BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF036C21

Length=575
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004234074.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    174   2e-49   Solanum lycopersicum
ref|XP_004233053.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    172   1e-48   Solanum lycopersicum
ref|XP_010316856.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    172   1e-48   Solanum lycopersicum
ref|XP_009590977.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        171   2e-48   Nicotiana tomentosiformis
ref|XP_009607196.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    171   3e-48   Nicotiana tomentosiformis
ref|XP_006358089.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    170   6e-48   Solanum tuberosum [potatoes]
ref|XP_006358087.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    170   7e-48   Solanum tuberosum [potatoes]
ref|XP_009785426.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        167   5e-47   Nicotiana sylvestris
gb|EYU28126.1|  hypothetical protein MIMGU_mgv1a007967mg                167   1e-46   Erythranthe guttata [common monkey flower]
ref|XP_009800423.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    166   1e-46   Nicotiana sylvestris
gb|EYU28125.1|  hypothetical protein MIMGU_mgv1a007967mg                168   2e-46   Erythranthe guttata [common monkey flower]
ref|XP_011101448.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        161   1e-44   Sesamum indicum [beniseed]
emb|CDO96875.1|  unnamed protein product                                160   3e-44   Coffea canephora [robusta coffee]
ref|XP_011033513.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    155   3e-42   Populus euphratica
ref|XP_002305719.1|  hypothetical protein POPTR_0004s06100g             155   3e-42   Populus trichocarpa [western balsam poplar]
ref|XP_006377531.1|  hypothetical protein POPTR_0011s06800g             152   1e-41   
ref|XP_002522271.1|  BRASSINAZOLE-RESISTANT 2 protein, putative         154   1e-41   Ricinus communis
ref|XP_011039378.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        152   5e-41   Populus euphratica
gb|KDP21147.1|  hypothetical protein JCGZ_21618                         152   5e-41   Jatropha curcas
gb|KDO77946.1|  hypothetical protein CISIN_1g020318mg                   150   6e-41   Citrus sinensis [apfelsine]
ref|XP_007025289.1|  BES1/BZR1                                          151   2e-40   Theobroma cacao [chocolate]
ref|XP_006449559.1|  hypothetical protein CICLE_v10015910mg             150   2e-40   Citrus clementina [clementine]
gb|KHG25078.1|  BES1/BZR1 4 -like protein                               149   1e-39   Gossypium arboreum [tree cotton]
gb|KJB69668.1|  hypothetical protein B456_011G036300                    146   7e-39   Gossypium raimondii
ref|XP_010242162.1|  PREDICTED: BES1/BZR1 homolog protein 4             144   7e-38   Nelumbo nucifera [Indian lotus]
ref|XP_008371512.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        143   1e-37   Malus domestica [apple tree]
ref|XP_007211637.1|  hypothetical protein PRUPE_ppa008675mg             143   1e-37   Prunus persica
ref|XP_002267082.1|  PREDICTED: BES1/BZR1 homolog protein 4             143   1e-37   Vitis vinifera
ref|XP_008383594.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        142   3e-37   
ref|XP_009352718.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        142   4e-37   Pyrus x bretschneideri [bai li]
ref|XP_004309625.1|  PREDICTED: BES1/BZR1 homolog protein 4             140   2e-36   Fragaria vesca subsp. vesca
gb|KHG15415.1|  BES1/BZR1 4 -like protein                               138   1e-35   Gossypium arboreum [tree cotton]
gb|KJB13026.1|  hypothetical protein B456_002G052400                    138   1e-35   Gossypium raimondii
ref|XP_002317445.1|  brassinosteroid signaling positive regulator...    137   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_007021866.1|  BES1/BZR1                                          136   4e-35   
ref|XP_011044050.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        135   7e-35   Populus euphratica
ref|XP_010644097.1|  PREDICTED: BES1/BZR1 homolog protein 4             135   1e-34   Vitis vinifera
gb|KJB45771.1|  hypothetical protein B456_007G327000                    134   2e-34   Gossypium raimondii
ref|XP_004137229.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        134   4e-34   Cucumis sativus [cucumbers]
ref|XP_010088009.1|  hypothetical protein L484_004599                   134   5e-34   
gb|KHG21553.1|  BES1/BZR1 4 -like protein                               133   8e-34   Gossypium arboreum [tree cotton]
ref|XP_008451746.1|  PREDICTED: BES1/BZR1 homolog protein 4             133   1e-33   Cucumis melo [Oriental melon]
ref|XP_004147390.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        132   1e-33   Cucumis sativus [cucumbers]
ref|XP_008443587.1|  PREDICTED: BES1/BZR1 homolog protein 4             132   2e-33   Cucumis melo [Oriental melon]
ref|XP_006442379.1|  hypothetical protein CICLE_v10021151mg             131   2e-33   
ref|XP_010093488.1|  hypothetical protein L484_017551                   133   2e-33   
ref|XP_006284265.1|  hypothetical protein CARUB_v10005431mg             130   3e-33   Capsella rubella
ref|NP_193624.1|  BES1/BZR1-like protein 3                              130   4e-33   Arabidopsis thaliana [mouse-ear cress]
gb|EPS61611.1|  hypothetical protein M569_13185                         130   4e-33   Genlisea aurea
ref|XP_006442380.1|  hypothetical protein CICLE_v10021151mg             130   5e-33   Citrus clementina [clementine]
ref|XP_006477843.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    130   5e-33   Citrus sinensis [apfelsine]
ref|XP_011082785.1|  PREDICTED: BES1/BZR1 homolog protein 4             130   8e-33   
ref|XP_010434483.1|  PREDICTED: BES1/BZR1 homolog protein 3             129   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_011002765.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    128   3e-32   Populus euphratica
ref|XP_002870016.1|  hypothetical protein ARALYDRAFT_492971             127   5e-32   
ref|XP_007211588.1|  hypothetical protein PRUPE_ppa008637mg             128   6e-32   Prunus persica
ref|XP_011002762.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    128   7e-32   Populus euphratica
ref|XP_008226380.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        127   1e-31   Prunus mume [ume]
gb|KFK28557.1|  hypothetical protein AALP_AA7G011700                    126   1e-31   Arabis alpina [alpine rockcress]
gb|KHG20428.1|  BES1/BZR1 4 -like protein                               127   1e-31   Gossypium arboreum [tree cotton]
ref|XP_010052157.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    126   4e-31   Eucalyptus grandis [rose gum]
ref|XP_003596274.1|  Brassinosteroid signaling positive regulator...    127   4e-31   
ref|XP_010518825.1|  PREDICTED: BES1/BZR1 homolog protein 3 isofo...    125   4e-31   Tarenaya hassleriana [spider flower]
gb|AES66525.2|  brassinazole-resistant 1 protein                        127   4e-31   Medicago truncatula
gb|KJB68361.1|  hypothetical protein B456_010G240700                    125   5e-31   Gossypium raimondii
ref|XP_010518826.1|  PREDICTED: BES1/BZR1 homolog protein 3 isofo...    125   5e-31   Tarenaya hassleriana [spider flower]
ref|XP_006414043.1|  hypothetical protein EUTSA_v10025918mg             124   8e-31   Eutrema salsugineum [saltwater cress]
ref|XP_004489001.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    124   2e-30   Cicer arietinum [garbanzo]
ref|XP_009136969.1|  PREDICTED: BES1/BZR1 homolog protein 3-like        123   2e-30   Brassica rapa
emb|CDX98592.1|  BnaA03g43770D                                          122   4e-30   
emb|CDY01563.1|  BnaC07g35530D                                          122   4e-30   
ref|XP_009128310.1|  PREDICTED: BES1/BZR1 homolog protein 4             122   4e-30   Brassica rapa
ref|XP_008386283.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        123   5e-30   
ref|XP_010537716.1|  PREDICTED: BES1/BZR1 homolog protein 4             122   5e-30   Tarenaya hassleriana [spider flower]
ref|XP_003543195.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        122   6e-30   Glycine max [soybeans]
ref|XP_003540502.1|  PREDICTED: BES1/BZR1 homolog protein 4             122   6e-30   Glycine max [soybeans]
gb|KHN36918.1|  BES1/BZR1 like protein 4                                122   8e-30   Glycine soja [wild soybean]
ref|XP_009359371.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        122   9e-30   Pyrus x bretschneideri [bai li]
gb|KEH38594.1|  brassinazole-resistant 1 protein                        119   2e-29   Medicago truncatula
ref|XP_007149549.1|  hypothetical protein PHAVU_005G079400g             121   2e-29   Phaseolus vulgaris [French bean]
ref|XP_006387974.1|  hypothetical protein POPTR_0439s00200g             119   5e-29   
ref|XP_010665681.1|  PREDICTED: BES1/BZR1 homolog protein 4             120   5e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004489003.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    120   9e-29   
ref|XP_004489004.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    119   1e-28   Cicer arietinum [garbanzo]
ref|XP_003596275.1|  Brassinosteroid signaling positive regulator...    119   1e-28   Medicago truncatula
gb|KFK42252.1|  hypothetical protein AALP_AA2G231000                    119   1e-28   Arabis alpina [alpine rockcress]
ref|XP_004294130.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        119   1e-28   Fragaria vesca subsp. vesca
ref|XP_006370100.1|  hypothetical protein POPTR_0001s39520g             118   3e-28   Populus trichocarpa [western balsam poplar]
ref|XP_009132289.1|  PREDICTED: BES1/BZR1 homolog protein 3             117   4e-28   Brassica rapa
ref|XP_009334016.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        117   4e-28   Pyrus x bretschneideri [bai li]
ref|XP_008381083.1|  PREDICTED: BES1/BZR1 homolog protein 4             117   5e-28   
gb|ACE97191.1|  brassinosteroid signaling positive regulator-rela...    114   6e-28   Populus tremula [European aspen]
gb|ACE97192.1|  brassinosteroid signaling positive regulator-rela...    114   6e-28   Populus tremula [European aspen]
ref|XP_010062789.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        117   6e-28   Eucalyptus grandis [rose gum]
gb|ACE97214.1|  brassinosteroid signaling positive regulator-rela...    114   6e-28   Populus tremula [European aspen]
ref|XP_009415180.1|  PREDICTED: protein BZR1 homolog 3-like             117   6e-28   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX99414.1|  BnaC01g11380D                                          117   6e-28   
gb|ACE97196.1|  brassinosteroid signaling positive regulator-rela...    114   6e-28   Populus tremula [European aspen]
ref|XP_010916623.1|  PREDICTED: protein BZR1 homolog 3-like             117   1e-27   Elaeis guineensis
ref|XP_002887754.1|  hypothetical protein ARALYDRAFT_895772             115   2e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_010429699.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        115   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_006302567.1|  hypothetical protein CARUB_v10020674mg             115   2e-27   Capsella rubella
ref|XP_010417476.1|  PREDICTED: BES1/BZR1 homolog protein 4             115   3e-27   Camelina sativa [gold-of-pleasure]
ref|NP_565187.1|  BES1/BZR1 homolog 4                                   115   4e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010472705.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        115   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_009768995.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        114   5e-27   Nicotiana sylvestris
emb|CDP06034.1|  unnamed protein product                                115   5e-27   Coffea canephora [robusta coffee]
emb|CDY26877.1|  BnaA02g19020D                                          114   6e-27   Brassica napus [oilseed rape]
emb|CDX87440.1|  BnaA07g34330D                                          114   6e-27   
ref|XP_009106588.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        114   7e-27   Brassica rapa
ref|XP_009622768.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        114   7e-27   Nicotiana tomentosiformis
ref|XP_006389963.1|  hypothetical protein EUTSA_v10018888mg             114   1e-26   Eutrema salsugineum [saltwater cress]
ref|XP_006348323.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        113   2e-26   Solanum tuberosum [potatoes]
ref|XP_008796066.1|  PREDICTED: protein BZR1 homolog 3                  113   3e-26   Phoenix dactylifera
emb|CDY66394.1|  BnaC03g78350D                                          108   3e-26   Brassica napus [oilseed rape]
emb|CDY14593.1|  BnaC02g25200D                                          111   5e-26   Brassica napus [oilseed rape]
ref|XP_004244287.1|  PREDICTED: BES1/BZR1 homolog protein 4             111   1e-25   Solanum lycopersicum
ref|XP_008792311.1|  PREDICTED: protein BZR1 homolog 3-like             111   1e-25   Phoenix dactylifera
ref|XP_010924706.1|  PREDICTED: protein BZR1 homolog 3-like             110   2e-25   Elaeis guineensis
ref|XP_008790049.1|  PREDICTED: protein BZR1 homolog 3-like             109   5e-25   Phoenix dactylifera
emb|CDX88466.1|  BnaC06g39100D                                          108   1e-24   
ref|XP_010915465.1|  PREDICTED: protein BZR1 homolog 3-like             107   3e-24   Elaeis guineensis
ref|XP_009397454.1|  PREDICTED: protein BZR1 homolog 2-like             104   2e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388695.1|  PREDICTED: protein BZR1 homolog 3-like             103   7e-23   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU29527.1|  hypothetical protein MIMGU_mgv1a010055mg                102   2e-22   Erythranthe guttata [common monkey flower]
gb|KHN36917.1|  BES1/BZR1 like protein 4                              99.4    1e-21   Glycine soja [wild soybean]
gb|EEE65864.1|  hypothetical protein OsJ_21656                          100   1e-21   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001057840.1|  Os06g0552300                                     99.8    1e-21   
ref|XP_006592940.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...  99.0    2e-21   Glycine max [soybeans]
ref|XP_003543196.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...  99.0    2e-21   Glycine max [soybeans]
ref|XP_006594721.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...  99.0    2e-21   Glycine max [soybeans]
gb|KJB69670.1|  hypothetical protein B456_011G036300                  98.6    3e-21   Gossypium raimondii
gb|EEC80795.1|  hypothetical protein OsI_23332                        99.0    3e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_006592939.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...  98.6    3e-21   Glycine max [soybeans]
ref|XP_003540501.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...  98.6    4e-21   Glycine max [soybeans]
ref|XP_009416433.1|  PREDICTED: protein BZR1 homolog 3                98.6    4e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009381197.1|  PREDICTED: BES1/BZR1 homolog protein 4-like      98.2    8e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003563774.1|  PREDICTED: protein BZR1 homolog 3                97.4    9e-21   Brachypodium distachyon [annual false brome]
ref|XP_002454981.1|  hypothetical protein SORBIDRAFT_03g002480        96.3    2e-20   Sorghum bicolor [broomcorn]
ref|NP_001136786.1|  BES transcription factor                         95.9    4e-20   Zea mays [maize]
ref|XP_002437132.1|  hypothetical protein SORBIDRAFT_10g021750        95.5    4e-20   Sorghum bicolor [broomcorn]
ref|XP_010925590.1|  PREDICTED: protein BZR1 homolog 3-like           94.7    8e-20   
ref|XP_004965584.1|  PREDICTED: BES1/BZR1 homolog protein 4-like      94.4    1e-19   Setaria italica
ref|XP_004968562.1|  PREDICTED: BES1/BZR1 homolog protein 4-like      94.0    2e-19   Setaria italica
dbj|BAJ97997.1|  predicted protein                                    92.8    5e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001132634.1|  uncharacterized protein LOC100194109             90.1    3e-18   Zea mays [maize]
gb|ACG41016.1|  brassinazole-resistant 1 protein                      89.7    4e-18   Zea mays [maize]
gb|EMT29878.1|  hypothetical protein F775_52316                       87.4    3e-17   
gb|EMS63049.1|  hypothetical protein TRIUR3_11319                     88.2    8e-17   Triticum urartu
gb|EEC70129.1|  hypothetical protein OsI_00807                        85.1    2e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_006643883.1|  PREDICTED: BES1/BZR1 homolog protein 4-like      84.3    2e-16   Oryza brachyantha
gb|EEE54074.1|  hypothetical protein OsJ_00786                        82.4    2e-15   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB33003.1|  unknown protein                                      82.4    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042330.1|  Os01g0203000                                     82.4    2e-15   
ref|XP_003571150.2|  PREDICTED: protein BZR1 homolog 3-like           79.7    3e-14   Brachypodium distachyon [annual false brome]
emb|CDM82126.1|  unnamed protein product                              79.0    3e-14   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006833072.1|  hypothetical protein AMTR_s00170p00061300        77.8    5e-14   Amborella trichopoda
ref|XP_003565213.1|  PREDICTED: protein BZR1 homolog 2                76.6    3e-13   
emb|CDY00299.1|  BnaA06g22000D                                        70.5    1e-11   
emb|CBI30731.3|  unnamed protein product                              68.9    2e-11   Vitis vinifera
gb|EMS49339.1|  hypothetical protein TRIUR3_13720                     68.9    4e-11   Triticum urartu
ref|XP_010675300.1|  PREDICTED: BES1/BZR1 homolog protein 4           69.3    4e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001172869.1|  Os02g0233200                                     69.3    1e-10   
sp|Q6EUF1.2|BZR4_ORYSJ  RecName: Full=Protein BZR1 homolog 4; Sho...  69.3    1e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EMT21245.1|  hypothetical protein F775_32777                       68.6    1e-10   
gb|ABK21940.1|  unknown                                               68.2    3e-10   Picea sitchensis
gb|EAY85121.1|  hypothetical protein OsI_06471                        66.2    1e-09   Oryza sativa Indica Group [Indian rice]
gb|EAZ22344.1|  hypothetical protein OsJ_05997                        57.0    1e-06   Oryza sativa Japonica Group [Japonica rice]
gb|ABR18463.1|  unknown                                               54.3    1e-05   Picea sitchensis



>ref|XP_004234074.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Solanum lycopersicum]
 ref|XP_004234075.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Solanum lycopersicum]
 ref|XP_006356092.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006356093.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Solanum 
tuberosum]
Length=323

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxd  395
            PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP+SNGGSRMWTPGQSG CSPA+A+  D
Sbjct  212  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPISNGGSRMWTPGQSGACSPAIASGID  271

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            ++ADVPMSDAI AEFAFGS+ MG+VKPWEGERIHEEC TDD E T GNS+ R
Sbjct  272  QTADVPMSDAISAEFAFGSHMMGLVKPWEGERIHEECATDDLELTLGNSSTR  323



>ref|XP_004233053.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X3 [Solanum lycopersicum]
 ref|XP_010316857.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Solanum lycopersicum]
Length=324

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxd  395
            PDSGWLSGVQTPQDGPSSPTFSLVS NPFGFKEPLSNGGSRMWTPGQSGTCSPAV    D
Sbjct  213  PDSGWLSGVQTPQDGPSSPTFSLVSSNPFGFKEPLSNGGSRMWTPGQSGTCSPAVGPCMD  272

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            ++ADVPMSDAI AEFAFGSN  G+VKPWEGERIHEECI+DD E T GNS+ R
Sbjct  273  QTADVPMSDAISAEFAFGSNMKGVVKPWEGERIHEECISDDLELTLGNSSTR  324



>ref|XP_010316856.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Solanum lycopersicum]
Length=325

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxd  395
            PDSGWLSGVQTPQDGPSSPTFSLVS NPFGFKEPLSNGGSRMWTPGQSGTCSPAV    D
Sbjct  214  PDSGWLSGVQTPQDGPSSPTFSLVSSNPFGFKEPLSNGGSRMWTPGQSGTCSPAVGPCMD  273

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            ++ADVPMSDAI AEFAFGSN  G+VKPWEGERIHEECI+DD E T GNS+ R
Sbjct  274  QTADVPMSDAISAEFAFGSNMKGVVKPWEGERIHEECISDDLELTLGNSSTR  325



>ref|XP_009590977.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Nicotiana tomentosiformis]
Length=324

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxd  395
            PDSGWLSGVQTPQD PSSPTFSLVSPNPFGFKEPLS GGSRMWTPGQSGTCSPA+ A  D
Sbjct  213  PDSGWLSGVQTPQDEPSSPTFSLVSPNPFGFKEPLSYGGSRMWTPGQSGTCSPAIGAGID  272

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            R+AD+PMSDAI AEFAFGSN  G+VKPWEGERIHEEC+TDD E T GNS+ R
Sbjct  273  RTADIPMSDAISAEFAFGSNMKGLVKPWEGERIHEECVTDDLELTLGNSSTR  324



