BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF035P23

Length=628
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008467047.1|  PREDICTED: glutamate--glyoxylate aminotransf...    293   7e-97   Cucumis melo [Oriental melon]
ref|XP_004239121.1|  PREDICTED: glutamate--glyoxylate aminotransf...    301   2e-96   Solanum lycopersicum
ref|XP_009623844.1|  PREDICTED: glutamate--glyoxylate aminotransf...    300   4e-96   Nicotiana tomentosiformis
ref|XP_006357614.1|  PREDICTED: glutamate--glyoxylate aminotransf...    299   7e-96   Solanum tuberosum [potatoes]
ref|XP_009765091.1|  PREDICTED: glutamate--glyoxylate aminotransf...    299   1e-95   Nicotiana sylvestris
ref|XP_008340115.1|  PREDICTED: glutamate--glyoxylate aminotransf...    297   5e-95   Malus domestica [apple tree]
ref|XP_008389735.1|  PREDICTED: glutamate--glyoxylate aminotransf...    296   9e-95   
ref|XP_008221924.1|  PREDICTED: glutamate--glyoxylate aminotransf...    296   1e-94   Prunus mume [ume]
ref|XP_009359228.1|  PREDICTED: glutamate--glyoxylate aminotransf...    295   2e-94   Pyrus x bretschneideri [bai li]
ref|XP_004135487.1|  PREDICTED: glutamate--glyoxylate aminotransf...    294   4e-94   
ref|XP_007222799.1|  hypothetical protein PRUPE_ppa005017mg             295   4e-94   Prunus persica
ref|XP_010100388.1|  Glutamate--glyoxylate aminotransferase 2           294   7e-94   Morus notabilis
gb|KDP26646.1|  hypothetical protein JCGZ_17804                         294   9e-94   Jatropha curcas
gb|KGN51765.1|  hypothetical protein Csa_5G598730                       293   1e-93   Cucumis sativus [cucumbers]
gb|EYU28421.1|  hypothetical protein MIMGU_mgv1a005535mg                293   3e-93   Erythranthe guttata [common monkey flower]
emb|CDP13207.1|  unnamed protein product                                292   4e-93   Coffea canephora [robusta coffee]
gb|KDO82251.1|  hypothetical protein CISIN_1g041151mg                   291   7e-93   Citrus sinensis [apfelsine]
ref|XP_003613139.1|  Alanine aminotransferase                           291   7e-93   Medicago truncatula
ref|XP_006438274.1|  hypothetical protein CICLE_v10031381mg             291   1e-92   Citrus clementina [clementine]
emb|CBI23368.3|  unnamed protein product                                291   2e-92   Vitis vinifera
ref|NP_001268094.1|  uncharacterized protein LOC100261274               290   3e-92   Vitis vinifera
ref|XP_010251104.1|  PREDICTED: glutamate--glyoxylate aminotransf...    290   3e-92   Nelumbo nucifera [Indian lotus]
ref|XP_004309987.1|  PREDICTED: glutamate--glyoxylate aminotransf...    289   6e-92   Fragaria vesca subsp. vesca
gb|AET06145.1|  PLP-dependent aminotransferase                          289   9e-92   Papaver somniferum
ref|XP_004489787.1|  PREDICTED: glutamate--glyoxylate aminotransf...    288   1e-91   Cicer arietinum [garbanzo]
ref|XP_011086618.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    288   2e-91   
emb|CAN62302.1|  hypothetical protein VITISV_023686                     288   2e-91   Vitis vinifera
ref|XP_004155366.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    287   4e-91   
ref|XP_003519649.1|  PREDICTED: glutamate--glyoxylate aminotransf...    287   5e-91   Glycine max [soybeans]
ref|XP_010023477.1|  PREDICTED: glutamate--glyoxylate aminotransf...    286   8e-91   Eucalyptus grandis [rose gum]
ref|XP_010682426.1|  PREDICTED: glutamate--glyoxylate aminotransf...    286   1e-90   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002312679.2|  alanine-2-oxoglutarate aminotransferase 1 fa...    285   2e-90   Populus trichocarpa [western balsam poplar]
ref|XP_009406515.1|  PREDICTED: glutamate--glyoxylate aminotransf...    284   6e-90   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAZ43368.1|  AlaT1                                                   283   8e-90   Vitis labrusca [Concord grape]
ref|NP_001237567.1|  alanine aminotransferase 2                         283   9e-90   
ref|XP_007158412.1|  hypothetical protein PHAVU_002G150800g             283   2e-89   Phaseolus vulgaris [French bean]
ref|XP_008789746.1|  PREDICTED: glutamate--glyoxylate aminotransf...    283   2e-89   
ref|XP_009413361.1|  PREDICTED: glutamate--glyoxylate aminotransf...    282   3e-89   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN14541.1|  Glutamate--glyoxylate aminotransferase 2                282   5e-89   Glycine soja [wild soybean]
ref|XP_010927963.1|  PREDICTED: glutamate--glyoxylate aminotransf...    281   1e-88   Elaeis guineensis
ref|XP_006840828.1|  hypothetical protein AMTR_s00083p00031040          280   2e-88   Amborella trichopoda
ref|XP_009105727.1|  PREDICTED: glutamate--glyoxylate aminotransf...    280   2e-88   Brassica rapa
emb|CDY61225.1|  BnaC06g43710D                                          280   2e-88   Brassica napus [oilseed rape]
ref|NP_001237581.1|  alanine aminotransferase 3                         280   2e-88   Glycine max [soybeans]
ref|XP_009105726.1|  PREDICTED: glutamate--glyoxylate aminotransf...    280   3e-88   Brassica rapa
gb|KJB31170.1|  hypothetical protein B456_005G179600                    280   4e-88   Gossypium raimondii
ref|XP_010552672.1|  PREDICTED: glutamate--glyoxylate aminotransf...    279   4e-88   Tarenaya hassleriana [spider flower]
gb|KJB31175.1|  hypothetical protein B456_005G179600                    279   7e-88   Gossypium raimondii
gb|KHG15331.1|  Glutamate--glyoxylate aminotransferase 2 -like pr...    279   7e-88   Gossypium arboreum [tree cotton]
ref|XP_010928898.1|  PREDICTED: glutamate--glyoxylate aminotransf...    279   7e-88   Elaeis guineensis
ref|XP_011071137.1|  PREDICTED: glutamate--glyoxylate aminotransf...    278   1e-87   
emb|CDX91708.1|  BnaC08g06270D                                          275   2e-87   
gb|EPS68501.1|  hypothetical protein M569_06265                         277   2e-87   Genlisea aurea
emb|CDY25780.1|  BnaA07g10020D                                          275   3e-87   Brassica napus [oilseed rape]
dbj|BAJ90574.1|  predicted protein                                      271   3e-87   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009110107.1|  PREDICTED: glutamate--glyoxylate aminotransf...    277   4e-87   Brassica rapa
ref|XP_006300456.1|  hypothetical protein CARUB_v10020212mg             276   5e-87   
ref|XP_011014669.1|  PREDICTED: glutamate--glyoxylate aminotransf...    276   7e-87   Populus euphratica
ref|XP_007044762.1|  Alanine-2-oxoglutarate aminotransferase 2 is...    276   7e-87   
ref|XP_002893277.1|  alanine-2-oxoglutarate aminotransferase 1          276   9e-87   
dbj|BAH20108.1|  AT1G70580                                              276   1e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307377.1|  hypothetical protein CARUB_v10009003mg             275   1e-86   Capsella rubella
gb|AAK68842.1|  alanine aminotransferase-like protein                   272   2e-86   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177215.1|  glutamate--glyoxylate aminotransferase 2              275   2e-86   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61453.1|  putative alanine aminotransferase                       275   2e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002315675.1|  hypothetical protein POPTR_0010s05530g             275   2e-86   Populus trichocarpa [western balsam poplar]
ref|XP_009115544.1|  PREDICTED: glutamate--glyoxylate aminotransf...    275   2e-86   Brassica rapa
ref|XP_006416099.1|  hypothetical protein EUTSA_v10007514mg             275   3e-86   
ref|XP_006390865.1|  hypothetical protein EUTSA_v10018474mg             274   4e-86   
emb|CDY41452.1|  BnaA08g20540D                                          274   5e-86   Brassica napus [oilseed rape]
gb|AAM22749.1|  alanine aminotransferase                                263   5e-86   Deschampsia antarctica
ref|XP_008447004.1|  PREDICTED: glutamate--glyoxylate aminotransf...    268   1e-85   
emb|CDY66294.1|  BnaAnng22050D                                          273   1e-85   Brassica napus [oilseed rape]
ref|NP_564192.2|  glutamate:glyoxylate aminotransferase                 272   2e-85   Arabidopsis thaliana [mouse-ear cress]
gb|AAL24255.1|  At1g23310/F26F24_4                                      272   2e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010498838.1|  PREDICTED: glutamate--glyoxylate aminotransf...    272   3e-85   Camelina sativa [gold-of-pleasure]
ref|XP_010477627.1|  PREDICTED: glutamate--glyoxylate aminotransf...    271   4e-85   Camelina sativa [gold-of-pleasure]
ref|XP_010460118.1|  PREDICTED: glutamate--glyoxylate aminotransf...    271   6e-85   Camelina sativa [gold-of-pleasure]
gb|EMS58349.1|  Alanine aminotransferase 2                              271   7e-85   Triticum urartu
ref|XP_009103182.1|  PREDICTED: glutamate--glyoxylate aminotransf...    270   1e-84   Brassica rapa
ref|XP_010415743.1|  PREDICTED: glutamate--glyoxylate aminotransf...    270   1e-84   Camelina sativa [gold-of-pleasure]
ref|XP_010427837.1|  PREDICTED: glutamate--glyoxylate aminotransf...    270   1e-84   Camelina sativa [gold-of-pleasure]
ref|NP_001058716.1|  Os07g0108300                                       270   2e-84   
gb|AAO84040.1|  alanine aminotransferase                                270   2e-84   Oryza sativa Indica Group [Indian rice]
emb|CDY12474.1|  BnaC07g13140D                                          271   4e-84   Brassica napus [oilseed rape]
ref|XP_004955317.1|  PREDICTED: glutamate--glyoxylate aminotransf...    269   5e-84   Setaria italica
gb|KGN51767.1|  hypothetical protein Csa_5G598750                       268   7e-84   Cucumis sativus [cucumbers]
tpg|DAA59363.1|  TPA: putative MATE efflux family protein isoform 1     266   1e-83   
gb|AAK25905.1|AF360195_1  putative alanine aminotransferase             268   2e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009151206.1|  PREDICTED: glutamate--glyoxylate aminotransf...    256   2e-83   
ref|XP_006658210.1|  PREDICTED: glutamate--glyoxylate aminotransf...    267   3e-83   
ref|XP_009759837.1|  PREDICTED: glutamate--glyoxylate aminotransf...    266   5e-83   Nicotiana sylvestris
ref|XP_010471056.1|  PREDICTED: glutamate--glyoxylate aminotransf...    266   5e-83   Camelina sativa [gold-of-pleasure]
ref|XP_003557680.1|  PREDICTED: glutamate--glyoxylate aminotransf...    266   6e-83   Brachypodium distachyon [annual false brome]
ref|XP_009624740.1|  PREDICTED: glutamate--glyoxylate aminotransf...    265   9e-83   Nicotiana tomentosiformis
ref|XP_004228555.1|  PREDICTED: glutamate--glyoxylate aminotransf...    265   1e-82   Solanum lycopersicum
ref|NP_001151209.1|  alanine aminotransferase 2                         265   1e-82   
tpg|DAA42658.1|  TPA: LOW QUALITY PROTEIN: alanine aminotransfera...    264   3e-82   
ref|NP_001183048.1|  uncharacterized protein LOC100501386               264   3e-82   Zea mays [maize]
ref|XP_002887312.1|  alanine-2-oxoglutarate aminotransferase 2          264   3e-82   Arabidopsis lyrata subsp. lyrata
ref|XP_006348507.1|  PREDICTED: glutamate--glyoxylate aminotransf...    262   2e-81   
ref|XP_008444367.1|  PREDICTED: glutamate--glyoxylate aminotransf...    261   6e-81   Cucumis melo [Oriental melon]
ref|XP_004142968.1|  PREDICTED: glutamate--glyoxylate aminotransf...    259   3e-80   Cucumis sativus [cucumbers]
ref|XP_010248614.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    254   7e-80   
gb|ABK25444.1|  unknown                                                 253   5e-78   Picea sitchensis
gb|AFK42206.1|  unknown                                                 246   2e-77   Lotus japonicus
ref|XP_011034252.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    247   7e-77   Populus euphratica
tpg|DAA42656.1|  TPA: hypothetical protein ZEAMMB73_648980              250   1e-76   
ref|XP_010230121.1|  PREDICTED: glutamate--glyoxylate aminotransf...    235   7e-75   
ref|XP_001763950.1|  predicted protein                                  227   6e-68   
ref|XP_001782822.1|  predicted protein                                  226   1e-67   
ref|XP_001777071.1|  predicted protein                                  217   4e-64   
ref|XP_003613140.1|  Alanine aminotransferase                           214   7e-63   
ref|XP_002968244.1|  hypothetical protein SELMODRAFT_145611             207   2e-60   Selaginella moellendorffii
emb|CDX91589.1|  BnaC02g15710D                                          195   8e-60   
ref|XP_004489786.1|  PREDICTED: glutamate--glyoxylate aminotransf...    206   8e-60   
ref|NP_001031083.1|  glutamate:glyoxylate aminotransferase              202   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005651940.1|  alanine aminotransferase                           201   7e-58   Coccomyxa subellipsoidea C-169
gb|EMT29455.1|  Alanine aminotransferase 2                              200   3e-57   
ref|XP_002947519.1|  alanine aminotransferase                           196   7e-56   Volvox carteri f. nagariensis
ref|XP_001698518.1|  alanine aminotransferase                           189   2e-53   Chlamydomonas reinhardtii
gb|EWM24220.1|  alanine-2-oxoglutarate aminotransferase 2               191   3e-53   Nannochloropsis gaditana
gb|AAB01685.1|  alanine aminotransferase                                187   1e-52   Chlamydomonas reinhardtii
ref|XP_003291733.1|  alanine transaminase                               181   3e-50   Dictyostelium purpureum
gb|ETK83815.1|  hypothetical protein L915_11053                         173   3e-50   Phytophthora parasitica
gb|AFK36743.1|  unknown                                                 172   3e-50   Lotus japonicus
gb|KIZ07569.1|  alanine transaminase                                    182   6e-50   Monoraphidium neglectum
gb|ETL90369.1|  hypothetical protein L917_10859                         171   8e-50   Phytophthora parasitica
gb|EEE58449.1|  hypothetical protein OsJ_09677                          172   2e-49   Oryza sativa Japonica Group [Japonica rice]
gb|ETL37230.1|  hypothetical protein L916_10951                         171   2e-49   Phytophthora parasitica
ref|NP_001060284.1|  Os07g0617800                                       172   2e-48   
ref|XP_004992298.1|  alanine aminotransferase                           174   5e-48   Salpingoeca rosetta
ref|XP_006649511.1|  PREDICTED: alanine aminotransferase 2-like         174   6e-48   
ref|XP_006657961.1|  PREDICTED: alanine aminotransferase 2-like i...    173   1e-47   Oryza brachyantha
tpg|DAA63613.1|  TPA: hypothetical protein ZEAMMB73_743428              170   1e-47   
ref|XP_008907369.1|  hypothetical protein PPTG_13440                    174   1e-47   Phytophthora parasitica INRA-310
gb|ETP41623.1|  hypothetical protein F442_11247                         174   1e-47   Phytophthora parasitica P10297
gb|ETP13560.1|  hypothetical protein F441_11279                         174   1e-47   Phytophthora parasitica CJ01A1
emb|CDJ93113.1|  Aminotransferase domain containing protein             174   2e-47   Haemonchus contortus [red stomach worm]
ref|XP_006657960.1|  PREDICTED: alanine aminotransferase 2-like i...    173   2e-47   Oryza brachyantha
tpg|DAA41461.1|  TPA: hypothetical protein ZEAMMB73_764403              169   3e-47   
dbj|BAC79866.1|  putative alanine aminotransferase                      172   4e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002906656.1|  alanine aminotransferase 2                         172   4e-47   Phytophthora infestans T30-4
ref|XP_006661735.1|  PREDICTED: alanine aminotransferase 2-like         172   5e-47   Oryza brachyantha
ref|NP_001064504.1|  Os10g0390500                                       172   5e-47   
gb|AFK38994.1|  unknown                                                 162   5e-47   Lotus japonicus
gb|AAK52114.1|AC079936_10  Putative alanine aminotransferase            172   5e-47   Oryza sativa Japonica Group [Japonica rice]
gb|KIY92376.1|  hypothetical protein MNEG_15586                         163   6e-47   Monoraphidium neglectum
gb|ETI43749.1|  hypothetical protein F443_11362                         171   9e-47   Phytophthora parasitica P1569
gb|EEE67593.1|  hypothetical protein OsJ_25140                          172   1e-46   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82447.1|  hypothetical protein OsI_26881                          172   1e-46   Oryza sativa Indica Group [Indian rice]
gb|EEC74641.1|  hypothetical protein OsI_10280                          171   1e-46   Oryza sativa Indica Group [Indian rice]
gb|AAV64199.1|  putative alanine aminotransferase                       171   2e-46   Zea mays [maize]
gb|AAV64237.1|  putative alanine aminotransferase                       171   2e-46   Zea mays [maize]
ref|XP_002463187.1|  hypothetical protein SORBIDRAFT_02g039340          171   2e-46   Sorghum bicolor [broomcorn]
ref|NP_001086104.1|  alanine aminotransferase 2                         171   2e-46   Xenopus laevis [clawed frog]
ref|XP_008653343.1|  PREDICTED: alanine aminotransferase 2              171   3e-46   Zea mays [maize]
ref|XP_002887430.1|  ALAAT2                                             169   1e-45   
gb|ETL95505.1|  hypothetical protein L917_06707                         160   1e-45   Phytophthora parasitica
ref|XP_007441690.1|  PREDICTED: alanine aminotransferase 2-like i...    168   1e-45   
emb|CDJ93112.1|  Aminotransferase domain containing protein             167   1e-45   Haemonchus contortus [red stomach worm]
ref|XP_007441689.1|  PREDICTED: alanine aminotransferase 2-like i...    168   1e-45   
gb|EFA80185.1|  alanine transaminase                                    169   2e-45   Heterostelium album PN500
ref|XP_002499950.1|  alanine aminotransferase                           167   2e-45   Micromonas commoda
ref|XP_007441688.1|  PREDICTED: alanine aminotransferase 2-like i...    168   2e-45   
ref|XP_005833147.1|  hypothetical protein GUITHDRAFT_157749             167   2e-45   Guillardia theta CCMP2712
ref|XP_009059448.1|  hypothetical protein LOTGIDRAFT_192553             167   3e-45   Lottia gigantea
ref|XP_005443445.1|  PREDICTED: alanine aminotransferase 2-like         166   3e-45   Falco cherrug
ref|XP_005230442.1|  PREDICTED: alanine aminotransferase 2-like         166   4e-45   
ref|XP_008783332.1|  PREDICTED: alanine aminotransferase 2              167   4e-45   Phoenix dactylifera
emb|CEF68484.1|  Alanine aminotransferase 1                             166   7e-45   Strongyloides ratti
dbj|GAM23260.1|  hypothetical protein SAMD00019534_064350               167   8e-45   Acytostelium subglobosum LB1
ref|XP_008797360.1|  PREDICTED: alanine aminotransferase 2-like         166   1e-44   Phoenix dactylifera
gb|ETN63742.1|  alanine aminotransferase                                166   1e-44   Anopheles darlingi [American malaria mosquito]
ref|XP_008560719.1|  PREDICTED: alanine aminotransferase 1              167   1e-44   Microplitis demolitor
ref|XP_005775483.1|  alanine aminotransferase                           166   1e-44   Emiliania huxleyi CCMP1516
ref|XP_004342401.1|  alanine aminotransferase, mitochondrial, put...    166   2e-44   Acanthamoeba castellanii str. Neff
ref|XP_009389580.1|  PREDICTED: alanine aminotransferase 2-like         165   2e-44   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN77825.1|  Alanine aminotransferase 1                              166   2e-44   Toxocara canis
ref|XP_011398130.1|  putative alanine aminotransferase, mitochond...    164   3e-44   Auxenochlorella protothecoides
gb|AAK59591.2|  putative alanine aminotransferase                       165   4e-44   Arabidopsis thaliana [mouse-ear cress]
gb|ADB91976.1|  alanine aminotransferase                                164   4e-44   Branchiostoma belcheri
ref|NP_001185380.1|  alanine aminotransferase 2                         165   4e-44   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565040.2|  alanine aminotransferase 2                            165   4e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009515714.1|  hypothetical protein PHYSODRAFT_476244             164   4e-44   Phytophthora sojae
ref|XP_001660470.1|  AAEL009872-PA                                      165   5e-44   
ref|XP_008869166.1|  hypothetical protein H310_06043                    164   5e-44   Aphanomyces invadans
ref|XP_010939850.1|  PREDICTED: alanine aminotransferase 2 isofor...    160   5e-44   
ref|XP_010415979.1|  PREDICTED: alanine aminotransferase 2, mitoc...    165   5e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010428116.1|  PREDICTED: alanine aminotransferase 2, mitoc...    164   6e-44   Camelina sativa [gold-of-pleasure]
gb|EYC32542.1|  hypothetical protein Y032_0003g1641                     164   8e-44   Ancylostoma ceylanicum
ref|XP_010937250.1|  PREDICTED: alanine aminotransferase 2              164   9e-44   Elaeis guineensis
gb|ETK88933.1|  hypothetical protein L915_06890                         158   1e-43   Phytophthora parasitica
emb|CCI42079.1|  unnamed protein product                                163   1e-43   Albugo candida
ref|XP_008120969.1|  PREDICTED: alanine aminotransferase 1-like         163   1e-43   Anolis carolinensis [Carolina anole]
gb|ENN78579.1|  hypothetical protein YQE_04947                          163   1e-43   Dendroctonus ponderosae
gb|EYC32543.1|  hypothetical protein Y032_0003g1641                     163   1e-43   Ancylostoma ceylanicum
ref|NP_001016805.1|  alanine aminotransferase 2                         163   2e-43   Xenopus tropicalis [western clawed frog]
gb|KJB68683.1|  hypothetical protein B456_011G0552001                   159   2e-43   Gossypium raimondii
ref|XP_003055208.1|  predicted protein                                  162   2e-43   Micromonas pusilla CCMP1545
gb|ETL42327.1|  hypothetical protein L916_06840                         155   2e-43   Phytophthora parasitica
gb|KGB32667.1|  Alanine aminotransferase 2                              162   2e-43   Schistosoma haematobium
ref|XP_005847240.1|  hypothetical protein CHLNCDRAFT_57929              163   2e-43   Chlorella variabilis
gb|KJB68682.1|  hypothetical protein B456_011G0552001                   159   2e-43   Gossypium raimondii
ref|XP_003573850.1|  PREDICTED: alanine aminotransferase 2              162   2e-43   Brachypodium distachyon [annual false brome]
ref|XP_006634237.1|  PREDICTED: alanine aminotransferase 2-like         162   3e-43   
ref|XP_009380146.1|  PREDICTED: alanine aminotransferase 2-like         162   3e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008800517.1|  PREDICTED: alanine aminotransferase 2-like         162   3e-43   
ref|XP_004303756.1|  PREDICTED: alanine aminotransferase 2              162   4e-43   Fragaria vesca subsp. vesca
gb|KFB49063.1|  AGAP000901-PA-like protein                              162   4e-43   Anopheles sinensis
ref|XP_008150574.1|  PREDICTED: alanine aminotransferase 2 isofor...    161   4e-43   
gb|ELK29365.1|  Alanine aminotransferase 2                              160   4e-43   Myotis davidii
sp|P52894.1|ALA2_HORVU  RecName: Full=Alanine aminotransferase 2;...    161   6e-43   Hordeum vulgare [barley]
ref|XP_010235387.1|  PREDICTED: alanine aminotransferase 2-like i...    161   6e-43   Brachypodium distachyon [annual false brome]
ref|XP_002681562.1|  alanine aminotransferase                           161   6e-43   Naegleria gruberi strain NEG-M
ref|XP_010471259.1|  PREDICTED: alanine aminotransferase 2, mitoc...    162   7e-43   Camelina sativa [gold-of-pleasure]
ref|XP_008150573.1|  PREDICTED: alanine aminotransferase 2 isofor...    161   7e-43   Eptesicus fuscus
dbj|BAN21041.1|  alanine aminotransferase                               161   7e-43   Riptortus pedestris
ref|XP_010939849.1|  PREDICTED: alanine aminotransferase 2 isofor...    160   8e-43   Elaeis guineensis
gb|ADE77246.1|  unknown                                                 157   8e-43   Picea sitchensis
gb|ETI43741.1|  hypothetical protein F443_11357                         160   8e-43   Phytophthora parasitica P1569
ref|XP_002970914.1|  hypothetical protein SELMODRAFT_94316              161   9e-43   
ref|XP_002969652.1|  hypothetical protein SELMODRAFT_91640              161   9e-43   
pdb|3TCM|A  Chain A, Crystal Structure Of Alanine Aminotransferas...    160   9e-43   Hordeum vulgare [barley]
ref|XP_004510570.1|  PREDICTED: alanine aminotransferase 2, mitoc...    161   9e-43   Cicer arietinum [garbanzo]
gb|KDD76740.1|  aminotransferase                                        160   1e-42   Helicosporidium sp. ATCC 50920
emb|CCD81366.1|  putative alanine aminotransferase                      160   1e-42   Schistosoma mansoni
