEFDKVFSAMCEGKMIDPLLDCLRDWNGA  710

Query  192  PLPIC  178
            PLPIC
Sbjct  711  PLPIC  715



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1340626501500