>ref|XP_009607196.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009607197.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Nicotiana 
tomentosiformis]
Length=326

 Score =   171 bits (433),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxd  395
            PDSGWLSGVQTPQDGPSSPTFSLVS NPFGFKEPLSNGGSRMWTPGQSGTCSPAV A  D
Sbjct  215  PDSGWLSGVQTPQDGPSSPTFSLVSSNPFGFKEPLSNGGSRMWTPGQSGTCSPAVGAGMD  274

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            ++AD+PMSD I AEFAFGSN  G+VKPWEGERIHEEC++DD E T GNS+ R
Sbjct  275  QTADIPMSDVISAEFAFGSNVKGVVKPWEGERIHEECVSDDLELTLGNSSTR  326



>ref|XP_006358089.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006358090.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X4 [Solanum 
tuberosum]
Length=325

 Score =   170 bits (431),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxd  395
            PDSGWLSGVQTPQDGPSSPTFSLVS NPFGFKEPLSNGGSRMWTPGQSGTCSPAV    D
Sbjct  214  PDSGWLSGVQTPQDGPSSPTFSLVSSNPFGFKEPLSNGGSRMWTPGQSGTCSPAVGPCMD  273

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            ++ DVPMSD I AEFAFGSN  G+VKPWEGERIHEECI+DD E T GNS+ R
Sbjct  274  QTGDVPMSDVISAEFAFGSNMKGVVKPWEGERIHEECISDDLELTLGNSSTR  325



>ref|XP_006358087.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006358088.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Solanum 
tuberosum]
Length=326

 Score =   170 bits (430),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxd  395
            PDSGWLSGVQTPQDGPSSPTFSLVS NPFGFKEPLSNGGSRMWTPGQSGTCSPAV    D
Sbjct  215  PDSGWLSGVQTPQDGPSSPTFSLVSSNPFGFKEPLSNGGSRMWTPGQSGTCSPAVGPCMD  274

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            ++ DVPMSD I AEFAFGSN  G+VKPWEGERIHEECI+DD E T GNS+ R
Sbjct  275  QTGDVPMSDVISAEFAFGSNMKGVVKPWEGERIHEECISDDLELTLGNSSTR  326



>ref|XP_009785426.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Nicotiana sylvestris]
Length=323

 Score =   167 bits (424),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -2

Query  571  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxdr  392
            DSGWLSGVQTPQD PSSPTFSLVSPNPFGF+EPLSNGGSRMWTPGQSG CSPA+ A  D+
Sbjct  213  DSGWLSGVQTPQDEPSSPTFSLVSPNPFGFREPLSNGGSRMWTPGQSGVCSPAIGAGIDQ  272

Query  391  sadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            +ADVPMSDAI AEFAFGSN  G+VKPWEGERIHEEC+TDD E T GNS+ +
Sbjct  273  TADVPMSDAISAEFAFGSNMKGLVKPWEGERIHEECLTDDLELTLGNSSTK  323



>gb|EYU28126.1| hypothetical protein MIMGU_mgv1a007967mg [Erythranthe guttata]
Length=328

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxd  395
            PDS WLSGVQTPQDG SSPTFSLV+ NPFGFKEPLSNGGSRMWTPGQSGTCSPA+ A  D
Sbjct  217  PDSRWLSGVQTPQDGASSPTFSLVAANPFGFKEPLSNGGSRMWTPGQSGTCSPAITAGVD  276

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            ++AD+PMSDA+ AEFAFGSN MG+VKPWEGERIHEEC  DD E T GNSN R
Sbjct  277  QTADIPMSDAMSAEFAFGSNIMGLVKPWEGERIHEECAPDDLELTLGNSNTR  328



>ref|XP_009800423.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009800424.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Nicotiana 
sylvestris]
Length=326

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 100/112 (89%), Gaps = 1/112 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxd  395
            PDSGWLSG+QTPQDGPSSPTFSLVS NPFGFKEPLSNGGSRMWTPGQSGTCSPAV A  D
Sbjct  216  PDSGWLSGIQTPQDGPSSPTFSLVS-NPFGFKEPLSNGGSRMWTPGQSGTCSPAVGAGMD  274

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            ++AD+PMSD I AEFAFGSN  G+VKPWEGERIHEEC++DD E T GNS+ R
Sbjct  275  QTADIPMSDVISAEFAFGSNVKGVVKPWEGERIHEECVSDDLELTLGNSSTR  326



>gb|EYU28125.1| hypothetical protein MIMGU_mgv1a007967mg [Erythranthe guttata]
Length=389

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxd  395
            PDS WLSGVQTPQDG SSPTFSLV+ NPFGFKEPLSNGGSRMWTPGQSGTCSPA+ A  D
Sbjct  269  PDSRWLSGVQTPQDGASSPTFSLVAANPFGFKEPLSNGGSRMWTPGQSGTCSPAITAGVD  328

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            ++AD+PMSDA+ AEFAFGSN MG+VKPWEGERIHEEC  DD E T GNSN R
Sbjct  329  QTADIPMSDAMSAEFAFGSNIMGLVKPWEGERIHEECAPDDLELTLGNSNTR  380



>ref|XP_011101448.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Sesamum indicum]
Length=325

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxd  395
            PDSGW+SGVQTPQDGPSSPTFSLVS NPFGFKEP+SNGGSRMWTPGQSGTCSPA+A   D
Sbjct  214  PDSGWVSGVQTPQDGPSSPTFSLVSANPFGFKEPISNGGSRMWTPGQSGTCSPAIAPGFD  273

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            ++ADVPMSDAI +EFAFGSN  G+VKPWEGERIH+EC+ DD E T G  + R
Sbjct  274  QTADVPMSDAISSEFAFGSNTKGLVKPWEGERIHDECVPDDLELTLGIPSTR  325



>emb|CDO96875.1| unnamed protein product [Coffea canephora]
Length=295

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxd  395
            PDSGWLSGVQTPQDGPSSPTFSLV+ NPFG KEPLSNGGSRMWTPGQSG CSPA+AA  D
Sbjct  184  PDSGWLSGVQTPQDGPSSPTFSLVASNPFGIKEPLSNGGSRMWTPGQSGACSPAIAAGFD  243

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            ++ADVPM+DA+ AEFAFG++  G+VKPWEGERIHEE ++DD E T GNS  R
Sbjct  244  QTADVPMADAVSAEFAFGNSTKGLVKPWEGERIHEEFVSDDLELTLGNSKTR  295



>ref|XP_011033513.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Populus 
euphratica]
 ref|XP_011033514.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Populus 
euphratica]
 ref|XP_011010915.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Populus 
euphratica]
 ref|XP_011010916.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Populus 
euphratica]
Length=331

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGGSRMWTPGQSGTCspavaaax  398
            PDSGWL+G+Q PQ GPSSPTFSLVS NPFGF+E  LS  GSRMWTPGQSGTCSPA+ A  
Sbjct  219  PDSGWLAGIQIPQSGPSSPTFSLVSRNPFGFREEALSGAGSRMWTPGQSGTCSPAIPAGI  278

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D++ADVPMSD++ AEFAFGSNA G+VKPWEGERIHEEC++DD E T GNSN R
Sbjct  279  DQTADVPMSDSMAAEFAFGSNAAGLVKPWEGERIHEECVSDDLELTLGNSNTR  331



>ref|XP_002305719.1| hypothetical protein POPTR_0004s06100g [Populus trichocarpa]
 gb|EEE86230.1| hypothetical protein POPTR_0004s06100g [Populus trichocarpa]
Length=331

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGGSRMWTPGQSGTCspavaaax  398
            PDSGWL+G+Q PQ GPSSPTFSLVS NPFGF+E  LS  GSRMWTPGQSGTCSPA+ A  
Sbjct  219  PDSGWLAGIQIPQSGPSSPTFSLVSRNPFGFREEALSGAGSRMWTPGQSGTCSPAIPAGI  278

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D++ADVPMSD++ AEFAFGSNA G+VKPWEGERIHEEC++DD E T GNSN R
Sbjct  279  DQTADVPMSDSMAAEFAFGSNAAGLVKPWEGERIHEECVSDDLELTLGNSNTR  331



>ref|XP_006377531.1| hypothetical protein POPTR_0011s06800g [Populus trichocarpa]
 gb|ERP55328.1| hypothetical protein POPTR_0011s06800g [Populus trichocarpa]
Length=254

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGGSRMWTPGQSGTCspavaaax  398
            PDSGWL+G+Q PQ GPSSPTFSLVS NPFGFKE  LS  GSRMWTPGQSGTCSPAV A  
Sbjct  142  PDSGWLAGIQIPQSGPSSPTFSLVSRNPFGFKEEALSGAGSRMWTPGQSGTCSPAVPAGI  201

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D++ADVPM+D++ AEFAFGSN  G+VKPWEGERIHEEC++DD E T GNS+ R
Sbjct  202  DQTADVPMADSMAAEFAFGSNTAGLVKPWEGERIHEECVSDDLELTLGNSSTR  254



>ref|XP_002522271.1| BRASSINAZOLE-RESISTANT 2 protein, putative [Ricinus communis]
 gb|EEF40129.1| BRASSINAZOLE-RESISTANT 2 protein, putative [Ricinus communis]
Length=331

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCspavaaax  398
            PDSGWL+G+Q PQ GPSSPTFSLVS NPFGF+ EPLS  GSRMWTPGQSGTCSPAV A  
Sbjct  219  PDSGWLAGIQIPQSGPSSPTFSLVSRNPFGFRDEPLSGAGSRMWTPGQSGTCSPAVPAGV  278

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D +ADVPM+D++ AEFAFGSN  G+VKPWEGERIHEEC++DD E T GNS+ R
Sbjct  279  DHTADVPMADSMAAEFAFGSNTTGLVKPWEGERIHEECVSDDLELTLGNSSTR  331



>ref|XP_011039378.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Populus euphratica]
Length=333

 Score =   152 bits (385),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGGSRMWTPGQSGTCspavaaax  398
            PDSGWL+G+Q PQ GPSSPTFSLVS NPFGFKE  LS  GSRMWTPGQSGTCSPAV A  
Sbjct  221  PDSGWLAGIQIPQSGPSSPTFSLVSRNPFGFKEEALSGAGSRMWTPGQSGTCSPAVPAGI  280

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D++ADVPMSD++ AEFAFGSNA G+VKPWEGERIHEEC++DD E T GN + R
Sbjct  281  DQTADVPMSDSMAAEFAFGSNAAGLVKPWEGERIHEECVSDDLELTLGNPSTR  333



>gb|KDP21147.1| hypothetical protein JCGZ_21618 [Jatropha curcas]
Length=331

 Score =   152 bits (384),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCspavaaax  398
            PDSGWL+G+Q PQ GPSSPTFSLVS NPFGF+ EPLS  GSRMWTPGQSGTCSPAV A  
Sbjct  219  PDSGWLAGIQIPQSGPSSPTFSLVSRNPFGFRDEPLSGAGSRMWTPGQSGTCSPAVPAGV  278

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D++ADVPM+D+I +EFAFGSN  G+VKPWEGERIHEEC++DD E T GNS  R
Sbjct  279  DQTADVPMADSIASEFAFGSNTGGLVKPWEGERIHEECVSDDLELTLGNSRTR  331



>gb|KDO77946.1| hypothetical protein CISIN_1g020318mg [Citrus sinensis]
Length=248

 Score =   150 bits (378),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 93/113 (82%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGG-SRMWTPGQSGTCspavaaax  398
            PDSGWLSG+Q PQ GPSSPTFSLVS NPFGF+E + +GG SRMWTPGQSGTCSPAV A  
Sbjct  136  PDSGWLSGIQIPQSGPSSPTFSLVSRNPFGFREEVLSGGPSRMWTPGQSGTCSPAVPAGV  195

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D ++DVPMSD I  EFAFG NA G+VKPWEGERIHEEC++DD E T GNS  R
Sbjct  196  DNTSDVPMSDCIATEFAFGCNATGLVKPWEGERIHEECVSDDLELTLGNSKTR  248



>ref|XP_007025289.1| BES1/BZR1 [Theobroma cacao]
 gb|EOY27911.1| BES1/BZR1 [Theobroma cacao]
Length=327

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 93/113 (82%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCspavaaax  398
            PDSGWLS ++ PQ GP+SPTFSLVS NPFGFK E LS GGSRMWTPGQSGTCSPA  A  
Sbjct  215  PDSGWLSRLEIPQSGPTSPTFSLVSRNPFGFKDETLSGGGSRMWTPGQSGTCSPAFPAGV  274

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D+++DVPMSDAI AEFAFGSN  G+VKPWEGE+IHEEC+ DD E T GNS  R
Sbjct  275  DQTSDVPMSDAIAAEFAFGSNVTGLVKPWEGEKIHEECVADDLELTLGNSKTR  327



>ref|XP_006449559.1| hypothetical protein CICLE_v10015910mg [Citrus clementina]
 ref|XP_006467592.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Citrus 
sinensis]
 ref|XP_006467593.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Citrus 
sinensis]
 gb|ESR62799.1| hypothetical protein CICLE_v10015910mg [Citrus clementina]
 gb|KDO77944.1| hypothetical protein CISIN_1g020318mg [Citrus sinensis]
 gb|KDO77945.1| hypothetical protein CISIN_1g020318mg [Citrus sinensis]
Length=327

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 93/113 (82%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGG-SRMWTPGQSGTCspavaaax  398
            PDSGWLSG+Q PQ GPSSPTFSLVS NPFGF+E + +GG SRMWTPGQSGTCSPAV A  
Sbjct  215  PDSGWLSGIQIPQSGPSSPTFSLVSRNPFGFREEVLSGGPSRMWTPGQSGTCSPAVPAGV  274

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D ++DVPMSD I  EFAFG NA G+VKPWEGERIHEEC++DD E T GNS  R
Sbjct  275  DNTSDVPMSDCIATEFAFGCNATGLVKPWEGERIHEECVSDDLELTLGNSKTR  327



>gb|KHG25078.1| BES1/BZR1 4 -like protein [Gossypium arboreum]
Length=319

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 92/113 (81%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCspavaaax  398
            PD GWLS ++ PQ GP+SPTFSLVS NPFGFK E LS GGSRMWTPGQSGTCSPA  A  
Sbjct  207  PDPGWLSRLEIPQSGPTSPTFSLVSRNPFGFKDEALSRGGSRMWTPGQSGTCSPAFPAGV  266

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D+++DVPMSDAI AEFAFGSN  G+VKPWEGE+IHEEC+ DD E T GNS  R
Sbjct  267  DQTSDVPMSDAIAAEFAFGSNMTGLVKPWEGEKIHEECVADDLELTLGNSKTR  319



>gb|KJB69668.1| hypothetical protein B456_011G036300 [Gossypium raimondii]
 gb|KJB69671.1| hypothetical protein B456_011G036300 [Gossypium raimondii]
Length=319

 Score =   146 bits (369),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 92/113 (81%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCspavaaax  398
            PD GWLS ++ PQ GP+SPTFSLVS NPFGFK E LS GGSRMWTPGQSGTCSPA  A  
Sbjct  207  PDPGWLSRLEIPQSGPTSPTFSLVSRNPFGFKDEALSGGGSRMWTPGQSGTCSPAFPAGV  266

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D+++DVPMSDAI AEFAFGSN  G+VKPWEGE+IHEEC+ +D E T GNS  R
Sbjct  267  DQTSDVPMSDAIAAEFAFGSNMTGLVKPWEGEKIHEECVANDLELTLGNSKTR  319



>ref|XP_010242162.1| PREDICTED: BES1/BZR1 homolog protein 4 [Nelumbo nucifera]
Length=327

 Score =   144 bits (363),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 92/112 (82%), Gaps = 1/112 (1%)
 Frame = -2

Query  571  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCspavaaaxd  395
            DSGWL+G++ PQ GPSSPTFSLVS NPFGFKE  L+ GGSRMWTPGQSGTCSPAVA   D
Sbjct  216  DSGWLAGIRIPQGGPSSPTFSLVSSNPFGFKEEVLAGGGSRMWTPGQSGTCSPAVAGGSD  275

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            ++ADVPMSD I  EFAFGSNA G+VKPWEGERIHEEC +DD E T G S  R
Sbjct  276  QTADVPMSDRISDEFAFGSNATGLVKPWEGERIHEECGSDDLELTLGTSRTR  327



>ref|XP_008371512.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Malus domestica]
 ref|XP_009351745.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Pyrus x bretschneideri]
Length=331

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 92/112 (82%), Gaps = 1/112 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxd  395
            PDSGWL+G+Q PQ GPSSPTFSLVS NPF  KE LS GGSRMWTPGQSGTCSPAVAA+ D
Sbjct  221  PDSGWLAGLQIPQSGPSSPTFSLVSRNPFNLKEALSGGGSRMWTPGQSGTCSPAVAASID  280

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             + DVPMSD + AEFAFGSN  G+VKPWEGERI EEC++DD E T G++  R
Sbjct  281  HTGDVPMSDGMAAEFAFGSNTTGLVKPWEGERI-EECVSDDLELTLGSTRTR  331



>ref|XP_007211637.1| hypothetical protein PRUPE_ppa008675mg [Prunus persica]
 ref|XP_008225238.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Prunus mume]
 ref|XP_008225239.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Prunus mume]
 gb|EMJ12836.1| hypothetical protein PRUPE_ppa008675mg [Prunus persica]
Length=323

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 91/112 (81%), Gaps = 1/112 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxd  395
            PDSGWL+G+Q PQ GPSSPTFSLVS NPF  KE LS GGSRMWTPGQSGTCSP VAA+ D
Sbjct  213  PDSGWLAGLQIPQSGPSSPTFSLVSRNPFNLKEALSGGGSRMWTPGQSGTCSPVVAASVD  272

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             S DVPMSD + AEFAFGSN  G+VKPWEGERI EEC++DD E T G++  R
Sbjct  273  HSGDVPMSDGMAAEFAFGSNTSGLVKPWEGERI-EECVSDDLELTLGSARTR  323



>ref|XP_002267082.1| PREDICTED: BES1/BZR1 homolog protein 4 [Vitis vinifera]
Length=341

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 93/113 (82%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCspavaaax  398
            PDSGW +G+Q PQ GP+SPTFSLVS NPFGFKE  L+ GGSRMWTPGQSGTCSPAVAA  
Sbjct  229  PDSGWFAGMQIPQGGPASPTFSLVSANPFGFKEEVLAGGGSRMWTPGQSGTCSPAVAAGS  288

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D +ADVPM+D I AEFAFGSN  G+VKPWEGERIHEEC +D+ E T G+S  R
Sbjct  289  DHTADVPMADGIAAEFAFGSNTTGLVKPWEGERIHEECGSDELELTLGSSRTR  341



>ref|XP_008383594.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Malus domestica]
Length=331

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 91/112 (81%), Gaps = 1/112 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxd  395
            PDSGWL+G+Q PQ GPSSPTFSLVS NPF  KE LS  GSRMWTPGQSGTCSPAVAA+ D
Sbjct  221  PDSGWLAGLQIPQSGPSSPTFSLVSKNPFNLKEALSGAGSRMWTPGQSGTCSPAVAASID  280

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             + D+PMSD + AEFAFGSN  G+VKPWEGERI EEC++DD E T G++  R
Sbjct  281  HTGDIPMSDGMAAEFAFGSNTTGLVKPWEGERI-EECVSDDLELTLGSTRTR  331



>ref|XP_009352718.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Pyrus x bretschneideri]
Length=331

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxd  395
            PDSGWL+G+Q PQ GPSSPTFSLVS NPF  KE LS  GSRMWTPGQSGTCSP VAA+ D
Sbjct  221  PDSGWLAGLQIPQSGPSSPTFSLVSKNPFNLKEALSGAGSRMWTPGQSGTCSPVVAASID  280

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             + D+PMSD + AEFAFGSN  G+VKPWEGERI EEC++DD E T G++  R
Sbjct  281  HTGDIPMSDGMAAEFAFGSNTTGLVKPWEGERI-EECVSDDLELTLGSTRTR  331