gb|KDR12685.1|  Alanine aminotransferase 2                              161   1e-42   Zootermopsis nevadensis
ref|XP_004235528.1|  PREDICTED: alanine aminotransferase 2, mitoc...    160   1e-42   
ref|XP_009515719.1|  hypothetical protein PHYSODRAFT_477603             160   1e-42   Phytophthora sojae
ref|XP_010318452.1|  PREDICTED: alanine aminotransferase 2, mitoc...    160   1e-42   Solanum lycopersicum
ref|XP_003429759.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    160   1e-42   
ref|XP_006105500.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    160   1e-42   
ref|XP_637993.1|  alanine transaminase                                  160   1e-42   Dictyostelium discoideum AX4
ref|XP_002166762.2|  PREDICTED: alanine aminotransferase 2-like         159   1e-42   
ref|XP_011036545.1|  PREDICTED: alanine aminotransferase 2-like         160   1e-42   Populus euphratica
ref|XP_010939848.1|  PREDICTED: alanine aminotransferase 2 isofor...    160   2e-42   Elaeis guineensis
ref|XP_005880402.1|  PREDICTED: alanine aminotransferase 2              161   2e-42   
gb|KHN39571.1|  Alanine aminotransferase 2, mitochondrial               160   2e-42   Glycine soja [wild soybean]
gb|ESA18192.1|  hypothetical protein GLOINDRAFT_334935                  160   2e-42   
gb|EXX69945.1|  alanine transaminase ALT1                               160   2e-42   Rhizophagus irregularis DAOM 197198w
ref|XP_010235383.1|  PREDICTED: alanine aminotransferase 2-like i...    160   2e-42   Brachypodium distachyon [annual false brome]
ref|XP_009826737.1|  hypothetical protein H257_04062                    159   2e-42   Aphanomyces astaci
ref|XP_001660471.1|  AAEL009875-PA                                      158   2e-42   
ref|XP_006530622.1|  PREDICTED: alanine aminotransferase 2 isofor...    155   2e-42   Mus musculus [mouse]
ref|XP_007548658.1|  PREDICTED: alanine aminotransferase 2-like i...    160   2e-42   Poecilia formosa
gb|KHG30536.1|  Alanine aminotransferase 2, mitochondrial -like p...    159   2e-42   Gossypium arboreum [tree cotton]
ref|XP_006746371.1|  PREDICTED: alanine aminotransferase 1              155   3e-42   Leptonychotes weddellii
gb|ETP13552.1|  hypothetical protein F441_11274                         159   3e-42   Phytophthora parasitica CJ01A1
ref|XP_001622550.1|  hypothetical protein NEMVEDRAFT_v1g236165          159   3e-42   Nematostella vectensis
ref|XP_008157904.1|  PREDICTED: alanine aminotransferase 1              159   3e-42   Eptesicus fuscus
ref|XP_007548657.1|  PREDICTED: alanine aminotransferase 2-like i...    160   3e-42   Poecilia formosa
ref|XP_008620886.1|  alanine transaminase                               159   3e-42   Saprolegnia diclina VS20
ref|XP_002826439.1|  PREDICTED: alanine aminotransferase 2              152   3e-42   
gb|KHN72520.1|  Alanine aminotransferase 2                              159   4e-42   Toxocara canis
ref|XP_009557985.1|  PREDICTED: alanine aminotransferase 2-like         158   4e-42   Cuculus canorus
ref|XP_006764960.1|  PREDICTED: alanine aminotransferase 2              160   4e-42   
ref|XP_008462239.1|  PREDICTED: alanine aminotransferase 1, mitoc...    159   4e-42   Cucumis melo [Oriental melon]
ref|XP_004580835.1|  PREDICTED: alanine aminotransferase 1              159   4e-42   Ochotona princeps [southern American pika]
ref|XP_001660472.1|  AAEL009875-PB                                      158   4e-42   
ref|XP_003228933.1|  PREDICTED: alanine aminotransferase 1-like         159   4e-42   Anolis carolinensis [Carolina anole]
ref|XP_007024768.1|  Alanine aminotransferase 2                         159   4e-42   
ref|XP_007547926.1|  PREDICTED: alanine aminotransferase 1              159   5e-42   Poecilia formosa
ref|XP_010884988.1|  PREDICTED: alanine aminotransferase 2-like i...    159   5e-42   Esox lucius
ref|XP_008436808.1|  PREDICTED: alanine aminotransferase 1              159   5e-42   Poecilia reticulata
ref|XP_002112002.1|  hypothetical protein TRIADDRAFT_50189              158   5e-42   Trichoplax adhaerens
ref|XP_005800011.1|  PREDICTED: alanine aminotransferase 2-like i...    159   5e-42   
gb|KFO75258.1|  Alanine aminotransferase 2                              158   5e-42   Cuculus canorus
emb|CDQ55985.1|  unnamed protein product                                151   6e-42   Oncorhynchus mykiss
ref|XP_009939421.1|  PREDICTED: alanine aminotransferase 2              157   6e-42   Opisthocomus hoazin [hoatzin]
gb|EMT23015.1|  Alanine aminotransferase 2                              159   6e-42   
gb|AHW58022.1|  alanine aminotransferase 1                              159   6e-42   Sogatella furcifera
gb|KFR15864.1|  Alanine aminotransferase 2                              157   6e-42   Opisthocomus hoazin [hoatzin]
gb|AIT69922.1|  alanine transaminase                                    159   6e-42   Sargassum fusiforme
emb|CCA27196.1|  unnamed protein product                                159   6e-42   Albugo laibachii Nc14
ref|XP_004166923.1|  PREDICTED: alanine aminotransferase 2, mitoc...    158   6e-42   
ref|XP_004144444.1|  PREDICTED: alanine aminotransferase 2, mitoc...    159   6e-42   
ref|XP_316880.5|  AGAP000901-PA                                         159   6e-42   Anopheles gambiae str. PEST
ref|XP_010096539.1|  Alanine aminotransferase 2                         159   6e-42   Morus notabilis
ref|XP_006300438.1|  hypothetical protein CARUB_v10020102mg             159   7e-42   
gb|AHJ25706.1|  GPT2                                                    152   7e-42   
gb|KGN58474.1|  hypothetical protein Csa_3G646610                       159   7e-42   
ref|XP_008460348.1|  PREDICTED: alanine aminotransferase 2, mitoc...    159   7e-42   
gb|EMS46317.1|  Alanine aminotransferase 2                              159   7e-42   
ref|XP_005608301.1|  PREDICTED: alanine aminotransferase 2 isofor...    157   7e-42   
ref|XP_009079156.1|  PREDICTED: alanine aminotransferase 2              155   7e-42   
ref|XP_005514471.1|  PREDICTED: alanine aminotransferase 2-like         157   7e-42   
ref|XP_005800010.1|  PREDICTED: alanine aminotransferase 2-like i...    159   8e-42   
ref|XP_010884980.1|  PREDICTED: alanine aminotransferase 2-like i...    159   8e-42   
ref|XP_008228107.1|  PREDICTED: alanine aminotransferase 2, mitoc...    159   8e-42   
ref|XP_011372050.1|  PREDICTED: alanine aminotransferase 2              156   8e-42   
ref|XP_008460347.1|  PREDICTED: alanine aminotransferase 2-like i...    159   8e-42   
ref|XP_007217248.1|  hypothetical protein PRUPE_ppa003850mg             159   8e-42   
ref|XP_010113991.1|  PREDICTED: alanine aminotransferase 2              157   8e-42   
ref|XP_010015482.1|  PREDICTED: alanine aminotransferase 2              157   8e-42   
gb|KFP35282.1|  Alanine aminotransferase 2                              157   9e-42   
gb|KFQ52041.1|  Alanine aminotransferase 2                              157   9e-42   
ref|XP_001745052.1|  hypothetical protein                               157   9e-42   
ref|XP_011079322.1|  PREDICTED: alanine aminotransferase 2-like         158   9e-42   
ref|XP_010078751.1|  PREDICTED: alanine aminotransferase 2              155   1e-41   
ref|XP_008507870.1|  PREDICTED: alanine aminotransferase 2 isofor...    157   1e-41   
gb|KDO24164.1|  hypothetical protein SPRG_10592                         158   1e-41   
ref|XP_006342897.1|  PREDICTED: alanine aminotransferase 2, mitoc...    158   1e-41   
gb|EMC77259.1|  Alanine aminotransferase 2                              157   1e-41   
ref|XP_001372290.1|  PREDICTED: alanine aminotransferase 1 isofor...    157   1e-41   
ref|XP_005490144.1|  PREDICTED: alanine aminotransferase 2              157   1e-41   
gb|KFV00293.1|  Alanine aminotransferase 2                              154   1e-41   
ref|XP_007135364.1|  hypothetical protein PHAVU_010G123200g             158   1e-41   
ref|XP_005608300.1|  PREDICTED: alanine aminotransferase 2 isofor...    157   1e-41   
ref|XP_010193171.1|  PREDICTED: alanine aminotransferase 2              156   1e-41   
ref|XP_004356702.1|  alanine aminotransferase, mitochondrial, put...    157   1e-41   
ref|XP_010394851.1|  PREDICTED: alanine aminotransferase 2              156   1e-41   
ref|XP_007488862.1|  PREDICTED: alanine aminotransferase 1 isofor...    157   1e-41   
ref|XP_005426315.1|  PREDICTED: alanine aminotransferase 2              156   1e-41   
gb|KFQ20610.1|  Alanine aminotransferase 2                              157   1e-41   
ref|NP_572879.2|  CG1640, isoform A                                     158   1e-41   
gb|AAL39959.1|  SD05601p                                                158   1e-41   
ref|XP_004141733.1|  PREDICTED: alanine aminotransferase 2, mitoc...    157   1e-41   
ref|XP_004155894.1|  PREDICTED: alanine aminotransferase 2, mitoc...    157   1e-41   
ref|XP_006828623.1|  hypothetical protein AMTR_s00129p00080070          156   1e-41   
ref|XP_002042929.1|  GM11628                                            158   1e-41   
gb|KFZ65228.1|  Alanine aminotransferase 2                              156   1e-41   
ref|XP_009976045.1|  PREDICTED: alanine aminotransferase 2              156   1e-41   
gb|KFU99477.1|  Alanine aminotransferase 2                              157   1e-41   
ref|XP_002106853.1|  GD17120                                            158   2e-41   
ref|XP_009274977.1|  PREDICTED: alanine aminotransferase 2              156   2e-41   
ref|XP_010151513.1|  PREDICTED: alanine aminotransferase 2              156   2e-41   
ref|XP_006342898.1|  PREDICTED: alanine aminotransferase 2, mitoc...    157   2e-41   
ref|XP_008499534.1|  PREDICTED: alanine aminotransferase 2              157   2e-41   
ref|XP_001769989.1|  predicted protein                                  157   2e-41   
ref|XP_004600748.1|  PREDICTED: alanine aminotransferase 2              157   2e-41   
ref|XP_008432758.1|  PREDICTED: alanine aminotransferase 2-like         158   2e-41   
ref|NP_727696.2|  CG1640, isoform B                                     158   2e-41   
ref|XP_009899311.1|  PREDICTED: alanine aminotransferase 1              156   2e-41   
gb|KFV67752.1|  Alanine aminotransferase 2                              156   2e-41   
ref|XP_005608298.1|  PREDICTED: alanine aminotransferase 2 isofor...    157   2e-41   
ref|XP_006530621.1|  PREDICTED: alanine aminotransferase 2 isofor...    155   2e-41   
ref|XP_005526440.1|  PREDICTED: alanine aminotransferase 2 isofor...    157   2e-41   
gb|EYU45916.1|  hypothetical protein MIMGU_mgv1a005454mg                157   2e-41   
gb|KFQ54613.1|  Alanine aminotransferase 2                              156   2e-41   
ref|XP_010285870.1|  PREDICTED: alanine aminotransferase 2              156   2e-41   
ref|XP_009700544.1|  PREDICTED: alanine aminotransferase 2              156   2e-41   
gb|KFP59082.1|  Alanine aminotransferase 2                              156   2e-41   
ref|XP_010716082.1|  PREDICTED: alanine aminotransferase 2              155   2e-41   
ref|XP_009487594.1|  PREDICTED: alanine aminotransferase 2              156   2e-41   
ref|XP_001490415.3|  PREDICTED: alanine aminotransferase 2 isofor...    157   2e-41   
gb|KFP49490.1|  Alanine aminotransferase 2                              155   2e-41   
ref|XP_009265680.1|  hypothetical protein J056_000007                   157   2e-41   
ref|XP_010166043.1|  PREDICTED: alanine aminotransferase 2              155   2e-41   
gb|ACJ85860.1|  unknown                                                 157   2e-41   
ref|XP_009816631.1|  PREDICTED: alanine aminotransferase 2              155   2e-41   
ref|XP_006426798.1|  hypothetical protein CICLE_v10025334mg             157   2e-41   
gb|KFQ05762.1|  Alanine aminotransferase 2                              156   2e-41   
ref|XP_009571057.1|  PREDICTED: alanine aminotransferase 2              155   2e-41   
gb|KFV58998.1|  Alanine aminotransferase 2                              156   2e-41   
ref|XP_004944250.1|  PREDICTED: alanine aminotransferase 2 isofor...    156   2e-41   
gb|KFQ69505.1|  Alanine aminotransferase 2                              156   2e-41   
gb|KFZ58051.1|  Alanine aminotransferase 2                              156   2e-41   
gb|ERG84738.1|  alanine aminotransferase 2-like protein                 157   2e-41   
ref|XP_005052721.1|  PREDICTED: alanine aminotransferase 2 isofor...    157   2e-41   
ref|XP_006426797.1|  hypothetical protein CICLE_v10025334mg             157   2e-41   
ref|XP_008246599.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    157   2e-41   
ref|XP_010140032.1|  PREDICTED: alanine aminotransferase 2              155   3e-41   
ref|XP_006641441.1|  PREDICTED: alanine aminotransferase 2-like         157   3e-41   
ref|XP_011260421.1|  PREDICTED: alanine aminotransferase 1              157   3e-41   
ref|XP_003627448.1|  Alanine aminotransferase                           157   3e-41   
ref|XP_009920931.1|  PREDICTED: alanine aminotransferase 2              155   3e-41   
ref|XP_008053205.1|  PREDICTED: alanine aminotransferase 2              156   3e-41   
gb|KFP94695.1|  Alanine aminotransferase 2                              156   3e-41   
gb|KFP06658.1|  Alanine aminotransferase 2                              157   3e-41   
ref|XP_005233896.1|  PREDICTED: alanine aminotransferase 2              155   3e-41   
emb|CDS24338.1|  alanine aminotransferase 2                             157   3e-41   
ref|XP_002194653.1|  PREDICTED: alanine aminotransferase 2              157   3e-41   
ref|XP_005526439.1|  PREDICTED: alanine aminotransferase 2 isofor...    157   3e-41   
gb|EFN75006.1|  Alanine aminotransferase 2                              157   3e-41   
gb|KFO93213.1|  Alanine aminotransferase 2                              156   3e-41   
ref|XP_006908800.1|  PREDICTED: alanine aminotransferase 2              155   3e-41   
ref|XP_010199869.1|  PREDICTED: alanine aminotransferase 2              155   3e-41   
ref|XP_002430266.1|  Alanine aminotransferase, putative                 156   3e-41   
ref|XP_011072689.1|  PREDICTED: alanine aminotransferase 2              157   3e-41   
ref|XP_009461778.1|  PREDICTED: alanine aminotransferase 2 isofor...    156   3e-41   
ref|XP_008637027.1|  PREDICTED: alanine aminotransferase 2              157   3e-41   
emb|CDS30789.1|  gag pol polyprotein                                    156   3e-41   
gb|KFO63157.1|  Alanine aminotransferase 2                              157   3e-41   
ref|XP_008936281.1|  PREDICTED: alanine aminotransferase 2              155   4e-41   
ref|XP_006121251.1|  PREDICTED: alanine aminotransferase 2              157   4e-41   
ref|XP_010628764.1|  PREDICTED: alanine aminotransferase 1              156   4e-41   
gb|KFM05788.1|  Alanine aminotransferase 2                              157   4e-41   
gb|KFP31561.1|  Alanine aminotransferase 2                              155   4e-41   
ref|XP_004400797.1|  PREDICTED: alanine aminotransferase 1              156   4e-41   
gb|KFW64540.1|  Alanine aminotransferase 2                              157   4e-41   
gb|KFO06425.1|  Alanine aminotransferase 2                              155   4e-41   
ref|XP_003757274.1|  PREDICTED: alanine aminotransferase 2              156   4e-41   
gb|AET06148.1|  PLP-dependent aminotransferase                          156   4e-41   
ref|XP_008584771.1|  PREDICTED: alanine aminotransferase 2              156   4e-41   
ref|XP_010309159.1|  PREDICTED: alanine aminotransferase 2              155   4e-41   
ref|XP_011226825.1|  PREDICTED: alanine aminotransferase 1 isofor...    156   4e-41   
ref|XP_005318527.1|  PREDICTED: alanine aminotransferase 2              155   4e-41   
gb|KFQ16813.1|  Alanine aminotransferase 2                              155   4e-41   
ref|XP_007537772.1|  PREDICTED: alanine aminotransferase 2 isofor...    156   4e-41   
ref|XP_004664888.1|  PREDICTED: alanine aminotransferase 2              156   4e-41   
ref|XP_009676627.1|  PREDICTED: alanine aminotransferase 2              155   4e-41   
gb|KFV83100.1|  Alanine aminotransferase 2                              156   4e-41   
gb|AIT69918.1|  alanine transaminase                                    156   4e-41   
gb|KFQ82063.1|  Alanine aminotransferase 2                              155   5e-41   
gb|KDO53767.1|  hypothetical protein CISIN_1g009517mg                   156   5e-41   
ref|XP_005141728.1|  PREDICTED: alanine aminotransferase 2              155   5e-41   
ref|XP_006465804.1|  PREDICTED: alanine aminotransferase 2, mitoc...    156   5e-41   
ref|XP_414111.3|  PREDICTED: alanine aminotransferase 2 isoform X2      156   5e-41   
ref|XP_006729760.1|  PREDICTED: alanine aminotransferase 2 isofor...    156   5e-41   
ref|XP_010884160.1|  PREDICTED: alanine aminotransferase 1 isofor...    155   6e-41   
ref|XP_011499275.1|  PREDICTED: alanine aminotransferase 2              156   6e-41   
ref|XP_003802370.1|  PREDICTED: alanine aminotransferase 1              155   6e-41   
gb|KHJ47772.1|  aminotransferase, class I/II                            156   6e-41   
ref|XP_006034404.1|  PREDICTED: alanine aminotransferase 2              154   6e-41   
gb|ELK15350.1|  Alanine aminotransferase 2                              156   6e-41   
gb|KFQ95766.1|  Alanine aminotransferase 2                              156   6e-41   
emb|CDI98892.1|  alanine aminotransferase 2                             156   6e-41   
ref|XP_010221695.1|  PREDICTED: alanine aminotransferase 2              154   6e-41   
ref|XP_001363190.1|  PREDICTED: alanine aminotransferase 2 isofor...    156   6e-41   
ref|XP_005664519.1|  PREDICTED: alanine aminotransferase 2 isofor...    156   6e-41   
ref|XP_007537771.1|  PREDICTED: alanine aminotransferase 2 isofor...    156   7e-41   
ref|XP_002760962.1|  PREDICTED: alanine aminotransferase 2              156   7e-41   
ref|XP_008700888.1|  PREDICTED: alanine aminotransferase 2              155   7e-41   
ref|XP_009088853.1|  PREDICTED: alanine aminotransferase 2              154   7e-41   
gb|KGL83280.1|  Alanine aminotransferase 2                              155   7e-41   
ref|XP_009636322.1|  PREDICTED: alanine aminotransferase 2              154   7e-41   
ref|XP_006191406.1|  PREDICTED: alanine aminotransferase 2              155   7e-41   
gb|KFP15258.1|  Alanine aminotransferase 2                              155   7e-41   
gb|AIT69930.1|  alanine transaminase                                    155   7e-41   
ref|XP_011235435.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    155   8e-41   
gb|EIE85592.1|  hypothetical protein RO3G_10302                         155   8e-41   
ref|NP_001012057.1|  alanine aminotransferase 2                         155   8e-41   
ref|XP_011373236.1|  PREDICTED: alanine aminotransferase 1              154   9e-41   
ref|XP_007474882.1|  PREDICTED: alanine aminotransferase 2 isofor...    156   9e-41   
ref|XP_004690373.1|  PREDICTED: alanine aminotransferase 2              155   9e-41   
ref|XP_005401471.1|  PREDICTED: alanine aminotransferase 2-like i...    154   9e-41   
ref|XP_011226824.1|  PREDICTED: alanine aminotransferase 1 isofor...    156   9e-41   
ref|XP_004472119.1|  PREDICTED: alanine aminotransferase 1              155   9e-41   
gb|KFD51767.1|  hypothetical protein M513_07294                         156   9e-41   
ref|XP_006186085.1|  PREDICTED: alanine aminotransferase 1              154   9e-41   
gb|EMP35918.1|  Alanine aminotransferase 2                              155   9e-41   
gb|KDE04574.1|  hypothetical protein MVLG_05042                         156   9e-41   
gb|KFO69634.1|  Alanine aminotransferase 2                              155   9e-41   
ref|XP_006887880.1|  PREDICTED: alanine aminotransferase 2              155   1e-40   
ref|XP_008903570.1|  hypothetical protein PPTG_10079                    155   1e-40   
ref|XP_008931733.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    154   1e-40   
ref|XP_010776891.1|  PREDICTED: alanine aminotransferase 2-like         154   1e-40   
ref|XP_009555221.1|  PREDICTED: alanine aminotransferase 2              155   1e-40   
gb|AIT69935.1|  alanine transaminase                                    155   1e-40   
ref|XP_007059708.1|  PREDICTED: alanine aminotransferase 2              155   1e-40   
ref|XP_002739142.1|  PREDICTED: alanine aminotransferase 2-like         155   1e-40   
ref|XP_009904992.1|  PREDICTED: alanine aminotransferase 2              155   1e-40   
gb|AAH34219.1|  Glutamic pyruvate transaminase (alanine aminotran...    155   1e-40   
ref|XP_005401470.1|  PREDICTED: alanine aminotransferase 2-like i...    154   1e-40   
ref|XP_010884157.1|  PREDICTED: alanine aminotransferase 1 isofor...    155   1e-40   
ref|XP_006172385.1|  PREDICTED: LOW QUALITY PROTEIN: glutamic-pyr...    154   1e-40   
ref|XP_008827853.1|  PREDICTED: alanine aminotransferase 2 isofor...    154   1e-40   
gb|AIT69941.1|  alanine transaminase                                    155   1e-40   
ref|NP_776291.1|  alanine aminotransferase 2                            155   1e-40   
ref|XP_004744170.1|  PREDICTED: alanine aminotransferase 2 isofor...    155   1e-40   
ref|XP_002158641.1|  PREDICTED: alanine aminotransferase 2-like         154   1e-40   
ref|XP_004265286.1|  PREDICTED: alanine aminotransferase 1              155   1e-40   
ref|XP_005401469.1|  PREDICTED: alanine aminotransferase 2-like i...    154   1e-40   
ref|XP_006261713.1|  PREDICTED: alanine aminotransferase 2              154   1e-40   
ref|XP_004403733.1|  PREDICTED: alanine aminotransferase 2              155   1e-40   
ref|XP_010842208.1|  PREDICTED: alanine aminotransferase 2              154   1e-40   
ref|XP_004324928.1|  PREDICTED: alanine aminotransferase 2              154   1e-40   
ref|XP_004583880.1|  PREDICTED: alanine aminotransferase 2 isofor...    154   1e-40   
gb|KFV72169.1|  Alanine aminotransferase 2                              155   1e-40   
ref|XP_010959534.1|  PREDICTED: alanine aminotransferase 1              154   2e-40   
ref|XP_006971818.1|  PREDICTED: alanine aminotransferase 2 isofor...    155   2e-40   
ref|XP_006971817.1|  PREDICTED: alanine aminotransferase 2 isofor...    155   2e-40   
ref|XP_004227217.1|  PREDICTED: alanine aminotransferase 2              155   2e-40   
ref|XP_004443056.1|  PREDICTED: alanine aminotransferase 1              154   2e-40   
gb|EDL11016.1|  glutamic pyruvate transaminase (alanine aminotran...    155   2e-40   
ref|XP_004235527.1|  PREDICTED: alanine aminotransferase 2-like         155   2e-40   
ref|XP_004629253.1|  PREDICTED: alanine aminotransferase 2              155   2e-40   
ref|XP_003127043.1|  PREDICTED: alanine aminotransferase 2 isofor...    155   2e-40   
gb|KHJ79030.1|  hypothetical protein OESDEN_21333                       146   2e-40   
ref|XP_010997044.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    154   2e-40   
ref|XP_007439806.1|  PREDICTED: alanine aminotransferase 2              153   2e-40   
ref|XP_004697404.1|  PREDICTED: alanine aminotransferase 1              154   2e-40   
ref|XP_008283496.1|  PREDICTED: alanine aminotransferase 2-like i...    154   2e-40   
ref|XP_006207932.1|  PREDICTED: alanine aminotransferase 2              154   2e-40   
ref|XP_010346117.1|  PREDICTED: alanine aminotransferase 2              155   2e-40   
ref|XP_003792568.1|  PREDICTED: alanine aminotransferase 2              154   2e-40   
ref|XP_010812871.1|  PREDICTED: alanine aminotransferase 2 isofor...    153   2e-40   
ref|XP_005024206.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    153   2e-40   
ref|XP_004371688.1|  PREDICTED: alanine aminotransferase 2              154   2e-40   
ref|XP_008283495.1|  PREDICTED: alanine aminotransferase 2-like i...    154   2e-40   
gb|AFK39904.1|  unknown                                                 154   3e-40   
ref|XP_005289905.1|  PREDICTED: alanine aminotransferase 2              154   3e-40   
ref|XP_004779455.1|  PREDICTED: alanine aminotransferase 1 isofor...    154   3e-40   
ref|XP_005367071.1|  PREDICTED: alanine aminotransferase 2              154   3e-40   
ref|XP_010685211.1|  PREDICTED: alanine aminotransferase 2              154   3e-40   
ref|XP_005809903.1|  PREDICTED: alanine aminotransferase 2-like         154   3e-40   
ref|XP_003978704.1|  PREDICTED: alanine aminotransferase 2-like         154   3e-40   
ref|XP_005395954.1|  PREDICTED: alanine aminotransferase 1              154   3e-40   
ref|XP_008283494.1|  PREDICTED: alanine aminotransferase 2-like i...    154   3e-40   