>ref|XP_004309625.1| PREDICTED: BES1/BZR1 homolog protein 4 [Fragaria vesca subsp. 
vesca]
Length=329

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 91/112 (81%), Gaps = 4/112 (4%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxd  395
            PDSGWL+G+Q+   GPSSPTFSLVS NPFGFKE LS GGSRMWTPGQSGTCSP VAA  D
Sbjct  222  PDSGWLAGLQS---GPSSPTFSLVSRNPFGFKEALSGGGSRMWTPGQSGTCSPVVAAGLD  278

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             + DV MSD + AEFAFGSNA G+VKPWEGERI EEC++DD E T G++  R
Sbjct  279  HTGDVAMSDGMAAEFAFGSNATGLVKPWEGERI-EECVSDDLELTLGSTKTR  329



>gb|KHG15415.1| BES1/BZR1 4 -like protein [Gossypium arboreum]
Length=325

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 91/113 (81%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCspavaaax  398
            PD  W SG+QTP   P+SPTFSLVS NPFGFKE  L+ GGSRMWTPGQSGTCSPA+AA  
Sbjct  213  PDPEWFSGLQTPHSRPTSPTFSLVSSNPFGFKEEVLAGGGSRMWTPGQSGTCSPAIAAGL  272

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D++ADVPMS+ I  EFAFGSNA G+VKPWEGERIHEEC +DD E T G+S  R
Sbjct  273  DQTADVPMSEVISDEFAFGSNATGLVKPWEGERIHEECGSDDLELTLGSSKTR  325



>gb|KJB13026.1| hypothetical protein B456_002G052400 [Gossypium raimondii]
 gb|KJB13027.1| hypothetical protein B456_002G052400 [Gossypium raimondii]
 gb|KJB13028.1| hypothetical protein B456_002G052400 [Gossypium raimondii]
 gb|KJB13029.1| hypothetical protein B456_002G052400 [Gossypium raimondii]
Length=325

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 91/113 (81%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCspavaaax  398
            PD  W SG+QTP   P+SPTFSLVS NPFGFKE  L+ GGSRMWTPGQSGTCSPA+AA  
Sbjct  213  PDPEWFSGLQTPHSRPTSPTFSLVSSNPFGFKEEVLAGGGSRMWTPGQSGTCSPAIAAGL  272

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D++ADVPMS+ I  EFAFGSNA G+VKPWEGERIHEEC +DD E T G+S  R
Sbjct  273  DQTADVPMSEVISDEFAFGSNATGLVKPWEGERIHEECGSDDLELTLGSSKTR  325



>ref|XP_002317445.1| brassinosteroid signaling positive regulator-related family protein 
[Populus trichocarpa]
 gb|EEE98057.1| brassinosteroid signaling positive regulator-related family protein 
[Populus trichocarpa]
Length=319

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 91/113 (81%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGGSRMWTPGQSGTCspavaaax  398
            PD GW +G++ PQ GP+SPTFSLV+ NPFGFKE  L+ GGSRMWTPGQSGTCSPA+AA  
Sbjct  207  PDPGWFAGIRLPQGGPTSPTFSLVASNPFGFKEEALAGGGSRMWTPGQSGTCSPAIAAGS  266

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D++AD+PM++ I  EFAF  NA G+VKPWEGERIHEEC +DD E T GNS  R
Sbjct  267  DQTADIPMAEVISDEFAFRCNATGLVKPWEGERIHEECGSDDLELTLGNSRTR  319



>ref|XP_007021866.1| BES1/BZR1 [Theobroma cacao]
 gb|EOY13391.1| BES1/BZR1 [Theobroma cacao]
Length=325

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 90/113 (80%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCspavaaax  398
            PD  W +G++ P  GP+SPTFSLVS NPFGFKE  L+ GGSRMWTPGQSGTCSPA+AA  
Sbjct  213  PDPEWFAGLRIPHSGPTSPTFSLVSTNPFGFKEEVLAGGGSRMWTPGQSGTCSPAIAAGS  272

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D +ADVPMS+ I  EFAFGSNA G+VKPWEGERIHEEC +DD E T G+S  R
Sbjct  273  DHTADVPMSEVISDEFAFGSNATGLVKPWEGERIHEECGSDDLELTLGSSRTR  325



>ref|XP_011044050.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Populus euphratica]
Length=319

 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGGSRMWTPGQSGTCspavaaax  398
            PD GW +G++ PQ GP+SPTFSLV+PN FGFKE   + GGSRMWTPGQSGTCSPA+AA  
Sbjct  207  PDPGWFAGIRLPQGGPTSPTFSLVAPNSFGFKEEAFAGGGSRMWTPGQSGTCSPAIAAGS  266

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D +AD+PM++ I  EFAF  NA G+VKPWEGERIHEEC +DD E T GNS  R
Sbjct  267  DHTADIPMAEVISDEFAFRCNATGLVKPWEGERIHEECGSDDLELTLGNSRTR  319



>ref|XP_010644097.1| PREDICTED: BES1/BZR1 homolog protein 4 [Vitis vinifera]
Length=326

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 90/114 (79%), Gaps = 2/114 (2%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPL--SNGGSRMWTPGQSGTCspavaaa  401
            PDS W +G++ PQ GP+SPTFSLVS NPFGFKE +  S  GSRMWTPGQSGTCSPA+AA 
Sbjct  213  PDSEWFAGIRIPQGGPTSPTFSLVSSNPFGFKEEMLASASGSRMWTPGQSGTCSPAIAAG  272

Query  400  xdrsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             D +ADVPMS+ I  EFAFG N +G+VKPWEGERIHEEC +DD E T G+S  R
Sbjct  273  SDHTADVPMSEVISDEFAFGCNTVGLVKPWEGERIHEECGSDDLELTLGSSRTR  326



>gb|KJB45771.1| hypothetical protein B456_007G327000 [Gossypium raimondii]
Length=317

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 90/113 (80%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCspavaaax  398
            PD  W +G++ P  GP+SPTFSLVS NPFGFKE  L+ GGSRMWTPGQSGTCSPA+AA  
Sbjct  205  PDPEWFAGLRIPLSGPTSPTFSLVSSNPFGFKEEVLAGGGSRMWTPGQSGTCSPAIAAGS  264

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D +ADVPMS+ I  EFAFGSNA G+VKPWEGERIHE+C +DD E T G+S  R
Sbjct  265  DHTADVPMSEVISDEFAFGSNATGLVKPWEGERIHEDCGSDDLELTLGSSRTR  317



>ref|XP_004137229.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Cucumis sativus]
 ref|XP_004156512.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Cucumis sativus]
 gb|KGN53574.1| hypothetical protein Csa_4G083490 [Cucumis sativus]
Length=325

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCspavaaax  398
            P   W +G++ PQ GP+SPTFSLVS NPFGFKE  ++ GGSRMWTPGQSGTCSPA+AA  
Sbjct  213  PTPEWFAGLRIPQGGPNSPTFSLVSTNPFGFKEAAITGGGSRMWTPGQSGTCSPAIAAGS  272

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D +AD+PMS+ I  EFAFGSNA GIVKPWEGE IHEEC +DD E T GNS  R
Sbjct  273  DHTADIPMSEVISDEFAFGSNAAGIVKPWEGEIIHEECGSDDLELTLGNSRTR  325



>ref|XP_010088009.1| hypothetical protein L484_004599 [Morus notabilis]
 gb|EXB31125.1| hypothetical protein L484_004599 [Morus notabilis]
Length=368

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 94/117 (80%), Gaps = 6/117 (5%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCspavaaax  398
            PDSGWL+G+Q PQ GPSSPTFSLVS NPFGFK E +S GGSRMWTPGQSGTCSPAVAA  
Sbjct  236  PDSGWLAGLQIPQSGPSSPTFSLVSRNPFGFKEEAMSGGGSRMWTPGQSGTCSPAVAAGA  295

Query  397  drsadvPMSDA-IQAEFAFGSNAM---GIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D +ADVPM D  + AEFAFG NA+   G+VKPWEGERI EEC++DD E T GNS  R
Sbjct  296  DNTADVPMCDGNMAAEFAFGCNAIATGGLVKPWEGERI-EECVSDDLELTLGNSRTR  351



>gb|KHG21553.1| BES1/BZR1 4 -like protein [Gossypium arboreum]
Length=317

 Score =   133 bits (334),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 90/113 (80%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCspavaaax  398
            PD  W +G++ P  GP+SPTFSLVS NPFGFKE  L+ GGSRMWTPGQSGTCSPA+AA  
Sbjct  205  PDPEWFAGLRIPLSGPTSPTFSLVSSNPFGFKEEVLAGGGSRMWTPGQSGTCSPAIAAGS  264

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D +ADVPMS+ I  EFAFGSNA G++KPWEGERIHE+C +DD E T G+S  R
Sbjct  265  DHTADVPMSEVISDEFAFGSNATGLMKPWEGERIHEDCGSDDLELTLGSSRIR  317



>ref|XP_008451746.1| PREDICTED: BES1/BZR1 homolog protein 4 [Cucumis melo]
 ref|XP_008451748.1| PREDICTED: BES1/BZR1 homolog protein 4 [Cucumis melo]
Length=325

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCspavaaax  398
            P   W +G++ PQ GP+SPTFSLVS NPFGFKE  ++ GGSRMWTPGQSGTCSPA+AA  
Sbjct  213  PTPEWFAGLRIPQGGPNSPTFSLVSTNPFGFKEAAITGGGSRMWTPGQSGTCSPAIAAGS  272

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D +AD+PMS+ I  EFAFGSNA G+VKPWEGE IHEEC +DD E T GNS  R
Sbjct  273  DHTADIPMSEVISDEFAFGSNAAGLVKPWEGEIIHEECGSDDLELTLGNSRTR  325



>ref|XP_004147390.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Cucumis sativus]
 ref|XP_004172293.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Cucumis sativus]
 gb|KGN65601.1| hypothetical protein Csa_1G467200 [Cucumis sativus]
Length=327

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = -2

Query  571  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxdr  392
            D  WL  ++ PQ GPSSPTFSLV+ NPFGFKE +S G SR WTP QSGTCSP VAA  D 
Sbjct  217  DPAWLDSIRIPQSGPSSPTFSLVARNPFGFKEAMSAGVSRNWTPTQSGTCSPTVAAGIDH  276

Query  391  sadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            ++DVPM+D    +FAFGS ++G+VKPWEGERIHEECI+DD E T GNS+ R
Sbjct  277  TSDVPMTDGTATDFAFGSCSIGLVKPWEGERIHEECISDDLELTLGNSSTR  327



>ref|XP_008443587.1| PREDICTED: BES1/BZR1 homolog protein 4 [Cucumis melo]
Length=327

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = -2

Query  571  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxdr  392
            D  WL  ++ PQ GPSSPTFSLV+ NPFGFKE +S G SR WTP QSGTCSP VAA  D 
Sbjct  217  DPAWLDSIRIPQSGPSSPTFSLVARNPFGFKEAMSAGVSRNWTPTQSGTCSPTVAAGIDH  276

Query  391  sadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            ++DVPM+D    +FAFGS ++G+VKPWEGERIHEECI+DD E T GNS+ R
Sbjct  277  TSDVPMTDGTATDFAFGSCSIGLVKPWEGERIHEECISDDLELTLGNSSTR  327



>ref|XP_006442379.1| hypothetical protein CICLE_v10021151mg [Citrus clementina]
 gb|ESR55619.1| hypothetical protein CICLE_v10021151mg [Citrus clementina]
Length=278

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCspavaaax  398
            PD  W +G++ P   P+SPTFSLV+ NPFGFK E L+ GGSRMWTPGQSGTCSPA+AA  
Sbjct  166  PDPEWFAGIRLPHGAPTSPTFSLVASNPFGFKDETLAGGGSRMWTPGQSGTCSPAIAAGS  225

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D +ADVPMS+ +  EFAFGSNA G+VK WEGERIHEEC +DD E T G+S  R
Sbjct  226  DHTADVPMSEVVTDEFAFGSNATGLVKAWEGERIHEECGSDDLELTLGSSRTR  278



>ref|XP_010093488.1| hypothetical protein L484_017551 [Morus notabilis]
 gb|EXB54112.1| hypothetical protein L484_017551 [Morus notabilis]
Length=391

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = -2

Query  571  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCspavaaaxd  395
            D  W +G++ PQ GP+SPTFSLVS NPFGFK E ++ GGSRMWTPGQSGTCSPA+AA  D
Sbjct  280  DPEWFAGIRLPQTGPTSPTFSLVSANPFGFKDEVMAGGGSRMWTPGQSGTCSPAIAAGSD  339

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             +AD+PM++ I  EFAFGS+A G+VKPWEGERIHEEC +DD E T G+S  R
Sbjct  340  HTADIPMAEVISDEFAFGSHATGLVKPWEGERIHEECGSDDLELTLGSSRTR  391



>ref|XP_006284265.1| hypothetical protein CARUB_v10005431mg [Capsella rubella]
 gb|EOA17163.1| hypothetical protein CARUB_v10005431mg [Capsella rubella]
Length=284

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 89/117 (76%), Gaps = 5/117 (4%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSR--MWTPGQSGTCspavaaa  401
            PDSGWLSG+QTPQ GPSSPTFSLVS NPF  KE    G S   MWTPGQSG CSPA+ A 
Sbjct  168  PDSGWLSGMQTPQSGPSSPTFSLVSRNPFFDKEAFKMGDSNSPMWTPGQSGNCSPAIPAG  227

Query  400  xdrsadvPMSDAIQAEFAFGSNA---MGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             D+++DVPMSD + AEFAFG NA   +G+VKPWEGERIH EC++DD E T GNS  R
Sbjct  228  ADQNSDVPMSDGMAAEFAFGCNATAVIGMVKPWEGERIHGECVSDDLELTLGNSRTR  284



>ref|NP_193624.1| BES1/BZR1-like protein 3 [Arabidopsis thaliana]
 sp|O49404.1|BEH3_ARATH RecName: Full=BES1/BZR1 homolog protein 3 [Arabidopsis thaliana]
 emb|CAA16746.1| putative protein [Arabidopsis thaliana]
 emb|CAB78891.1| putative protein [Arabidopsis thaliana]
 gb|AAM65918.1| unknown [Arabidopsis thaliana]
 dbj|BAC43438.1| unknown protein [Arabidopsis thaliana]
 gb|ABD19693.1| At4g18890 [Arabidopsis thaliana]
 gb|AEE84102.1| BES1/BZR1-like protein 3 [Arabidopsis thaliana]
Length=284

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 89/117 (76%), Gaps = 5/117 (4%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNG--GSRMWTPGQSGTCspavaaa  401
            PDSGWLSG+QTPQ GPSSPTFSLVS NPF  KE    G   S MWTPGQSG CSPA+ A 
Sbjct  168  PDSGWLSGMQTPQSGPSSPTFSLVSRNPFFDKEAFKMGDCNSPMWTPGQSGNCSPAIPAG  227

Query  400  xdrsadvPMSDAIQAEFAFGSNAM---GIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             D+++DVPM+D + AEFAFG NAM   G+VKPWEGERIH EC++DD E T GNS  R
Sbjct  228  VDQNSDVPMADGMTAEFAFGCNAMAANGMVKPWEGERIHGECVSDDLELTLGNSRTR  284



>gb|EPS61611.1| hypothetical protein M569_13185 [Genlisea aurea]
Length=307

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 90/118 (76%), Gaps = 8/118 (7%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPF-------GFKEPLSNGGSRMWTPGQSGTCsp  416
            PDSG +SGVQTPQD PSSPTFSLVS  PF         KEPLSNGGSRMWTPGQSGTCSP
Sbjct  187  PDSGLVSGVQTPQDMPSSPTFSLVSAGPFGGGGGGSSIKEPLSNGGSRMWTPGQSGTCSP  246

Query  415  avaaaxdrsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECIT-DDXEXTXGNSN  245
            AVA   D++ADVPM+D +  EFAFG+NA  +VKPWEGE IH+ECI  DD E   GNS+
Sbjct  247  AVAPGSDQTADVPMADVMSTEFAFGNNAKRLVKPWEGEIIHDECIIPDDLELKLGNSS  304



>ref|XP_006442380.1| hypothetical protein CICLE_v10021151mg [Citrus clementina]
 gb|ESR55620.1| hypothetical protein CICLE_v10021151mg [Citrus clementina]
Length=324

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCspavaaax  398
            PD  W +G++ P   P+SPTFSLV+ NPFGFK E L+ GGSRMWTPGQSGTCSPA+AA  
Sbjct  212  PDPEWFAGIRLPHGAPTSPTFSLVASNPFGFKDETLAGGGSRMWTPGQSGTCSPAIAAGS  271

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D +ADVPMS+ +  EFAFGSNA G+VK WEGERIHEEC +DD E T G+S  R
Sbjct  272  DHTADVPMSEVVTDEFAFGSNATGLVKAWEGERIHEECGSDDLELTLGSSRTR  324



>ref|XP_006477843.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Citrus 
sinensis]
 ref|XP_006477844.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Citrus 
sinensis]
 gb|KDO43794.1| hypothetical protein CISIN_1g020567mg [Citrus sinensis]
Length=324

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCspavaaax  398
            PD  W +G++ P   P+SPTFSLV+ NPFGFK E L+ GGSRMWTPGQSGTCSPA+AA  
Sbjct  212  PDPEWFAGIRLPHGAPTSPTFSLVASNPFGFKDETLAGGGSRMWTPGQSGTCSPAIAAGS  271

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D +ADVPMS+ +  EFAFGSNA G+VK WEGERIHEEC +DD E T G+S  R
Sbjct  272  DHTADVPMSEVVTDEFAFGSNATGLVKAWEGERIHEECGSDDLELTLGSSRTR  324



>ref|XP_011082785.1| PREDICTED: BES1/BZR1 homolog protein 4 [Sesamum indicum]
 ref|XP_011082786.1| PREDICTED: BES1/BZR1 homolog protein 4 [Sesamum indicum]
Length=325

 Score =   130 bits (327),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = -2

Query  571  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCspavaaaxd  395
            DS W +GVQ PQ GP+SPTFSLVS NPFGF+ E LS GGS M TPGQSGTCSPAVAAA +
Sbjct  214  DSKWFAGVQIPQSGPTSPTFSLVSSNPFGFRVEDLSRGGSLMCTPGQSGTCSPAVAAASE  273

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            ++AD+PM++ I  +FAFGSN  G+VKPWEGERIHEEC +DD E T G+S  R
Sbjct  274  QNADIPMAEVISNDFAFGSNIAGLVKPWEGERIHEECGSDDLELTLGSSKTR  325



>ref|XP_010434483.1| PREDICTED: BES1/BZR1 homolog protein 3 [Camelina sativa]
 ref|XP_010439796.1| PREDICTED: BES1/BZR1 homolog protein 3 [Camelina sativa]
 ref|XP_010449452.1| PREDICTED: BES1/BZR1 homolog protein 3 [Camelina sativa]
Length=284

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 89/117 (76%), Gaps = 5/117 (4%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNG--GSRMWTPGQSGTCspavaaa  401
            PDSGWLSG+QTPQ GPSSPTFSLVS NPF  KE    G   S MWTPGQSG CSPA+ A 
Sbjct  168  PDSGWLSGMQTPQSGPSSPTFSLVSRNPFFDKEAFKMGDCNSPMWTPGQSGNCSPAIPAG  227

Query  400  xdrsadvPMSDAIQAEFAFGSNA---MGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             D+++DVPM+D + AEFAFG NA   +G+VKPWEGERIH EC++DD E T GNS  R
Sbjct  228  VDQNSDVPMADGMAAEFAFGCNATTVIGMVKPWEGERIHGECVSDDLELTLGNSRTR  284



>ref|XP_011002765.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X3 [Populus euphratica]
Length=272

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 88/117 (75%), Gaps = 6/117 (5%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPL-----SNGGSRMWTPGQSGTCspav  410
            PD  W  G++ PQ GP+SPTFSLV+ NPFGFKE       SNGGSRMWTPGQSGTCSPA+
Sbjct  157  PDPEWFRGIRMPQGGPTSPTFSLVASNPFGFKEEALAGGGSNGGSRMWTPGQSGTCSPAI  216