>ref|XP_008467047.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like, partial 
[Cucumis melo]
Length=238

 Score =   293 bits (751),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  568  PGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAM  389
            P QIF+GLMVNPPKPGDISYDQF+RESKGILESLR+RARIMTDGFNSCRNV+CNFTEGAM
Sbjct  87   PAQIFMGLMVNPPKPGDISYDQFIRESKGILESLRRRARIMTDGFNSCRNVICNFTEGAM  146

Query  388  YSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP  209
            YSFPQIRLPP+AIE A+ LGK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP
Sbjct  147  YSFPQIRLPPKAIEAAKKLGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP  206

Query  208  AEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            AEEDMP IM SFKKFND FM++YEDHRGYSRM
Sbjct  207  AEEDMPEIMASFKKFNDSFMEEYEDHRGYSRM  238



>ref|XP_004239121.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Solanum 
lycopersicum]
Length=481

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    PGQIF+GLMVNPPKPGDISYDQ+VRESKGILESLRKRA +M
Sbjct  311  PKAVEEIYKVASISLSPNVPGQIFMGLMVNPPKPGDISYDQYVRESKGILESLRKRAHMM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIETA  LGKAPDV YCL+LLEATGISTVP
Sbjct  371  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIETANKLGKAPDVLYCLRLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFM++YEDH+GYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMEKYEDHKGYSRM  481



>ref|XP_009623844.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
tomentosiformis]
Length=481

 Score =   300 bits (768),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 152/171 (89%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    PGQIF+GLMVNPPKPGDISYDQ+VRESKGILESLRKRA +M
Sbjct  311  PKSVEEIYKVASISLSPNVPGQIFMGLMVNPPKPGDISYDQYVRESKGILESLRKRAHMM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE A+ LGK PDV+YCL+LLEATGISTVP
Sbjct  371  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAAKKLGKVPDVFYCLRLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFNDEFM+QYEDHRGYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKFNDEFMEQYEDHRGYSRM  481



>ref|XP_006357614.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=481

 Score =   299 bits (766),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    PGQIF+GLMVNPPKPGDISYDQ+VRESKGILESLR+RA +M
Sbjct  311  PKAVEEIYKVASISLSPNVPGQIFMGLMVNPPKPGDISYDQYVRESKGILESLRRRAHMM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETA  LGKA DV+YCL+LLEATGISTVP
Sbjct  371  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETANKLGKAADVFYCLRLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFM++YEDH+GYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMEKYEDHKGYSRM  481



>ref|XP_009765091.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
sylvestris]
Length=481

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 152/171 (89%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    PGQIF+GLMVNPPKPGDISYDQ+VRESKGILESLRKRA +M
Sbjct  311  PKSVEEIYKVASISLSPNVPGQIFMGLMVNPPKPGDISYDQYVRESKGILESLRKRAHMM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+ LGK PDV+YCL+LLEATGISTVP
Sbjct  371  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKKLGKVPDVFYCLRLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFNDEFM+QYEDHRGYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKFNDEFMEQYEDHRGYSRM  481



>ref|XP_008340115.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
 ref|XP_008340116.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
Length=481

 Score =   297 bits (760),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P QIF+GLMVNPPKPGDISY+QF+RESKGILESLR+RARIM
Sbjct  311  PKTVDEIYKIASIALSPNVPAQIFMGLMVNPPKPGDISYEQFIRESKGILESLRRRARIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE AQ  GK  DV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAAQRAGKVADVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKFNDEFMDQYED RGYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKFNDEFMDQYEDQRGYSRM  481



>ref|XP_008389735.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Malus 
domestica]
Length=481

 Score =   296 bits (759),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    +++   L    P QIF+GLMVNPPKPGDISY+QF+RESKGILESLR+RA IM
Sbjct  311  PKTVDEIYKVVSIALSPNVPAQIFMGLMVNPPKPGDISYEQFIRESKGILESLRRRAHIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE A+  GK PDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAAKRAGKVPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKFNDEFMDQYED RGYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKFNDEFMDQYEDRRGYSRM  481



>ref|XP_008221924.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221925.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221927.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
Length=481

 Score =   296 bits (758),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P QIF+GLMVNPPKPGDISY+QFVRESKGILESLRKRARIM
Sbjct  311  PQTVDEIYKVASIALSPNVPAQIFMGLMVNPPKPGDISYEQFVRESKGILESLRKRARIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFN+CRNVVCNFTEGAMYSFPQIRLPPRAIE A+  GK  DV+YCLKLLEATGISTVP
Sbjct  371  TDGFNNCRNVVCNFTEGAMYSFPQIRLPPRAIEAAKRAGKVADVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKFNDEFM+QYEDHRGYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKFNDEFMEQYEDHRGYSRM  481



>ref|XP_009359228.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Pyrus x 
bretschneideri]
Length=481

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P QIF+GLMVNPPKPGDISY+QF+RESKGILESLR+RARIM
Sbjct  311  PKTVDEIYKIASIALSPNVPAQIFMGLMVNPPKPGDISYEQFIRESKGILESLRRRARIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE AQ  GK  DV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAAQRAGKVADVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKFN+EFMDQYED RGYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKFNNEFMDQYEDQRGYSRM  481



>ref|XP_004135487.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
Length=460

 Score =   294 bits (753),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -1

Query  571  CPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGA  392
             P QIF+GLMVNPPKPGDISYDQF+RESKGILESLR+RARIMTDGFNSCRNV+CNFTEGA
Sbjct  308  VPAQIFMGLMVNPPKPGDISYDQFIRESKGILESLRRRARIMTDGFNSCRNVICNFTEGA  367

Query  391  MYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  212
            MYSFPQIRLPP+AI+ A+ LGK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL
Sbjct  368  MYSFPQIRLPPKAIDAAKKLGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  427

Query  211  PAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            PAEEDMP IM SFKKFND FM++YEDHRGYSRM
Sbjct  428  PAEEDMPEIMTSFKKFNDSFMEEYEDHRGYSRM  460



>ref|XP_007222799.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
 gb|EMJ23998.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
Length=481

 Score =   295 bits (754),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P QIF+GLMVNPPKPGDISY+QFVRESKGILESLR+RARIM
Sbjct  311  PQTVDEIYKVASIALSPNVPAQIFMGLMVNPPKPGDISYEQFVRESKGILESLRRRARIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFN+CRN+VCNFTEGAMYSFPQIRLPPRAIE A+  GK  DV+YCLKLLEATGISTVP
Sbjct  371  TDGFNNCRNIVCNFTEGAMYSFPQIRLPPRAIEAAKRAGKVADVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKFNDEFM+QYEDHRGYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKFNDEFMEQYEDHRGYSRM  481



>ref|XP_010100388.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
 gb|EXB82522.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
Length=481

 Score =   294 bits (753),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -1

Query  571  CPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGA  392
             P QIFLGLMVNPP+PGDISY+Q+VRESKGILESLR+RA IMTDGFNSCRNVVCNFTEGA
Sbjct  329  VPAQIFLGLMVNPPRPGDISYEQYVRESKGILESLRRRASIMTDGFNSCRNVVCNFTEGA  388

Query  391  MYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  212
            MYSFPQIRLPP+AIE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEG+FHLRTTIL
Sbjct  389  MYSFPQIRLPPKAIEAAKRAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGMFHLRTTIL  448

Query  211  PAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            PAEEDMPAIMESFKKFNDEFM+QYEDHRGYSRM
Sbjct  449  PAEEDMPAIMESFKKFNDEFMEQYEDHRGYSRM  481



>gb|KDP26646.1| hypothetical protein JCGZ_17804 [Jatropha curcas]
Length=481

 Score =   294 bits (752),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P QIF+GLMVNPPKPGDISYDQFVRE KGILESLR+RAR+M
Sbjct  311  PKTVDEIYKVASVSLSPNVPAQIFMGLMVNPPKPGDISYDQFVREGKGILESLRRRARLM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+ LGK PDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKRLGKVPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEE+MPAIM SFKKFNDEFM+QYEDH GYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEEMPAIMSSFKKFNDEFMEQYEDHTGYSRM  481



>gb|KGN51765.1| hypothetical protein Csa_5G598730 [Cucumis sativus]
Length=481

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -1

Query  571  CPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGA  392
             P QIF+GLMVNPPKPGDISYDQF+RESKGILESLR+RARIMTDGFNSCRNV+CNFTEGA
Sbjct  329  VPAQIFMGLMVNPPKPGDISYDQFIRESKGILESLRRRARIMTDGFNSCRNVICNFTEGA  388

Query  391  MYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  212
            MYSFPQIRLPP+AI+ A+ LGK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL
Sbjct  389  MYSFPQIRLPPKAIDAAKKLGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  448

Query  211  PAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            PAEEDMP IM SFKKFND FM++YEDHRGYSRM
Sbjct  449  PAEEDMPEIMTSFKKFNDSFMEEYEDHRGYSRM  481



>gb|EYU28421.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
 gb|EYU28422.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
Length=480

 Score =   293 bits (749),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P QIF+GLMVNPPKPGDISY++F+RESKGILESLR+RA++M
Sbjct  310  PKAVEEIYKVASIALSPNVPAQIFMGLMVNPPKPGDISYERFIRESKGILESLRRRAQLM  369

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE AQ  GK  DV+YCLKLLEATGISTVP
Sbjct  370  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAQKAGKVADVFYCLKLLEATGISTVP  429

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKFNDEFM+QYEDH+GYSRM
Sbjct  430  GSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKFNDEFMEQYEDHKGYSRM  480



>emb|CDP13207.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   292 bits (748),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    PGQIF+GLMVNPPKPGDISY+++VRESK +LESLRKRA IM
Sbjct  311  PKSVEEIYKVASIALSPNVPGQIFMGLMVNPPKPGDISYERYVRESKAVLESLRKRAHIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK PDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKKAGKVPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFNDEFM+QYEDH+GYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEDMPAIMASFKKFNDEFMEQYEDHKGYSRM  481



>gb|KDO82251.1| hypothetical protein CISIN_1g041151mg [Citrus sinensis]
Length=463

 Score =   291 bits (745),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P QIF+GLMVNP KPGDISY+QFVRESKGILESLR+RAR+M
Sbjct  293  PKTVDEIYKIASIALSPNVPAQIFMGLMVNPLKPGDISYEQFVRESKGILESLRRRARMM  352

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK PDV+YCL+LLEATGISTVP
Sbjct  353  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKRAGKVPDVFYCLRLLEATGISTVP  412

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEG+FHLRTTILPAEEDMPAIMESFKKFNDEFM+QYED+RGYSRM
Sbjct  413  GSGFGQKEGIFHLRTTILPAEEDMPAIMESFKKFNDEFMEQYEDYRGYSRM  463



>ref|XP_003613139.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96097.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=481

 Score =   291 bits (746),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = -1

Query  571  CPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGA  392
             P QIF+GLM+NPPKPGDISYD+FVRESKG+LESLR+RARIMTDGFNSCRNVVCNFTEGA
Sbjct  329  VPAQIFMGLMINPPKPGDISYDRFVRESKGVLESLRRRARIMTDGFNSCRNVVCNFTEGA  388

Query  391  MYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  212
            MYSFPQI+LPP+A+ETA+  GKA DVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL
Sbjct  389  MYSFPQIKLPPKALETAKQAGKAADVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  448

Query  211  PAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            PAEE+MPAIM+SFKKFND+FM+QY+DHRGYSR+
Sbjct  449  PAEEEMPAIMDSFKKFNDDFMEQYDDHRGYSRL  481



>ref|XP_006438274.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438275.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438276.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438277.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438278.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006483938.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483939.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Citrus sinensis]
 ref|XP_006483940.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X3 [Citrus sinensis]
 gb|ESR51514.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51515.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51516.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51517.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51518.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
Length=481

 Score =   291 bits (744),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P QIF+GLMVNP KPGDISY+QFVRESKGILESLR+RAR+M
Sbjct  311  PKTVDEIYKIASIALSPNVPAQIFMGLMVNPLKPGDISYEQFVRESKGILESLRRRARMM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK PDV+YCL+LLEATGISTVP
Sbjct  371  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKRAGKVPDVFYCLRLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFM+QYED+RGYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMEQYEDYRGYSRM  481



>emb|CBI23368.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    PGQIFLG+MVNPP PGDISY QF+RESKGILESL++RA+IM
Sbjct  311  PQTVDEIYKVASISLSPNVPGQIFLGVMVNPPTPGDISYLQFMRESKGILESLKRRAQIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK  DV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKKAGKVADVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFM+QYEDHRGYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMEQYEDHRGYSRM  481



>ref|NP_001268094.1| uncharacterized protein LOC100261274 [Vitis vinifera]
 gb|AAZ43369.1| AlaT1 [Vitis vinifera]
Length=484

 Score =   290 bits (742),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    PGQIFLG+MVNPP PGDISY QF+RESKGILESLR+RA+IM
Sbjct  311  PQTVDEIYKVASISLSPNVPGQIFLGVMVNPPTPGDISYLQFMRESKGILESLRRRAQIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK  DV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKKAGKVADVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEE+MPAIMESFKKFNDEFM+QYEDHRGYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEEMPAIMESFKKFNDEFMEQYEDHRGYSRM  481



>ref|XP_010251104.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251105.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251106.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
Length=481

 Score =   290 bits (742),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P QIFLGLMVNPPKPGDISY +FV ESK IL+SLR+RA IM
Sbjct  311  PKTVDEIYKVASVSLSPNVPAQIFLGLMVNPPKPGDISYLKFVTESKAILDSLRRRAHIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE A+  GK PDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAAKNAGKVPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFNDEFM+QYEDHRGYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEDMPAIMASFKKFNDEFMEQYEDHRGYSRM  481



>ref|XP_004309987.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457416.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
Length=481

 Score =   289 bits (740),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P QIF+GLMVNPPKPGDISYDQF RESK ILESLR+RAR+M
Sbjct  311  PQTVDEIYKVASVALSPNVPAQIFMGLMVNPPKPGDISYDQFARESKEILESLRRRARLM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAI+ A+  GK PDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIQAAKSAGKVPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQK+GVFHLRTTILPAEEDMPAIM+SFKKFN+EFM+QYED RGYSRM
Sbjct  431  GSGFGQKDGVFHLRTTILPAEEDMPAIMDSFKKFNNEFMEQYEDDRGYSRM  481



>gb|AET06145.1| PLP-dependent aminotransferase [Papaver somniferum]
Length=480

 Score =   289 bits (739),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -1

Query  568  PGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAM  389
            PGQIFLGLMVNPPKPGDISY +FV+ESK ILESLRKRA IMT+GFNSCRNVVCNFTEGAM
Sbjct  329  PGQIFLGLMVNPPKPGDISYQKFVQESKTILESLRKRAHIMTNGFNSCRNVVCNFTEGAM  388

Query  388  YSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP  209
            YSFPQIRLPP+AIE A+  GK PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP
Sbjct  389  YSFPQIRLPPKAIEVAKMAGKVPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP  448

Query  208  AEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            AEEDMPAIM+SFKKFND FM+QYED RGYSRM
Sbjct  449  AEEDMPAIMDSFKKFNDAFMEQYEDQRGYSRM  480



>ref|XP_004489787.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Cicer arietinum]
Length=481

 Score =   288 bits (738),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -1

Query  571  CPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGA  392
             P QIF+GLMVNPPKPGDISY+Q++RESKGIL SLR+RARIMTDGFNSCRNVVCNFTEGA
Sbjct  329  VPAQIFMGLMVNPPKPGDISYEQYLRESKGILGSLRRRARIMTDGFNSCRNVVCNFTEGA  388

Query  391  MYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  212
            MYSFPQI LPP+A+ETA+  GKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL
Sbjct  389  MYSFPQIVLPPKALETAKQAGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  448

Query  211  PAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            PAEE+MPAIM+SFKKFND+FM+QYEDHRGYSR+
Sbjct  449  PAEEEMPAIMDSFKKFNDDFMEQYEDHRGYSRL  481



>ref|XP_011086618.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Sesamum indicum]
Length=478

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P QIF+GLMVNP KPGDISY+++VRESKGILESLR+RA+IM
Sbjct  308  PKTVEEIYKVASISLSPNVPAQIFMGLMVNPLKPGDISYERYVRESKGILESLRRRAQIM  367

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK  DV+YCLKLLEATGISTVP
Sbjct  368  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKKAGKVADVFYCLKLLEATGISTVP  427

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFNDEFM+QYEDHRGYSRM
Sbjct  428  GSGFGQKEGVFHLRTTILPAEEDMPAIMASFKKFNDEFMEQYEDHRGYSRM  478



>emb|CAN62302.1| hypothetical protein VITISV_023686 [Vitis vinifera]
Length=481

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    PGQIFLG+MVNPP PGDISY QF+RESKGILESL++RA+IM
Sbjct  311  PQTVDEIYKVASISLSPNVPGQIFLGVMVNPPTPGDISYLQFMRESKGILESLKRRAQIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK  DV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKKAGKVADVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEE MPAIMESFKKFNDEFM+QYEDHRGYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEXMPAIMESFKKFNDEFMEQYEDHRGYSRM  481



>ref|XP_004155366.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Cucumis sativus]
Length=481

 Score =   287 bits (735),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -1

Query  571  CPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGA  392
             P QIF+GLMVNPPKPGDISYDQF+RESKGILESLR+RARIMTDGFNSCRNV+CNFTEGA
Sbjct  329  VPAQIFMGLMVNPPKPGDISYDQFIRESKGILESLRRRARIMTDGFNSCRNVICNFTEGA  388

Query  391  MYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  212
            MYSFPQIRLPP+AI+ A+ LGK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL
Sbjct  389  MYSFPQIRLPPKAIDAAKKLGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  448

Query  211  PAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            PAEEDMP IM SFKKFND FM++YED  GYSRM
Sbjct  449  PAEEDMPEIMTSFKKFNDSFMEEYEDXWGYSRM  481



>ref|XP_003519649.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
2 [Glycine max]
 gb|KHN00386.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score =   287 bits (734),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -1

Query  571  CPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGA  392
             P QIF+G+M+NPP+PGDISYD+FVRES GILESLR+RARIMTDGFNSCRNVVCNFTEGA
Sbjct  329  VPAQIFMGVMLNPPQPGDISYDKFVRESTGILESLRRRARIMTDGFNSCRNVVCNFTEGA  388

Query  391  MYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  212
            MYSFPQIRLPPRA+E A+  GK PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL
Sbjct  389  MYSFPQIRLPPRALEAAKQAGKVPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  448

Query  211  PAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            PAEEDMP IM+SFKKFNDEFM+QYED RGYSR+
Sbjct  449  PAEEDMPDIMDSFKKFNDEFMEQYEDDRGYSRL  481



>ref|XP_010023477.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
 ref|XP_010023478.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
Length=481

 Score =   286 bits (732),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P QI +G+MV+PPKPGDISYD +VRESKGI+ESLR+RAR+M
Sbjct  311  PKTVDEIYKVASVSLSPNVPAQILMGMMVDPPKPGDISYDLYVRESKGIIESLRRRARMM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAI+ A+  GK PDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIQAAKQAGKVPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMP IM SFKKFNDEFM+QYEDHRGYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEDMPEIMASFKKFNDEFMEQYEDHRGYSRM  481



>ref|XP_010682426.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682427.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
Length=481

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  568  PGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAM  389
            PGQIFLGLMVNPPKPGDISY ++ +ESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAM
Sbjct  330  PGQIFLGLMVNPPKPGDISYLRYEQESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAM  389

Query  388  YSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP  209
            YSFPQI LPP+AIE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFH+RTTILP
Sbjct  390  YSFPQICLPPKAIEDAKKAGKHPDVFYCLKLLEATGISTVPGSGFGQKEGVFHMRTTILP  449

Query  208  AEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            AEEDMPAIM+SFKKFND FM+QYEDHRGYSRM
Sbjct  450  AEEDMPAIMDSFKKFNDAFMEQYEDHRGYSRM  481



>ref|XP_002312679.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
 gb|EEE90046.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
Length=481

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P QIF+GLMVNPPKPGDISY+QF+RESKGILESLR+RAR+M
Sbjct  311  PKAVDEIYKVASVSLSPNVPAQIFMGLMVNPPKPGDISYEQFIRESKGILESLRRRARMM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNV+CNFTEGAMYSFPQIRLPP+AI+ A+  GK PDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCRNVICNFTEGAMYSFPQIRLPPKAIDAAKMAGKVPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMP IM+SFKKFNDEFM+QYE H GYSR+
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEDMPEIMDSFKKFNDEFMEQYEGHGGYSRL  481



>ref|XP_009406515.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406516.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   284 bits (727),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -1

Query  571  CPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGA  392
             PGQIF+GLMVNP KPGDISY +FV ES  ILESL++RA IMTDGFNSCRNVVCNFTEGA
Sbjct  329  VPGQIFMGLMVNPLKPGDISYLRFVAESTAILESLKRRAHIMTDGFNSCRNVVCNFTEGA  388

Query  391  MYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  212
            MYSFPQIRLPPRAIE A+  GKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL
Sbjct  389  MYSFPQIRLPPRAIEAAKSAGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  448

Query  211  PAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            PAEEDMPAIM SFKKFNDEFM+QYED+RGYSRM
Sbjct  449  PAEEDMPAIMTSFKKFNDEFMEQYEDYRGYSRM  481



>gb|AAZ43368.1| AlaT1 [Vitis labrusca]
Length=477

 Score =   283 bits (725),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    PGQIFLG+MVNPP PGDISY QF+RESKGILESLR+RA+IM
Sbjct  311  PQTVDEIYKVASISLSPNVPGQIFLGVMVNPPTPGDISYLQFMRESKGILESLRRRAQIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK  DV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKKAGKVADVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRG  125
            GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFM+QYEDHRG
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMEQYEDHRG  477



>ref|NP_001237567.1| alanine aminotransferase 2 [Glycine max]
 gb|ABW17197.1| alanine aminotransferase 2 [Glycine max]
Length=481

 Score =   283 bits (725),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -1

Query  571  CPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGA  392
             P QIF+G+M++PP+PGDISYD+FVRES GILESLR+RAR+MTDGFNSCRNVVCNFTEGA
Sbjct  329  VPAQIFMGVMLHPPQPGDISYDKFVRESTGILESLRRRARLMTDGFNSCRNVVCNFTEGA  388

Query  391  MYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  212
            MYSFPQIRLPPRA+E A+  GK PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL
Sbjct  389  MYSFPQIRLPPRALEAAKQAGKVPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  448

Query  211  PAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            PAEEDMP IM+SFKKFNDEFM+QYED RGYSR+
Sbjct  449  PAEEDMPDIMDSFKKFNDEFMEQYEDDRGYSRL  481



>ref|XP_007158412.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
 gb|ESW30406.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
Length=481

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -1

Query  571  CPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGA  392
             P QIF+G+M+NP KPGDISYDQFVRES GILESLR+RAR+MTDGFNSCRNVVCNFTEGA
Sbjct  329  VPAQIFMGVMINPLKPGDISYDQFVRESNGILESLRRRARLMTDGFNSCRNVVCNFTEGA  388

Query  391  MYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  212
            MYSFPQIRLPPRAIE A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL
Sbjct  389  MYSFPQIRLPPRAIEAAKQAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  448

Query  211  PAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            PAEE+MPAIM+SFK FNDEFM+QYED+RGYSR+
Sbjct  449  PAEEEMPAIMDSFKNFNDEFMEQYEDNRGYSRL  481



>ref|XP_008789746.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
 ref|XP_008789747.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
Length=481

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  568  PGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAM  389
            PGQIFLGLMVNPPKPGDISY +FV+ESK +LESLR+RA+IMTDGFNSCRNVVCNFTEGAM
Sbjct  330  PGQIFLGLMVNPPKPGDISYLKFVQESKAVLESLRRRAQIMTDGFNSCRNVVCNFTEGAM  389

Query  388  YSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP  209
            YSFPQIRLPP+AIE A+  GKAPDV+YCL LLEATGISTVPGSGFGQKEGVFHLRTTILP
Sbjct  390  YSFPQIRLPPKAIEAARKAGKAPDVFYCLGLLEATGISTVPGSGFGQKEGVFHLRTTILP  449

Query  208  AEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            AEEDMPAIM SF+KFNDEFM+QYE+ RGYSRM
Sbjct  450  AEEDMPAIMASFRKFNDEFMEQYENCRGYSRM  481



>ref|XP_009413361.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009413362.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
Length=481

 Score =   282 bits (722),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -1

Query  568  PGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAM  389
            PGQIFLGLMVNPPKPGDISY +F  ES  ILESL++RA IMTDGFNSCRNVVCNFTEGAM
Sbjct  330  PGQIFLGLMVNPPKPGDISYLRFAAESNAILESLKRRAHIMTDGFNSCRNVVCNFTEGAM  389

Query  388  YSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP  209
            YSFPQIRLPP+AIE A+  GKAPDV+YCLKL+EATGISTVPGSGFGQKEGVFHLRTTILP
Sbjct  390  YSFPQIRLPPKAIEAAKRAGKAPDVFYCLKLVEATGISTVPGSGFGQKEGVFHLRTTILP  449

Query  208  AEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            AEE+MPAIM+SFKKFNDEFM+QYED+RGYSRM
Sbjct  450  AEEEMPAIMDSFKKFNDEFMEQYEDYRGYSRM  481



>gb|KHN14541.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score =   282 bits (721),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -1

Query  571  CPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGA  392
             P QIF+G+M++PP+PGDISYD+FVRES GILESLR+RAR+MTDGFNSCRNVVCNFTEGA
Sbjct  329  VPAQIFMGVMLHPPQPGDISYDKFVRESTGILESLRRRARLMTDGFNSCRNVVCNFTEGA  388

Query  391  MYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  212
            MYSFPQIRLPPRA+E A+  GK PDV+YCLKLLEATGISTVPGSGFGQ+EGVFHLRTTIL
Sbjct  389  MYSFPQIRLPPRALEAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQREGVFHLRTTIL  448

Query  211  PAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            P EEDMPAIM+SFKKFNDEFM+QYED+RGYSR+
Sbjct  449  PDEEDMPAIMDSFKKFNDEFMEQYEDNRGYSRL  481



>ref|XP_010927963.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Elaeis guineensis]
Length=481

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    PGQIFLGLMVNPPKPGDIS+ +FV ESK +LESLR+RA IM
Sbjct  311  PQTVDEIYKVASVSLSPNVPGQIFLGLMVNPPKPGDISHLKFVVESKAVLESLRRRAHIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQI LPP+AIE A+ +GKAPDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCRNVVCNFTEGAMYSFPQICLPPKAIEAAKKVGKAPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEE+MPAIM SFKKFNDEFM+QYED RGYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEEMPAIMASFKKFNDEFMEQYEDCRGYSRM  481



>ref|XP_006840828.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
 gb|ERN02503.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
Length=481

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -1

Query  571  CPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGA  392
             P QIF+GLMVNPPKPGDIS+ +F  ESK ILESLR+RARIMTDGFNSCRNVVCNFTEGA
Sbjct  329  VPAQIFMGLMVNPPKPGDISFMRFAAESKEILESLRRRARIMTDGFNSCRNVVCNFTEGA  388

Query  391  MYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  212
            MYSFPQIRLPP+AIE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL
Sbjct  389  MYSFPQIRLPPKAIEAAKRAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  448

Query  211  PAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            PAE+DMP IM SFKKFNDEFM+QYE HRGYSRM
Sbjct  449  PAEQDMPEIMASFKKFNDEFMEQYEHHRGYSRM  481



>ref|XP_009105727.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Brassica rapa]
Length=481

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  565  GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMY  386
             QIF+GLMV+PPKPGDISYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMY
Sbjct  331  AQIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMY  390

Query  385  SFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  206
            SFPQI+LPP+AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA
Sbjct  391  SFPQIKLPPKAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  450

Query  205  EEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            EE+MP IMESFKKFNDEFM QY D+ GYSRM
Sbjct  451  EEEMPEIMESFKKFNDEFMSQYGDNFGYSRM  481



>emb|CDY61225.1| BnaC06g43710D [Brassica napus]
Length=481

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  565  GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMY  386
             QIF+GLMV+PPKPGDISYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMY
Sbjct  331  AQIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMY  390

Query  385  SFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  206
            SFPQI+LPP+AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA
Sbjct  391  SFPQIKLPPKAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  450

Query  205  EEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            EE+MP IMESFKKFNDEFM QY D+ GYSRM
Sbjct  451  EEEMPEIMESFKKFNDEFMSQYGDNFGYSRM  481



>ref|NP_001237581.1| alanine aminotransferase 3 [Glycine max]
 gb|ABW17198.1| alanine aminotransferase 3 [Glycine max]
Length=480

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -1

Query  571  CPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGA  392
             P QIF+G+M++PP+PGDISYD+FVRES GILESLR+RAR+MTDGFNSCRNVVCNFTEGA
Sbjct  328  VPAQIFMGVMLHPPQPGDISYDKFVRESTGILESLRRRARLMTDGFNSCRNVVCNFTEGA  387

Query  391  MYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  212
            MYSFPQIRLPPRA+E A+   K PDV+YCLKLLEATGISTVPGSGFGQ+EGVFHLRTTIL
Sbjct  388  MYSFPQIRLPPRALEAAKQAAKVPDVFYCLKLLEATGISTVPGSGFGQREGVFHLRTTIL  447

Query  211  PAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            P EEDMPAIM+SFKKFNDEFM+QYED+RGYSR+
Sbjct  448  PDEEDMPAIMDSFKKFNDEFMEQYEDNRGYSRL  480



>ref|XP_009105726.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Brassica rapa]
Length=509

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  565  GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMY  386
             QIF+GLMV+PPKPGDISYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMY
Sbjct  359  AQIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMY  418

Query  385  SFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  206
            SFPQI+LPP+AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA
Sbjct  419  SFPQIKLPPKAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  478

Query  205  EEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            EE+MP IMESFKKFNDEFM QY D+ GYSRM
Sbjct  479  EEEMPEIMESFKKFNDEFMSQYGDNFGYSRM  509



>gb|KJB31170.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31171.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31172.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31173.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=481

 Score =   280 bits (715),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P QIF+GLMVNP KPGD+SYDQFVRESKGILESLR+RARIM
Sbjct  311  PKTVDEIYKIASISLSPNVPAQIFMGLMVNPLKPGDVSYDQFVRESKGILESLRRRARIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQ+RLPP+AIE A+  GK PDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCKNVVCNFTEGAMYSFPQLRLPPKAIEAAKQAGKVPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMP IM SFKKFNDEFM QYED+   SRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEDMPEIMSSFKKFNDEFMAQYEDNWNRSRM  481



>ref|XP_010552672.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Tarenaya 
hassleriana]
Length=481

 Score =   279 bits (714),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P QIF+GLMV+PP PGDISY+QF+RESKGILESLR+RARIM
Sbjct  311  PRTVEEIYKVASIALSPNVPAQIFMGLMVSPPNPGDISYEQFIRESKGILESLRRRARIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQI+LP RAIE A+  GK PDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCKNVVCNFTEGAMYSFPQIKLPARAIEAARQAGKVPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QYED+ GYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMSQYEDNFGYSRM  481



>gb|KJB31175.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=495

 Score =   279 bits (714),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P QIF+GLMVNP KPGD+SYDQFVRESKGILESLR+RARIM
Sbjct  325  PKTVDEIYKIASISLSPNVPAQIFMGLMVNPLKPGDVSYDQFVRESKGILESLRRRARIM  384

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQ+RLPP+AIE A+  GK PDV+YCLKLLEATGISTVP
Sbjct  385  TDGFNSCKNVVCNFTEGAMYSFPQLRLPPKAIEAAKQAGKVPDVFYCLKLLEATGISTVP  444

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMP IM SFKKFNDEFM QYED+   SRM
Sbjct  445  GSGFGQKEGVFHLRTTILPAEEDMPEIMSSFKKFNDEFMAQYEDNWNRSRM  495



>gb|KHG15331.1| Glutamate--glyoxylate aminotransferase 2 -like protein [Gossypium 
arboreum]
Length=481

 Score =   279 bits (713),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P QIF+GLMVNP KPGD+SYDQ+VRESKGILESLR+RARIM
Sbjct  311  PKTVDEIYKIASISLSPNVPAQIFMGLMVNPLKPGDVSYDQYVRESKGILESLRRRARIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQI LPP+AIE A+  GK PDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCKNVVCNFTEGAMYSFPQIHLPPKAIEAAKQAGKVPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMP IM SFKKFNDEFM QYED+  +SRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEDMPEIMSSFKKFNDEFMAQYEDNWNHSRM  481



>ref|XP_010928898.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
 ref|XP_010928907.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
Length=481

 Score =   279 bits (713),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = -1

Query  568  PGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAM  389
            PGQIFLGLMVNPPK GDISY + V+ESK +LESLR+RA IMTDGFNSCRNVVCNFTEGAM
Sbjct  330  PGQIFLGLMVNPPKAGDISYLKLVQESKAVLESLRRRAHIMTDGFNSCRNVVCNFTEGAM  389

Query  388  YSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP  209
            YSFPQIRLP +AIE A+  GKAPDV+YCLKLLEATGI+TVPGSGFGQKEGVFHLRTTILP
Sbjct  390  YSFPQIRLPLKAIEAARKAGKAPDVFYCLKLLEATGIATVPGSGFGQKEGVFHLRTTILP  449

Query  208  AEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            AEEDMPAIM SF+KFNDEFM+QYED+RGYSRM
Sbjct  450  AEEDMPAIMTSFRKFNDEFMEQYEDYRGYSRM  481



>ref|XP_011071137.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Sesamum 
indicum]
Length=481

 Score =   278 bits (711),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    PGQIF+GLMV+PPKPGDISY+++VRESKGILESLR+RARIM
Sbjct  311  PQTVEEIYKVASISLSPNVPGQIFMGLMVSPPKPGDISYERYVRESKGILESLRRRARIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFN CRNVVCNFTEGAMYSFPQIRLP + +E A+  GK  DV+YCLKLLEATGISTVP
Sbjct  371  TDGFNCCRNVVCNFTEGAMYSFPQIRLPLKVMEAAKRAGKVADVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFNDEFM+QYED+ GYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEDMPAIMASFKKFNDEFMEQYEDNGGYSRM  481



>emb|CDX91708.1| BnaC08g06270D [Brassica napus]
Length=403

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V+    ++    L      QIF+GLMV+PPKPGDISYDQF RESKGILESLR+RA+IM
Sbjct  233  PRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFARESKGILESLRRRAKIM  292

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ A+  GK PDV+YCLKLLEATGISTVP
Sbjct  293  TDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQAAKQAGKVPDVFYCLKLLEATGISTVP  352

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QYE+  GYSRM
Sbjct  353  GSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMAQYENGFGYSRM  403



>gb|EPS68501.1| hypothetical protein M569_06265, partial [Genlisea aurea]
Length=481

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 141/154 (92%), Gaps = 2/154 (1%)
 Frame = -1

Query  568  PGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAM  389
            P QIF+GLMVNPPKPGDISYD+F+ ESKGILESLR+RARIMTDGFNSCRN+VCNFTEGAM
Sbjct  328  PAQIFMGLMVNPPKPGDISYDKFITESKGILESLRRRARIMTDGFNSCRNIVCNFTEGAM  387

Query  388  YSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP  209
            YSFPQI+LP RAIE A   GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP
Sbjct  388  YSFPQIQLPARAIEAANRAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP  447

Query  208  AEEDMPAIMESFKKFNDEFMDQYED--HRGYSRM  113
            AEE+MP IM SFKKFND+FMDQYE+  H+ YSRM
Sbjct  448  AEEEMPEIMASFKKFNDDFMDQYEEDHHKAYSRM  481



>emb|CDY25780.1| BnaA07g10020D [Brassica napus]
Length=403

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V+    ++    L      QIF+GLMVNPPKPGDISYDQF RESKGILESLR+RA IM
Sbjct  233  PRVVEEIYKVASIALSPNVSAQIFMGLMVNPPKPGDISYDQFTRESKGILESLRRRANIM  292

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ A+  GK PDV+YCLKLLE TGISTVP
Sbjct  293  TDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQAAKQAGKVPDVFYCLKLLETTGISTVP  352

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY+++ GYSRM
Sbjct  353  GSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQYDNNFGYSRM  403



>dbj|BAJ90574.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=295

 Score =   271 bits (693),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    PGQIF+GLMVNPPKPGDISY ++  ESK ILESLR+RA+IM
Sbjct  128  PKTVDEIYKVASIALSPNVPGQIFMGLMVNPPKPGDISYLKYSAESKSILESLRRRAQIM  187

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLP RA++ A+  GK PDVYYCLKLLEATGISTVP
Sbjct  188  TDGFNSCRNVVCNFTEGAMYSFPQIRLPQRAMDVAKSAGKEPDVYYCLKLLEATGISTVP  247

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  131
            GSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFND FMDQY+DH
Sbjct  248  GSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKFNDSFMDQYQDH  292



>ref|XP_009110107.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Brassica 
rapa]
Length=478

 Score =   277 bits (708),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V+    ++    L      QIF+GLMV+PPKPGDISYDQF RESKGILESLR+RA+IM
Sbjct  308  PRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFARESKGILESLRRRAKIM  367

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ A+  GKAPDV+YCLKLLEATGISTVP
Sbjct  368  TDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQAAKQAGKAPDVFYCLKLLEATGISTVP  427

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QYE+  GYSRM
Sbjct  428  GSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMAQYENGFGYSRM  478



>ref|XP_006300456.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
 gb|EOA33354.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
Length=481

 Score =   276 bits (707),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  565  GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMY  386
             QIF+GLMV+PPKPGDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMY
Sbjct  331  AQIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMY  390

Query  385  SFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  206
            SFPQI+LPP+AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA
Sbjct  391  SFPQIKLPPKAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  450

Query  205  EEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            EE+MP IM+SFKKFNDEFM QY D  GYSRM
Sbjct  451  EEEMPEIMDSFKKFNDEFMSQYGDSFGYSRM  481



>ref|XP_011014669.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Populus euphratica]
 ref|XP_011014670.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Populus euphratica]
Length=481

 Score =   276 bits (706),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P QIF+GLMVNP KPGDISY+QF+RESKGI+ESLR+RAR+M
Sbjct  311  PKTVDEIYKVASVSLSPNVPAQIFMGLMVNPLKPGDISYEQFIRESKGIIESLRRRARMM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NV+CNFTEGAMYSFPQIRLPP+AIE A+  GK PDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCKNVICNFTEGAMYSFPQIRLPPKAIEAAKKAGKVPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEE+MP IM SFKKFN+EFM+QY+D  GYSR+
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEEMPEIMASFKKFNNEFMEQYDDRSGYSRL  481



>ref|XP_007044762.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044763.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044764.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00594.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00595.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00596.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
Length=481

 Score =   276 bits (706),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -1

Query  571  CPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGA  392
             P QIF+GLMVNP KPGDISY+Q+VRESKGIL+SLR+RA IMTDGFNSC+NVVCNFTEGA
Sbjct  329  VPAQIFMGLMVNPLKPGDISYEQYVRESKGILDSLRRRAWIMTDGFNSCKNVVCNFTEGA  388

Query  391  MYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  212
            MYSFPQIRLPP+A+E A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL
Sbjct  389  MYSFPQIRLPPKAVEAAKKAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  448

Query  211  PAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            PAEEDMP IM SFKKFNDEFM+QYED+  +SRM
Sbjct  449  PAEEDMPEIMSSFKKFNDEFMEQYEDNWSHSRM  481



>ref|XP_002893277.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH69536.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
Length=481

 Score =   276 bits (705),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V+    ++    L      QI +GLMV+PPKPGDISYDQF RESKGILESLR+RARIM
Sbjct  311  PRVVEEIYKVASIALSPNVSAQILMGLMVSPPKPGDISYDQFARESKGILESLRRRARIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQIRLPP AI+ A+  GK PDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCKNVVCNFTEGAMYSFPQIRLPPGAIQAAKQAGKVPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY+++ GYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQYDNNVGYSRM  481



>dbj|BAH20108.1| AT1G70580 [Arabidopsis thaliana]
Length=481

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L      QIF+GLMV+PPKPGDISYDQFVRESKGILESLR+RAR+M
Sbjct  311  PRTVEEIHKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARMM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQI+LP +AI+ A+  GK PDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCKNVVCNFTEGAMYSFPQIKLPSKAIQAAKQAGKVPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY D+ GYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMSQYADNFGYSRM  481



>ref|XP_006307377.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
 gb|EOA40275.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
Length=481

 Score =   275 bits (704),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V+    ++    L      QIF+GLMV+PPKPGDISYDQF RESKGILESLR+RA+IM
Sbjct  311  PRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFARESKGILESLRRRAKIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ A+  GK PDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQAAKQAGKVPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY+++ GYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQYDNNVGYSRM  481



>gb|AAK68842.1| alanine aminotransferase-like protein [Arabidopsis thaliana]
Length=379

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V+    ++    L      QIF+GLMVNPPKPGDISYDQF RESKGILESLR+RAR+M
Sbjct  209  PRVVEEIYKVASIALSPNVSAQIFMGLMVNPPKPGDISYDQFARESKGILESLRRRARLM  268

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ A+  GK PDV+YCLKLLEATGISTVP
Sbjct  269  TDGFNSCKNVVCNFTEGAMYSFPQIRLPTGALQAAKQAGKVPDVFYCLKLLEATGISTVP  328

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAE++MP IM+SFKKFNDEFM QY+++ GYS+M
Sbjct  329  GSGFGQKEGVFHLRTTILPAEDEMPEIMDSFKKFNDEFMTQYDNNFGYSKM  379



>ref|NP_177215.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_974122.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031262.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031263.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 sp|Q9S7E9.1|GGT2_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 2; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT2; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT2; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis 
thaliana]
 gb|AAG52344.1|AC011663_23 putative alanine aminotransferase; 91367-88744 [Arabidopsis thaliana]
 gb|AAG52480.1|AC010796_19 putative alanine aminotransferase; 63135-65758 [Arabidopsis thaliana]
 gb|AAN62333.1|AF479640_1 glutamate:glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AAK59635.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AAL34156.1| putative alanine aminotransferase [Arabidopsis thaliana]
 dbj|BAH19506.1| AT1G70580 [Arabidopsis thaliana]
 gb|AEE35082.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35083.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35084.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35085.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
Length=481

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  565  GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMY  386
             QIF+GLMV+PPKPGDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMY
Sbjct  331  AQIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMY  390

Query  385  SFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  206
            SFPQI+LP +AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA
Sbjct  391  SFPQIKLPSKAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  450

Query  205  EEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            EE+MP IM+SFKKFNDEFM QY D+ GYSRM
Sbjct  451  EEEMPEIMDSFKKFNDEFMSQYADNFGYSRM  481



>gb|AAM61453.1| putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  565  GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMY  386
             QIF+GLMV+PPKPGDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMY
Sbjct  331  AQIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMY  390

Query  385  SFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  206
            SFPQI+LP +AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA
Sbjct  391  SFPQIKLPSKAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  450

Query  205  EEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            EE+MP IM+SFKKFNDEFM QY D+ GYSRM
Sbjct  451  EEEMPEIMDSFKKFNDEFMSQYADNFGYSRM  481



>ref|XP_002315675.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
 gb|EEF01846.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
Length=481

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P QIF+GLMVNP KPG+ISY+QF+RESKGI+ESLR+RAR+M
Sbjct  311  PKTVDEIYKVASVSLSPNVPAQIFMGLMVNPLKPGNISYEQFIRESKGIIESLRRRARMM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NV+CNFTEGAMYSFPQIRLPP+AIE A+  GK PDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCKNVICNFTEGAMYSFPQIRLPPKAIEAAKKAGKVPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEE+MP IM SFKKFN+EFM+QY+D  GYSR+
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEEMPEIMASFKKFNNEFMEQYDDRSGYSRL  481



>ref|XP_009115544.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
 emb|CDY44130.1| BnaA09g31220D [Brassica napus]
 emb|CDY04729.1| BnaC05g18600D [Brassica napus]
Length=478

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V+    ++    L      QIF+GLMV+PPKPGDISYDQF RESKGILESLR+RA+IM
Sbjct  308  PRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFARESKGILESLRRRAKIM  367

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQI+LPP A++ A+  GK PDV+YCLKLLEATGISTVP
Sbjct  368  TDGFNSCKNVVCNFTEGAMYSFPQIKLPPGALQAAKQAGKVPDVFYCLKLLEATGISTVP  427

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QYE+  GYSRM
Sbjct  428  GSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQYENSFGYSRM  478



>ref|XP_006416099.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416100.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416101.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34452.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34453.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34454.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
Length=478

 Score =   275 bits (702),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V+    ++    L      QIF+GLMV+PPKPGDISYDQF RESKGILESLR+RA+IM
Sbjct  308  PRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFSRESKGILESLRRRAKIM  367

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ A+  GK PDV+YCLKLLEATGISTVP
Sbjct  368  TDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQAAKQAGKVPDVFYCLKLLEATGISTVP  427

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY+++ GYSRM
Sbjct  428  GSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQYDNNFGYSRM  478



>ref|XP_006390865.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390866.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390867.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390868.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28151.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28152.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28153.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28154.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
Length=481

 Score =   274 bits (701),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  565  GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMY  386
             QIF+GLMV+PPKPGDISYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMY
Sbjct  331  AQIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMY  390

Query  385  SFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  206
            SFPQI+LP +AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA
Sbjct  391  SFPQIKLPSKAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  450

Query  205  EEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            EE+MP IM SFKKFNDEFM QY D+ GYSRM
Sbjct  451  EEEMPEIMGSFKKFNDEFMSQYGDNFGYSRM  481



>emb|CDY41452.1| BnaA08g20540D [Brassica napus]
Length=478

 Score =   274 bits (700),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V+    ++    L      QIF+GLMV+PPKPGDISYDQF RESKGILESLR+RA+IM
Sbjct  308  PRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFARESKGILESLRRRAKIM  367

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ A+  GK PDV+YCLKLLEATGISTVP
Sbjct  368  TDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQAAKQAGKVPDVFYCLKLLEATGISTVP  427

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY++  GYSRM
Sbjct  428  GSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMAQYDNGFGYSRM  478



>gb|AAM22749.1| alanine aminotransferase [Deschampsia antarctica]
Length=147

 Score =   263 bits (671),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  562  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  383
            QIF+GLMVNPPKPGDISY ++  ESK ILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYS
Sbjct  1    QIFMGLMVNPPKPGDISYLKYATESKSILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYS  60

Query  382  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  203
            FPQIRLP RA++TA+  GKAPDV+YCL LLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  61   FPQIRLPQRAMDTAKSAGKAPDVFYCLMLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  120

Query  202  EDMPAIMESFKKFNDEFMDQYEDH  131
            EDMPAIM SFKKFND FM+QY+D+
Sbjct  121  EDMPAIMSSFKKFNDSFMEQYQDY  144



>ref|XP_008447004.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=334

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  571  CPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGA  392
             P QIF+GLMVNPPKPGD SYDQ++ ESKGILESLR+RARIMTDGFNSC+NVVCNFTEGA
Sbjct  189  VPAQIFMGLMVNPPKPGDFSYDQYISESKGILESLRRRARIMTDGFNSCKNVVCNFTEGA  248

Query  391  MYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  212
            MYSFPQIRLPPRAIE+A+ LGK PDV YCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL
Sbjct  249  MYSFPQIRLPPRAIESAKQLGKVPDVLYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  308

Query  211  PAEEDMPAIMESFKKFNDEFMDQY  140
            PAEEDMP IM SFKKFND FM++Y
Sbjct  309  PAEEDMPEIMASFKKFNDAFMEEY  332



>emb|CDY66294.1| BnaAnng22050D [Brassica napus]
Length=481

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  565  GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMY  386
             QIF+GLMV+PPK GDISYDQFVRES+GILESLR+RARIMTDGFNSC+NVVCNFTEGAMY
Sbjct  331  AQIFMGLMVSPPKSGDISYDQFVRESEGILESLRRRARIMTDGFNSCKNVVCNFTEGAMY  390

Query  385  SFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  206
            SFPQI+LPP+AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA
Sbjct  391  SFPQIKLPPKAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  450

Query  205  EEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            EE+MP IMESFKKFN EFM QY D+ GYSRM
Sbjct  451  EEEMPEIMESFKKFNHEFMSQYGDNFGYSRM  481



>ref|NP_564192.2| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q9LR30.1|GGT1_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 1; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT1; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT1; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis 
thaliana]
 gb|AAF87015.1|AC005292_24 F26F24.16 [Arabidopsis thaliana]
 gb|AAN62332.1|AF479639_1 glutamate:glyoxylate aminotransferase 1 [Arabidopsis thaliana]
 gb|AAL08235.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAN12918.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AEE30370.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V+    ++    L      QIF+GLMVNPPKPGDISYDQF RESKGILESLR+RAR+M
Sbjct  311  PRVVEEIYKVASIALSPNVSAQIFMGLMVNPPKPGDISYDQFARESKGILESLRRRARLM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ A+  GK PDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCKNVVCNFTEGAMYSFPQIRLPTGALQAAKQAGKVPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAE++MP IM+SFKKFNDEFM QY+++ GYS+M
Sbjct  431  GSGFGQKEGVFHLRTTILPAEDEMPEIMDSFKKFNDEFMTQYDNNFGYSKM  481



>gb|AAL24255.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAO11559.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
Length=481

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V+    ++    L      QIF+GLMVNPPKPGDISYDQF RESKGILESLR+RAR+M
Sbjct  311  PRVVEEIYKVASIALSPNVSAQIFMGLMVNPPKPGDISYDQFARESKGILESLRRRARLM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ A+  GK PDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCKNVVCNFTEGAMYSFPQIRLPTGALQAAKQAGKVPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAE++MP IM+SFKKFNDEFM QY+++ GYS+M
Sbjct  431  GSGFGQKEGVFHLRTTILPAEDEMPEIMDSFKKFNDEFMTQYDNNFGYSKM  481



>ref|XP_010498838.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498839.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498840.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score =   272 bits (696),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V+    ++    L      QIF+GLMV+PPKPGDISYDQF RESKGILESLR+RA+IM
Sbjct  311  PRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFTRESKGILESLRRRAKIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ A+  GK PDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCKNVVCNFTEGAMYSFPQIRLPAGALQAAKQAGKVPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY++  GYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQYDNTVGYSRM  481



>ref|XP_010477627.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Camelina 
sativa]
Length=481

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V+    ++    L      QIF+GLMV+PPKPGDISYDQF RESKGILESLR+RA+IM
Sbjct  311  PRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFARESKGILESLRRRAKIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NV CNFTEGAMYSFPQIRLP  A++ A+  GK PDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCKNVACNFTEGAMYSFPQIRLPAGALQAAKQAGKVPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY+++ GYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQYDNNVGYSRM  481



>ref|XP_010460118.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score =   271 bits (693),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V+    ++    L      QIF+GLMV+PPKPGDISYDQF RESKGILESLR+RA+IM
Sbjct  311  PRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFARESKGILESLRRRAKIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ A+  GK PDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCKNVVCNFTEGAMYSFPQIRLPAGALQAAKQAGKVPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFND+FM QY+++ GYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDDFMTQYDNNFGYSRM  481



>gb|EMS58349.1| Alanine aminotransferase 2 [Triticum urartu]
Length=478

 Score =   271 bits (693),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  571  CPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGA  392
             PGQIF+GLMVNPPKPGDISY ++  ESK ILESLR+RA+IMTDGFNSCRNVVCNFTEGA
Sbjct  329  VPGQIFMGLMVNPPKPGDISYLKYSAESKSILESLRRRAQIMTDGFNSCRNVVCNFTEGA  388

Query  391  MYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  212
            MYSFPQIRLP RA++ A+  GKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL
Sbjct  389  MYSFPQIRLPQRAMDVAKSAGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  448

Query  211  PAEEDMPAIMESFKKFNDEFMDQYEDH  131
            PAEEDMPAIM SFKKFND FM+QY+DH
Sbjct  449  PAEEDMPAIMSSFKKFNDSFMEQYQDH  475



>ref|XP_009103182.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
Length=478

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V+    ++    L      QIF+GLMVNPPKPGDISYDQF RESKGILESLR+RA+IM
Sbjct  308  PRVVEEIYKVASIALSPNVSAQIFMGLMVNPPKPGDISYDQFTRESKGILESLRRRAKIM  367

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQI LPP A++ A+  GK PDV+YCLKLLEA GISTVP
Sbjct  368  TDGFNSCKNVVCNFTEGAMYSFPQILLPPGALQAAKQAGKVPDVFYCLKLLEAAGISTVP  427

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFND FM QY+++ GYSRM
Sbjct  428  GSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDAFMTQYDNNFGYSRM  478



>ref|XP_010415743.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 145/171 (85%), Gaps = 2/171 (1%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L      QIF+GLMV+PPKPGDISYDQFVRESKGILESLR+RAR+M
Sbjct  311  PKTVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARMM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK PDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKVPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY    GYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMSQY--GVGYSRM  479