Query  409  aaaxdrsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            AA  D +AD+PM++ I  EFAF  NA G+VKPWEGERIHEEC +DD E T GNS  R
Sbjct  217  AAGSDHTADIPMAE-ISDEFAFRCNATGLVKPWEGERIHEECGSDDLELTLGNSRTR  272



>ref|XP_002870016.1| hypothetical protein ARALYDRAFT_492971 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46275.1| hypothetical protein ARALYDRAFT_492971 [Arabidopsis lyrata subsp. 
lyrata]
Length=284

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 89/117 (76%), Gaps = 5/117 (4%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNG--GSRMWTPGQSGTCspavaaa  401
            PDSGWLSG+QTPQ GPSSPTFSLVS NPF  KE    G   S MWTPGQSG CSPA+ A 
Sbjct  168  PDSGWLSGMQTPQSGPSSPTFSLVSRNPFFDKEAFKMGDCNSPMWTPGQSGNCSPAIPAG  227

Query  400  xdrsadvPMSDAIQAEFAFGSN---AMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             D+++DVPM+D + AEFAFG N   A+G+VKPWEGERIH EC++DD E T GNS  +
Sbjct  228  VDQNSDVPMADGMAAEFAFGCNAIAAIGMVKPWEGERIHGECVSDDLELTLGNSRTK  284



>ref|XP_007211588.1| hypothetical protein PRUPE_ppa008637mg [Prunus persica]
 gb|EMJ12787.1| hypothetical protein PRUPE_ppa008637mg [Prunus persica]
Length=324

 Score =   128 bits (321),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 88/113 (78%), Gaps = 2/113 (2%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCspavaaax  398
            PD  W +G++ P  GP+SPTFSLV+ NPFGFK E L+ GGSRMWTPGQSGTCSPA+AA  
Sbjct  213  PDPEWFAGLRIPH-GPTSPTFSLVALNPFGFKDEALAGGGSRMWTPGQSGTCSPAIAAGS  271

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D +AD+PMS+ I  EFAFG N  G+VKPWEGERIHEEC +DD E T G+S  R
Sbjct  272  DHTADIPMSEVISDEFAFGCNTAGLVKPWEGERIHEECGSDDLELTLGSSRTR  324



>ref|XP_011002762.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Populus euphratica]
 ref|XP_011002763.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Populus euphratica]
Length=328

 Score =   128 bits (321),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 88/117 (75%), Gaps = 6/117 (5%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPL-----SNGGSRMWTPGQSGTCspav  410
            PD  W  G++ PQ GP+SPTFSLV+ NPFGFKE       SNGGSRMWTPGQSGTCSPA+
Sbjct  213  PDPEWFRGIRMPQGGPTSPTFSLVASNPFGFKEEALAGGGSNGGSRMWTPGQSGTCSPAI  272

Query  409  aaaxdrsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            AA  D +AD+PM++ I  EFAF  NA G+VKPWEGERIHEEC +DD E T GNS  R
Sbjct  273  AAGSDHTADIPMAE-ISDEFAFRCNATGLVKPWEGERIHEECGSDDLELTLGNSRTR  328



>ref|XP_008226380.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Prunus mume]
Length=324

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCspavaaax  398
            PD  W +G++ P +GP+SPTFSLV+ NPFGFK E L+ GGSRMWTPGQSGTCSPA+AA  
Sbjct  213  PDPEWFAGLRIP-NGPTSPTFSLVALNPFGFKDEALAGGGSRMWTPGQSGTCSPAIAAGS  271

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D +AD+PMS+ I  EFAFG N  G+VKPWEGERIHEEC +DD E T G+S  R
Sbjct  272  DHTADIPMSEVISDEFAFGCNTAGLVKPWEGERIHEECGSDDLELTLGSSRTR  324



>gb|KFK28557.1| hypothetical protein AALP_AA7G011700 [Arabis alpina]
Length=284

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 88/117 (75%), Gaps = 5/117 (4%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNG--GSRMWTPGQSGTCspavaaa  401
            PDSGWLSG+QTPQ GPSSPTFSLVS NPF   +    G   S MWTPGQSG CSPA+ A 
Sbjct  168  PDSGWLSGMQTPQSGPSSPTFSLVSRNPFFDNQAFKMGDCNSPMWTPGQSGNCSPAIPAG  227

Query  400  xdrsadvPMSDAIQAEFAFGSN---AMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             D++ADVPMSD + AEFAFG N   A+G+VKPWEGERIH EC++DD E T GNS  R
Sbjct  228  LDQTADVPMSDGMAAEFAFGCNAIAAIGMVKPWEGERIHGECVSDDLELTLGNSRTR  284



>gb|KHG20428.1| BES1/BZR1 4 -like protein [Gossypium arboreum]
Length=322

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 86/114 (75%), Gaps = 8/114 (7%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCspavaaax  398
            PD  WLS       GP+SPTFSLVS NPFGFK E LS GGSRMWTPGQSGTCSPA  A  
Sbjct  215  PDPEWLS------SGPTSPTFSLVSRNPFGFKDEALSAGGSRMWTPGQSGTCSPAFPAGV  268

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECIT-DDXEXTXGNSNXR  239
            D+++DVPMSD I AEFAFGSN  G+VKPWEGE+IHEEC+  DD E T GNS  R
Sbjct  269  DQTSDVPMSDVIAAEFAFGSNFTGLVKPWEGEKIHEECVADDDLELTLGNSKTR  322



>ref|XP_010052157.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010052158.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Eucalyptus 
grandis]
 gb|KCW76060.1| hypothetical protein EUGRSUZ_D00428 [Eucalyptus grandis]
Length=320

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 89/113 (79%), Gaps = 8/113 (7%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGGSRMWTPGQSGTCspavaaax  398
            PDSGWL+G      GPSSPTFSLV+ NPFGFKE   S GGSRMWTPGQSGTCSPA+AA  
Sbjct  215  PDSGWLTG------GPSSPTFSLVARNPFGFKEEAFSGGGSRMWTPGQSGTCSPAIAAGA  268

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D ++D+PMSD++  EFAFGSNA G+VKPWEGERIHE+  +DD E T GN+  R
Sbjct  269  DLTSDIPMSDSMATEFAFGSNATGLVKPWEGERIHEDA-SDDLELTLGNARTR  320



>ref|XP_003596274.1| Brassinosteroid signaling positive regulator-related protein 
[Medicago truncatula]
Length=447

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 85/112 (76%), Gaps = 1/112 (1%)
 Frame = -2

Query  571  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCspavaaaxd  395
            D  W +G++ P   P+SPTF+LVS +PF FKE   S GGSRMWTPGQSG CSPA+AA  D
Sbjct  205  DPEWFAGIKLPHASPTSPTFNLVSRSPFAFKEDGFSGGGSRMWTPGQSGACSPAIAAGFD  264

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            ++AD+PMS+AI  EFAFGSN  GIVKPWEGERIHEE + DD E T GNS  R
Sbjct  265  QTADIPMSEAISDEFAFGSNTFGIVKPWEGERIHEEFVADDLELTLGNSKTR  316



>ref|XP_010518825.1| PREDICTED: BES1/BZR1 homolog protein 3 isoform X1 [Tarenaya hassleriana]
Length=311

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 92/130 (71%), Gaps = 5/130 (4%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPL-SNGGSRMWTPGQSGTCspavaaax  398
            PDSGWLSG+QTPQ GPSSPTFSLVS NPF  KE   +   S MWTPGQSG CSPA+ A  
Sbjct  180  PDSGWLSGMQTPQSGPSSPTFSLVSRNPFFEKEAFKARDCSPMWTPGQSGNCSPAIPAGA  239

Query  397  drsadvPMSDAIQAEFAFGSN--AMGIVKPWEGERIHEECITDDXEXTXGNSNXR*GVEG  224
            D++ADVPM+D +  EFAFG N    G+VKPWEGERIHEEC  DD E T GNS  R   E 
Sbjct  240  DQTADVPMADGMAVEFAFGCNPRTTGLVKPWEGERIHEECAPDDLELTLGNSRTR--CER  297

Query  223  RVKIQSRSIS  194
            R K +  +++
Sbjct  298  REKEKGENVA  307



>gb|AES66525.2| brassinazole-resistant 1 protein [Medicago truncatula]
Length=517

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 85/112 (76%), Gaps = 1/112 (1%)
 Frame = -2

Query  571  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCspavaaaxd  395
            D  W +G++ P   P+SPTF+LVS +PF FKE   S GGSRMWTPGQSG CSPA+AA  D
Sbjct  205  DPEWFAGIKLPHASPTSPTFNLVSRSPFAFKEDGFSGGGSRMWTPGQSGACSPAIAAGFD  264

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            ++AD+PMS+AI  EFAFGSN  GIVKPWEGERIHEE + DD E T GNS  R
Sbjct  265  QTADIPMSEAISDEFAFGSNTFGIVKPWEGERIHEEFVADDLELTLGNSKTR  316



>gb|KJB68361.1| hypothetical protein B456_010G240700 [Gossypium raimondii]
Length=322

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 85/114 (75%), Gaps = 8/114 (7%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCspavaaax  398
            PD  WLS       GP+SPTFSLVS NPFGFK E LS GGSRMWTPGQSGTCSPA  A  
Sbjct  215  PDPEWLS------SGPTSPTFSLVSRNPFGFKDEALSAGGSRMWTPGQSGTCSPAFPAGV  268

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECIT-DDXEXTXGNSNXR  239
            D+++DVPMSD I AEFAFGSN  G+VKPWEGE IHEEC+  DD E T GNS  R
Sbjct  269  DQTSDVPMSDVIAAEFAFGSNFTGLVKPWEGEMIHEECVADDDLELTLGNSKTR  322



>ref|XP_010518826.1| PREDICTED: BES1/BZR1 homolog protein 3 isoform X2 [Tarenaya hassleriana]
Length=294

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 85/115 (74%), Gaps = 3/115 (3%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPL-SNGGSRMWTPGQSGTCspavaaax  398
            PDSGWLSG+QTPQ GPSSPTFSLVS NPF  KE   +   S MWTPGQSG CSPA+ A  
Sbjct  180  PDSGWLSGMQTPQSGPSSPTFSLVSRNPFFEKEAFKARDCSPMWTPGQSGNCSPAIPAGA  239

Query  397  drsadvPMSDAIQAEFAFGSN--AMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D++ADVPM+D +  EFAFG N    G+VKPWEGERIHEEC  DD E T GNS  R
Sbjct  240  DQTADVPMADGMAVEFAFGCNPRTTGLVKPWEGERIHEECAPDDLELTLGNSRTR  294



>ref|XP_006414043.1| hypothetical protein EUTSA_v10025918mg [Eutrema salsugineum]
 gb|ESQ55496.1| hypothetical protein EUTSA_v10025918mg [Eutrema salsugineum]
Length=285

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 87/116 (75%), Gaps = 5/116 (4%)
 Frame = -2

Query  571  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNG--GSRMWTPGQSGTCspavaaax  398
            DSGWLSG+QTPQ GPSSPTFSLVS NPF  KE    G   S MWTPGQSG CSPA+ A  
Sbjct  170  DSGWLSGMQTPQSGPSSPTFSLVSRNPFFDKEAFKMGDCNSPMWTPGQSGNCSPAIPAGV  229

Query  397  drsadvPMSDAIQAEFAFGSNAM---GIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D+++DVPM+D + AEFAFG NA+   G+VKPWEGERIH EC++DD E T G S  R
Sbjct  230  DQNSDVPMADGMAAEFAFGCNAIAAVGMVKPWEGERIHGECVSDDLELTLGTSRTR  285



>ref|XP_004489001.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Cicer 
arietinum]
 ref|XP_004489002.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Cicer 
arietinum]
Length=321

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 84/113 (74%), Gaps = 2/113 (2%)
 Frame = -2

Query  571  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCspavaaaxd  395
            D  W +G++ P   P+SPTF+LVSPNPF FKE   S  GSRMWTPG SGTCSPA+AA  D
Sbjct  209  DPEWFAGIKLPHTSPTSPTFNLVSPNPFAFKEDGFSGSGSRMWTPGPSGTCSPAIAAGSD  268

Query  394  rsadvPMSDA-IQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             +AD+PMS+A I  EFAFGSN  GIVKPWEGERIHEE + DD E T GNS  R
Sbjct  269  HNADIPMSEAAISDEFAFGSNTFGIVKPWEGERIHEEFVADDLELTLGNSKTR  321



>ref|XP_009136969.1| PREDICTED: BES1/BZR1 homolog protein 3-like [Brassica rapa]
Length=276

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 84/114 (74%), Gaps = 7/114 (6%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSR--MWTPGQSGTCspavaaa  401
            PDSGWLSG+QTPQ GPSSPTFSLVS NPF  KE    G S   MWTPGQSG CSPA+ A 
Sbjct  168  PDSGWLSGMQTPQSGPSSPTFSLVSRNPFFDKEAFKMGDSSSPMWTPGQSGNCSPAIPAG  227

Query  400  xdrsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             D+++D+ M+D + AEFAF     G+VKPWEGERIH EC++DD E T GNS  R
Sbjct  228  VDQNSDLTMADGMAAEFAF-----GMVKPWEGERIHGECVSDDLELTLGNSRTR  276



>emb|CDX98592.1| BnaA03g43770D [Brassica napus]
Length=276

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 85/114 (75%), Gaps = 7/114 (6%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSR--MWTPGQSGTCspavaaa  401
            PDSGWLSG+QTPQ GPSSPTFSLVS NPF  KE    G S   MWTPGQSG CSPA+ A 
Sbjct  168  PDSGWLSGMQTPQSGPSSPTFSLVSRNPFFDKEAFKMGDSNSPMWTPGQSGNCSPAIPAG  227

Query  400  xdrsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             D+++DVPM+D + AEFAF     G+VKPWEGERIH EC++DD E T GNS  R
Sbjct  228  VDQNSDVPMADGMAAEFAF-----GMVKPWEGERIHGECVSDDLELTLGNSRTR  276



>emb|CDY01563.1| BnaC07g35530D [Brassica napus]
Length=276

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 85/114 (75%), Gaps = 7/114 (6%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSR--MWTPGQSGTCspavaaa  401
            PDSGWLSG+QTPQ GPSSPTFSLVS NPF  KE    G S   MWTPGQSG CSPA+ A 
Sbjct  168  PDSGWLSGMQTPQSGPSSPTFSLVSRNPFFDKEAFKMGDSSSPMWTPGQSGNCSPAIPAG  227

Query  400  xdrsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             D+++DVPM+D + AEFAF     G+VKPWEGERIH EC++DD E T GNS  R
Sbjct  228  VDQNSDVPMADGMAAEFAF-----GMVKPWEGERIHGECVSDDLELTLGNSRTR  276



>ref|XP_009128310.1| PREDICTED: BES1/BZR1 homolog protein 4 [Brassica rapa]
Length=292

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 85/114 (75%), Gaps = 6/114 (5%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxd  395
            PDS W SG+Q PQ  P+SPTFSLVS NPFGFKE    GGSRMWTPGQSGTC    + A  
Sbjct  183  PDSEWFSGIQLPQSVPASPTFSLVSQNPFGFKEGGGGGGSRMWTPGQSGTC----SPAIP  238

Query  394  rsadvPMSDAIQA--EFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            ++ADVPMS+A+ A  EFAFGSNA G+VK WEGERIHE   +DD E T GNS+ R
Sbjct  239  QTADVPMSEAVVAPPEFAFGSNANGLVKAWEGERIHEVSGSDDLELTLGNSSTR  292



>ref|XP_008386283.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Malus domestica]
Length=324

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 87/113 (77%), Gaps = 2/113 (2%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCspavaaax  398
            PD  W +G+  P+ GP+SPTFSLVS NPFGFK E L+ GGSRMWTPGQSGTCSPA+AA  
Sbjct  213  PDPEWFAGIPVPR-GPNSPTFSLVSLNPFGFKDEVLAGGGSRMWTPGQSGTCSPAIAAGS  271

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D +AD+PMS+ I  EFAFG N  G+VK WEGE+IHEEC +DD E T G+S  R
Sbjct  272  DHTADIPMSEVISDEFAFGCNTTGLVKAWEGEKIHEECGSDDLELTLGSSRTR  324



>ref|XP_010537716.1| PREDICTED: BES1/BZR1 homolog protein 4 [Tarenaya hassleriana]
Length=309

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 84/116 (72%), Gaps = 4/116 (3%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSN---GGSRMWTPGQSGTCspavaa  404
            PD  W SG+Q PQ  P+SPTFSLVS NPFGFKE   N   GGS MWTPGQSGTCSPA   
Sbjct  193  PDPEWFSGIQIPQSVPTSPTFSLVSANPFGFKEASGNNGSGGSMMWTPGQSGTCSPAAIP  252

Query  403  a-xdrsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
               D++ADVPMS+A+ AEFAFG N  G+VK WEGERIHEE  +DD E T GNS  R
Sbjct  253  PGSDQTADVPMSEAVPAEFAFGGNENGLVKAWEGERIHEESGSDDLELTLGNSTTR  308



>ref|XP_003543195.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Glycine max]
Length=325

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 83/112 (74%), Gaps = 1/112 (1%)
 Frame = -2

Query  571  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCspavaaaxd  395
            D  W +G++ P   P+SPTFSLVS NPF FKE  L   GSRMWTP QSGTCSPA+    D
Sbjct  214  DPEWFAGIKLPHVSPTSPTFSLVSSNPFAFKEDGLPGSGSRMWTPAQSGTCSPAIPPGSD  273

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            ++AD+PMS+A+  EFAFGSN +G+VKPWEGERIHEE  +DD E T GNS  R
Sbjct  274  QNADIPMSEAVSDEFAFGSNTLGLVKPWEGERIHEEFGSDDLELTLGNSKTR  325



>ref|XP_003540502.1| PREDICTED: BES1/BZR1 homolog protein 4 [Glycine max]
Length=322

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 82/112 (73%), Gaps = 1/112 (1%)
 Frame = -2

Query  571  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGGSRMWTPGQSGTCspavaaaxd  395
            D  W +G++ P   P+SPTFSLVS NPF FKE  L + GS MWTP QSGTCSPAV     
Sbjct  211  DPEWFAGIKLPHVSPTSPTFSLVSSNPFAFKEHALPSSGSPMWTPAQSGTCSPAVPPGSY  270

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            ++AD+PMSDA+  EFAFGSN +G+VKPWEGERIHEE  +DD E T GNS  R
Sbjct  271  QNADIPMSDAVSDEFAFGSNVLGLVKPWEGERIHEEFGSDDLELTLGNSKTR  322



>gb|KHN36918.1| BES1/BZR1 like protein 4 [Glycine soja]
Length=331

 Score =   122 bits (307),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 83/112 (74%), Gaps = 1/112 (1%)
 Frame = -2

Query  571  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCspavaaaxd  395
            D  W +G++ P   P+SPTFSLVS NPF FKE  L   GSRMWTP QSGTCSPA+    D
Sbjct  214  DPEWFAGIKLPHVSPTSPTFSLVSSNPFAFKEDGLPGSGSRMWTPAQSGTCSPAIPPGSD  273

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            ++AD+PMS+A+  EFAFGSN +G+VKPWEGERIHEE  +DD E T GNS  R
Sbjct  274  QNADIPMSEAVSDEFAFGSNMLGLVKPWEGERIHEEFGSDDLELTLGNSKTR  325



>ref|XP_009359371.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Pyrus x bretschneideri]
Length=324

 Score =   122 bits (306),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 86/113 (76%), Gaps = 2/113 (2%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCspavaaax  398
            PD  W +G+  P+ GP+SPTFSLVS NPFGFK E L+  GSRMWTPGQSGTCSPA+AA  
Sbjct  213  PDPEWFAGIPVPR-GPNSPTFSLVSSNPFGFKDEVLAGAGSRMWTPGQSGTCSPAIAAGS  271

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D +AD+PMS+ I  EFAFG N  G+VK WEGE+IHEEC +DD E T G+S  R
Sbjct  272  DHTADIPMSEVISDEFAFGCNTTGLVKAWEGEKIHEECGSDDLELTLGSSRTR  324



>gb|KEH38594.1| brassinazole-resistant 1 protein [Medicago truncatula]
Length=236

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = -2

Query  571  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGG-SRMWTPGQSGTCspavaaaxd  395
            D  W +G++ P  G +SPTFSLV+ NPFGF+E +  G  SRMWTPGQSGTCSPA+AA  D
Sbjct  125  DPDWFAGIRMPHSGQTSPTFSLVATNPFGFREEVFCGSDSRMWTPGQSGTCSPALAAGSD  184

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             +AD+PMS+AI  EFAFGS+A+G+VKPWEGERIHE+  +DD E T G S  R
Sbjct  185  HNADIPMSEAISDEFAFGSSAVGLVKPWEGERIHEDSGSDDLELTLGTSKTR  236



>ref|XP_007149549.1| hypothetical protein PHAVU_005G079400g [Phaseolus vulgaris]
 gb|ESW21543.1| hypothetical protein PHAVU_005G079400g [Phaseolus vulgaris]
Length=325

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 82/112 (73%), Gaps = 1/112 (1%)
 Frame = -2

Query  571  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCspavaaaxd  395
            D  W +G++ P   P+SPTFSL+S NPF FKE  L   GSRMWTP  SGTCSPA+A   D
Sbjct  214  DPEWFAGIKLPHVNPTSPTFSLISSNPFAFKEDGLVGSGSRMWTPAHSGTCSPAIAPGTD  273

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             +AD+PMS+A+  EFAFGSN +G+VKPWEGERIHEE  +DD E T GNS  R
Sbjct  274  HNADIPMSEAVSDEFAFGSNMLGLVKPWEGERIHEEFGSDDLELTLGNSKTR  325



>ref|XP_006387974.1| hypothetical protein POPTR_0439s00200g [Populus trichocarpa]
 gb|ERP46888.1| hypothetical protein POPTR_0439s00200g [Populus trichocarpa]
Length=249

 Score =   119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 88/117 (75%), Gaps = 6/117 (5%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-----PLSNGGSRMWTPGQSGTCspav  410
            PD  W  GV+ PQ GP+SPTFSLV+ NPFGFKE       SNGGSRMWTPGQSGTCSPA+
Sbjct  134  PDPEWFRGVRMPQGGPTSPTFSLVASNPFGFKEEAFGGGGSNGGSRMWTPGQSGTCSPAI  193

Query  409  aaaxdrsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            AA  D +AD+PM++ I  EFAF  NA G+VKPWEGERIHEEC +DD E T GNS  R
Sbjct  194  AAGSDHTADIPMAE-ISDEFAFRCNATGLVKPWEGERIHEECGSDDLELTLGNSRTR  249



>ref|XP_010665681.1| PREDICTED: BES1/BZR1 homolog protein 4 [Beta vulgaris subsp. 
vulgaris]
Length=329

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 84/114 (74%), Gaps = 2/114 (2%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCspavaaax  398
            P+ GWL+ +Q  Q  P+SPTFSLVS NPF  +E  ++ GGSRMWTPGQSGTCSP +AA  
Sbjct  216  PEPGWLANIQITQGAPASPTFSLVSTNPFASREEVMAGGGSRMWTPGQSGTCSPIIAAGP  275

Query  397  drsadvPMSDAIQAEFAFGSNAM-GIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             R+ADV MSD I AEFAFG+  M G+VK WEGE IHEEC+ DD E T G+S  R
Sbjct  276  ARTADVHMSDGIAAEFAFGNGMMGGLVKAWEGEIIHEECVPDDLELTLGSSRTR  329



>ref|XP_004489003.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Cicer 
arietinum]
Length=342

 Score =   120 bits (300),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 87/113 (77%), Gaps = 2/113 (2%)
 Frame = -2

Query  571  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGG-SRMWTPGQSGTCspavaaaxd  395
            D  W +G++ PQ GP+SPTFSLV+ NPFGF+E +  G  SRMWTPGQSGTCSPAVAA  D
Sbjct  213  DPDWFAGIRMPQGGPTSPTFSLVASNPFGFREEVFCGSDSRMWTPGQSGTCSPAVAAGSD  272

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECI-TDDXEXTXGNSNXR  239
             +AD+PM++A+  EFAFGS+  G+VKPWEGERIHE+C  +DD E T G S  R
Sbjct  273  HTADIPMAEAVSDEFAFGSHTAGLVKPWEGERIHEDCDGSDDLELTLGCSKTR  325



>ref|XP_004489004.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Cicer 
arietinum]
Length=325

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 87/113 (77%), Gaps = 2/113 (2%)
 Frame = -2

Query  571  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGG-SRMWTPGQSGTCspavaaaxd  395
            D  W +G++ PQ GP+SPTFSLV+ NPFGF+E +  G  SRMWTPGQSGTCSPAVAA  D
Sbjct  213  DPDWFAGIRMPQGGPTSPTFSLVASNPFGFREEVFCGSDSRMWTPGQSGTCSPAVAAGSD  272

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECI-TDDXEXTXGNSNXR  239
             +AD+PM++A+  EFAFGS+  G+VKPWEGERIHE+C  +DD E T G S  R
Sbjct  273  HTADIPMAEAVSDEFAFGSHTAGLVKPWEGERIHEDCDGSDDLELTLGCSKTR  325



>ref|XP_003596275.1| Brassinosteroid signaling positive regulator-related protein 
[Medicago truncatula]
 gb|AES66526.1| brassinazole-resistant 1 protein [Medicago truncatula]
Length=323

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = -2

Query  571  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGG-SRMWTPGQSGTCspavaaaxd  395
            D  W +G++ P  G +SPTFSLV+ NPFGF+E +  G  SRMWTPGQSGTCSPA+AA  D
Sbjct  212  DPDWFAGIRMPHSGQTSPTFSLVATNPFGFREEVFCGSDSRMWTPGQSGTCSPALAAGSD  271

Query  394  rsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             +AD+PMS+AI  EFAFGS+A+G+VKPWEGERIHE+  +DD E T G S  R
Sbjct  272  HNADIPMSEAISDEFAFGSSAVGLVKPWEGERIHEDSGSDDLELTLGTSKTR  323



>gb|KFK42252.1| hypothetical protein AALP_AA2G231000 [Arabis alpina]
Length=317

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 80/115 (70%), Gaps = 8/115 (7%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCspavaaax  398
            PDS W SG+Q  Q  P+SPTFSLVS  PFGFK E  S GGSRMWTPGQSGTCSPA+    
Sbjct  208  PDSEWFSGIQLAQSVPASPTFSLVSQKPFGFKDEVASAGGSRMWTPGQSGTCSPALPTGD  267

Query  397  drsadvPMSDAIQA--EFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
                   MS+A+ A  EFAFGSN  G+VK WEGERIHEE  +DD E T GNS+ R
Sbjct  268  VP-----MSEAVVAPPEFAFGSNINGLVKAWEGERIHEESGSDDLELTLGNSSTR  317



>ref|XP_004294130.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Fragaria vesca subsp. 
vesca]
Length=324

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 85/114 (75%), Gaps = 3/114 (3%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGGSRMWTPGQSGTCspavaaax  398
            P   W SG+Q P  GP+SPTFSLVS NPFGFKE  L+ GGSRMWTPGQSGTCSPA+AA  
Sbjct  212  PSPEWFSGIQIPH-GPTSPTFSLVSSNPFGFKEEALAGGGSRMWTPGQSGTCSPAIAAGS  270

Query  397  drsadvPMSDAIQAEFAFGS-NAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D +AD+PMS+ I  EFAFGS N  G+VK WEGERIHEE  +DD E T G S  R
Sbjct  271  DHTADIPMSEVISDEFAFGSCNTAGLVKAWEGERIHEESGSDDLELTLGCSKTR  324



>ref|XP_006370100.1| hypothetical protein POPTR_0001s39520g [Populus trichocarpa]
 ref|XP_006370101.1| brassinosteroid signaling positive regulator-related family protein 
[Populus trichocarpa]
 gb|ABK93591.1| unknown [Populus trichocarpa]
 gb|ERP66669.1| hypothetical protein POPTR_0001s39520g [Populus trichocarpa]
 gb|ERP66670.1| brassinosteroid signaling positive regulator-related family protein 
[Populus trichocarpa]
Length=328

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 88/117 (75%), Gaps = 6/117 (5%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-----PLSNGGSRMWTPGQSGTCspav  410
            PD  W  G++ PQ GP+SPTFSLV+ NPFGFKE       SNGGSRMWTPGQSGTCSPA+
Sbjct  213  PDPEWFRGIRIPQGGPTSPTFSLVASNPFGFKEEAFGGGGSNGGSRMWTPGQSGTCSPAI  272

Query  409  aaaxdrsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            AA  D +AD+PM++ I  EFAF  NA G+VKPWEGERIHEEC +DD E T GNS  R
Sbjct  273  AAGSDHTADIPMAE-ISDEFAFRCNATGLVKPWEGERIHEECGSDDLELTLGNSRTR  328



>ref|XP_009132289.1| PREDICTED: BES1/BZR1 homolog protein 3 [Brassica rapa]
 emb|CDX78903.1| BnaA01g09700D [Brassica napus]
Length=276

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 85/114 (75%), Gaps = 7/114 (6%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNG--GSRMWTPGQSGTCspavaaa  401
            P+SGWLSG+QTPQ GPSSPTFSLVS NPF  K   + G   S MWTPGQSG CSPA+ A 
Sbjct  168  PESGWLSGMQTPQSGPSSPTFSLVSRNPFFDKAAFTMGDCSSPMWTPGQSGNCSPAIPAG  227

Query  400  xdrsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             D+++DVPM+D + AEFAF     G+VKPWEGERIH EC+++D E T GNS  R
Sbjct  228  VDQNSDVPMADGMAAEFAF-----GMVKPWEGERIHGECVSEDLELTLGNSRTR  276



>ref|XP_009334016.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Pyrus x bretschneideri]
Length=324

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 85/113 (75%), Gaps = 2/113 (2%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLS-NGGSRMWTPGQSGTCspavaaax  398
            PD  W +G+  P  GP+SPTFSLVS NPFGFK+ +S  GGSRMWTPGQSGTCSPA+AA  
Sbjct  213  PDPEWFAGIPIPH-GPTSPTFSLVSSNPFGFKDEVSAGGGSRMWTPGQSGTCSPAIAAGS  271

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D +AD+PMS+ I  EFAFG N  G+VK WEGE+IHE+  +DD E T G+S  R
Sbjct  272  DHAADIPMSEVISDEFAFGCNTTGLVKAWEGEKIHEDSGSDDLELTLGSSRTR  324



>ref|XP_008381083.1| PREDICTED: BES1/BZR1 homolog protein 4 [Malus domestica]
Length=324

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 85/113 (75%), Gaps = 2/113 (2%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLS-NGGSRMWTPGQSGTCspavaaax  398
            PD  W +G+  P  GP+SPTFSLVS NPFGFK+ +S  GGSRMWTPGQSGTCSPA+AA  
Sbjct  213  PDPEWFAGIPIPH-GPTSPTFSLVSSNPFGFKDEVSAGGGSRMWTPGQSGTCSPAIAAGS  271

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D +AD+PMS+ I  EFAFG N  G+VK WEGE+IHE+  +DD E T G+S  R
Sbjct  272  DHAADIPMSEVISDEFAFGCNTTGLVKAWEGEKIHEDSGSDDLELTLGSSRTR  324



>gb|ACE97191.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97193.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97194.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97195.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97199.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97200.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97201.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97202.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97203.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97204.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97205.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97206.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97207.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97209.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97210.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97211.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97212.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97213.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97215.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97216.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97217.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97218.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97219.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97220.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97221.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97222.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97223.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97224.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97225.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97226.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97227.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97228.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
Length=174

 Score =   114 bits (285),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 77/90 (86%), Gaps = 1/90 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGGSRMWTPGQSGTCspavaaax  398
            PDSGWL+G+Q PQ GPSSPTFSLVS NPFGFKE  LS  GSRMWTPGQSGTCSPAV A  
Sbjct  85   PDSGWLAGIQIPQSGPSSPTFSLVSRNPFGFKEEALSGAGSRMWTPGQSGTCSPAVPAGI  144

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWE  308
            D++ADVPM+D++ AEFAFGSN  G+VKPWE
Sbjct  145  DQTADVPMADSMAAEFAFGSNTAGLVKPWE  174



>gb|ACE97192.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97197.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97198.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97208.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
Length=174

 Score =   114 bits (285),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 77/90 (86%), Gaps = 1/90 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGGSRMWTPGQSGTCspavaaax  398
            PDSGWL+G+Q PQ GPSSPTFSLVS NPFGFKE  LS  GSRMWTPGQSGTCSPAV A  
Sbjct  85   PDSGWLAGIQIPQSGPSSPTFSLVSRNPFGFKEEALSGAGSRMWTPGQSGTCSPAVPAGI  144

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWE  308
            D++ADVPM+D++ AEFAFGSN  G+VKPWE
Sbjct  145  DQTADVPMADSMAAEFAFGSNTAGLVKPWE  174



>ref|XP_010062789.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Eucalyptus grandis]
 gb|KCW69907.1| hypothetical protein EUGRSUZ_F03236 [Eucalyptus grandis]
Length=320

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 84/113 (74%), Gaps = 1/113 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCspavaaax  398
            PD  W+S +Q PQ GP SPTF+LVS NPFG K E L+ GGSR WTPGQSGTCSPA+AAA 
Sbjct  208  PDPEWISRIQIPQGGPVSPTFTLVSSNPFGSKQEVLAVGGSRTWTPGQSGTCSPAIAAAA  267

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D + D+PMS+ +  EFAFG +  G+VKPWEGERIH+E  +DD E T G S  R
Sbjct  268  DHTGDIPMSEVMSNEFAFGVSGKGLVKPWEGERIHDEPGSDDLELTLGGSKCR  320



>gb|ACE97214.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
Length=174

 Score =   114 bits (284),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 77/90 (86%), Gaps = 1/90 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGGSRMWTPGQSGTCspavaaax  398
            PDSGWL+G+Q PQ GPSSPTFSLVS NPFGFKE  LS  GSRMWTPGQSGTCSPAV A  
Sbjct  85   PDSGWLAGIQIPQSGPSSPTFSLVSRNPFGFKEEALSGAGSRMWTPGQSGTCSPAVPAGI  144

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWE  308
            D++ADVPM+D++ AEFAFGSN  G+VKPWE
Sbjct  145  DQTADVPMADSMAAEFAFGSNTAGLVKPWE  174



>ref|XP_009415180.1| PREDICTED: protein BZR1 homolog 3-like [Musa acuminata subsp. 
malaccensis]
Length=337

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 81/118 (69%), Gaps = 10/118 (8%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxd  395
            PD+ WL+G++ P  GPSSPTFSLVSPNPFG  +  S  GSRMWTPGQSGTC  +      
Sbjct  221  PDAAWLAGLRLPSGGPSSPTFSLVSPNPFGLYKEAS--GSRMWTPGQSGTC--SPVPGGH  276

Query  394  rsadvPMSDAIQAEFAFGSNA------MGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
               +V MSD    EFAFGS++      +G+VKPWEGERIHEE ++D+ E T G+SN R
Sbjct  277  SHGNVQMSDVGSDEFAFGSSSNHIPTTVGLVKPWEGERIHEEFVSDELELTLGSSNTR  334



>emb|CDX99414.1| BnaC01g11380D [Brassica napus]
Length=308

 Score =   117 bits (292),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 84/114 (74%), Gaps = 7/114 (6%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNG--GSRMWTPGQSGTCspavaaa  401
            P+SGWLSG+QTPQ GPSSPTFSLVS NPF  K     G   S MWTPGQSG CSPA+ A 
Sbjct  200  PESGWLSGMQTPQSGPSSPTFSLVSRNPFFDKAAFKMGDCSSPMWTPGQSGNCSPAIPAG  259

Query  400  xdrsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             D+++DVPM+D + AEFAF     G+VKPWEGERIH EC+++D E T GNS  R
Sbjct  260  VDQNSDVPMADGMAAEFAF-----GMVKPWEGERIHGECVSEDLELTLGNSRTR  308



>gb|ACE97196.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
Length=174

 Score =   114 bits (284),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 77/90 (86%), Gaps = 1/90 (1%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGGSRMWTPGQSGTCspavaaax  398
            PDSGWL+G+Q PQ GPSSPTFSLVS NPFGFKE  LS  GSRMWTPGQSGTCSPAV A  
Sbjct  85   PDSGWLAGIQIPQSGPSSPTFSLVSRNPFGFKEEALSGAGSRMWTPGQSGTCSPAVPAGI  144

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWE  308
            D++ADVPM+D++ AEFAFGSN  G+VKPWE
Sbjct  145  DQTADVPMADSMAAEFAFGSNTAGLVKPWE  174



>ref|XP_010916623.1| PREDICTED: protein BZR1 homolog 3-like [Elaeis guineensis]
Length=340

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 80/123 (65%), Gaps = 11/123 (9%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGG--SRMWTPGQSGTCspavaaa  401
            PD  WL+G++ P  GPSSPT+SLVS NPFGF +  S G   SRMWTPGQSGTC       
Sbjct  221  PDPAWLAGLRLPSGGPSSPTYSLVSSNPFGFFKEASAGAGSSRMWTPGQSGTC---SPVP  277

Query  400  xdrsadvPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
                ADV MSD I  EFAFGS+      A G+VKPWEGERIHEEC +D+ E T G+S  R
Sbjct  278  GGGHADVQMSDGISDEFAFGSSSNGNLPANGLVKPWEGERIHEECASDELELTLGSSRTR  337

Query  238  *GV  230
             G 
Sbjct  338  SGA  340



>ref|XP_002887754.1| hypothetical protein ARALYDRAFT_895772 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64013.1| hypothetical protein ARALYDRAFT_895772 [Arabidopsis lyrata subsp. 
lyrata]
Length=324

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 87/118 (74%), Gaps = 6/118 (5%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-----PLSNGGSRMWTPGQSGTCspav  410
            PDS W SG+Q  Q  P+SPTFSLVS NPFGFKE         GGSRMWTPGQSGTCSPA+
Sbjct  207  PDSEWFSGIQLAQSVPASPTFSLVSQNPFGFKEEAASAAGGGGGSRMWTPGQSGTCSPAI  266

Query  409  aaaxdrsadvPMSDAIQA-EFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
              A D++ADVPMS+A+   EFAFGSN  G+VK WEGERIHEE  +DD E T GNS+ R
Sbjct  267  PPAADQTADVPMSEAVAPPEFAFGSNTNGLVKAWEGERIHEESGSDDLELTLGNSSTR  324



>ref|XP_010429699.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Camelina sativa]
Length=325

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 86/118 (73%), Gaps = 6/118 (5%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-----PLSNGGSRMWTPGQSGTCspav  410
            PDS W SG+Q  Q  P+SPTFSLVS NPFGFKE         GGSRMWTPGQSGTCSPA+
Sbjct  208  PDSEWFSGIQLAQSVPASPTFSLVSQNPFGFKEEAASAAGCGGGSRMWTPGQSGTCSPAI  267

Query  409  aaaxdrsadvPMSDAIQA-EFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             +  D +ADVPMS+A+   EFAFGSN  G+VK WEGERIHEE  +DD E T GNS+ R
Sbjct  268  PSGADHTADVPMSEAVAPPEFAFGSNTNGLVKAWEGERIHEESGSDDLELTLGNSSTR  325



>ref|XP_006302567.1| hypothetical protein CARUB_v10020674mg [Capsella rubella]
 gb|EOA35465.1| hypothetical protein CARUB_v10020674mg [Capsella rubella]
Length=317

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 86/118 (73%), Gaps = 6/118 (5%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-----PLSNGGSRMWTPGQSGTCspav  410
            PDS W SG+Q  Q  P+SPTFSLVS NPFGFKE         GGSRMWTPGQSGTCSPA+
Sbjct  200  PDSEWFSGIQLAQSVPASPTFSLVSQNPFGFKEEAASAAGGGGGSRMWTPGQSGTCSPAI  259