>ref|XP_010427837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Camelina 
sativa]
Length=479

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 140/151 (93%), Gaps = 2/151 (1%)
 Frame = -1

Query  565  GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMY  386
             QIF+GLMV+PPKPGDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMY
Sbjct  331  AQIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMY  390

Query  385  SFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  206
            SFPQI+LPP+AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA
Sbjct  391  SFPQIKLPPKAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  450

Query  205  EEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            EE+MP IM+SFKKFNDEFM QY    GYSRM
Sbjct  451  EEEMPEIMDSFKKFNDEFMSQY--GVGYSRM  479



>ref|NP_001058716.1| Os07g0108300 [Oryza sativa Japonica Group]
 dbj|BAD30627.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF20630.1| Os07g0108300 [Oryza sativa Japonica Group]
 gb|EAZ02507.1| hypothetical protein OsI_24612 [Oryza sativa Indica Group]
 gb|EAZ38438.1| hypothetical protein OsJ_22816 [Oryza sativa Japonica Group]
 dbj|BAG90568.1| unnamed protein product [Oryza sativa Japonica Group]
Length=485

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 144/171 (84%), Gaps = 3/171 (2%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    PGQIF+GLMVNPPKPGDISY +F  ESK ILESLR+RAR+M
Sbjct  318  PKTVDEIYKVASIALSPNVPGQIFMGLMVNPPKPGDISYLKFSAESKSILESLRRRARLM  377

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AI+ A+  GKA DV+YCLKLLEATGISTVP
Sbjct  378  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIDAAKRAGKAADVFYCLKLLEATGISTVP  437

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFND FMDQY+   GYSRM
Sbjct  438  GSGFGQKEGVFHLRTTILPAEEDMPAIMTSFKKFNDTFMDQYD---GYSRM  485



>gb|AAO84040.1| alanine aminotransferase [Oryza sativa Indica Group]
Length=484

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 144/171 (84%), Gaps = 3/171 (2%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    PGQIF+GLMVNPPKPGDISY +F  ESK ILESLR+RAR+M
Sbjct  317  PKTVDEIYKVASIALSPNVPGQIFMGLMVNPPKPGDISYLKFSAESKSILESLRRRARLM  376

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AI+ A+  GKA DV+YCLKLLEATGISTVP
Sbjct  377  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIDAAKRAGKAADVFYCLKLLEATGISTVP  436

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFND FMDQY+   GYSRM
Sbjct  437  GSGFGQKEGVFHLRTTILPAEEDMPAIMTSFKKFNDTFMDQYD---GYSRM  484



>emb|CDY12474.1| BnaC07g13140D [Brassica napus]
Length=537

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V+    ++    L      QIF+GLMV+ PKPGDISYDQF RESKGILESLR+RA+IM
Sbjct  367  PRVVEEIYKVASIALSPNVSAQIFMGLMVSSPKPGDISYDQFTRESKGILESLRRRAKIM  426

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+N VCNFTEGAMYSFPQI+LPP A++ A+  GK PDV+YCLKLLEATGISTVP
Sbjct  427  TDGFNSCKNAVCNFTEGAMYSFPQIQLPPGALQAAKQAGKVPDVFYCLKLLEATGISTVP  486

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY+++ GYSRM
Sbjct  487  GSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQYDNNFGYSRM  537



>ref|XP_004955317.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like isoform 
X2 [Setaria italica]
Length=478

 Score =   269 bits (687),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 142/171 (83%), Gaps = 3/171 (2%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    PGQIF+G+MVNPPKPGDISY +F  ESK IL+SLR+RAR+M
Sbjct  311  PQTVDEIYKVASIALSPNVPGQIFMGVMVNPPKPGDISYLKFAAESKSILDSLRRRARMM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE A+  GKAPDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAAKRAGKAPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEED PAIM SFK FND FM QYE   GYSRM
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEDFPAIMSSFKNFNDSFMAQYE---GYSRM  478



>gb|KGN51767.1| hypothetical protein Csa_5G598750 [Cucumis sativus]
Length=474

 Score =   268 bits (685),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  571  CPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGA  392
             P QIF+GLMVNPPKPGDISYDQ++ ESKGILESLR+RARIMTDGFNSC+NVVCNFTEGA
Sbjct  329  VPAQIFMGLMVNPPKPGDISYDQYISESKGILESLRRRARIMTDGFNSCKNVVCNFTEGA  388

Query  391  MYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  212
            MYSFPQI+LPPRAIE A+ LGK PDV YCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL
Sbjct  389  MYSFPQIQLPPRAIEAAKQLGKVPDVLYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  448

Query  211  PAEEDMPAIMESFKKFNDEFMDQY  140
            PAEEDMP IM SFKKFND FM++Y
Sbjct  449  PAEEDMPEIMTSFKKFNDAFMEEY  472



>tpg|DAA59363.1| TPA: putative MATE efflux family protein isoform 1 [Zea mays]
 tpg|DAA59364.1| TPA: putative MATE efflux family protein isoform 2 [Zea mays]
Length=399

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 142/171 (83%), Gaps = 3/171 (2%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    PGQIF+G+MVNPPKPGDISY +F  ESK I ESLR+RAR+M
Sbjct  232  PKTVDEIYKVASIALSPNVPGQIFMGVMVNPPKPGDISYLKFAAESKSIHESLRRRARMM  291

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE A+  GK+ DV+YCLKLLEATGISTVP
Sbjct  292  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAARRAGKSADVFYCLKLLEATGISTVP  351

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEED PAIM SFKKFND FM+QYE   GYSR+
Sbjct  352  GSGFGQKEGVFHLRTTILPAEEDFPAIMSSFKKFNDSFMEQYE---GYSRL  399



>gb|AAK25905.1|AF360195_1 putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V+    ++    L      QIF+GLMVNPPKPGDISYDQF RESKGILESLR+RAR+M
Sbjct  311  PRVVEEIYKVASIALSPNVSAQIFMGLMVNPPKPGDISYDQFARESKGILESLRRRARLM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVV NFTEGAMYSFPQIRLP  A++ A+  GK PDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCKNVVRNFTEGAMYSFPQIRLPTGALQAAKQAGKVPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAE++MP IM+SFKKFNDEFM QY+++ GYS+M
Sbjct  431  GSGFGQKEGVFHLRTTILPAEDEMPEIMDSFKKFNDEFMTQYDNNFGYSKM  481



>ref|XP_009151206.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Brassica 
rapa]
Length=155

 Score =   256 bits (655),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -1

Query  565  GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMY  386
             QIF+GLMV+PPKPGDISYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMY
Sbjct  21   AQIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMY  80

Query  385  SFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  206
            SFPQI+LPP+AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA
Sbjct  81   SFPQIKLPPKAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  140

Query  205  EEDMPAIMESFKKFN  161
            EE+MP IMESFKKFN
Sbjct  141  EEEMPLIMESFKKFN  155



>ref|XP_006658210.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Oryza 
brachyantha]
Length=494

 Score =   267 bits (682),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 143/174 (82%), Gaps = 3/174 (2%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    PGQIF+GLMVNPPKPGDISY +F  ESK ILESLR+RAR+M
Sbjct  321  PKTVDEIYKVASIALSPNVPGQIFMGLMVNPPKPGDISYLKFAAESKAILESLRRRARLM  380

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLP RAI+ A   GKA DV+YCLKLLEATGISTVP
Sbjct  381  TDGFNSCRNVVCNFTEGAMYSFPQIRLPQRAIDAANRAGKAADVFYCLKLLEATGISTVP  440

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRG---YSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFND FMD+Y+ + G   YSRM
Sbjct  441  GSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKFNDSFMDEYDGYGGGSSYSRM  494



>ref|XP_009759837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
sylvestris]
Length=473

 Score =   266 bits (680),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P QIFLGLM NPPKPGDISYDQFVRESKGILESLR+RA IM
Sbjct  311  PKSVEEIYKVASISLSPNVPAQIFLGLMANPPKPGDISYDQFVRESKGILESLRRRAHIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            T GFNSCRNV+CNFTEGAMYSFPQI+LP  AI+ A+ LGKAPDV+YCLKLLEATGISTVP
Sbjct  371  TGGFNSCRNVLCNFTEGAMYSFPQIQLPRGAIDAAKKLGKAPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  137
            GSGFGQKEGVFHLRTTILPAEEDMP+IM SFKKFND+FM QYE
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEDMPSIMASFKKFNDDFMKQYE  473



>ref|XP_010471056.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score =   266 bits (680),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 139/151 (92%), Gaps = 2/151 (1%)
 Frame = -1

Query  565  GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMY  386
             QIF+GLMV+PPKPGDISY QFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMY
Sbjct  331  AQIFMGLMVSPPKPGDISYAQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMY  390

Query  385  SFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  206
            SFPQI+LPP+AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA
Sbjct  391  SFPQIKLPPKAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  450

Query  205  EEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            EE+MP IM+SFKKFND+FM QY    GYSRM
Sbjct  451  EEEMPEIMDSFKKFNDDFMSQY--GVGYSRM  479



>ref|XP_003557680.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Brachypodium 
distachyon]
Length=479

 Score =   266 bits (680),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 144/171 (84%), Gaps = 3/171 (2%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    PGQIF+GLM+NPPKPGDISY +F  ESK IL+SLR+RA+IM
Sbjct  312  PKTVDEIYKVASIALSPNVPGQIFMGLMMNPPKPGDISYLKFATESKSILDSLRRRAQIM  371

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQIRLP RAI+TA+  GK PDV+YCLKLLEATGISTVP
Sbjct  372  TDGFNSCQNVVCNFTEGAMYSFPQIRLPKRAIDTAKSAGKEPDVFYCLKLLEATGISTVP  431

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFND FM+QY+D   YSR+
Sbjct  432  GSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKFNDSFMEQYQD---YSRL  479



>ref|XP_009624740.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625366.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
Length=473

 Score =   265 bits (678),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P QIFLGLM NPPKPGDISYDQFVRESKGILESLR+RA +M
Sbjct  311  PKSVEEIYKVASISLSPNVPAQIFLGLMANPPKPGDISYDQFVRESKGILESLRRRAHLM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQI+LP   I+ A+ LGK PDV+YC+KLLEATGISTVP
Sbjct  371  TDGFNSCRNVVCNFTEGAMYSFPQIQLPRGVIDAAKKLGKTPDVFYCIKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  137
            GSGFGQKEGVFHLRTTILPAEEDMP+IM SFKKFND+FM+QYE
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEDMPSIMASFKKFNDDFMEQYE  473



>ref|XP_004228555.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
lycopersicum]
Length=473

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P QIFLGL+ NPPKPGDISY+QF RESKGILESLR+RA IM
Sbjct  311  PKSVEEIYKVASISLSPNVPAQIFLGLLANPPKPGDISYEQFARESKGILESLRRRAHIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQI+LPPRAI+ A+ L KAPDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCKNVVCNFTEGAMYSFPQIQLPPRAIDAAKKLEKAPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  137
            GSGFGQKEGVFHLRTTILPAEE+MP+IM SFKKFNDEFM +YE
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEEMPSIMASFKKFNDEFMARYE  473



>ref|NP_001151209.1| alanine aminotransferase 2 [Zea mays]
 gb|ACG41981.1| alanine aminotransferase 2 [Zea mays]
Length=478

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 142/171 (83%), Gaps = 3/171 (2%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    PGQIF+G+MVNPPKPGDISY +F  ESK I ESLR+RAR+M
Sbjct  311  PKTVDEIYKVASIALSPNVPGQIFMGVMVNPPKPGDISYLKFAAESKSIHESLRRRARMM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE A+  GK+ DV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAARRAGKSADVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILPAEED PAIM SFKKFND FM+QYE   GYSR+
Sbjct  431  GSGFGQKEGVFHLRTTILPAEEDFPAIMSSFKKFNDSFMEQYE---GYSRL  478



>tpg|DAA42658.1| TPA: LOW QUALITY PROTEIN: alanine aminotransferase 2 [Zea mays]
Length=479

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 136/153 (89%), Gaps = 3/153 (2%)
 Frame = -1

Query  571  CPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGA  392
             PGQIF+G+MVNPPKPGDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGA
Sbjct  330  VPGQIFMGVMVNPPKPGDISYPKFTAESKSILESLRRRARMMTDGFNSCRNVVCNFTEGA  389

Query  391  MYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  212
            MYSFPQI+LP RAIE A+  GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL
Sbjct  390  MYSFPQIQLPARAIEAAKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  449

Query  211  PAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            PAEED P IM SFKKFND FM+QYE   GYSRM
Sbjct  450  PAEEDFPTIMSSFKKFNDSFMEQYE---GYSRM  479



>ref|NP_001183048.1| uncharacterized protein LOC100501386 [Zea mays]
 gb|ACR35540.1| unknown [Zea mays]
Length=479

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 136/153 (89%), Gaps = 3/153 (2%)
 Frame = -1

Query  571  CPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGA  392
             PGQIF+G+MVNPPKPGDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGA
Sbjct  330  VPGQIFMGVMVNPPKPGDISYPKFTAESKSILESLRRRARMMTDGFNSCRNVVCNFTEGA  389

Query  391  MYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  212
            MYSFPQI+LP RAIE A+  GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL
Sbjct  390  MYSFPQIQLPARAIEAAKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  449

Query  211  PAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            PAEED P IM SFKKFND FM+QYE   GYSRM
Sbjct  450  PAEEDFPTIMSSFKKFNDSFMEQYE---GYSRM  479



>ref|XP_002887312.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH63571.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=482

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 139/152 (91%), Gaps = 1/152 (1%)
 Frame = -1

Query  565  GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMY  386
             QIF+GLMV+PPKPGDIS+DQFV ESK ILESLR+RAR+MTDGFNSC+NVVCNFTEGAMY
Sbjct  331  AQIFMGLMVSPPKPGDISHDQFVCESKRILESLRRRARMMTDGFNSCKNVVCNFTEGAMY  390

Query  385  SFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  206
            SFPQI+LP +AIE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA
Sbjct  391  SFPQIKLPSKAIEAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  450

Query  205  EEDMPAIMESFKKFNDEFMDQYEDHR-GYSRM  113
            EE+MP IM+SFKKFNDEFM QY D+  GYSRM
Sbjct  451  EEEMPEIMDSFKKFNDEFMSQYGDNNFGYSRM  482



>ref|XP_006348507.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=476

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P QIFLGL+ NPPKPGDISY+QF RESKGILESLR+RA IM
Sbjct  314  PKSVEEIYKVASISLSPNVPAQIFLGLLANPPKPGDISYEQFARESKGILESLRRRAHIM  373

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQI+LPP AI+ A+ L KAPDV+YCLKLLEATGISTVP
Sbjct  374  TDGFNSCKNVVCNFTEGAMYSFPQIQLPPGAIDAAKKLEKAPDVFYCLKLLEATGISTVP  433

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  137
            GSGFGQKEGVFHLRTTILP EE+MP+IM SFKKFNDEFM QYE
Sbjct  434  GSGFGQKEGVFHLRTTILPVEEEMPSIMASFKKFNDEFMAQYE  476



>ref|XP_008444367.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=473

 Score =   261 bits (666),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P Q+F+GLMVNPPKPGD+SY+Q+ RESKGILESLR+RARIM
Sbjct  311  PQTVDEIYKIASISLSPNVPAQVFMGLMVNPPKPGDVSYEQYHRESKGILESLRRRARIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AIETA+  GK  DV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCKNVVCNFTEGAMYSFPQIQLPPKAIETAKRAGKEADVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GSGFGQKEGVFHLRTTILP EE+MP IM SF+KFNDEFM+QY
Sbjct  431  GSGFGQKEGVFHLRTTILPPEEEMPGIMASFRKFNDEFMEQY  472



>ref|XP_004142968.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 ref|XP_004161062.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 gb|KGN62316.1| hypothetical protein Csa_2G349020 [Cucumis sativus]
Length=473

 Score =   259 bits (661),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P Q+F+GLMVNP KPGD+SY+Q+ RESKGIL+SLR+RARIM
Sbjct  311  PQTVDEIYKIASISLSPNVPAQVFMGLMVNPLKPGDVSYEQYHRESKGILDSLRRRARIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AIETA+  GK  DV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCKNVVCNFTEGAMYSFPQIQLPPKAIETAKRAGKEADVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GSGFGQKEGVFHLRTTILP EE+MPAIM SFKKFNDEFM+QY
Sbjct  431  GSGFGQKEGVFHLRTTILPPEEEMPAIMASFKKFNDEFMEQY  472



>ref|XP_010248614.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2 [Nelumbo nucifera]
Length=338

 Score =   254 bits (648),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 136/171 (80%), Gaps = 6/171 (4%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    P QIFL LMVNPPKPGDISY +F      I ESL++RA IM
Sbjct  174  PKTVDEIYKVASISLSPNVPIQIFLSLMVNPPKPGDISYLKF------ITESLKRRAHIM  227

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQ+RLPP+AIETA+  GK PDV+YCLKLLEATGIS VP
Sbjct  228  TDGFNSCKNVVCNFTEGAMYSFPQMRLPPKAIETAKRAGKVPDVFYCLKLLEATGISMVP  287

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKE  FHL TTILPAEEDMPAIM SFKKFNDEFM+QY DHRGYS M
Sbjct  288  GSGFGQKEEAFHLMTTILPAEEDMPAIMASFKKFNDEFMEQYGDHRGYSWM  338



>gb|ABK25444.1| unknown [Picea sitchensis]
 gb|ABR16321.1| unknown [Picea sitchensis]
 gb|ABR17158.1| unknown [Picea sitchensis]
 gb|ACN40300.1| unknown [Picea sitchensis]
Length=480

 Score =   253 bits (647),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 140/171 (82%), Gaps = 1/171 (1%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    PGQIFLGLMVNPPKP DISY +FV ESK ILESLR+RA +M
Sbjct  311  PKTVDEIYKVASISLSPNVPGQIFLGLMVNPPKPADISYQRFVAESKAILESLRRRAHLM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFN+CRNV+CNFTEGAMYSFPQI+LPP+AI  A+  GKAPDV+YCLKLLEATG+STVP
Sbjct  371  TDGFNNCRNVICNFTEGAMYSFPQIKLPPKAIAAAKEAGKAPDVFYCLKLLEATGMSTVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            GSGFGQKEGVFHLRTTILP EE+MP IM  FK FND+FM +YE++  +SR+
Sbjct  431  GSGFGQKEGVFHLRTTILPPEEEMPEIMNVFKIFNDDFMAKYENY-SWSRL  480



>gb|AFK42206.1| unknown [Lotus japonicus]
Length=305

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -1

Query  568  PGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAM  389
            P QIF+GLMVNPPKPGDISYDQFVRESKGILESLR+RARIMTDGFNSCRNVVCNFTEGAM
Sbjct  174  PAQIFMGLMVNPPKPGDISYDQFVRESKGILESLRRRARIMTDGFNSCRNVVCNFTEGAM  233

Query  388  YSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP  209
            YSFPQI+LPPRAIE A+   KAPDVYYCLKLLEATGISTVPGSGFGQK+G FHLRTTILP
Sbjct  234  YSFPQIKLPPRAIEAAKQARKAPDVYYCLKLLEATGISTVPGSGFGQKDGYFHLRTTILP  293

Query  208  AEEDMPAIMESF  173
             EE+MPAIM  F
Sbjct  294  LEEEMPAIMGEF  305



>ref|XP_011034252.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2 [Populus euphratica]
Length=382

 Score =   247 bits (631),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 134/154 (87%), Gaps = 3/154 (2%)
 Frame = -1

Query  568  PGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAM  389
            P QIF+GLMVNPPKPGD+SY+QF+RESKGILESLR+RAR+MTDGFNSC+NV+CNFTEGAM
Sbjct  230  PAQIFMGLMVNPPKPGDVSYEQFIRESKGILESLRRRARMMTDGFNSCKNVICNFTEGAM  289

Query  388  YSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEG--VFHLRTTI  215
            YSFPQI  PP+AI+ A+  GK PDV+YCLKLLEATGISTVP  G        VFHLRTTI
Sbjct  290  YSFPQIX-PPKAIDAAKRAGKVPDVFYCLKLLEATGISTVPQIGLIVIRSCRVFHLRTTI  348

Query  214  LPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            LPAEEDMP IM+SFKKFNDEFM++YE H GYSR+
Sbjct  349  LPAEEDMPEIMDSFKKFNDEFMERYEGHGGYSRL  382



>tpg|DAA42656.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
 tpg|DAA42657.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
Length=483

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -1

Query  571  CPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGA  392
             PGQIF+G+MVNPPKPGDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGA
Sbjct  330  VPGQIFMGVMVNPPKPGDISYPKFTAESKSILESLRRRARMMTDGFNSCRNVVCNFTEGA  389

Query  391  MYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  212
            MYSFPQI+LP RAIE A+  GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL
Sbjct  390  MYSFPQIQLPARAIEAAKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTIL  449

Query  211  PAEEDMPAIMESFKKFNDEF  152
            PAEED P IM SFKKFND F
Sbjct  450  PAEEDFPTIMSSFKKFNDSF  469



>ref|XP_010230121.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like, partial 
[Brachypodium distachyon]
Length=164

 Score =   235 bits (599),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = -1

Query  568  PGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAM  389
            PGQIF+GLM+N PKPGDISY +F  ESK IL+SLR+RA+IMTDGFNSC+NVVCNFTEGAM
Sbjct  22   PGQIFMGLMMNHPKPGDISYLKFATESKSILDSLRRRAQIMTDGFNSCQNVVCNFTEGAM  81

Query  388  YSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP  209
            YS+ QI LP RAI+TA+  GK PDV+YCLKLLEAT ISTVPGSGFGQKEGVFHLRTTILP
Sbjct  82   YSYFQICLPKRAIDTAKSAGKEPDVFYCLKLLEATRISTVPGSGFGQKEGVFHLRTTILP  141

Query  208  AEEDMPAIMESFKKFN  161
            AEEDMPAIM SFKKFN
Sbjct  142  AEEDMPAIMLSFKKFN  157



>ref|XP_001763950.1| predicted protein [Physcomitrella patens]
 gb|EDQ71354.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   227 bits (579),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L     GQI +GLMV PP+PGD+S+  +  ES  I++SLRKRA IM
Sbjct  312  PKTVEELYKVASIALSPNVTGQIMMGLMVKPPRPGDVSFPLYAAESAAIMQSLRKRAHIM  371

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFN+C NVVCNFTEGAMYSFPQ++LP  AI  A+  GKAPDV+YCL+LLEATGISTVP
Sbjct  372  TDGFNACENVVCNFTEGAMYSFPQVKLPKAAIAAARQAGKAPDVFYCLRLLEATGISTVP  431

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHR  128
            GSGFGQKEG FH+RTTILP+E+DMPAIMESFK FN +FM QY D +
Sbjct  432  GSGFGQKEGTFHVRTTILPSEKDMPAIMESFKMFNADFMAQYSDSK  477



>ref|XP_001782822.1| predicted protein [Physcomitrella patens]
 gb|EDQ52399.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -1

Query  565  GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMY  386
            GQI +GLMVNPPKPGDISY Q+  ESK I  SLRKRA IMTDGFN+C NVVCNFTEGAMY
Sbjct  332  GQIMMGLMVNPPKPGDISYPQYEAESKAISLSLRKRAHIMTDGFNACENVVCNFTEGAMY  391

Query  385  SFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  206
            SFPQ++LP  A+  A+  GKAPDV+YCL+LLEATGISTVPGSGFGQKEG FH+RTTILP+
Sbjct  392  SFPQVKLPQAAVAAAKKAGKAPDVFYCLRLLEATGISTVPGSGFGQKEGTFHVRTTILPS  451

Query  205  EEDMPAIMESFKKFNDEFMDQYEDHR  128
            E+DMP IMESFKKFN +FM QY D +
Sbjct  452  EKDMPGIMESFKKFNQDFMAQYADAK  477



>ref|XP_001777071.1| predicted protein [Physcomitrella patens]
 gb|EDQ58064.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   217 bits (553),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -1

Query  565  GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMY  386
            GQI +GLMV+PPKPGDISY  +  ES+ I  SLRKRA IMTDGFN+C N+VCNFTEGAMY
Sbjct  332  GQIMMGLMVSPPKPGDISYPLYKAESEAISLSLRKRAHIMTDGFNACENIVCNFTEGAMY  391

Query  385  SFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  206
            SFPQ++LP  AI  A+  GKAPDV+YCL+LLEATGISTVPGSGFGQKEG FH+RTTILP+
Sbjct  392  SFPQVKLPQAAIAAAKKAGKAPDVFYCLRLLEATGISTVPGSGFGQKEGTFHVRTTILPS  451

Query  205  EEDMPAIMESFKKFNDEFMDQYEDHR  128
            E DMP IMESFKKFN +FM Q+ D +
Sbjct  452  ERDMPGIMESFKKFNADFMAQHSDTK  477



>ref|XP_003613140.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96098.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=474

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = -1

Query  568  PGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAM  389
            P QIF+GLM+NPPKPGDISYD+FVRESKG+LESLR+RARIMTDGFNSCRNVVCNFTEGAM
Sbjct  330  PAQIFMGLMINPPKPGDISYDRFVRESKGVLESLRRRARIMTDGFNSCRNVVCNFTEGAM  389

Query  388  YSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            YSFPQI+LPP+A+ETA+  GKA DVYYCLKLLEATGISTVPGSGFGQKEG  H
Sbjct  390  YSFPQIKLPPKALETAKQAGKAADVYYCLKLLEATGISTVPGSGFGQKEGYVH  442



>ref|XP_002968244.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
 ref|XP_002976136.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ23041.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ30498.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
Length=481

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = -1

Query  565  GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMY  386
            GQI +GLMV PP+P DISY Q+  ESK I+ES+R+RA IMTDGFN C +VVCNFTEGAMY
Sbjct  331  GQIMMGLMVTPPRPFDISYPQYQAESKAIIESMRRRAHIMTDGFNKCEDVVCNFTEGAMY  390

Query  385  SFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  206
            SFP+I+L   A++ A   GKA DV+YCLKLLEATGISTVPGSGFGQKEG  HLRTTILP 
Sbjct  391  SFPRIKLSKAAMDAAAQAGKAADVFYCLKLLEATGISTVPGSGFGQKEGTLHLRTTILPL  450

Query  205  EEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  113
            E+DMP IM  F+KF+ +FM QY D+   SR+
Sbjct  451  EQDMPGIMAKFQKFHADFMAQYSDYSVSSRL  481



>emb|CDX91589.1| BnaC02g15710D [Brassica napus]
 emb|CDX88411.1| BnaC06g38550D [Brassica napus]
 emb|CDX86159.1| BnaA06g28760D [Brassica napus]
Length=131

 Score =   195 bits (496),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 100/114 (88%), Gaps = 8/114 (7%)
 Frame = -1

Query  565  GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMY  386
             QIF+GLMV+PPKPGDISYDQFVRE        R+RARIMTDGFNSC+NVVCNFTEGAMY
Sbjct  21   AQIFMGLMVSPPKPGDISYDQFVRE--------RRRARIMTDGFNSCKNVVCNFTEGAMY  72

Query  385  SFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLR  224
            SFPQI+LPP+AI+ A+  GK PDV+YCLKL EATGISTVPGSGFGQKEGVFHLR
Sbjct  73   SFPQIKLPPKAIQAAKQAGKVPDVFYCLKLFEATGISTVPGSGFGQKEGVFHLR  126



>ref|XP_004489786.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Cicer arietinum]
Length=497

 Score =   206 bits (524),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -1

Query  568  PGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAM  389
            P QIF+GLMVNPPKPGDISY+Q++RESKGIL SLR+RARIMTDGFNSCRNVVCNFTEGAM
Sbjct  330  PAQIFMGLMVNPPKPGDISYEQYLRESKGILGSLRRRARIMTDGFNSCRNVVCNFTEGAM  389

Query  388  YSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEG  239
            YSFPQI LPP+A+ETA+  GKAPDV+YCLKLLEATGISTVPGSGFGQKEG
Sbjct  390  YSFPQIVLPPKALETAKQAGKAPDVFYCLKLLEATGISTVPGSGFGQKEG  439



>ref|NP_001031083.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19579.1| AT1G23310 [Arabidopsis thaliana]
 gb|AEE30371.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=441

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V+    ++    L      QIF+GLMVNPPKPGDISYDQF RESKGILESLR+RAR+M
Sbjct  311  PRVVEEIYKVASIALSPNVSAQIFMGLMVNPPKPGDISYDQFARESKGILESLRRRARLM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ A+  GK PDV+YCLKLLEATGISTVP
Sbjct  371  TDGFNSCKNVVCNFTEGAMYSFPQIRLPTGALQAAKQAGKVPDVFYCLKLLEATGISTVP  430

Query  265  GSGFGQKEG  239
            GSGFGQKEG
Sbjct  431  GSGFGQKEG  439



>ref|XP_005651940.1| alanine aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE27396.1| alanine aminotransferase [Coccomyxa subellipsoidea C-169]
Length=523

 Score =   201 bits (512),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = -1

Query  565  GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMY  386
            GQ  L LMVNPPK GD S++Q   E+ GI+ S+R+RAR+MTDGFN+C  + CN+TEGAMY
Sbjct  381  GQAGLALMVNPPKEGDPSHEQHEAEAAGIIASMRRRARMMTDGFNACEGITCNYTEGAMY  440

Query  385  SFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  206
            SFP++ LPP+A++ A+  GKAPD +YCLKLL+ATG+ TVPGSGFGQ+EG FHLRTTILP 
Sbjct  441  SFPRLNLPPKALQAAKKAGKAPDTWYCLKLLDATGVLTVPGSGFGQEEGTFHLRTTILPQ  500

Query  205  EEDMPAIMESFKKFNDEFMDQY  140
            E+ +  ++ SF+KF+  FMD+Y
Sbjct  501  EDKIKDVIASFQKFHASFMDEY  522



>gb|EMT29455.1| Alanine aminotransferase 2 [Aegilops tauschii]
Length=523

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  +    ++    L    PGQIF+GLMVNPPKPGDISY ++  ESK ILESLR+RA+IM
Sbjct  311  PKTVDEIYKVASIALSPNVPGQIFMGLMVNPPKPGDISYLKYSAESKSILESLRRRAQIM  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNSCRNVVCNFTEGAMYSFPQIRLP RA++ A+  GKAPDVYYCLKLLEATGISTVP
Sbjct  371  TDGFNSCRNVVCNFTEGAMYSFPQIRLPQRAMDVAKSAGKAPDVYYCLKLLEATGISTVP  430

Query  265  GSGFGQKEG  239
            GSGFGQKEG
Sbjct  431  GSGFGQKEG  439



>ref|XP_002947519.1| alanine aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ51567.1| alanine aminotransferase [Volvox carteri f. nagariensis]
Length=522

 Score =   196 bits (499),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 119/162 (73%), Gaps = 0/162 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            PG +    +     L     GQI L  +VNPPKPGD SY+ + +E    L SLR+RA ++
Sbjct  360  PGAIEEVYKCASINLSPNTMGQIALSCLVNPPKPGDSSYEMYTKEKAAELASLRRRAHMV  419

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNS   V CNFTEGAMYSFPQI+LPP+A+E A+  GKA DV+YCLKLLE+TGISTVP
Sbjct  420  TDGFNSLDGVTCNFTEGAMYSFPQIKLPPKALEAAKAAGKAGDVFYCLKLLESTGISTVP  479

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GSGFGQ++G FHLRTTILP EE M + +E F+KF+ +FM QY
Sbjct  480  GSGFGQEDGTFHLRTTILPREEVMSSFVEKFEKFHKDFMKQY  521



>ref|XP_001698518.1| alanine aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP08011.1| alanine aminotransferase [Chlamydomonas reinhardtii]
Length=521

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 118/162 (73%), Gaps = 0/162 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            PG +    +     L     GQI L ++VNPPKPGD SYDQ+ +E    L SLR+RA ++
Sbjct  359  PGAIEEVYKCASINLSPNTMGQIALSVLVNPPKPGDPSYDQYTKEKASELVSLRRRAHMV  418

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFN+   V CNFTEGAMYSFPQI+LP +A+E A+  GKA DV+YCLKLLEATGISTVP
Sbjct  419  TDGFNALDGVTCNFTEGAMYSFPQIKLPAKALEAAKAAGKAGDVFYCLKLLEATGISTVP  478

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GSGFGQ+EG FHLRTTILP EE M   +E F KF+ +FM QY
Sbjct  479  GSGFGQEEGTFHLRTTILPREEVMTHFVEKFDKFHKDFMKQY  520



>gb|EWM24220.1| alanine-2-oxoglutarate aminotransferase 2 [Nannochloropsis gaditana]
Length=593

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 122/185 (66%), Gaps = 7/185 (4%)
 Frame = -1

Query  601  RLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCR  422
            +L    L    PGQ+ LGLMVN P+PGD SY Q+ RE + +L+SLR+RAR +TD FNSC 
Sbjct  365  KLASINLSPNVPGQVILGLMVNGPRPGDESYAQYAREKQDLLDSLRRRARAITDAFNSCE  424

Query  421  NVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKE  242
             +VC  TEGAMYSFP+I LPP A+  A+  GK+PDV+YCLKLLE TGISTVPGSGF Q++
Sbjct  425  GIVCQETEGAMYSFPKITLPPAAMAAAKAAGKSPDVFYCLKLLETTGISTVPGSGFKQRD  484

Query  241  GVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE-------DHRGYSRM*QIADNMKQL  83
            G FH RTTILP E     I++ F  F+  FM +Y+       D R   R  Q    +  +
Sbjct  485  GTFHFRTTILPPESKFQDIIQRFLAFHSAFMAEYKGSTGRGTDSRDVKRAEQQESEVNWM  544

Query  82   LKSHK  68
            + +H+
Sbjct  545  IPAHR  549



>gb|AAB01685.1| alanine aminotransferase [Chlamydomonas reinhardtii]
Length=521

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 117/162 (72%), Gaps = 0/162 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            PG +    +     L     GQI L ++VNPPKPGD SYDQ+ +E    L SLR+R  ++
Sbjct  359  PGAIEEVYKCASINLSPNTMGQIALSVLVNPPKPGDPSYDQYTKEKASELVSLRRRRHMV  418

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFN+   V CNFTEGAMYSFPQI+LP +A+E A+  GKA DV+YCLKLLEATGISTVP
Sbjct  419  TDGFNALDGVTCNFTEGAMYSFPQIKLPAKALEAAKAAGKAGDVFYCLKLLEATGISTVP  478

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GSGFGQ+EG FHLRTTILP EE M   +E F KF+ +FM QY
Sbjct  479  GSGFGQEEGTFHLRTTILPREEVMTTFVEKFDKFHKDFMKQY  520



>ref|XP_003291733.1| alanine transaminase [Dictyostelium purpureum]
 gb|EGC31753.1| alanine transaminase [Dictyostelium purpureum]
Length=530

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 109/151 (72%), Gaps = 3/151 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            + +CP   GQ+ + LMV PP PGD SY+ +++E  GI +SL+KRA ++    NS   V C
Sbjct  380  IGLCPNVIGQLVVDLMVRPPTPGDSSYELYIKERDGIYDSLKKRANLLNKALNSLEGVTC  439

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N +EGAMY+FPQIRLP +A+E AQ +GKAPD YYC++LLE TGI  VPGSGFGQK+G +H
Sbjct  440  NPSEGAMYAFPQIRLPKKAVEYAQSIGKAPDAYYCIQLLEHTGICVVPGSGFGQKDGTYH  499

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYE  137
             RTT LP+EE +  + E    F+ +FM++Y+
Sbjct  500  FRTTFLPSEEAIEGVCERIADFHKQFMNKYK  530



>gb|ETK83815.1| hypothetical protein L915_11053 [Phytophthora parasitica]
Length=200

 Score =   173 bits (438),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 107/157 (68%), Gaps = 0/157 (0%)
 Frame = -1

Query  610  RYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFN  431
            ++ +L+   L     GQ+ +G+M NPP+PGD SY+++  +  G L SL++RA  +   FN
Sbjct  43   QFYKLMSVNLCSNIDGQLVVGMMTNPPQPGDASYERYAEQRDGTLGSLKRRAEKLVKAFN  102

Query  430  SCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFG  251
                V CN TEGAMY+FP + LPP+A+E A+  G APD +YC+++L+ TGI  VPGSGFG
Sbjct  103  ELEGVTCNETEGAMYTFPNLTLPPKAVEAAKEAGMAPDAFYCMQMLDETGIVVVPGSGFG  162

Query  250  QKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            QKEG +H RTTILP E+ +  ++E   KF+  FMD+Y
Sbjct  163  QKEGTWHFRTTILPPEDAVDDVIEKTSKFHARFMDKY  199



>gb|AFK36743.1| unknown [Lotus japonicus]
Length=171

 Score =   172 bits (435),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 105/152 (69%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L+++PPK GD SY+ F+ E + IL SL +RA+I+ DGFN    V C
Sbjct  20   VNLCSNISGQILASLIMSPPKVGDESYESFMAEKENILSSLARRAKILEDGFNKLEGVTC  79

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FPQIRLP +AI+ A+    APD +YC +LL ATG+  VPGSGFGQ  G +H
Sbjct  80   NKAEGAMYLFPQIRLPQKAIKAAEAANTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWH  139

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
             R TILP EE +PAI+  F +F+++FM+++ D
Sbjct  140  FRCTILPQEEKIPAIVSRFTEFHEKFMNEFRD  171



>gb|KIZ07569.1| alanine transaminase [Monoraphidium neglectum]
Length=621

 Score =   182 bits (461),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 114/162 (70%), Gaps = 0/162 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P  + ++ ++    L     GQI L  MVNPP  GD S++ +++E +G L SL +RA+++
Sbjct  459  PATVDQFYKISSINLSPNSIGQIALSCMVNPPAAGDPSHELWIQEQQGELASLNRRAKMV  518

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
             DGFNS + V CN TEGAMY+FP++ LPPRA+E A+  G+APD +YCL+LLEATGI  VP
Sbjct  519  VDGFNSLQGVSCNATEGAMYAFPRLSLPPRALEAARKAGRAPDAFYCLRLLEATGIVAVP  578

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GSGFGQ EG FHLRTTILP EE M   ++ F+ F+  FM ++
Sbjct  579  GSGFGQAEGSFHLRTTILPREERMAEFVQKFRTFHQSFMAEF  620



>gb|ETL90369.1| hypothetical protein L917_10859 [Phytophthora parasitica]
Length=170

 Score =   171 bits (433),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 106/157 (68%), Gaps = 0/157 (0%)
 Frame = -1

Query  610  RYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFN  431
            ++ +L+   L     GQ+ +G+M NPP+PGD SY+++  +  G L SL++RA  +   FN
Sbjct  13   QFYKLMSVNLCSNIDGQLVVGMMTNPPQPGDASYERYAEQRDGTLGSLKRRAEKLVKAFN  72

Query  430  SCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFG  251
                V CN TEGAMY+FP + LPP+A+E A+  G APD +YC+++L+ TGI  VPGSGFG
Sbjct  73   ELEGVTCNETEGAMYTFPNLTLPPKAVEAAKEAGMAPDAFYCMQMLDETGIVVVPGSGFG  132

Query  250  QKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            QK G +H RTTILP E+ +  ++E   KF+  FMD+Y
Sbjct  133  QKAGTWHFRTTILPPEDAVDDVIEKTSKFHARFMDKY  169



>gb|EEE58449.1| hypothetical protein OsJ_09677 [Oryza sativa Japonica Group]
Length=254

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 108/159 (68%), Gaps = 3/159 (2%)
 Frame = -1

Query  601  RLLQYPLVQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFN  431
            +L +   V +C    GQI   L+++PPK GD SYD +  E   IL+SL +RA+ M   FN
Sbjct  96   QLYKIASVNLCSNITGQILASLIMDPPKAGDASYDLYEEEKDNILKSLSRRAKAMESAFN  155

Query  430  SCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFG  251
            S   + CN TEGAMY FP+I LP +AIE A+ + KAPDV+Y L+LL+ TGI   PGSGFG
Sbjct  156  SIDGITCNKTEGAMYLFPRIYLPQKAIEAARAVNKAPDVFYALRLLDTTGIVVTPGSGFG  215

Query  250  QKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            Q  G +H+R TILP EE +P+++  F++F++EFM QY D
Sbjct  216  QVAGTWHVRCTILPQEEKIPSMISRFREFHEEFMSQYRD  254



>gb|ETL37230.1| hypothetical protein L916_10951 [Phytophthora parasitica]
 gb|ETM43674.1| hypothetical protein L914_10886 [Phytophthora parasitica]
Length=200

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 106/157 (68%), Gaps = 0/157 (0%)
 Frame = -1

Query  610  RYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFN  431
            ++ +L+   L     GQ+ +G+M NPP+PGD SY+++  +  G L SL++RA  +   FN
Sbjct  43   QFYKLMSVNLCSNIDGQLVVGMMTNPPQPGDASYERYAEQRDGTLGSLKRRAEKLVKAFN  102

Query  430  SCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFG  251
                V CN TEGAMY+FP + LPP+A+E A+  G APD +YC+++L+ TGI  VPGSGFG
Sbjct  103  ELEGVTCNETEGAMYTFPNLTLPPKAVEAAKEAGMAPDAFYCMQMLDETGIVVVPGSGFG  162

Query  250  QKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            QK G +H RTTILP E+ +  ++E   KF+  FMD+Y
Sbjct  163  QKAGTWHFRTTILPPEDAVDDVIEKTSKFHARFMDKY  199



>ref|NP_001060284.1| Os07g0617800 [Oryza sativa Japonica Group]
 dbj|BAF22198.1| Os07g0617800 [Oryza sativa Japonica Group]
Length=329

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 104/152 (68%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L++NPPK GD SY+ F+ E  GIL SL +RA+ + + FNS   + C
Sbjct  178  VNLCSNVSGQILASLIMNPPKAGDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITC  237

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FP+I LP +AI  AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H
Sbjct  238  NKAEGAMYLFPRIYLPQKAIGAAQAAGTAPDAYYARRLLEATGIVVVPGSGFGQVPGTWH  297

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
             R TILP E+ +PAI+  FK+F+++FMD++ D
Sbjct  298  FRCTILPQEDKIPAIISKFKEFHEKFMDEFRD  329



>ref|XP_004992298.1| alanine aminotransferase [Salpingoeca rosetta]
 gb|EGD75245.1| alanine aminotransferase [Salpingoeca rosetta]
Length=481

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 112/162 (69%), Gaps = 0/162 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            PG L +  ++    L     GQ+ +GLM NPPKPGD SY+Q+ +E   I +SL++RA ++
Sbjct  314  PGALDQLYKVFSIGLSSNVDGQLMMGLMCNPPKPGDASYEQYEQECDAIFQSLKRRAEMI  373

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            ++ FN+   V C   EGA+Y+FP++RLP  A++ A+     PD++YCL+LL ATGI  VP
Sbjct  374  SNAFNALPGVSCQNVEGALYAFPRVRLPEAAVKEAEKKDMGPDLFYCLELLHATGICAVP  433

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GSGFGQ+EG FH RTTILPAEE MP +++ F  F+ +F+ ++
Sbjct  434  GSGFGQEEGTFHFRTTILPAEEQMPRVIDLFTSFHKDFLQRF  475



>ref|XP_006649511.1| PREDICTED: alanine aminotransferase 2-like [Oryza brachyantha]
Length=482

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 109/159 (69%), Gaps = 3/159 (2%)
 Frame = -1

Query  601  RLLQYPLVQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFN  431
            +L +   V +C    GQI   L++NPPK GD SYD ++ E  GIL+SL +RA+ M   FN
Sbjct  324  QLYKIASVNLCSNITGQILSSLIMNPPKAGDGSYDLYMEEKDGILKSLARRAKAMESAFN  383

Query  430  SCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFG  251
            S   + CN TEGAMY FPQI LP +AIE A+ + KAPD +Y L+LL+ TGI   PGSGFG
Sbjct  384  SIDGITCNKTEGAMYLFPQIYLPHKAIEAARAVNKAPDAFYALRLLDTTGIVVTPGSGFG  443

Query  250  QKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            Q  G +H+R TILP EE +P+++  F++F++EFM QY D
Sbjct  444  QVAGTWHVRCTILPQEEKIPSMIARFREFHEEFMAQYRD  482



>ref|XP_006657961.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Oryza 
brachyantha]
Length=453

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 103/152 (68%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L++NPPK GD SY+ F+ E  GIL SL +RA+ + + FNS   + C
Sbjct  302  VNLCSNVSGQILASLIMNPPKAGDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITC  361

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FP+I LP +AI  AQ  G  PD YY  +LLEATGI  VPGSGFGQ  G +H
Sbjct  362  NKAEGAMYLFPRIHLPQKAIGAAQAAGTVPDAYYARRLLEATGIVVVPGSGFGQVPGTWH  421

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
             R TILP E+ +PAI+  FK+F+++FMD+Y D
Sbjct  422  FRCTILPQEDKIPAIISKFKEFHEKFMDEYRD  453



>tpg|DAA63613.1| TPA: hypothetical protein ZEAMMB73_743428 [Zea mays]
Length=329

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 107/164 (65%), Gaps = 0/164 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V  +  ++    L     GQI   L++NPPK GD S++ F+ E  GIL SL +RA+ +
Sbjct  166  PEVREQIYKVASVNLCSNVSGQILASLVMNPPKAGDESFESFMSEKDGILSSLARRAKAL  225

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
             + FNS   + CN  EGAMY FP++ LP +AI  AQ +G APD YY  +LLEATGI  VP
Sbjct  226  EEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGAAQAVGTAPDAYYAKRLLEATGIVVVP  285

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            GSGFGQ  G +H R TILP E+ +PAI+   K+F+++FMD++ D
Sbjct  286  GSGFGQVPGTWHFRCTILPQEDKIPAIVSRLKEFHEKFMDEFRD  329



>ref|XP_008907369.1| hypothetical protein PPTG_13440 [Phytophthora parasitica INRA-310]
 gb|ETN06993.1| hypothetical protein PPTG_13440 [Phytophthora parasitica INRA-310]
 gb|ETO72425.1| hypothetical protein F444_11432 [Phytophthora parasitica P1976]
Length=499

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 107/157 (68%), Gaps = 0/157 (0%)
 Frame = -1

Query  610  RYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFN  431
            ++ +L+   L     GQ+ +G+M NPP+PGD SY+++  +  G L SL++RA  +   FN
Sbjct  342  QFYKLMSVNLCSNIDGQLVVGMMTNPPQPGDASYERYAEQRDGTLGSLKRRAEKLVKAFN  401

Query  430  SCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFG  251
                V CN TEGAMY+FP + LPP+A+E A+  G APD +YC+++L+ TGI  VPGSGFG
Sbjct  402  ELEGVTCNETEGAMYTFPNLTLPPKAVEAAKEAGMAPDAFYCMQMLDETGIVVVPGSGFG  461

Query  250  QKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            QKEG +H RTTILP E+ +  ++E   KF+  FMD+Y
Sbjct  462  QKEGTWHFRTTILPPEDAVDDVIEKTSKFHARFMDKY  498



>gb|ETP41623.1| hypothetical protein F442_11247 [Phytophthora parasitica P10297]
Length=499

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 107/157 (68%), Gaps = 0/157 (0%)
 Frame = -1

Query  610  RYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFN  431
            ++ +L+   L     GQ+ +G+M NPP+PGD SY+++  +  G L SL++RA  +   FN
Sbjct  342  QFYKLMSVNLCSNIDGQLVVGMMTNPPQPGDASYERYAEQRDGTLGSLKRRAEKLVKAFN  401

Query  430  SCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFG  251
                V CN TEGAMY+FP + LPP+A+E A+  G APD +YC+++L+ TGI  VPGSGFG
Sbjct  402  ELEGVTCNETEGAMYTFPNLTLPPKAVEAAKEAGMAPDAFYCMQMLDETGIVVVPGSGFG  461

Query  250  QKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            QKEG +H RTTILP E+ +  ++E   KF+  FMD+Y
Sbjct  462  QKEGTWHFRTTILPPEDAVDDVIEKTSKFHARFMDKY  498



>gb|ETP13560.1| hypothetical protein F441_11279 [Phytophthora parasitica CJ01A1]
Length=499

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 107/157 (68%), Gaps = 0/157 (0%)
 Frame = -1

Query  610  RYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFN  431
            ++ +L+   L     GQ+ +G+M NPP+PGD SY+++  +  G L SL++RA  +   FN
Sbjct  342  QFYKLMSVNLCSNIDGQLVVGMMTNPPQPGDASYERYAEQRDGTLGSLKRRAEKLVKAFN  401

Query  430  SCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFG  251
                V CN TEGAMY+FP + LPP+A+E A+  G APD +YC+++L+ TGI  VPGSGFG
Sbjct  402  ELEGVTCNETEGAMYTFPNLTLPPKAVEAAKEAGMAPDAFYCMQMLDETGIVVVPGSGFG  461

Query  250  QKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            QKEG +H RTTILP E+ +  ++E   KF+  FMD+Y
Sbjct  462  QKEGTWHFRTTILPPEDAVDDVIEKTSKFHARFMDKY  498



>emb|CDJ93113.1| Aminotransferase domain containing protein [Haemonchus contortus]
Length=505

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 112/163 (69%), Gaps = 0/163 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V   + +++   L     GQ+ +  +VNPPKPGD SYDQ+++E   +L SL++RA ++
Sbjct  343  PEVYVLFKKMISAKLCSTILGQVMMDALVNPPKPGDPSYDQWLKEKNAVLASLKERATLV  402

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
             + + S   + CN  +GAMY+FPQ+ LPPRA+E A+ L   PD +Y ++LLE+TG+  VP
Sbjct  403  KEAYGSIEGIKCNEVQGAMYAFPQLMLPPRAVEKARSLNMEPDFFYAMQLLESTGVCIVP  462

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  137
            GSGFGQKEG +H RTTILP  E M  ++E FK F+ +FM++Y+
Sbjct  463  GSGFGQKEGTYHFRTTILPQTEMMKDMLERFKSFHTKFMEEYK  505



>ref|XP_006657960.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Oryza 
brachyantha]
Length=491

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 103/152 (68%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L++NPPK GD SY+ F+ E  GIL SL +RA+ + + FNS   + C
Sbjct  340  VNLCSNVSGQILASLIMNPPKAGDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITC  399

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FP+I LP +AI  AQ  G  PD YY  +LLEATGI  VPGSGFGQ  G +H
Sbjct  400  NKAEGAMYLFPRIHLPQKAIGAAQAAGTVPDAYYARRLLEATGIVVVPGSGFGQVPGTWH  459

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
             R TILP E+ +PAI+  FK+F+++FMD+Y D
Sbjct  460  FRCTILPQEDKIPAIISKFKEFHEKFMDEYRD  491



>tpg|DAA41461.1| TPA: hypothetical protein ZEAMMB73_764403 [Zea mays]
 tpg|DAA41462.1| TPA: hypothetical protein ZEAMMB73_764403 [Zea mays]
Length=330

 Score =   169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 108/165 (65%), Gaps = 0/165 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V  +  ++    L     GQI   L++NPPK GD S++ F  E  GIL SL +RA+ +
Sbjct  166  PQVRDQIYKMASINLCSNITGQILASLVMNPPKAGDESFESFRLERDGILSSLGRRAKAL  225

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
             + FNS   + CN  EGAMY FP++ LP +AI  AQ  G APD YY  +LLEATGI  VP
Sbjct  226  EEAFNSLEGITCNKAEGAMYLFPRLHLPRKAIGAAQAAGTAPDAYYAKRLLEATGIVFVP  285

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  131
            GSGFGQ  G +H+R+TILP E+ +P I+  FK+F+D+FMD++ D+
Sbjct  286  GSGFGQVPGTWHIRSTILPQEDKIPGIVSRFKEFHDKFMDEFRDY  330



>dbj|BAC79866.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
 dbj|BAC79995.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
Length=486

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 104/152 (68%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L++NPPK GD SY+ F+ E  GIL SL +RA+ + + FNS   + C
Sbjct  335  VNLCSNVSGQILASLIMNPPKAGDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITC  394

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FP+I LP +AI  AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H
Sbjct  395  NKAEGAMYLFPRIYLPQKAIGAAQAAGTAPDAYYARRLLEATGIVVVPGSGFGQVPGTWH  454

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
             R TILP E+ +PAI+  FK+F+++FMD++ D
Sbjct  455  FRCTILPQEDKIPAIISKFKEFHEKFMDEFRD  486