Query  409  aaaxdrsadvPMSDAIQA-EFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
                D++ADVPMS+A+   EFAFGSN  G+VK WEGERIHEE  +DD E T GNS+ R
Sbjct  260  PPGADQTADVPMSEAVAPPEFAFGSNTNGLVKAWEGERIHEESGSDDLELTLGNSSTR  317



>ref|XP_010417476.1| PREDICTED: BES1/BZR1 homolog protein 4 [Camelina sativa]
Length=325

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 85/118 (72%), Gaps = 6/118 (5%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-----PLSNGGSRMWTPGQSGTCspav  410
            PDS W SG+Q  Q  P+SPTFSLVS NPFGFKE         GGSRMWTPGQSGTCSPA+
Sbjct  208  PDSEWFSGIQLAQSVPASPTFSLVSQNPFGFKEEAASAAGGGGGSRMWTPGQSGTCSPAI  267

Query  409  aaaxdrsadvPMSDAIQA-EFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
                D +ADVPMS+A+   EFAFGSN  G+VK WEGERIHEE  +DD E T GNS+ R
Sbjct  268  PPGADHTADVPMSEAVAPPEFAFGSNTNGLVKAWEGERIHEESGSDDLELTLGNSSTR  325



>ref|NP_565187.1| BES1/BZR1 homolog 4 [Arabidopsis thaliana]
 sp|Q9ZV88.1|BEH4_ARATH RecName: Full=BES1/BZR1 homolog protein 4 [Arabidopsis thaliana]
 gb|AAC83038.1| EST gb|R30300 comes from this gene [Arabidopsis thaliana]
 gb|AAK91446.1| At1g78700/F9K20_26 [Arabidopsis thaliana]
 gb|AAL90992.1| At1g78700/F9K20_26 [Arabidopsis thaliana]
 gb|AEE36140.1| BES1/BZR1 homolog 4 [Arabidopsis thaliana]
Length=325

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 86/118 (73%), Gaps = 6/118 (5%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-----PLSNGGSRMWTPGQSGTCspav  410
            PDS W SG+Q  Q  P+SPTFSLVS NPFGFKE         GGSRMWTPGQSGTCSPA+
Sbjct  208  PDSEWFSGIQLAQSVPASPTFSLVSQNPFGFKEEAASAAGGGGGSRMWTPGQSGTCSPAI  267

Query  409  aaaxdrsadvPMSDAIQA-EFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
                D++ADVPMS+A+   EFAFGSN  G+VK WEGERIHEE  +DD E T GNS+ R
Sbjct  268  PPGADQTADVPMSEAVAPPEFAFGSNTNGLVKAWEGERIHEESGSDDLELTLGNSSTR  325



>ref|XP_010472705.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Camelina sativa]
Length=325

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 85/118 (72%), Gaps = 6/118 (5%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-----PLSNGGSRMWTPGQSGTCspav  410
            PDS W SG+Q  Q  P+SPTFSLVS NPFGFKE         GGSRMWTPGQSGTCSPA+
Sbjct  208  PDSEWFSGIQLAQSVPASPTFSLVSQNPFGFKEEAASAAGGGGGSRMWTPGQSGTCSPAI  267

Query  409  aaaxdrsadvPMSDAIQA-EFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
                D +ADVPMS+A+   EFAFGSN  G+VK WEGERIHEE  +DD E T GNS+ R
Sbjct  268  PPGADHTADVPMSEAVAPPEFAFGSNTDGLVKAWEGERIHEESGSDDLELTLGNSSTR  325



>ref|XP_009768995.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Nicotiana sylvestris]
Length=316

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 84/113 (74%), Gaps = 7/113 (6%)
 Frame = -2

Query  568  SGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE---PLSNGGSRMWTPGQSGTCspavaaax  398
            S WL+G+     GP SPT+SLVS NPFGFK     LS+GGSRM TPGQSGTCSPA+ A  
Sbjct  208  SEWLTGIS----GPPSPTYSLVSSNPFGFKMDGLALSHGGSRMCTPGQSGTCSPAITAGL  263

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D +AD+PM++ I  EFAFGSNA G+VKPWEGERIHE+C  DD E T G+S  R
Sbjct  264  DNTADIPMAEVISDEFAFGSNAGGMVKPWEGERIHEDCGPDDLELTLGSSKTR  316



>emb|CDP06034.1| unnamed protein product [Coffea canephora]
Length=327

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 79/113 (70%), Gaps = 5/113 (4%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCspavaaax  398
            PDS W +G+Q PQ GP+SPTFSLVS NPF FK E L + GS M TPGQSGTCSPA+ A  
Sbjct  211  PDSEWFAGMQIPQGGPTSPTFSLVSANPFAFKFESLRHTGSHMCTPGQSGTCSPAIPAGS  270

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D      M++ I  EFAF S   G+VKPWEGERIHE+C +DD E T G+S  R
Sbjct  271  DVP----MAEVISDEFAFRSIKGGLVKPWEGERIHEDCGSDDLELTLGSSKTR  319



>emb|CDY26877.1| BnaA02g19020D [Brassica napus]
Length=293

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 84/115 (73%), Gaps = 7/115 (6%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSR-MWTPGQSGTCspavaaax  398
            PDS W SG+Q  Q  P+SPTFSLVS NPFGFKE    GGSR +WTPGQSGTC    + A 
Sbjct  183  PDSEWFSGIQLAQSVPASPTFSLVSQNPFGFKEGGGGGGSRILWTPGQSGTC----SPAI  238

Query  397  drsadvPMSDAIQA--EFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             ++ADVPMS+A+ A  EFAFGSNA G+VK WEGERIHE   +DD E T GNS+ R
Sbjct  239  PQTADVPMSEAVVAPPEFAFGSNANGLVKAWEGERIHEVSGSDDLELTLGNSSTR  293



>emb|CDX87440.1| BnaA07g34330D [Brassica napus]
Length=307

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 83/118 (70%), Gaps = 10/118 (8%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGG----SRMWTPGQSGTCspav  410
            PDS W +G+Q  Q  P+SPTFSLVS NPFGF+E  L++ G    SRMWTPGQSGTCSPA+
Sbjct  192  PDSEWFAGIQLAQSVPASPTFSLVSRNPFGFREDQLASAGGGDGSRMWTPGQSGTCSPAI  251

Query  409  aaaxdrsadvPMSDAIQA-EFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
                D      MS+A+   EFAFGSNA G+VK WEGERIHEE  +DD E T GNS+ R
Sbjct  252  PQTGDVP----MSEAVAPPEFAFGSNANGLVKAWEGERIHEESGSDDLELTLGNSSTR  305



>ref|XP_009106588.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Brassica rapa]
Length=307

 Score =   114 bits (285),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 83/118 (70%), Gaps = 10/118 (8%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGG----SRMWTPGQSGTCspav  410
            PDS W +G+Q  Q  P+SPTFSLVS NPFGF+E  L++ G    SRMWTPGQSGTCSPA+
Sbjct  192  PDSEWFAGIQLAQSVPASPTFSLVSRNPFGFREDQLASAGGGDGSRMWTPGQSGTCSPAI  251

Query  409  aaaxdrsadvPMSDAIQA-EFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
                D      MS+A+   EFAFGSNA G+VK WEGERIHEE  +DD E T GNS+ R
Sbjct  252  PQTGDVP----MSEAVAPPEFAFGSNANGLVKAWEGERIHEESGSDDLELTLGNSSTR  305



>ref|XP_009622768.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Nicotiana tomentosiformis]
Length=316

 Score =   114 bits (285),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 85/113 (75%), Gaps = 7/113 (6%)
 Frame = -2

Query  568  SGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP---LSNGGSRMWTPGQSGTCspavaaax  398
            S WL+G+     GP SPT+SLVS NPFGFK     LS+GGSRM TPGQSGTCSPA+AA  
Sbjct  208  SEWLAGIS----GPPSPTYSLVSSNPFGFKMDGLVLSHGGSRMCTPGQSGTCSPAIAAGL  263

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D +AD+PM++ I  EFAFGSNA G+VKPWEGERIHE+C  DD E T G+S  R
Sbjct  264  DNTADIPMAEVISDEFAFGSNAGGMVKPWEGERIHEDCGPDDLELTLGSSKTR  316



>ref|XP_006389963.1| hypothetical protein EUTSA_v10018888mg [Eutrema salsugineum]
 gb|ESQ27249.1| hypothetical protein EUTSA_v10018888mg [Eutrema salsugineum]
Length=319

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 85/117 (73%), Gaps = 9/117 (8%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSN---GGSRMWTPGQSGTCspavaa  404
            PDS W SG+Q  Q  P+SPTFSLVS NPFGFKE +++   GGSRMWTP QSGTC    + 
Sbjct  207  PDSEWFSGIQLAQSVPASPTFSLVSQNPFGFKEEVASARGGGSRMWTPSQSGTC----SP  262

Query  403  axdrsadvPMSDAIQ-AEFAFG-SNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            A  ++ADVPMS+A+   EFAFG SN  G+VK WEGERIHEE  +DD E T GNS+ R
Sbjct  263  AIPQTADVPMSEAVAPPEFAFGSSNTNGLVKAWEGERIHEESGSDDLELTLGNSSTR  319



>ref|XP_006348323.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Solanum tuberosum]
Length=315

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 81/100 (81%), Gaps = 2/100 (2%)
 Frame = -2

Query  532  GPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCspavaaaxdrsadvPMSDA-IQ  359
            GP SPT+SLVSPNPFGFK + LS GGSRM TPGQSGTCSPA+AA  DR+ADVPM++  I 
Sbjct  216  GPPSPTYSLVSPNPFGFKMDSLSRGGSRMCTPGQSGTCSPAIAAGLDRNADVPMAEVMIS  275

Query  358  AEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             EFAFGSN  G+VKPWEGERIHE+C+ DD E T G+S  R
Sbjct  276  DEFAFGSNIAGMVKPWEGERIHEDCVPDDLELTLGSSKTR  315



>ref|XP_008796066.1| PREDICTED: protein BZR1 homolog 3 [Phoenix dactylifera]
Length=338

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 79/123 (64%), Gaps = 11/123 (9%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGG--SRMWTPGQSGTCspavaaa  401
            PD  WL+G++ P  GPSSPT+SLVS NPFGF +  S G   SRM TPGQSGTC       
Sbjct  219  PDPAWLAGLRLPSGGPSSPTYSLVSSNPFGFFKEASAGAGSSRMLTPGQSGTC---SPVP  275

Query  400  xdrsadvPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
                ADV MSD I  EFAFGS+      A G+VKPWEGERIHEEC +D+ E T G+S  R
Sbjct  276  GGGHADVQMSDGISDEFAFGSSSNGDLPANGLVKPWEGERIHEECASDELELTLGSSRTR  335

Query  238  *GV  230
             G 
Sbjct  336  SGA  338



>emb|CDY66394.1| BnaC03g78350D [Brassica napus]
Length=139

 Score =   108 bits (270),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 80/118 (68%), Gaps = 10/118 (8%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-----PLSNGGSRMWTPGQSGTCspav  410
            PDS W +G+Q  Q  P+SPTFSLVS NPFGF+E         GGSRMWT GQSGTCSPA+
Sbjct  24   PDSEWFAGIQLAQSVPASPTFSLVSRNPFGFREDQLASAGGGGGSRMWTLGQSGTCSPAI  83

Query  409  aaaxdrsadvPMSDAIQA-EFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
                D      MS+A+   EFAFGSNA G+VK WEGERIHEE  +DD E T GNS+ R
Sbjct  84   TQTGDVP----MSEAVAPPEFAFGSNANGLVKAWEGERIHEESGSDDLELTLGNSSTR  137



>emb|CDY14593.1| BnaC02g25200D [Brassica napus]
Length=293

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 80/115 (70%), Gaps = 7/115 (6%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGG-SRMWTPGQSGTCspavaaax  398
            PD  W SG+Q  Q  P+SPTFSLVS NPFGFKE    GG SRMWTPGQSGTCSPA+    
Sbjct  183  PDCEWFSGIQLAQSVPASPTFSLVSQNPFGFKEAGGGGGGSRMWTPGQSGTCSPAIPQTA  242

Query  397  drsadvPMSDAIQA--EFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D      MS+A+ A  EFAFGS+A G+VK WEGERIHE   +DD E T GNS+ R
Sbjct  243  DVP----MSEAVVAPPEFAFGSSANGLVKAWEGERIHEVSGSDDLELTLGNSSTR  293



>ref|XP_004244287.1| PREDICTED: BES1/BZR1 homolog protein 4 [Solanum lycopersicum]
Length=315

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 79/100 (79%), Gaps = 2/100 (2%)
 Frame = -2

Query  532  GPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCspavaaaxdrsadvPMSDA-IQ  359
            GP SPT+SLVSPNPFGFK + LS GGSRM TPGQSG CSPA+AA  D +ADVPM++  I 
Sbjct  216  GPPSPTYSLVSPNPFGFKMDGLSRGGSRMCTPGQSGACSPAIAAGLDHNADVPMAEVMIS  275

Query  358  AEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
             EFAFGSN  G+VKPWEGERIHE+C+ DD E T G+S  R
Sbjct  276  DEFAFGSNVAGMVKPWEGERIHEDCVPDDLELTLGSSKTR  315



>ref|XP_008792311.1| PREDICTED: protein BZR1 homolog 3-like [Phoenix dactylifera]
Length=339

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 80/121 (66%), Gaps = 13/121 (11%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGF--KEPLSNGG-SRMWTPGQSGTCspavaa  404
            PD  WL+G++ P  GPSSPT+SLVS NPFGF  KE  +  G SRMWTPGQSGTC    + 
Sbjct  220  PDPAWLAGLRLPSGGPSSPTYSLVSSNPFGFFCKEASAGAGSSRMWTPGQSGTC----SP  275

Query  403  axdrsadvPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDXEXTXGNSNX  242
                 A V +SD I  EFAFGS+      + G+VKPWEGERIHEEC +D+ E T G+S  
Sbjct  276  VPGGHAGVRVSDGISDEFAFGSSSNGNLQSNGLVKPWEGERIHEECGSDELELTLGSSRT  335

Query  241  R  239
            R
Sbjct  336  R  336



>ref|XP_010924706.1| PREDICTED: protein BZR1 homolog 3-like [Elaeis guineensis]
Length=339

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 78/120 (65%), Gaps = 12/120 (10%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGG--SRMWTPGQSGTCspavaaa  401
            PD+ WL+G++ P  GPSSPT+SLVS NPFGF    S G   SRMWTPGQSG C    +  
Sbjct  221  PDAAWLAGLRLPSGGPSSPTYSLVSSNPFGFCNEASAGAGSSRMWTPGQSGAC----SPV  276

Query  400  xdrsadvPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
                ADV M + I  EFAFGS+      + G+VKPWEGERIHEEC +D+ E T G+S  R
Sbjct  277  PGGHADVRMCNGISDEFAFGSSCNGNLQSNGLVKPWEGERIHEECASDELELTLGSSRTR  336



>ref|XP_008790049.1| PREDICTED: protein BZR1 homolog 3-like [Phoenix dactylifera]
Length=315

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 79/120 (66%), Gaps = 9/120 (8%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGG-SRMWTPGQSGTCspavaaa  401
            PD  WL+G+  P  GPSSPTFSLVS NPFG FKE ++ GG SRM TPGQSGTC   V   
Sbjct  194  PDPAWLAGIHLPTGGPSSPTFSLVSSNPFGFFKEVIAGGGSSRMMTPGQSGTC-SPVMPG  252

Query  400  xdrsadvPMSDAIQAEFAFGSNAM------GIVKPWEGERIHEECITDDXEXTXGNSNXR  239
                 DV MSD +  EFAFGS++       G+VK WEGERIHEEC +D+ E T G+S  R
Sbjct  253  GAGHVDVQMSDGMSDEFAFGSSSNGNHPPPGLVKAWEGERIHEECGSDELELTLGSSRTR  312



>emb|CDX88466.1| BnaC06g39100D [Brassica napus]
Length=307

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 80/118 (68%), Gaps = 10/118 (8%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-----PLSNGGSRMWTPGQSGTCspav  410
            P S W +G+Q  Q  P+SPTFSLVS NPFGF+E         GGSRMWTPGQSGTCSPA+
Sbjct  192  PGSEWFAGIQLAQSVPASPTFSLVSRNPFGFREDQLASAGGGGGSRMWTPGQSGTCSPAI  251

Query  409  aaaxdrsadvPMSDAIQA-EFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
                D      MS+A+   EFAFGSNA G+VK WEGERIHEE  +DD E T GNS+ R
Sbjct  252  PQTGDVP----MSEAVAPPEFAFGSNANGLVKAWEGERIHEESGSDDLELTLGNSSTR  305



>ref|XP_010915465.1| PREDICTED: protein BZR1 homolog 3-like [Elaeis guineensis]
Length=343

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 78/120 (65%), Gaps = 10/120 (8%)
 Frame = -2

Query  571  DSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGG-SRMWTPGQSGTCspavaaax  398
            D  WL+G+  P  GPSSPTFSLVS NPFG FKE ++ GG SRM TPGQSGTC   V    
Sbjct  222  DPAWLAGIHLPTGGPSSPTFSLVSSNPFGFFKEVIAGGGSSRMLTPGQSGTC-SPVMPGG  280

Query  397  drsadvPMSDAIQAEFAFGSNA-------MGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
                DV MSD +  EFAFGS++        G+V+ WEGERIHEEC +D+ E T G+S  R
Sbjct  281  SGHVDVQMSDGVSDEFAFGSSSSNRHHPPAGLVRAWEGERIHEECGSDELELTLGSSRTR  340



>ref|XP_009397454.1| PREDICTED: protein BZR1 homolog 2-like [Musa acuminata subsp. 
malaccensis]
Length=337

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 72/118 (61%), Gaps = 10/118 (8%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxd  395
            PD  W++G+Q     PSSPTFSLVS NPF F      G SRMWTPGQSGT S        
Sbjct  221  PDPAWIAGLQIETVSPSSPTFSLVSSNPFSFS---GGGSSRMWTPGQSGT-SSPALPGMP  276

Query  394  rsadvPMSDAIQAEFAFGSNAMG------IVKPWEGERIHEECITDDXEXTXGNSNXR  239
             +  + MSD I  EFAFGS+A        +VKPWEGERIHEEC +DD E T G+S  R
Sbjct  277  HNVGIQMSDGISQEFAFGSSATDDNPIATLVKPWEGERIHEECGSDDLELTLGSSRTR  334



>ref|XP_009388695.1| PREDICTED: protein BZR1 homolog 3-like [Musa acuminata subsp. 
malaccensis]
Length=337

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 74/118 (63%), Gaps = 10/118 (8%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxd  395
            PD GW++G+Q     PSSPTFSLVS NP GF      G SRMWTPGQSGT S  V     
Sbjct  221  PDPGWIAGLQIDTGPPSSPTFSLVSSNPQGFS---GGGSSRMWTPGQSGT-SSPVMPGMP  276

Query  394  rsadvPMSDAIQAEFAFGSNAMG------IVKPWEGERIHEECITDDXEXTXGNSNXR  239
               D+ MSD I  EFAFGS++ G      +VKPWEGERIHEEC +DD E T G S  R
Sbjct  277  CCVDIQMSDGISDEFAFGSSSNGGHLQAVLVKPWEGERIHEECGSDDLELTLGGSRTR  334



>gb|EYU29527.1| hypothetical protein MIMGU_mgv1a010055mg [Erythranthe guttata]
Length=324

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 69/101 (68%), Gaps = 6/101 (6%)
 Frame = -2

Query  538  QDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCspavaaaxdrsadvPMSDAI  362
            Q GP+SPTFSLVS NPFGF+ E LS  GS M TPGQSGTCSP + A+        M++ I
Sbjct  229  QSGPTSPTFSLVSSNPFGFRVEDLSRSGSLMCTPGQSGTCSPVIGASDIP-----MAEVI  283

Query  361  QAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
              EFAFGSN  G+VK WEGERIHE C +D+ E T G S  R
Sbjct  284  PNEFAFGSNTKGLVKAWEGERIHEVCGSDELELTLGTSKTR  324