>ref|XP_002906656.1| alanine aminotransferase 2 [Phytophthora infestans T30-4]
 gb|EEY66057.1| alanine aminotransferase 2 [Phytophthora infestans T30-4]
Length=499

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 107/161 (66%), Gaps = 0/161 (0%)
 Frame = -1

Query  622  GVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMT  443
            G   ++ +L+   L     GQ+ +G+M NPP+PGD SY+++  +  G L SL++RA  + 
Sbjct  338  GAKDQFYKLMSVNLCSNIEGQLVVGMMTNPPQPGDASYERYAEQRDGTLGSLKRRAEKLV  397

Query  442  DGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPG  263
              FN    V CN TEGAMY+FP + LPP+A+E A+  G APD +YC ++L+ TGI  VPG
Sbjct  398  KAFNELEGVTCNETEGAMYTFPNLTLPPKAVEAAKEAGMAPDAFYCTQMLDDTGIVVVPG  457

Query  262  SGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            SGFGQKEG +H RTTILP E+ +  ++E   KF+ +FMD Y
Sbjct  458  SGFGQKEGTWHFRTTILPPEDAVDDVIEMTSKFHAKFMDTY  498



>ref|XP_006661735.1| PREDICTED: alanine aminotransferase 2-like [Oryza brachyantha]
Length=483

 Score =   172 bits (436),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 103/152 (68%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L++NPPK GD SY  +  E  GIL+SL +RA+ + D FN+   + C
Sbjct  332  VNLCSNITGQILASLVMNPPKAGDASYASYKAEKDGILQSLARRAKALEDAFNNLEGITC  391

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N TEGAMY FPQ+ LP +AIE A+   KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H
Sbjct  392  NKTEGAMYLFPQLLLPRKAIEAAKAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWH  451

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            +R TILP EE +PAI+  FK F++ FM  Y D
Sbjct  452  IRCTILPQEEKIPAIITRFKTFHESFMAAYRD  483



>ref|NP_001064504.1| Os10g0390500 [Oryza sativa Japonica Group]
 dbj|BAA77260.1| alanine aminotransferase [Oryza sativa]
 dbj|BAA77261.1| alanine aminotransferase [Oryza sativa]
 gb|ABB47494.1| Alanine aminotransferase 2, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26418.1| Os10g0390500 [Oryza sativa Japonica Group]
 gb|ACA50484.1| alanine aminotransferase [Oryza sativa Japonica Group]
 gb|EEC66876.1| hypothetical protein OsI_33417 [Oryza sativa Indica Group]
 gb|EEE50893.1| hypothetical protein OsJ_31385 [Oryza sativa Japonica Group]
Length=483

 Score =   172 bits (436),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 103/152 (68%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L++NPPK GD SY  +  E  GIL+SL +RA+ + + FNS   + C
Sbjct  332  VNLCSNITGQILASLVMNPPKAGDASYASYKAEKDGILQSLARRAKALENAFNSLEGITC  391

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N TEGAMY FPQ+ LP +AI+ A+   KAPD +Y L+LLEATGI  VPGSGFGQ  G +H
Sbjct  392  NKTEGAMYLFPQLSLPQKAIDAAKAANKAPDAFYALRLLEATGIVVVPGSGFGQVPGTWH  451

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            +R TILP EE +PAI+  FK F++ FM  Y D
Sbjct  452  IRCTILPQEEKIPAIISRFKAFHEGFMAAYRD  483



>gb|AFK38994.1| unknown [Lotus japonicus]
Length=136

 Score =   162 bits (411),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 97/136 (71%), Gaps = 0/136 (0%)
 Frame = -1

Query  541  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  362
            ++PPK GD SY+ F+ E + IL SL +RA+I+ DGFN    V CN  EGAMY FPQIRLP
Sbjct  1    MSPPKVGDESYESFMAEKENILSSLARRAKILEDGFNKLEGVTCNQAEGAMYLFPQIRLP  60

Query  361  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  182
             +AI+ A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP EE +PAI+
Sbjct  61   QKAIKAAEAANTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIV  120

Query  181  ESFKKFNDEFMDQYED  134
              F +F+++FM+++ D
Sbjct  121  SRFTEFHEKFMNEFRD  136



>gb|AAK52114.1|AC079936_10 Putative alanine aminotransferase [Oryza sativa Japonica Group]
Length=484

 Score =   172 bits (436),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 103/152 (68%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L++NPPK GD SY  +  E  GIL+SL +RA+ + + FNS   + C
Sbjct  333  VNLCSNITGQILASLVMNPPKAGDASYASYKAEKDGILQSLARRAKALENAFNSLEGITC  392

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N TEGAMY FPQ+ LP +AI+ A+   KAPD +Y L+LLEATGI  VPGSGFGQ  G +H
Sbjct  393  NKTEGAMYLFPQLSLPQKAIDAAKAANKAPDAFYALRLLEATGIVVVPGSGFGQVPGTWH  452

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            +R TILP EE +PAI+  FK F++ FM  Y D
Sbjct  453  IRCTILPQEEKIPAIISRFKAFHEGFMAAYRD  484



>gb|KIY92376.1| hypothetical protein MNEG_15586 [Monoraphidium neglectum]
Length=157

 Score =   163 bits (413),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 110/152 (72%), Gaps = 0/152 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            PG +    ++    L     GQI +  MVNPP PG  SYD + +E +G L SLR+RA ++
Sbjct  6    PGAIEEMYKIASINLSPGTVGQIAMSCMVNPPAPGSPSYDLWRQEREGELASLRRRAHMV  65

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFNS   V CNFTEGAMY+FP++ LPP+A+  A+  GKAPDV+YCL+LLEATGISTVP
Sbjct  66   TDGFNSLEGVTCNFTEGAMYAFPRLHLPPKAVAAAKAAGKAPDVFYCLRLLEATGISTVP  125

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFK  170
            GSGFGQ+EG FHLRTTILP EE M   ++ FK
Sbjct  126  GSGFGQEEGTFHLRTTILPREEKMAEFVQLFK  157



>gb|ETI43749.1| hypothetical protein F443_11362 [Phytophthora parasitica P1569]
Length=499

 Score =   171 bits (434),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 106/157 (68%), Gaps = 0/157 (0%)
 Frame = -1

Query  610  RYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFN  431
            ++ +L+   L     GQ+ +G+M NPP+PGD SY+++  +  G L SL++RA  +   FN
Sbjct  342  QFYKLMSVNLCSNIDGQLVVGMMTNPPQPGDASYERYAEQRDGTLGSLKRRAEKLVKAFN  401

Query  430  SCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFG  251
                V CN TEGAMY+FP + LPP+A+E A+  G APD +YC+++L+ TGI  VPGSGFG
Sbjct  402  ELEGVTCNETEGAMYTFPNLTLPPKAVEAAKEAGMAPDAFYCMQMLDETGIVVVPGSGFG  461

Query  250  QKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            QK G +H RTTILP E+ +  ++E   KF+  FMD+Y
Sbjct  462  QKAGTWHFRTTILPPEDAVDDVIEKTSKFHARFMDKY  498



>gb|EEE67593.1| hypothetical protein OsJ_25140 [Oryza sativa Japonica Group]
Length=546

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 104/152 (68%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L++NPPK GD SY+ F+ E  GIL SL +RA+ + + FNS   + C
Sbjct  395  VNLCSNVSGQILASLIMNPPKAGDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITC  454

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FP+I LP +AI  AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H
Sbjct  455  NKAEGAMYLFPRIYLPQKAIGAAQAAGTAPDAYYARRLLEATGIVVVPGSGFGQVPGTWH  514

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
             R TILP E+ +PAI+  FK+F+++FMD++ D
Sbjct  515  FRCTILPQEDKIPAIISKFKEFHEKFMDEFRD  546



>gb|EEC82447.1| hypothetical protein OsI_26881 [Oryza sativa Indica Group]
Length=546

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 104/152 (68%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L++NPPK GD SY+ F+ E  GIL SL +RA+ + + FNS   + C
Sbjct  395  VNLCSNVSGQILASLIMNPPKAGDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITC  454

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FP+I LP +AI  AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H
Sbjct  455  NKAEGAMYLFPRIYLPQKAIGAAQAAGTAPDAYYARRLLEATGIVVVPGSGFGQVPGTWH  514

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
             R TILP E+ +PAI+  FK+F+++FMD++ D
Sbjct  515  FRCTILPQEDKIPAIISKFKEFHEKFMDEFRD  546



>gb|EEC74641.1| hypothetical protein OsI_10280 [Oryza sativa Indica Group]
Length=494

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 108/159 (68%), Gaps = 3/159 (2%)
 Frame = -1

Query  601  RLLQYPLVQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFN  431
            +L +   V +C    GQI   L+++PPK GD SYD +  E   IL+SL +RA+ M   FN
Sbjct  336  QLYKIASVNLCSNITGQILASLIMDPPKAGDASYDLYEEERDNILKSLSRRAKAMESAFN  395

Query  430  SCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFG  251
            S   + CN TEGAMY FP+I LP +AIE A+ + KAPDV+Y L+LL+ TGI   PGSGFG
Sbjct  396  SIDGITCNKTEGAMYLFPRIYLPQKAIEAARAVNKAPDVFYALRLLDTTGIVVTPGSGFG  455

Query  250  QKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            Q  G +H+R TILP EE +P+++  F++F++EFM QY D
Sbjct  456  QVAGTWHVRCTILPQEEKIPSMISRFREFHEEFMSQYRD  494



>gb|AAV64199.1| putative alanine aminotransferase [Zea mays]
Length=516

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 107/164 (65%), Gaps = 0/164 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V  +  ++    L     GQI   L++NPPK GD S++ F+ E  GIL SL +RA+ +
Sbjct  353  PEVREQIYKVASVNLCSNVSGQILASLVMNPPKAGDESFESFMSEKDGILSSLARRAKAL  412

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
             + FNS   + CN  EGAMY FP++ LP +AI  AQ +G APD YY  +LLEATGI  VP
Sbjct  413  EEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGAAQAVGTAPDAYYAKRLLEATGIVVVP  472

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            GSGFGQ  G +H R TILP E+ +PAI+   K+F+++FMD++ D
Sbjct  473  GSGFGQVPGTWHFRCTILPQEDKIPAIVSRLKEFHEKFMDEFRD  516



>gb|AAV64237.1| putative alanine aminotransferase [Zea mays]
Length=516

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 107/164 (65%), Gaps = 0/164 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V  +  ++    L     GQI   L++NPPK GD S++ F+ E  GIL SL +RA+ +
Sbjct  353  PDVREQIYKVASVNLCSNVSGQILASLVMNPPKAGDESFESFMSERDGILSSLARRAKAL  412

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
             + FNS   + CN  EGAMY FP++ LP +AI  AQ +G APD YY  +LLEATGI  VP
Sbjct  413  EEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGAAQAVGTAPDAYYAKRLLEATGIVVVP  472

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            GSGFGQ  G +H R TILP E+ +PAI+   K+F+++FMD++ D
Sbjct  473  GSGFGQVPGTWHFRCTILPQEDKIPAIVSRLKEFHEKFMDEFRD  516



>ref|XP_002463187.1| hypothetical protein SORBIDRAFT_02g039340 [Sorghum bicolor]
 gb|EER99708.1| hypothetical protein SORBIDRAFT_02g039340 [Sorghum bicolor]
Length=541

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 107/164 (65%), Gaps = 0/164 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V  +  ++    L     GQI   L++NPPK GD S++ F+ E  GIL SL +RA+ +
Sbjct  378  PEVREQIYKVASVNLCSNVSGQILASLVMNPPKAGDESFESFMLERDGILSSLARRAKAL  437

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
             + FNS   + CN  EGAMY FP++ LP +AI  AQ  G APD YY  +LLEATGI  VP
Sbjct  438  EEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGAAQAAGTAPDAYYAKRLLEATGIVVVP  497

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            GSGFGQ  G +H R TILP E+ +PAI+  FK+F+++FMD++ D
Sbjct  498  GSGFGQVPGTWHFRCTILPQEDKIPAIISRFKEFHEKFMDEFRD  541



>ref|NP_001086104.1| alanine aminotransferase 2 [Xenopus laevis]
 sp|Q6GM82.1|ALAT2_XENLA RecName: Full=Alanine aminotransferase 2; Short=ALT2; AltName: 
Full=Glutamate pyruvate transaminase 2; Short=GPT 2; AltName: 
Full=Glutamic--alanine transaminase 2; AltName: Full=Glutamic--pyruvic 
transaminase 2 [Xenopus laevis]
 gb|AAH74194.1| Gpt2 protein [Xenopus laevis]
Length=540

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 112/162 (69%), Gaps = 0/162 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V ++ T+L+   L    PGQ+ L ++VNPPKPG+ SY QF+ E + +L +L ++AR+ 
Sbjct  378  PAVKQQLTKLVSVRLCPPVPGQVLLDVIVNPPKPGEPSYKQFISEKQAVLNNLAEKARLT  437

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
             +  N    + CN  +GAMYSFP+I +P +AI+ AQ  G+APD+++C+KLLE TGI  VP
Sbjct  438  EEILNQAPGIRCNPVQGAMYSFPRIHIPEKAIKLAQAEGQAPDMFFCMKLLEETGICVVP  497

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GSGFGQ+EG  H R TILP  + + +++E  K F+ +FMD+Y
Sbjct  498  GSGFGQREGTHHFRMTILPPTDKLKSLLERLKDFHQKFMDEY  539



>ref|XP_008653343.1| PREDICTED: alanine aminotransferase 2 [Zea mays]
Length=541

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 107/164 (65%), Gaps = 0/164 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V  +  ++    L     GQI   L++NPPK GD S++ F+ E  GIL SL +RA+ +
Sbjct  378  PEVREQIYKVASVNLCSNVSGQILASLVMNPPKAGDESFESFMSEKDGILSSLARRAKAL  437

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
             + FNS   + CN  EGAMY FP++ LP +AI  AQ +G APD YY  +LLEATGI  VP
Sbjct  438  EEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGAAQAVGTAPDAYYAKRLLEATGIVVVP  497

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            GSGFGQ  G +H R TILP E+ +PAI+   K+F+++FMD++ D
Sbjct  498  GSGFGQVPGTWHFRCTILPQEDKIPAIVSRLKEFHEKFMDEFRD  541



>ref|XP_002887430.1| ALAAT2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63689.1| ALAAT2 [Arabidopsis lyrata subsp. lyrata]
Length=535

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 101/152 (66%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L+++PPKPGD SYD ++ E  GIL S+ KRA+ + DG NS   V C
Sbjct  384  VNLCSNISGQILASLVMSPPKPGDDSYDSYMAERDGILSSMAKRAKTLEDGLNSLEGVTC  443

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FP+I LP +AIE A+    APD +YC +LL ATG+  VPGSGFGQ  G +H
Sbjct  444  NRAEGAMYLFPRINLPQKAIEAAEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQAPGTWH  503

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
             R TILP E+ +PAI+    +F+  FMD++ D
Sbjct  504  FRCTILPQEDKIPAIVNRLTEFHKSFMDEFRD  535



>gb|ETL95505.1| hypothetical protein L917_06707 [Phytophthora parasitica]
 gb|ETM48704.1| hypothetical protein L914_06798 [Phytophthora parasitica]
 gb|ETO72416.1| hypothetical protein F444_11426 [Phytophthora parasitica P1976]
Length=177

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 110/164 (67%), Gaps = 0/164 (0%)
 Frame = -1

Query  622  GVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMT  443
            G   ++ +L+   L     GQ+ +G+M NPP+PGD SY +++ +  G L SL++RA  + 
Sbjct  9    GAKDQFYKLMSVNLCSNIEGQLMVGMMTNPPQPGDASYQRYIEQRDGTLHSLKRRAIKLV  68

Query  442  DGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPG  263
              FN+   + CN TEGA+Y+FP I LP +A+E A+  G APD +YC+++L+ TGI  VPG
Sbjct  69   KAFNNLEGITCNETEGALYTFPSISLPAKAVEAAKEAGMAPDAFYCMQMLDETGIVVVPG  128

Query  262  SGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  131
            SGFGQK G +H R+TILP EE +  ++E   KF+ +FMD+Y ++
Sbjct  129  SGFGQKAGTWHFRSTILPPEEAVDEVIEKTAKFHAKFMDKYREN  172



>ref|XP_007441690.1| PREDICTED: alanine aminotransferase 2-like isoform X3 [Python 
bivittatus]
 ref|XP_007441691.1| PREDICTED: alanine aminotransferase 2-like isoform X4 [Python 
bivittatus]
 ref|XP_007441692.1| PREDICTED: alanine aminotransferase 2-like isoform X5 [Python 
bivittatus]
Length=492

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 114/169 (67%), Gaps = 6/169 (4%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRA  455
            P V ++ T+L+    V++CP   GQI L  MVN P+PGD SY QF +E   +L +L ++A
Sbjct  326  PAVQQQLTKLVS---VRLCPPVTGQILLDAMVNQPQPGDPSYQQFSQEKAAVLGALARKA  382

Query  454  RIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGIS  275
            ++  + FN    + CN  +GAMY+FP+I LPPRA++ A+  G+APD+++CLKLLE TGI 
Sbjct  383  QLTEEIFNRAPGIHCNSVQGAMYAFPRIELPPRAVQDAEAQGQAPDMFFCLKLLEETGIC  442

Query  274  TVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHR  128
             VPGSGFGQKEG FH R TILP +E +  +++   +F+ +F  +Y   +
Sbjct  443  VVPGSGFGQKEGTFHFRMTILPPQEKLEILLQKLSQFHAKFTQEYSQRQ  491



>emb|CDJ93112.1| Aminotransferase domain containing protein [Haemonchus contortus]
Length=416

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 108/163 (66%), Gaps = 0/163 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V  ++ ++    L     GQ  +  +VNPPKPGD SYDQ+++E   +L SL++RA ++
Sbjct  254  PEVYVQFKKMTSAKLCSTVLGQAAMDALVNPPKPGDPSYDQWLKEKTAVLASLKERATLV  313

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
             + + S   + CN  +GAMY+FPQI LP RAIE A+ L   PD +Y ++LLEATG+  VP
Sbjct  314  KEAYGSIDGIKCNEVQGAMYAFPQIMLPRRAIEKARSLNMEPDFFYAMQLLEATGVCIVP  373

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  137
            GSGFGQKEG +H RTTILP    M  ++E FK F+ +FM +Y+
Sbjct  374  GSGFGQKEGTWHFRTTILPQTAMMKDMLERFKSFHTKFMKEYK  416



>ref|XP_007441689.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Python 
bivittatus]
Length=507

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 114/169 (67%), Gaps = 6/169 (4%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRA  455
            P V ++ T+L+    V++CP   GQI L  MVN P+PGD SY QF +E   +L +L ++A
Sbjct  341  PAVQQQLTKLVS---VRLCPPVTGQILLDAMVNQPQPGDPSYQQFSQEKAAVLGALARKA  397

Query  454  RIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGIS  275
            ++  + FN    + CN  +GAMY+FP+I LPPRA++ A+  G+APD+++CLKLLE TGI 
Sbjct  398  QLTEEIFNRAPGIHCNSVQGAMYAFPRIELPPRAVQDAEAQGQAPDMFFCLKLLEETGIC  457

Query  274  TVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHR  128
             VPGSGFGQKEG FH R TILP +E +  +++   +F+ +F  +Y   +
Sbjct  458  VVPGSGFGQKEGTFHFRMTILPPQEKLEILLQKLSQFHAKFTQEYSQRQ  506



>gb|EFA80185.1| alanine transaminase [Polysphondylium pallidum PN500]
Length=599

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 102/151 (68%), Gaps = 3/151 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            + +CP   GQI + LMV PP  G+ SYD +V+E   I +SL++RA ++    N    V C
Sbjct  449  IGLCPNVTGQIVVDLMVRPPVAGEQSYDTYVKERDTIFDSLKRRANLLAAALNGLEGVTC  508

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY+FPQIRLP RAIE A+  GKAPD YYC++LLEATGI  VPGSGFGQK+G +H
Sbjct  509  NQPEGAMYAFPQIRLPARAIEEAKANGKAPDAYYCIQLLEATGICVVPGSGFGQKDGTYH  568

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYE  137
             RTT LP+E+ +  +      F+  FM +Y+
Sbjct  569  FRTTFLPSEQAIQGVCTRIADFHKNFMAKYK  599



>ref|XP_002499950.1| alanine aminotransferase [Micromonas sp. RCC299]
 gb|ACO61208.1| alanine aminotransferase [Micromonas sp. RCC299]
Length=463

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 105/159 (66%), Gaps = 4/159 (3%)
 Frame = -1

Query  604  TRLLQYPLVQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGF  434
              L +   V +CP   GQ+ +GL+++PPKPGD SY+ +  E   IL SL++RA  +  G 
Sbjct  304  AELYKLASVGLCPNLSGQVLMGLVMSPPKPGDPSYELYAAERDAILSSLKRRALKLVSGL  363

Query  433  NSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK-APDVYYCLKLLEATGISTVPGSG  257
            N+   V CN  +GAMY+FP++ LP + +  A   GK APD  YC+KLLEATGI  VPGSG
Sbjct  364  NALEGVTCNEAQGAMYAFPKVSLPEKFVAEATASGKMAPDALYCMKLLEATGIVVVPGSG  423

Query  256  FGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            FGQ EG +H RTT LP+EED+  ++E   KF+ EFMD Y
Sbjct  424  FGQVEGTWHFRTTFLPSEEDIGGVVEKLAKFHAEFMDTY  462



>ref|XP_007441688.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Python 
bivittatus]
Length=518

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 114/169 (67%), Gaps = 6/169 (4%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRA  455
            P V ++ T+L+    V++CP   GQI L  MVN P+PGD SY QF +E   +L +L ++A
Sbjct  352  PAVQQQLTKLVS---VRLCPPVTGQILLDAMVNQPQPGDPSYQQFSQEKAAVLGALARKA  408

Query  454  RIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGIS  275
            ++  + FN    + CN  +GAMY+FP+I LPPRA++ A+  G+APD+++CLKLLE TGI 
Sbjct  409  QLTEEIFNRAPGIHCNSVQGAMYAFPRIELPPRAVQDAEAQGQAPDMFFCLKLLEETGIC  468

Query  274  TVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHR  128
             VPGSGFGQKEG FH R TILP +E +  +++   +F+ +F  +Y   +
Sbjct  469  VVPGSGFGQKEGTFHFRMTILPPQEKLEILLQKLSQFHAKFTQEYSQRQ  517



>ref|XP_005833147.1| hypothetical protein GUITHDRAFT_157749 [Guillardia theta CCMP2712]
 gb|EKX46167.1| hypothetical protein GUITHDRAFT_157749 [Guillardia theta CCMP2712]
Length=473

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 105/162 (65%), Gaps = 0/162 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V+ +  +L    L     GQI + LMVNPP  GD S+DQ+ RE K + ESL++R++ +
Sbjct  311  PVVVEQIYKLFSISLCSNIAGQIIVDLMVNPPAKGDPSHDQYEREMKDLFESLKRRSQKL  370

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
                NS +N+ C    GAMY+FP I LPP A++ A+  G  PD +Y ++LL+ATGI  VP
Sbjct  371  HAALNSMKNITCTEIGGAMYAFPSIHLPPSAVQAAKEAGMTPDTFYAVELLDATGICVVP  430

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GSGF QK+G FH RTT LP+E  M  +++  +KFN  FMD+Y
Sbjct  431  GSGFRQKQGSFHFRTTFLPSESKMDDVIDKLRKFNQSFMDKY  472



>ref|XP_009059448.1| hypothetical protein LOTGIDRAFT_192553, partial [Lottia gigantea]
 gb|ESO89980.1| hypothetical protein LOTGIDRAFT_192553, partial [Lottia gigantea]
Length=484

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 111/162 (69%), Gaps = 0/162 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V  +Y + +   L     GQ+ +  +VNPPKPGD+SYD F +E   +L+SL ++A ++
Sbjct  323  PEVRAQYNKSISANLCPPSSGQVVIDCVVNPPKPGDLSYDLFKKEKDEVLKSLAEKATLV  382

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TD FNS   + CN  +GAMY+FP+I LP +AIE A+   K+PD +YC +LLE TGI TVP
Sbjct  383  TDTFNSIEGIKCNQVQGAMYAFPRIFLPDKAIEEAKKNDKSPDAFYCFQLLEETGICTVP  442

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GSGF Q++G FH RTTILP  + + ++++ FK+F+  FM +Y
Sbjct  443  GSGFRQRDGTFHFRTTILPPIDTLKSVLKDFKEFHVNFMKKY  484



>ref|XP_005443445.1| PREDICTED: alanine aminotransferase 2-like [Falco cherrug]
Length=422

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 107/162 (66%), Gaps = 0/162 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V ++  +L+   L    PGQI L  +V+PP+PGD SY+ F+ E K +L +L  +AR+ 
Sbjct  260  PDVQQQLAKLVSVRLCPPVPGQILLDTVVDPPQPGDPSYELFIAEKKAVLSALAHKARLT  319

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
             + FN    + CN  +GAMYSFP+I LPPRA+  A+  G+APD+++C+KLLE TGI  VP
Sbjct  320  QEIFNQVPGIRCNPVQGAMYSFPRIELPPRALAAAKAQGQAPDMFFCMKLLEETGICVVP  379

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GSGFGQ+EG FH R TILP  E +  ++E    F  +F+ +Y
Sbjct  380  GSGFGQREGTFHFRMTILPPTEKLQVLLEKLSSFYTKFVKEY  421



>ref|XP_005230442.1| PREDICTED: alanine aminotransferase 2-like [Falco peregrinus]
Length=436

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 107/162 (66%), Gaps = 0/162 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V ++  +L+   L    PGQI L  +V+PP+PGD SY+ F+ E K +L +L  +AR+ 
Sbjct  274  PDVQQQLAKLVSVRLCPPVPGQILLDTVVDPPQPGDPSYELFIAEKKAVLSALAHKARLT  333

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
             + FN    + CN  +GAMYSFP+I LPPRA+  A+  G+APD+++C+KLLE TGI  VP
Sbjct  334  QEIFNQVPGIRCNPVQGAMYSFPRIELPPRALAAAKAQGQAPDMFFCMKLLEETGICVVP  393

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GSGFGQ+EG FH R TILP  E +  ++E    F  +F+ +Y
Sbjct  394  GSGFGQREGTFHFRMTILPPTEKLQVLLEKLSSFYTKFIKEY  435