>gb|KHN36917.1| BES1/BZR1 like protein 4 [Glycine soja]
Length=254

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 83/116 (72%), Gaps = 5/116 (4%)
 Frame = -2

Query  571  DSGWLSGVQTPQDG--PSSPTFSLVSPNPFGFKE-PLSNGGSRMWT-PGQSGTCspavaa  404
            ++ W S ++ PQ G  P+SPTFSLVS NPFG KE  +   GSRMWT PG SGTCSPAVAA
Sbjct  135  ETDWFSKIRIPQGGLAPTSPTFSLVSSNPFGLKEDAMVGSGSRMWTTPGASGTCSPAVAA  194

Query  403  axdrsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECI-TDDXEXTXGNSNXR  239
              + ++D+PM++A+  EFAFGS++ G+V  W+GERIHE    TDD E T G+S  R
Sbjct  195  GSENTSDIPMAEAVSDEFAFGSSSSGLVNAWKGERIHEASFGTDDLELTLGSSKTR  250



>gb|EEE65864.1| hypothetical protein OsJ_21656 [Oryza sativa Japonica Group]
Length=369

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 76/119 (64%), Gaps = 9/119 (8%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGGSRMWTPGQSGTCspavaaax  398
            PD  WLSG Q    GPSSPT++LVSPNPFG FKE +++  SR+ TPGQSGTC   V    
Sbjct  249  PDPAWLSGFQISSAGPSSPTYNLVSPNPFGIFKEAIAS-TSRVCTPGQSGTC-SPVMGGM  306

Query  397  drsadvPMSDAIQAEFAFGSNAM------GIVKPWEGERIHEECITDDXEXTXGNSNXR  239
                DV M D    +FAFGS++       G+VK WEGERIHEEC +D+ E T G+S  R
Sbjct  307  PAHHDVQMVDGAPDDFAFGSSSNGNNESPGLVKAWEGERIHEECASDELELTLGSSKTR  365



>ref|NP_001057840.1| Os06g0552300 [Oryza sativa Japonica Group]
 sp|Q5Z9E5.1|BZR3_ORYSJ RecName: Full=Protein BZR1 homolog 3; Short=OsBZR3; AltName: 
Full=Protein BRASSINAZOLE-RESISTANT 1 homolog 3 [Oryza sativa 
Japonica Group]
 dbj|BAD53662.1| putative mature anther-specific protein LAT61 [Oryza sativa Japonica 
Group]
 dbj|BAF19754.1| Os06g0552300 [Oryza sativa Japonica Group]
 dbj|BAG94965.1| unnamed protein product [Oryza sativa Japonica Group]
Length=355

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 76/119 (64%), Gaps = 9/119 (8%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGGSRMWTPGQSGTCspavaaax  398
            PD  WLSG Q    GPSSPT++LVSPNPFG FKE +++  SR+ TPGQSGTC   V    
Sbjct  235  PDPAWLSGFQISSAGPSSPTYNLVSPNPFGIFKEAIAS-TSRVCTPGQSGTC-SPVMGGM  292

Query  397  drsadvPMSDAIQAEFAFGSNAM------GIVKPWEGERIHEECITDDXEXTXGNSNXR  239
                DV M D    +FAFGS++       G+VK WEGERIHEEC +D+ E T G+S  R
Sbjct  293  PAHHDVQMVDGAPDDFAFGSSSNGNNESPGLVKAWEGERIHEECASDELELTLGSSKTR  351



>ref|XP_006592940.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X3 [Glycine 
max]
Length=278

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 83/116 (72%), Gaps = 5/116 (4%)
 Frame = -2

Query  571  DSGWLSGVQTPQDG--PSSPTFSLVSPNPFGFKEPLSNG-GSRMWT-PGQSGTCspavaa  404
            ++ W S ++ PQ G  P+SPTFSLVS NPFGFKE    G GSRMWT PG SGTCSPAVAA
Sbjct  159  ETDWFSKIRIPQVGLTPTSPTFSLVSSNPFGFKEDAMGGSGSRMWTTPGASGTCSPAVAA  218

Query  403  axdrsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECI-TDDXEXTXGNSNXR  239
              + ++D+PM++A+  EFAFGS++  +V  W+GERIHE    TDD E T G+S  R
Sbjct  219  GSENTSDIPMAEAVSDEFAFGSSSSVLVNAWKGERIHEASFGTDDLELTLGSSKTR  274



>ref|XP_003543196.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Glycine 
max]
Length=334

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 83/116 (72%), Gaps = 5/116 (4%)
 Frame = -2

Query  571  DSGWLSGVQTPQDG--PSSPTFSLVSPNPFGFKE-PLSNGGSRMWT-PGQSGTCspavaa  404
            ++ W S ++ PQ G  P+SPTFSLVS NPFG KE  +   GSRMWT PG SGTCSPAVAA
Sbjct  215  ETDWFSKIRIPQGGLAPTSPTFSLVSSNPFGLKEDAMVGSGSRMWTTPGASGTCSPAVAA  274

Query  403  axdrsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECI-TDDXEXTXGNSNXR  239
              + ++D+PM++A+  EFAFGS++ G+V  W+GERIHE    TDD E T G+S  R
Sbjct  275  GSENTSDIPMAEAVSDEFAFGSSSSGLVNAWKGERIHEASFGTDDLELTLGSSKTR  330



>ref|XP_006594721.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Glycine 
max]
Length=330

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 83/116 (72%), Gaps = 5/116 (4%)
 Frame = -2

Query  571  DSGWLSGVQTPQDG--PSSPTFSLVSPNPFGFKE-PLSNGGSRMWT-PGQSGTCspavaa  404
            ++ W S ++ PQ G  P+SPTFSLVS NPFG KE  +   GSRMWT PG SGTCSPAVAA
Sbjct  215  ETDWFSKIRIPQGGLAPTSPTFSLVSSNPFGLKEDAMVGSGSRMWTTPGASGTCSPAVAA  274

Query  403  axdrsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECI-TDDXEXTXGNSNXR  239
              + ++D+PM++A+  EFAFGS++ G+V  W+GERIHE    TDD E T G+S  R
Sbjct  275  GSENTSDIPMAEAVSDEFAFGSSSSGLVNAWKGERIHEASFGTDDLELTLGSSKTR  330



>gb|KJB69670.1| hypothetical protein B456_011G036300 [Gossypium raimondii]
Length=285

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = -2

Query  499  PNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxdrsadvPMSDAIQAEFAFGSNAMGIV  320
            P+P     P   GGSRMWTPGQSGTCSPA  A  D+++DVPMSDAI AEFAFGSN  G+V
Sbjct  199  PSPSRQVFPDPGGGSRMWTPGQSGTCSPAFPAGVDQTSDVPMSDAIAAEFAFGSNMTGLV  258

Query  319  KPWEGERIHEECITDDXEXTXGNSNXR  239
            KPWEGE+IHEEC+ +D E T GNS  R
Sbjct  259  KPWEGEKIHEECVANDLELTLGNSKTR  285



>gb|EEC80795.1| hypothetical protein OsI_23332 [Oryza sativa Indica Group]
Length=354

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 76/119 (64%), Gaps = 9/119 (8%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGGSRMWTPGQSGTCspavaaax  398
            PD  WL+G Q    GPSSPT++LVSPNPFG FKE +++  SR+ TPGQSGTC   V    
Sbjct  234  PDPAWLAGFQISSAGPSSPTYNLVSPNPFGIFKEAIAS-TSRVCTPGQSGTC-SPVMGGM  291

Query  397  drsadvPMSDAIQAEFAFGSNAM------GIVKPWEGERIHEECITDDXEXTXGNSNXR  239
                DV M D    +FAFGS++       G+VK WEGERIHEEC +D+ E T G+S  R
Sbjct  292  PAHHDVQMVDGAPDDFAFGSSSNGNNESPGLVKAWEGERIHEECASDELELTLGSSKTR  350



>ref|XP_006592939.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Glycine 
max]
Length=334

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 83/116 (72%), Gaps = 5/116 (4%)
 Frame = -2

Query  571  DSGWLSGVQTPQDG--PSSPTFSLVSPNPFGFKEPLSNG-GSRMWT-PGQSGTCspavaa  404
            ++ W S ++ PQ G  P+SPTFSLVS NPFGFKE    G GSRMWT PG SGTCSPAVAA
Sbjct  215  ETDWFSKIRIPQVGLTPTSPTFSLVSSNPFGFKEDAMGGSGSRMWTTPGASGTCSPAVAA  274

Query  403  axdrsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECI-TDDXEXTXGNSNXR  239
              + ++D+PM++A+  EFAFGS++  +V  W+GERIHE    TDD E T G+S  R
Sbjct  275  GSENTSDIPMAEAVSDEFAFGSSSSVLVNAWKGERIHEASFGTDDLELTLGSSKTR  330



>ref|XP_003540501.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Glycine 
max]
Length=330

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 83/116 (72%), Gaps = 5/116 (4%)
 Frame = -2

Query  571  DSGWLSGVQTPQDG--PSSPTFSLVSPNPFGFKEPLSNG-GSRMWT-PGQSGTCspavaa  404
            ++ W S ++ PQ G  P+SPTFSLVS NPFGFKE    G GSRMWT PG SGTCSPAVAA
Sbjct  215  ETDWFSKIRIPQVGLTPTSPTFSLVSSNPFGFKEDAMGGSGSRMWTTPGASGTCSPAVAA  274

Query  403  axdrsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECI-TDDXEXTXGNSNXR  239
              + ++D+PM++A+  EFAFGS++  +V  W+GERIHE    TDD E T G+S  R
Sbjct  275  GSENTSDIPMAEAVSDEFAFGSSSSVLVNAWKGERIHEASFGTDDLELTLGSSKTR  330



>ref|XP_009416433.1| PREDICTED: protein BZR1 homolog 3 [Musa acuminata subsp. malaccensis]
Length=337

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 71/118 (60%), Gaps = 10/118 (8%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxd  395
            P S WL+ ++ P  GPSSPTFSL+S NP  F +  S  GSRM TPGQSGTCSP       
Sbjct  221  PQSAWLASLRLPSGGPSSPTFSLISSNPLVFYKEAS--GSRMLTPGQSGTCSPIPGGHSH  278

Query  394  rsadvPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
                  MSD    EF FGS+      A G+VKPWEGE IHEEC +D+ + T G+S  R
Sbjct  279  GDVQ--MSDGGSDEFEFGSSSNGTDTATGLVKPWEGEMIHEECASDELDLTLGSSKTR  334



>ref|XP_009381197.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Musa acuminata subsp. 
malaccensis]
Length=411

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 75/133 (56%), Gaps = 24/133 (18%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCs--------  419
            PD  W++G+Q     PSSPTFSLVS NPFGF      G SRMWTPGQSGT S        
Sbjct  279  PDPAWIAGLQIETTSPSSPTFSLVSSNPFGFS---GGGSSRMWTPGQSGTSSPVMPGIIW  335

Query  418  --------pavaaaxdrsadvPMSDAIQAEFAFGSNA-----MGIVKPWEGERIHEECIT  278
                      V      + DV MS+ I  EFAFGS++      G+VKPWEGERIHEEC  
Sbjct  336  MPGQSGTRSPVMPGISHNIDVQMSNGITDEFAFGSSSNGNSLRGLVKPWEGERIHEECGP  395

Query  277  DDXEXTXGNSNXR  239
            DD + T G+S  R
Sbjct  396  DDLQLTLGSSRTR  408



>ref|XP_003563774.1| PREDICTED: protein BZR1 homolog 3 [Brachypodium distachyon]
Length=355

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 76/119 (64%), Gaps = 9/119 (8%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGGSRMWTPGQSGTCspavaaax  398
            PD  WL+G Q    GPSSPT++LVS NPFG FKE L++  SR+ TPGQSGTC   V    
Sbjct  235  PDPAWLAGFQISSAGPSSPTYNLVSHNPFGIFKEALAST-SRVCTPGQSGTC-SPVMGGA  292

Query  397  drsadvPMSDAIQAEFAFGSNAM------GIVKPWEGERIHEECITDDXEXTXGNSNXR  239
                DV M+D    +FAFGS++       G+VK WEGERIHEEC +D+ E T G+S  R
Sbjct  293  PTHHDVQMADGATDDFAFGSSSNGNNESPGLVKAWEGERIHEECASDELELTLGSSMTR  351



>ref|XP_002454981.1| hypothetical protein SORBIDRAFT_03g002480 [Sorghum bicolor]
 gb|EES00101.1| hypothetical protein SORBIDRAFT_03g002480 [Sorghum bicolor]
Length=348

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 73/114 (64%), Gaps = 10/114 (9%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKE--PLSNGGSRMWTPGQSGTCspavaa  404
            PD  WL+G+Q     P+SPTFSLVS NPF  FKE  P+ N  SRM TPGQSGTCSPA+  
Sbjct  233  PDPAWLAGIQISSTSPNSPTFSLVSTNPFSVFKESIPVGNSSSRMCTPGQSGTCSPAIPG  292

Query  403  axdrsadvPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDXEXT  260
                S    M DA+  EFAFGS+      A G+V+ WEGERIHE+  +DD E T
Sbjct  293  MLQHSDVHMM-DAVSDEFAFGSSTNGAQQAAGLVRAWEGERIHEDSGSDDLELT  345



>ref|NP_001136786.1| BES transcription factor [Zea mays]
 gb|ACF82630.1| unknown [Zea mays]
 gb|ACG34754.1| brassinazole-resistant 1 protein [Zea mays]
 gb|ACR37890.1| unknown [Zea mays]
 gb|ADX60154.1| BES transcription factor [Zea mays]
 gb|ADX60163.1| MYBGA transcription factor, partial [Zea mays]
 gb|AFW86961.1| brassinazole-resistant 1 protein [Zea mays]
Length=355

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGGSRMWTPGQSGTCspavaaax  398
            PD  WL+G Q    GPSSPT+SLV+PNPFG FKE + +  SRM TPGQSGTC   V    
Sbjct  233  PDPAWLAGFQISSAGPSSPTYSLVAPNPFGIFKETIVST-SRMCTPGQSGTC-SPVMGGA  290

Query  397  drsadvPMSDAIQAEFAFGSNAM------GIVKPWEGERIHEECITDDX--EXTXGNSNX  242
                DV M+D    +FAFGS++       G+VK WEGERIHEEC +D+   E T G+S  
Sbjct  291  PIHHDVQMADGAPDDFAFGSSSNGNNESPGLVKAWEGERIHEECASDEHELELTLGSSKT  350

Query  241  R  239
            R
Sbjct  351  R  351



>ref|XP_002437132.1| hypothetical protein SORBIDRAFT_10g021750 [Sorghum bicolor]
 gb|EER88499.1| hypothetical protein SORBIDRAFT_10g021750 [Sorghum bicolor]
Length=356

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGGSRMWTPGQSGTCspavaaax  398
            PD  WL+G Q    GPSSPT+SLV+PNPFG FKE +++  SRM TPGQSGTC   V    
Sbjct  234  PDPAWLAGFQISSAGPSSPTYSLVAPNPFGIFKETIAST-SRMCTPGQSGTC-SPVMGGV  291

Query  397  drsadvPMSDAIQAEFAFGSNAM------GIVKPWEGERIHEECITDDX--EXTXGNSNX  242
                DV M D    +FAFGS++       G+VK WEGERIHEEC +D+   E T G+S  
Sbjct  292  PIHHDVQMVDGAPDDFAFGSSSNGNNESPGLVKAWEGERIHEECASDEHELELTLGSSKT  351

Query  241  R  239
            R
Sbjct  352  R  352



>ref|XP_010925590.1| PREDICTED: protein BZR1 homolog 3-like [Elaeis guineensis]
Length=337

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 74/117 (63%), Gaps = 9/117 (8%)
 Frame = -2

Query  565  GWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGG-SRMWTPGQSGTCspavaaaxdr  392
             WL+G+Q P  GPSSPTF LVS NPFG FKE ++ GG SR+  PGQSGTC   V      
Sbjct  218  AWLAGIQLPTGGPSSPTFRLVSSNPFGFFKEAMAGGGSSRVVRPGQSGTC-SPVMPGGPG  276

Query  391  sadvPMSDAIQAEFAFGSNA------MGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
              DVPM D    EFAFGS +       G+VK WEGERIHEEC +D+ + T G+S  R
Sbjct  277  HIDVPMPDGTSDEFAFGSGSNSNHPPAGLVKAWEGERIHEECGSDELDLTLGSSWAR  333



>ref|XP_004965584.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Setaria italica]
Length=356

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGGSRMWTPGQSGTCspavaaax  398
            PD  WLSG +    GPSSPT+SLV+PNPFG FKE +++  SRM TPGQSGTC   V    
Sbjct  234  PDPTWLSGFRISSAGPSSPTYSLVAPNPFGIFKETVAST-SRMCTPGQSGTC-SPVMGGV  291

Query  397  drsadvPMSDAIQAEFAFGSNAM------GIVKPWEGERIHEECITDDX--EXTXGNSNX  242
                DV M D    +FAFGS++       G+VK WEGERIHEEC +D+   E T G+S  
Sbjct  292  PIHHDVQMVDGTPDDFAFGSSSNGNNQSPGLVKAWEGERIHEECASDEHELELTLGSSKT  351

Query  241  R  239
            R
Sbjct  352  R  352



>ref|XP_004968562.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Setaria italica]
Length=347

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 73/114 (64%), Gaps = 10/114 (9%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGG--SRMWTPGQSGTCspavaa  404
            PD  WL+ +Q     P+SPTFSLVS NPF  FKE +S GG  SRM TPGQSGTCSPA+  
Sbjct  232  PDPAWLASIQISSTSPNSPTFSLVSTNPFSVFKESISVGGNSSRMCTPGQSGTCSPAIPG  291

Query  403  axdrsadvPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDXEXT  260
                S    M DA+  EFAFGS+      A G+V+ WEGERIHE+  +DD E T
Sbjct  292  MPRPSDVHMM-DAVSDEFAFGSSTNGAQQAAGLVRAWEGERIHEDSGSDDLELT  344



>dbj|BAJ97997.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91390.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=357

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 70/121 (58%), Gaps = 12/121 (10%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspav--aaa  401
            PD  WL+G Q    GPSSPT++LVS NPFG     S   SR  TPGQSGTCSP +     
Sbjct  235  PDPAWLAGFQISSAGPSSPTYNLVSHNPFGIALASS---SRACTPGQSGTCSPVMGDHPP  291

Query  400  xdrsadvPMSDAIQAEFAFGSNAM-------GIVKPWEGERIHEECITDDXEXTXGNSNX  242
                  + M D    +FAFGSN+        G+VK WEGERIHEEC +D+ E T G+S  
Sbjct  292  VHHDVQMEMVDGAADDFAFGSNSNDNNGSPPGLVKAWEGERIHEECASDELELTLGSSRT  351

Query  241  R  239
            R
Sbjct  352  R  352



>ref|NP_001132634.1| uncharacterized protein LOC100194109 [Zea mays]
 gb|ACF81562.1| unknown [Zea mays]
 gb|ACG40609.1| brassinazole-resistant 1 protein [Zea mays]
Length=345

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 71/116 (61%), Gaps = 12/116 (10%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGGS----RMWTPGQSGTCspav  410
            PD  WL+G+Q     P+SPTFSLVS NPFG FKE +  GG     RM TPGQSG CSPA+
Sbjct  228  PDPAWLAGIQISSTSPNSPTFSLVSTNPFGVFKESIPVGGGDSSMRMCTPGQSGACSPAI  287

Query  409  aaaxdrsadvPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDXEXT  260
                  S    M D +  EFAFGS+      A G+V+ WEGERIHE+  +DD E T
Sbjct  288  PGMPRHSDVHMM-DVVSDEFAFGSSTNGAQQAAGLVRAWEGERIHEDSGSDDLELT  342



>gb|ACG41016.1| brassinazole-resistant 1 protein [Zea mays]
Length=346

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 71/117 (61%), Gaps = 13/117 (11%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGGS-----RMWTPGQSGTCspa  413
            PD  WL+G+Q     P+SPTFSLVS NPFG FKE +  GG      RM TPGQSG CSPA
Sbjct  228  PDPAWLAGIQISSTSPNSPTFSLVSTNPFGVFKESIPVGGGGDSSMRMCTPGQSGACSPA  287

Query  412  vaaaxdrsadvPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDXEXT  260
            +      S    M D +  EFAFGS+      A G+V+ WEGERIHE+  +DD E T
Sbjct  288  IPGMPRHSDVHMM-DVVSDEFAFGSSTNGAQQAAGLVRAWEGERIHEDSGSDDLELT  343



>gb|EMT29878.1| hypothetical protein F775_52316 [Aegilops tauschii]
Length=355

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 73/120 (61%), Gaps = 11/120 (9%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspav--aaa  401
            PD  WL+G Q    GPSSPT++LVS NPFG     S   SR+ TPGQSGTCSPA+   A 
Sbjct  234  PDPAWLAGFQISSAGPSSPTYNLVSHNPFGIALASS---SRVCTPGQSGTCSPAMGDHAP  290

Query  400  xdrsadvPMSDAIQAEFAFGSNAM------GIVKPWEGERIHEECITDDXEXTXGNSNXR  239
                  + M +    +FAFGSN+       G+VK WEGERIHEEC +D+ E T G+S  R
Sbjct  291  AHHDVQMEMVEGAADDFAFGSNSNGNNGSPGLVKAWEGERIHEECASDELELTLGSSRTR  350



>gb|EMS63049.1| hypothetical protein TRIUR3_11319 [Triticum urartu]
Length=544

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 72/120 (60%), Gaps = 11/120 (9%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspav--aaa  401
            PD  WL+G Q    GPSSPT++LVS NPFG     S   SR  TPGQSGTCSP +   A 
Sbjct  423  PDPAWLAGFQISSAGPSSPTYNLVSHNPFGIALASS---SRACTPGQSGTCSPVMGDHAP  479

Query  400  xdrsadvPMSDAIQAEFAFGSNAM------GIVKPWEGERIHEECITDDXEXTXGNSNXR  239
                  + M+D    +FAFGSN+       G+VK WEGERIHEEC +D+ E T G+S  R
Sbjct  480  AHHDVQMEMADGAPDDFAFGSNSNGNNGSPGLVKAWEGERIHEECASDELELTLGSSRTR  539



>gb|EEC70129.1| hypothetical protein OsI_00807 [Oryza sativa Indica Group]
Length=334

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 76/121 (63%), Gaps = 10/121 (8%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKE--PLSNGGSRMWTPGQSGTCspavaa  404
            PD  WL+G+Q     PSSPTFSLVS NPF  FK+  P+ N  SRM TPGQSGTCSPA+  
Sbjct  212  PDPAWLAGIQISSTSPSSPTFSLVSSNPFSVFKDAIPVGNNSSRMCTPGQSGTCSPAIPG  271

Query  403  axdrsadvPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDXEXTXGNSNX  242
                     M DA+  EFAFGS+      A G+V+ WEGERIHE+  +DD E T G+S  
Sbjct  272  MAPHPDIHMM-DAVSDEFAFGSSTNGGHQAAGLVRAWEGERIHEDSGSDDLELTLGSSRT  330

Query  241  R  239
            R
Sbjct  331  R  331



>ref|XP_006643883.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Oryza brachyantha]
Length=261

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 75/121 (62%), Gaps = 10/121 (8%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKE--PLSNGGSRMWTPGQSGTCspavaa  404
            PD  WL+G+Q     PSSPTFSLVS NPF  FK+  P+ N  SRM TPGQSGTCSPA+  
Sbjct  139  PDPAWLAGIQISSTSPSSPTFSLVSTNPFSVFKDAIPVGNSSSRMCTPGQSGTCSPAIPG  198

Query  403  axdrsadvPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDXEXTXGNSNX  242
                     M D +  EFAFGS+      A G+V+ WEGERIHE+  +DD E T G+S  
Sbjct  199  MAPHPDIHMM-DVVSDEFAFGSSTNGGHQAAGLVRAWEGERIHEDSGSDDLELTLGSSRT  257

Query  241  R  239
            R
Sbjct  258  R  258



>gb|EEE54074.1| hypothetical protein OsJ_00786 [Oryza sativa Japonica Group]
Length=334

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 75/121 (62%), Gaps = 10/121 (8%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPL--SNGGSRMWTPGQSGTCspavaa  404
            PD  WL+G+Q     PSSPTFSLVS NPF  FK+ +   N  SRM TPGQSGTCSPA+  
Sbjct  212  PDPAWLAGIQISSTSPSSPTFSLVSSNPFSVFKDAILVGNNSSRMCTPGQSGTCSPAIPG  271

Query  403  axdrsadvPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDXEXTXGNSNX  242
                     M DA+  EFAFGS+      A G+V+ WEGERIHE+  +DD E T G+S  
Sbjct  272  MAPHPDIHMM-DAVSDEFAFGSSTNGGHQAAGLVRAWEGERIHEDSGSDDLELTLGSSRT  330

Query  241  R  239
            R
Sbjct  331  R  331



>dbj|BAB33003.1| unknown protein [Oryza sativa Japonica Group]
Length=354

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 75/121 (62%), Gaps = 10/121 (8%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPL--SNGGSRMWTPGQSGTCspavaa  404
            PD  WL+G+Q     PSSPTFSLVS NPF  FK+ +   N  SRM TPGQSGTCSPA+  
Sbjct  232  PDPAWLAGIQISSTSPSSPTFSLVSSNPFSVFKDAILVGNNSSRMCTPGQSGTCSPAIPG  291

Query  403  axdrsadvPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDXEXTXGNSNX  242
                     M DA+  EFAFGS+      A G+V+ WEGERIHE+  +DD E T G+S  
Sbjct  292  MAPHPDIHMM-DAVSDEFAFGSSTNGGHQAAGLVRAWEGERIHEDSGSDDLELTLGSSRT  350

Query  241  R  239
            R
Sbjct  351  R  351



>ref|NP_001042330.1| Os01g0203000 [Oryza sativa Japonica Group]
 sp|Q0JPT4.1|BZR2_ORYSJ RecName: Full=Protein BZR1 homolog 2; Short=OsBZR2; AltName: 
Full=Protein BRASSINAZOLE-RESISTANT 1 homolog 2 [Oryza sativa 
Japonica Group]
 dbj|BAF04244.1| Os01g0203000, partial [Oryza sativa Japonica Group]
Length=365

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 75/121 (62%), Gaps = 10/121 (8%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPL--SNGGSRMWTPGQSGTCspavaa  404
            PD  WL+G+Q     PSSPTFSLVS NPF  FK+ +   N  SRM TPGQSGTCSPA+  
Sbjct  243  PDPAWLAGIQISSTSPSSPTFSLVSSNPFSVFKDAILVGNNSSRMCTPGQSGTCSPAIPG  302

Query  403  axdrsadvPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDXEXTXGNSNX  242
                     M DA+  EFAFGS+      A G+V+ WEGERIHE+  +DD E T G+S  
Sbjct  303  MAPHPDIHMM-DAVSDEFAFGSSTNGGHQAAGLVRAWEGERIHEDSGSDDLELTLGSSRT  361

Query  241  R  239
            R
Sbjct  362  R  362



>ref|XP_003571150.2| PREDICTED: protein BZR1 homolog 3-like [Brachypodium distachyon]
Length=378

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 75/129 (58%), Gaps = 14/129 (11%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLV-SPNPF-GFKEPLSN---GGSRMWTPGQSGTCspav  410
            PD  WL+G Q    GPSSPT++L+ S NPF   +E  +    G SRM+TPGQSG CSP V
Sbjct  247  PDPAWLAGFQISSAGPSSPTYNLMASQNPFVAVREAAAAATAGSSRMYTPGQSGACSPVV  306

Query  409  aaaxdrsa-dvPMSDAIQAE-FAFGSNAM-------GIVKPWEGERIHEECITDDXEXTX  257
              A      D  M+D   AE FAFG+          G++K WEGERIHEE  +D+ E T 
Sbjct  307  GGAGLVIRGDTHMADRAAAEDFAFGNGGGGGNGRVPGLLKAWEGERIHEESASDELELTL  366

Query  256  GNSNXR*GV  230
            GNS+ R G 
Sbjct  367  GNSSTRAGA  375



>emb|CDM82126.1| unnamed protein product [Triticum aestivum]
Length=333

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 73/122 (60%), Gaps = 11/122 (9%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGG-SRMWTPGQSGTCspavaaa  401
            PD  WL+G+Q     PSSPTFSL+S NPF  FKE +  GG SRM TPGQSGTCSP +   
Sbjct  212  PDPAWLAGIQISSTSPSSPTFSLMSSNPFSVFKEAIPGGGSSRMCTPGQSGTCSPVIPGM  271

Query  400  xdrsadvPMSDAIQAEFAFGSN--------AMGIVKPWEGERIHEECITDDXEXTXGNSN  245
                    M D +  EFAFGS+          G+V+ WEGERIHE+  +D+ E T G+S 
Sbjct  272  ARHPDVHMM-DVVSDEFAFGSSTNGGAQQATAGLVRAWEGERIHEDSGSDELELTLGSSR  330

Query  244  XR  239
             R
Sbjct  331  TR  332



>ref|XP_006833072.1| hypothetical protein AMTR_s00170p00061300 [Amborella trichopoda]
 gb|ERM98350.1| hypothetical protein AMTR_s00170p00061300 [Amborella trichopoda]
Length=293

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 65/113 (58%), Gaps = 23/113 (20%)
 Frame = -2

Query  568  SGWLSGVQTPQDGPSSPTFSLVSP---NPFGFKEPLSNGGSRMWTPGQSGTCspavaaax  398
            S WLSG++ P  GP SPTFSLVSP   NPFG           +W P  SGTCSP    + 
Sbjct  199  SDWLSGIRLPAGGPMSPTFSLVSPASSNPFG----------GLWAPAGSGTCSPCNVESG  248

Query  397  drsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            D      M +A   EFAFG     +VKPW+GE+IH+EC +DD E T G+S  R
Sbjct  249  DVR----MVEA-SDEFAFG-----VVKPWQGEKIHDECGSDDLELTLGSSRTR  291



>ref|XP_003565213.1| PREDICTED: protein BZR1 homolog 2 [Brachypodium distachyon]
Length=355

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 73/122 (60%), Gaps = 11/122 (9%)
 Frame = -2

Query  574  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGG---SRMWTPGQSGTCspava  407
            PD  WL+G+Q     PSSPTFSL+S NPF  FKE +   G   SRM TPGQSGTCSP + 
Sbjct  234  PDPAWLAGIQISSTSPSSPTFSLMSSNPFSVFKEAIPVPGSNSSRMCTPGQSGTCSPVIP  293

Query  406  aaxdrsadvPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDXEXTXGNSN  245
                      M D +  EFAFGS+      A G+V+ WEGERIHE+  +D+ E T G+S 
Sbjct  294  GMARHPDVHMM-DVVSDEFAFGSSSNDAQQAPGLVRAWEGERIHEDSGSDELELTLGSSR  352

Query  244  XR  239
             R
Sbjct  353  TR  354



>emb|CDY00299.1| BnaA06g22000D [Brassica napus]
Length=224

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 58/83 (70%), Gaps = 11/83 (13%)
 Frame = -2

Query  526  SSPTFSLVSPNPFGFKE-----PLSNGGSRMWTPGQSGTCspavaaaxdrsadvPMSDAI  362
            S+PTFSLVS NPFGF+E         GGSRMWTPGQSGTC    + A  ++ DVPMS+A+
Sbjct  103  STPTFSLVSRNPFGFREDQLASAGGGGGSRMWTPGQSGTC----SPAITQTGDVPMSEAV  158

Query  361  Q--AEFAFGSNAMGIVKPWEGER  299
                EFAFGSNA G+ K WEGER
Sbjct  159  APPPEFAFGSNANGLAKAWEGER  181



>emb|CBI30731.3| unnamed protein product [Vitis vinifera]
Length=169

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = -2

Query  532  GPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCspavaaaxdrsadvPMSDAIQA  356
            GP+SPTFSLVS NPFGFKE  L+ GGSRMWTPGQSGTCSPAVAA  D +ADVPM+D I A
Sbjct  85   GPASPTFSLVSANPFGFKEEVLAGGGSRMWTPGQSGTCSPAVAAGSDHTADVPMADGIAA  144

Query  355  EFAFGS  338
            +   G+
Sbjct  145  DSPLGA  150



>gb|EMS49339.1| hypothetical protein TRIUR3_13720 [Triticum urartu]
Length=245

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 58/100 (58%), Gaps = 11/100 (11%)
 Frame = -2

Query  508  LVSPNPFG-FKEPLSNGGS-RMWTPGQSGTCspavaaaxdrsadvPMSDAIQAEFAFGSN  335
            L+S NPF  FKE +  GGS RM TPGQSGTCSP +           M D +  EFAFGS+
Sbjct  146  LMSSNPFSVFKEAIPGGGSSRMCTPGQSGTCSPVIPGMARHPDVHMM-DVVSDEFAFGSS  204

Query  334  A--------MGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
                      G+V+ WEGERIHE+  +D+ E T G+S  R
Sbjct  205  TNGGAQQATAGLVRAWEGERIHEDSGSDELELTLGSSRTR  244



>ref|XP_010675300.1| PREDICTED: BES1/BZR1 homolog protein 4 [Beta vulgaris subsp. 
vulgaris]
Length=286

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 66/98 (67%), Gaps = 8/98 (8%)
 Frame = -2

Query  508  LVSPN-PFG--FKEPLS-----NGGSRMWTPGQSGTCspavaaaxdrsadvPMSDAIQAE  353
            LVSP+ PFG  F E  +     +G SRM +P QSGTCSPA+ A  D +A++PM   I  E
Sbjct  184  LVSPHHPFGGFFTENATARGGGDGFSRMLSPLQSGTCSPAIPAGSDHTANIPMFGVICDE  243

Query  352  FAFGSNAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            FAFGS+A G+VK WEGERIHEE  +DD + T G+S  R
Sbjct  244  FAFGSSANGLVKAWEGERIHEEYGSDDLDLTLGSSMTR  281



>ref|NP_001172869.1| Os02g0233200 [Oryza sativa Japonica Group]
 dbj|BAD27718.1| putative mature anther-specific protein LAT61 [Oryza sativa Japonica 
Group]
 dbj|BAH91598.1| Os02g0233200 [Oryza sativa Japonica Group]
Length=376

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 60/111 (54%), Gaps = 11/111 (10%)
 Frame = -2

Query  562  WLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxdrsad  383
            WL+G Q    GPSSPT+SLV+P P  F    +  GS       SG CSP           
Sbjct  271  WLAGFQISSAGPSSPTYSLVAPPPNPFGAAAAAAGSSSRV--MSGACSPVAGGDVQ----  324

Query  382  vPMSDAIQAEFAFGS---NAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
              M+DA + EFAFG       G+VK WEGERIHEEC +DD E T G+S  R
Sbjct  325  --MADAARREFAFGGEGGKMTGLVKAWEGERIHEECGSDDLELTLGSSMTR  373



>sp|Q6EUF1.2|BZR4_ORYSJ RecName: Full=Protein BZR1 homolog 4; Short=OsBZR4; AltName: 
Full=Protein BRASSINAZOLE-RESISTANT 1 homolog 4 [Oryza sativa 
Japonica Group]
Length=351

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 60/111 (54%), Gaps = 11/111 (10%)
 Frame = -2

Query  562  WLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCspavaaaxdrsad  383
            WL+G Q    GPSSPT+SLV+P P  F    +  GS       SG CSP           
Sbjct  246  WLAGFQISSAGPSSPTYSLVAPPPNPFGAAAAAAGSSSRV--MSGACSPVAGGDVQ----  299

Query  382  vPMSDAIQAEFAFGS---NAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
              M+DA + EFAFG       G+VK WEGERIHEEC +DD E T G+S  R
Sbjct  300  --MADAARREFAFGGEGGKMTGLVKAWEGERIHEECGSDDLELTLGSSMTR  348



>gb|EMT21245.1| hypothetical protein F775_32777 [Aegilops tauschii]
Length=335

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 58/100 (58%), Gaps = 11/100 (11%)
 Frame = -2

Query  508  LVSPNPFG-FKEPLSNGGS-RMWTPGQSGTCspavaaaxdrsadvPMSDAIQAEFAFGSN  335
            L+S NPF  FKE +  GGS RM TPGQSGTCSP +           M D +  EFAFGS+
Sbjct  236  LMSSNPFSVFKEAIPGGGSSRMCTPGQSGTCSPVIPGMARHPDVHMM-DVVSDEFAFGSS  294

Query  334  A--------MGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
                      G+V+ WEGERIHE+  +D+ E T G+S  R
Sbjct  295  TNGGAQQATAGLVRAWEGERIHEDSGSDELELTLGSSRTR  334



>gb|ABK21940.1| unknown [Picea sitchensis]
Length=367

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 59/113 (52%), Gaps = 14/113 (12%)
 Frame = -2

Query  562  WLSGVQT---PQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGT---Cspavaaa  401
            W+ G++    P  GPSSPTF+L++P     +  L+  G R+WTPGQSG    C+      
Sbjct  238  WMGGIRMMAFPSAGPSSPTFNLLTPAA-QLQHGLATEGGRLWTPGQSGVSSPCNNRAGEE  296

Query  400  xdrsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEEC----ITDDXEXTXG  254
                           EFAFGS A   VKPW+GERIHEEC     +DD E T G
Sbjct  297  ERLLPPFQEGMDASDEFAFGSVA---VKPWQGERIHEECGGEIGSDDLELTLG  346



>gb|EAY85121.1| hypothetical protein OsI_06471 [Oryza sativa Indica Group]
Length=377

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 61/114 (54%), Gaps = 16/114 (14%)
 Frame = -2

Query  562  WLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLS---NGGSRMWTPGQSGTCspavaaaxdr  392
            WL+G Q    GPSSPT+SLV+P P  F    +      SR+     SG CSP        
Sbjct  271  WLAGFQISSAGPSSPTYSLVAPPPNPFGAAAAAAAGSSSRV----MSGACSPVAGGDVQ-  325

Query  391  sadvPMSDAIQAEFAFGS---NAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
                 M+DA + EFAFG       G+VK WEGERIHEEC +DD E T G+S  R
Sbjct  326  -----MADAARREFAFGGEGGKMTGLVKAWEGERIHEECGSDDLELTLGSSMTR  374



>gb|EAZ22344.1| hypothetical protein OsJ_05997 [Oryza sativa Japonica Group]
Length=246

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 33/49 (67%), Gaps = 3/49 (6%)
 Frame = -2

Query  376  MSDAIQAEFAFGS---NAMGIVKPWEGERIHEECITDDXEXTXGNSNXR  239
            M+DA + EFAFG       G+VK WEGERIHEEC +DD E T G+S  R
Sbjct  195  MADAARREFAFGGEGGKMTGLVKAWEGERIHEECGSDDLELTLGSSMTR  243



>gb|ABR18463.1| unknown [Picea sitchensis]
Length=407

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 58/129 (45%), Gaps = 30/129 (23%)
 Frame = -2

Query  562  WLSGVQTPQD-----GPSSPTFSLVSPNPFGFKEPLSNGG----------SRMWTPGQSG  428
            WL GV+         GPSSPTFSL+SP     +   S GG          SR+WTP  S 
Sbjct  276  WLGGVRVSASASASMGPSSPTFSLLSP---AAQLEHSLGGERSHFFVPADSRLWTPVGSA  332

Query  427  TCspavaaaxdrsadvPMSDAIQAEFAFGSNAMGIVKPWEGERIHEEC------ITDDXE  266
                +       +    +  A   EF F     G VKPW+GERIHEEC       +DD E
Sbjct  333  M---SSPCRTPATGGAVVRVAAADEFQF---ECGSVKPWQGERIHEECGGDMDIASDDLE  386

Query  265  XTXGNSNXR  239
             T G+S  R
Sbjct  387  LTLGSSKRR  395



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750