>ref|XP_008783332.1| PREDICTED: alanine aminotransferase 2 [Phoenix dactylifera]
Length=526

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 102/152 (67%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L++NPPK GD SY+ F+ E  GIL SL +RA+ + D FNS   V C
Sbjct  375  VNLCSNISGQILASLVMNPPKVGDESYESFIAEKNGILSSLARRAKALEDAFNSLEGVTC  434

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FP++ LP +AIE A+ +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H
Sbjct  435  NKAEGAMYLFPRLHLPQKAIEAAKAVNVAPDAFYARRLLDATGIVVVPGSGFGQVPGTWH  494

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
             R TILP E+ +PAI+   K F++ FM+++ D
Sbjct  495  FRCTILPQEDKIPAIISHLKAFHESFMEEFHD  526



>emb|CEF68484.1| Alanine aminotransferase 1 [Strongyloides ratti]
Length=481

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 105/161 (65%), Gaps = 0/161 (0%)
 Frame = -1

Query  619  VLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTD  440
            V   + ++    L     GQ  +  +VNPPKPG+ SY+Q+  E   +L SL++RA ++ +
Sbjct  321  VFAEFKKMTSAKLCSTVVGQAVIDTVVNPPKPGEESYEQWNSEKNAVLASLKERATLVKE  380

Query  439  GFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGS  260
             +     + CN  +GAMY+FP++ LP +AIE A+ LG+ PD +Y + LLE TGI  VPGS
Sbjct  381  AYEKLEGITCNPVQGAMYAFPRVHLPTKAIEKAKSLGQEPDFFYAMSLLEETGICVVPGS  440

Query  259  GFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  137
            GFGQ+EG +H RTTILP  E M  +ME F KF++EFM +YE
Sbjct  441  GFGQREGTYHFRTTILPQPELMKEMMERFTKFHNEFMKKYE  481



>dbj|GAM23260.1| hypothetical protein SAMD00019534_064350 [Acytostelium subglobosum 
LB1]
Length=531

 Score =   167 bits (422),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 104/151 (69%), Gaps = 3/151 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            + +CP   GQ+ + LMVNPP+ G+ S+ Q++ E   I  SL++RA ++    NS   V C
Sbjct  381  IGLCPNVIGQLVVDLMVNPPQEGEASHKQYIEERDAIYNSLKRRANLLATALNSLEGVTC  440

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY+FPQIRLPP+A+E A+  GK PD +YC++LLEATGI  VPGSGFGQ++G +H
Sbjct  441  NAPEGAMYAFPQIRLPPKAVEEAKQNGKQPDAHYCIQLLEATGICVVPGSGFGQRDGTYH  500

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYE  137
             RTT LP+E+ +  + +    F+  FM +Y+
Sbjct  501  FRTTFLPSEQAIEGVCKKVADFHKAFMAKYK  531



>ref|XP_008797360.1| PREDICTED: alanine aminotransferase 2-like [Phoenix dactylifera]
Length=530

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 106/164 (65%), Gaps = 0/164 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V  +  ++    L     GQI   L++NPPK GD SY+ ++ E   IL SL +RA+ +
Sbjct  367  PDVKEQIYKVASVNLCSNISGQILASLVMNPPKVGDESYESYIAERDEILSSLARRAKAL  426

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
             D FNS   V CN  EGAMY FP++ LP +AI+ A+ +  APD YY  +LL+ATGI  VP
Sbjct  427  EDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIKAAEAVKTAPDAYYAHRLLDATGIVVVP  486

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            GSGFGQ  G +H+R+TILP E+ +PAI+   K F++ FMD++ D
Sbjct  487  GSGFGQVPGTWHIRSTILPQEDKIPAILSRLKAFHEAFMDEFRD  530



>gb|ETN63742.1| alanine aminotransferase [Anopheles darlingi]
Length=489

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 108/157 (69%), Gaps = 3/157 (2%)
 Frame = -1

Query  598  LLQYPLVQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNS  428
            LL+    Q+CP   GQ  L  +VNPP+PG+ SY+QF RE + +L+SLR RA ++ + FNS
Sbjct  333  LLKCISAQLCPTTAGQAVLDCVVNPPQPGEPSYEQFTREKQNVLDSLRDRAELVANTFNS  392

Query  427  CRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQ  248
                 CN  +GAMY+FPQIRLPP+A+E A+  GK  D +Y  +LLE TGI  VPGSGFGQ
Sbjct  393  IEGFSCNPVQGAMYAFPQIRLPPKALEAAKKDGKPADTFYAFRLLEETGICIVPGSGFGQ  452

Query  247  KEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  137
            + G +H RTTILP  E +  ++  FK F+++F+ +Y+
Sbjct  453  RPGTYHFRTTILPQTEKLKEMLGLFKTFHEKFLQKYK  489



>ref|XP_008560719.1| PREDICTED: alanine aminotransferase 1 [Microplitis demolitor]
Length=577

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 107/148 (72%), Gaps = 3/148 (2%)
 Frame = -1

Query  574  MCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNF  404
            +CP   GQ+ + ++VNPPKPG+ SY+QF++E   +LESL +R+R++ D  NS      N 
Sbjct  429  LCPTVLGQVAMDVVVNPPKPGEPSYEQFIKEKTAVLESLAERSRLVVDTLNSIPGFKSNP  488

Query  403  TEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLR  224
              GAMY FP+I LPP+AIE A+  G+APDV+Y  KLLE+TGI  +PGSGFGQK G +H+R
Sbjct  489  AMGAMYVFPRINLPPKAIEAAKAAGQAPDVFYAFKLLESTGICVIPGSGFGQKPGTYHIR  548

Query  223  TTILPAEEDMPAIMESFKKFNDEFMDQY  140
            TTILP +E +  ++ S K+F+ +FM +Y
Sbjct  549  TTILPQKEMIKTMLNSLKEFHLKFMKEY  576



>ref|XP_005775483.1| alanine aminotransferase [Emiliania huxleyi CCMP1516]
 gb|EOD23054.1| alanine aminotransferase [Emiliania huxleyi CCMP1516]
Length=541

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 97/142 (68%), Gaps = 0/142 (0%)
 Frame = -1

Query  565  GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMY  386
            GQI  GLMV PP+PGD SY+ +  E   IL S+++RA ++ DG N+   V CN  +GAMY
Sbjct  399  GQIATGLMVQPPRPGDASYEIYSGERDAILASMKRRATMLVDGLNALEGVTCNQPQGAMY  458

Query  385  SFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  206
            +FP I LPP+AI  A+  GK PD +Y L LLEATGI  VPGSGFGQKEG +H RTT LP 
Sbjct  459  AFPSITLPPKAIAAAKDAGKVPDTFYALALLEATGIVVVPGSGFGQKEGTWHFRTTFLPP  518

Query  205  EEDMPAIMESFKKFNDEFMDQY  140
            E +M  +++    F+ +FM +Y
Sbjct  519  ESEMTDVVDRMTAFHADFMGKY  540



>ref|XP_004342401.1| alanine aminotransferase, mitochondrial, putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR20285.1| alanine aminotransferase, mitochondrial, putative [Acanthamoeba 
castellanii str. Neff]
Length=514

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 106/162 (65%), Gaps = 0/162 (0%)
 Frame = -1

Query  619  VLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTD  440
            V +++ +L    L    PGQ+ + LMV PP  G+ SYD + +E+ GI ESL++RA  +T+
Sbjct  353  VKQQFYKLASISLCPNLPGQVVVDLMVRPPVAGEPSYDLYHQETTGIFESLKRRALRLTE  412

Query  439  GFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGS  260
             FN    V CN  EGAMY FP++RLP +A+  A    K PD +YCL LL+ TGI  VPGS
Sbjct  413  AFNKLEGVTCNEAEGAMYLFPRVRLPAKAVHEAVKQKKTPDSFYCLALLDQTGICVVPGS  472

Query  259  GFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            GFGQK+G +H RTT LP E+ + A+ +S  KF+ +FM +Y D
Sbjct  473  GFGQKDGTYHFRTTFLPPEDKIDAVAKSIAKFHHDFMQKYRD  514



>ref|XP_009389580.1| PREDICTED: alanine aminotransferase 2-like [Musa acuminata subsp. 
malaccensis]
Length=487

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 104/162 (64%), Gaps = 0/162 (0%)
 Frame = -1

Query  619  VLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTD  440
            V  ++ ++    L     GQI   L++NPPK GD SY  F+ E  GIL SL +RA+ + D
Sbjct  326  VREQFYKVASVNLCSNISGQIIASLVMNPPKVGDESYKSFIAEKNGILSSLARRAKALED  385

Query  439  GFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGS  260
             FNS   V CN  EGAMY FP++ LP +AI+ A+ +  APD  Y  +LL+ATGI  VPGS
Sbjct  386  AFNSLEGVTCNKAEGAMYLFPRLHLPQKAIDAAKAVIAAPDTLYARRLLDATGIVVVPGS  445

Query  259  GFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            GFGQ  G +H+R TILP E+ +PAI+   K F++ FMD++ D
Sbjct  446  GFGQVPGTWHVRCTILPQEDKIPAIISRLKAFHEAFMDEFRD  487



>gb|KHN77825.1| Alanine aminotransferase 1 [Toxocara canis]
Length=552

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 109/162 (67%), Gaps = 0/162 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V   + +++   L     GQ  L  +VNPP+PGD SYD +++E    L+SL++RAR++
Sbjct  390  PDVFTMFKKMISAKLCSTILGQTVLDCVVNPPRPGDPSYDLWLKEKTATLDSLKERARLV  449

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
             + + S   + CN  +GAMY+FPQI LPP+A++ A+ L +A D +Y ++LLEATG+  VP
Sbjct  450  KEAYGSIEGIKCNPVQGAMYAFPQIMLPPKAVQKAKSLNQAADFFYAMQLLEATGVCVVP  509

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GSGFGQK+G +H RTTILP    M  ++E FK F+ +FM +Y
Sbjct  510  GSGFGQKDGTYHFRTTILPQPPLMKEMLERFKGFHTKFMKEY  551



>ref|XP_011398130.1| putative alanine aminotransferase, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM25238.1| putative alanine aminotransferase, mitochondrial [Auxenochlorella 
protothecoides]
Length=487

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 102/160 (64%), Gaps = 3/160 (2%)
 Frame = -1

Query  604  TRLLQYPLVQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGF  434
              L +   V +CP   GQ  + LMV PP     +  Q+ ++ +  L SLR+RA +MTD F
Sbjct  328  AELYKVASVNLCPNTVGQATVSLMVAPPTGDSEAARQYAKQYEDSLASLRRRAHVMTDAF  387

Query  433  NSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGF  254
            N      CNFTEGAMYSFP++ LP +AI+ A+  GK PD +YCL LL  TGI TVPGSGF
Sbjct  388  NGLEGASCNFTEGAMYSFPRLHLPAKAIQAAKEAGKDPDTFYCLALLADTGIVTVPGSGF  447

Query  253  GQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            GQ EG FHLRTTILP E+ M   ++  + F+  FM +Y+D
Sbjct  448  GQVEGTFHLRTTILPQEDVMHEFVDKLRTFHKSFMAKYKD  487



>gb|AAK59591.2| putative alanine aminotransferase [Arabidopsis thaliana]
Length=532

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 100/152 (66%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L+++PPKPGD SYD ++ E  GIL S+ KRA+ + D  NS   V C
Sbjct  381  VNLCSNISGQILASLVMSPPKPGDDSYDSYMAERDGILSSMAKRAKTLEDALNSLEGVTC  440

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FP+I LP +AIE A+    APD +YC +LL ATG+  VPGSGFGQ  G +H
Sbjct  441  NRAEGAMYLFPRINLPQKAIEAAEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWH  500

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
             R TILP E+ +PAI+    +F+  FMD++ +
Sbjct  501  FRCTILPQEDKIPAIVNRLTEFHKSFMDEFRN  532



>gb|ADB91976.1| alanine aminotransferase [Branchiostoma belcheri]
Length=500

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 109/164 (66%), Gaps = 0/164 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V  +  +L+   L     GQ  +  +VNPP+PG+ SY+ F++E   +L SL +RA+++
Sbjct  337  PAVKLQLKKLVSTKLCPPVSGQATMDCVVNPPQPGEPSYESFIKEKTAVLTSLAERAKLV  396

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
             + FNS   V CN  +GAMY FP+I LP RA+E A+ LG++PD +Y L+LLE  GI  VP
Sbjct  397  AETFNSIEGVTCNTVQGAMYPFPRIHLPRRAVEKAKSLGQSPDGFYALQLLEQAGICVVP  456

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            GSGFGQ+EG +H RTTILP  + +   M++F  F+++F+ +Y D
Sbjct  457  GSGFGQREGTYHFRTTILPQPDKLKIFMDAFTAFHNKFLQEYAD  500



>ref|NP_001185380.1| alanine aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35307.1| alanine aminotransferase 2 [Arabidopsis thaliana]
Length=553

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 100/152 (66%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L+++PPKPGD SYD ++ E  GIL S+ KRA+ + D  NS   V C
Sbjct  402  VNLCSNISGQILASLVMSPPKPGDDSYDSYMAERDGILSSMAKRAKTLEDALNSLEGVTC  461

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FP+I LP +AIE A+    APD +YC +LL ATG+  VPGSGFGQ  G +H
Sbjct  462  NRAEGAMYLFPRINLPQKAIEAAEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWH  521

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
             R TILP E+ +PAI+    +F+  FMD++ +
Sbjct  522  FRCTILPQEDKIPAIVNRLTEFHKSFMDEFRN  553



>ref|NP_565040.2| alanine aminotransferase 2 [Arabidopsis thaliana]
 sp|Q9LDV4.1|ALAT2_ARATH RecName: Full=Alanine aminotransferase 2, mitochondrial; Short=AtAlaAT2; 
Short=AtAlaATm; AltName: Full=Alanine-2-oxoglutarate 
aminotransferase 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF82781.1|AF275371_1 alanine aminotransferase [Arabidopsis thaliana]
 gb|AAG52580.1|AC016529_11 putative alanine aminotransferase; 79592-76658 [Arabidopsis thaliana]
 gb|AEE35305.1| alanine aminotransferase 2 [Arabidopsis thaliana]
Length=540

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 100/152 (66%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L+++PPKPGD SYD ++ E  GIL S+ KRA+ + D  NS   V C
Sbjct  389  VNLCSNISGQILASLVMSPPKPGDDSYDSYMAERDGILSSMAKRAKTLEDALNSLEGVTC  448

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FP+I LP +AIE A+    APD +YC +LL ATG+  VPGSGFGQ  G +H
Sbjct  449  NRAEGAMYLFPRINLPQKAIEAAEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWH  508

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
             R TILP E+ +PAI+    +F+  FMD++ +
Sbjct  509  FRCTILPQEDKIPAIVNRLTEFHKSFMDEFRN  540



>ref|XP_009515714.1| hypothetical protein PHYSODRAFT_476244 [Phytophthora sojae]
 gb|EGZ28439.1| hypothetical protein PHYSODRAFT_476244 [Phytophthora sojae]
Length=492

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 111/163 (68%), Gaps = 0/163 (0%)
 Frame = -1

Query  622  GVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMT  443
            G   ++ +L+   L     GQ+ +G+M NPP+PGD SY++++ +  G LE+L++RA  + 
Sbjct  324  GAKDQFYKLMSVNLCSNVEGQLMVGMMTNPPQPGDASYERYIEQRDGTLEALKRRAVKLV  383

Query  442  DGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPG  263
              FN    V CN TEGAMY+FP+I +P +A+E A+  G APD +YC+++L+ TGI  VPG
Sbjct  384  KAFNELEGVTCNETEGAMYTFPKITIPAKAVEAAKAAGMAPDAFYCMQMLDETGIVVVPG  443

Query  262  SGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            SGFGQKEG +H R+TILP EE +  ++E   KF+  FMD+Y +
Sbjct  444  SGFGQKEGTWHFRSTILPPEEAVDEVIEKTVKFHANFMDKYRE  486



>ref|XP_001660470.1| AAEL009872-PA [Aedes aegypti]
 gb|EAT38206.1| AAEL009872-PA [Aedes aegypti]
Length=544

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 108/157 (69%), Gaps = 3/157 (2%)
 Frame = -1

Query  598  LLQYPLVQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNS  428
            LL+    Q+CP   GQ  + ++VNPPKPG+ SY+QF++E   +L SL+ RA ++   FNS
Sbjct  388  LLKCISAQLCPTTIGQACMDVVVNPPKPGEPSYEQFMKEKNAVLASLKVRAEMVASTFNS  447

Query  427  CRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQ  248
                 CN  +GAMY FPQIRLP +AIE A+  G+APDV+Y  +LLE TGI  VPGSGFGQ
Sbjct  448  IEGFSCNPVQGAMYCFPQIRLPEKAIEAAKKAGQAPDVFYAFQLLEQTGICIVPGSGFGQ  507

Query  247  KEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  137
            + G +H RTTILP    +  +++ F+ F+++F+ QY+
Sbjct  508  RPGTYHFRTTILPQPAKLKEMLDMFRAFHEKFLKQYK  544



>ref|XP_008869166.1| hypothetical protein H310_06043 [Aphanomyces invadans]
 gb|ETW02561.1| hypothetical protein H310_06043 [Aphanomyces invadans]
Length=486

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 104/160 (65%), Gaps = 0/160 (0%)
 Frame = -1

Query  619  VLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTD  440
            V+    +L+   L     GQ+ + LM NPPKPGD SYD +V +   I+ SL++RA  +  
Sbjct  326  VMEELYKLVSINLCSNIEGQLMVALMTNPPKPGDASYDLYVSQRDEIVNSLKRRALKLVA  385

Query  439  GFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGS  260
             FN    V CN TEGAMY+FP+I +P +A+  A+ +G+APD +Y   LL ATGI  VPGS
Sbjct  386  SFNELEGVTCNATEGAMYTFPRITVPAKAVAEAKKVGQAPDAFYAFALLNATGIVVVPGS  445

Query  259  GFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GFGQ++G FH R+TILP EE +  ++    KF+ +FM++Y
Sbjct  446  GFGQEDGTFHFRSTILPPEEAIDEVIAKTAKFHADFMNKY  485



>ref|XP_010939850.1| PREDICTED: alanine aminotransferase 2 isoform X3 [Elaeis guineensis]
Length=329

 Score =   160 bits (406),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 97/156 (62%), Gaps = 0/156 (0%)
 Frame = -1

Query  601  RLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCR  422
            +L    L     GQI   L++N PK GD SY+ F  E  GIL SL +RA+ + D FNS  
Sbjct  174  KLASVNLCSNISGQILASLVMNTPKVGDESYESFTAEKNGILSSLARRAKALEDAFNSLE  233

Query  421  NVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKE  242
             V CN  EGAMY FP++ LP +AIE A  +  APD +Y  +LL+ATGI  VPGSGFGQ  
Sbjct  234  GVTCNKAEGAMYLFPRLHLPQKAIEAANAVNAAPDAFYARRLLDATGIVVVPGSGFGQVP  293

Query  241  GVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            G +H R TILP E  +PAI+   K F++ F+ ++ D
Sbjct  294  GTWHFRCTILPQENKIPAIIARLKAFHESFLGEFRD  329



>ref|XP_010415979.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Camelina 
sativa]
Length=548

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 103/164 (63%), Gaps = 0/164 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V  +  ++    L     GQI   L+++PPKPGD SYD ++ E  GIL S+ KRA+ +
Sbjct  385  PDVREQIYKMASVNLCSNISGQILASLVMSPPKPGDDSYDSYMVERDGILSSMAKRAKTL  444

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
             +  N+   V CN  EGAMY FP+I LP +AIE A+    APD +YC +LL ATG+  VP
Sbjct  445  EEALNNLEGVTCNRAEGAMYLFPRISLPQKAIEAAEAEKTAPDAFYCKRLLNATGVVVVP  504

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            GSGFGQ  G +H R TILP E+ +PAI++    F+  FMD++ D
Sbjct  505  GSGFGQVPGTWHFRCTILPQEDKIPAIVDRLTAFHKSFMDEFRD  548



>ref|XP_010428116.1| PREDICTED: alanine aminotransferase 2, mitochondrial [Camelina 
sativa]
Length=549

 Score =   164 bits (416),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 100/152 (66%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L+++PPKPGD SYD ++ E  GIL S+ KRA+ + +  N+   V C
Sbjct  398  VNLCSNISGQILASLVMSPPKPGDDSYDSYMVERDGILSSMAKRAKTLEEALNNLEGVTC  457

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FP+I LP +AIE A+    APD +YC +LL ATG+  VPGSGFGQ  G +H
Sbjct  458  NRAEGAMYLFPRINLPQKAIEAAEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWH  517

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
             R TILP E+ +PAI+E    F+  FMD++ D
Sbjct  518  FRCTILPQEDKIPAIVERLTAFHKSFMDEFRD  549



>gb|EYC32542.1| hypothetical protein Y032_0003g1641 [Ancylostoma ceylanicum]
Length=499

 Score =   164 bits (414),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 111/163 (68%), Gaps = 0/163 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V   + +++   L     GQ+ +  +VNPPKPG+ SYD +++E   +L+SL++RA ++
Sbjct  337  PQVFVLFKKMISAKLCSTILGQVVMDCVVNPPKPGEPSYDLWLKEKTAVLDSLKQRATLV  396

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
             + + S   + CN  +GAMY+FPQI++P +AIE A+ L + PD +Y ++LLE+TG+  VP
Sbjct  397  KEAYGSIEGIRCNEVQGAMYAFPQIQIPQKAIEKARSLNQEPDFFYAMQLLESTGVCIVP  456

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  137
            GSGFGQKEG +H RTTILP  E M  ++  FK F+ +F+ +Y+
Sbjct  457  GSGFGQKEGTYHFRTTILPQPELMKDMLNRFKSFHTKFLQEYK  499



>ref|XP_010937250.1| PREDICTED: alanine aminotransferase 2 [Elaeis guineensis]
Length=526

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 101/152 (66%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L++N PK GD SY+ F+ E  GIL SL +RA+ + D FNS   V C
Sbjct  375  VNLCSNISGQILASLVMNTPKVGDESYESFIAEKNGILSSLARRAKALEDAFNSLEGVTC  434

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FP++ LP +AIE A+ +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H
Sbjct  435  NKAEGAMYLFPRLHLPQKAIEAAKVVNAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWH  494

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
             R TILP E+ +PAI+   K F++ FM+++ D
Sbjct  495  FRCTILPQEDKIPAIISRLKAFHESFMEEFHD  526



>gb|ETK88933.1| hypothetical protein L915_06890 [Phytophthora parasitica]
Length=266

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 109/164 (66%), Gaps = 0/164 (0%)
 Frame = -1

Query  622  GVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMT  443
            G   ++ +L+   L     GQ+ +G+M NPP+ GD SY +++ +  G L SL++RA  + 
Sbjct  98   GAKDQFYKLMSVNLCSNIEGQLMVGMMTNPPQSGDASYQRYIEQRDGTLHSLKRRAIKLV  157

Query  442  DGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPG  263
              FN+   V CN TEGA+Y+FP I LP +A+E A+  G APD +YC+++L+ TGI  VPG
Sbjct  158  KAFNNLEGVTCNETEGALYTFPSISLPAKAVEAAKEAGMAPDAFYCMQMLDETGIVVVPG  217

Query  262  SGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  131
            SGFGQK G +H R+TILP EE +  ++E   KF+ +FMD+Y ++
Sbjct  218  SGFGQKAGTWHFRSTILPPEEAVDEVIEKTAKFHAKFMDKYREN  261



>emb|CCI42079.1| unnamed protein product [Albugo candida]
Length=479

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 101/154 (66%), Gaps = 0/154 (0%)
 Frame = -1

Query  601  RLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCR  422
            +L+   L     GQ+ +GLMVNPPK GD SY ++  +   IL SL++RA  +   FN   
Sbjct  325  KLMSINLCSNIEGQLMVGLMVNPPKKGDASYQRYCHQRDSILASLKRRALKLVAAFNKLE  384

Query  421  NVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKE  242
             V CN TEGA+Y+FP+IRL  +A++ A G   APD YYC+++LE TGI  VPGSGFGQK+
Sbjct  385  GVTCNATEGALYTFPRIRLSEKAVQAASGCNMAPDTYYCIQMLEKTGIVVVPGSGFGQKD  444

Query  241  GVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            G FH R+TILP E+++  ++     F+  FM+ +
Sbjct  445  GTFHFRSTILPPEDEVNEVITKMSDFHLNFMNAH  478



>ref|XP_008120969.1| PREDICTED: alanine aminotransferase 1-like [Anolis carolinensis]
Length=504

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 112/165 (68%), Gaps = 6/165 (4%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRA  455
            P V ++ T+L+    V++CP   GQI L ++VN P+ GD SY QF +E + +L +L K+A
Sbjct  327  PAVQQQLTKLVS---VRLCPPVTGQILLDVVVNQPQQGDPSYQQFSQEKQAVLGALAKKA  383

Query  454  RIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGIS  275
             +    FN    + CN  +GAMY+FP+I+LPPRA++ A+  G+APD+++CL+LLE TGI 
Sbjct  384  HLTEQTFNKAPGIHCNPVQGAMYAFPRIQLPPRAVQEAKAQGQAPDMFFCLRLLEETGIC  443

Query  274  TVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
             VPGSGFGQKEG FH R TILP  E +  +++   +F+ +F  +Y
Sbjct  444  VVPGSGFGQKEGTFHFRMTILPPMEKLEVVLQKLSQFHAKFTQEY  488



>gb|ENN78579.1| hypothetical protein YQE_04947, partial [Dendroctonus ponderosae]
 gb|ERL91463.1| hypothetical protein D910_08793 [Dendroctonus ponderosae]
Length=525

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 108/162 (67%), Gaps = 0/162 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V   Y + +   L     GQ+ L  +VNPP+ G+ SY+ F +E + +L+SL+ RA+++
Sbjct  363  PQVKAMYLKAISAMLCPTVLGQVTLDAIVNPPQKGEPSYESFTKEKQAVLDSLKVRAKMV  422

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
             D FNS     CN  +GAMY+FPQI LP +AIE A+  GK PDV+Y  +LLE TGI  VP
Sbjct  423  ADTFNSMEGFSCNTVQGAMYAFPQITLPAKAIEAAKKEGKQPDVFYAFELLENTGICIVP  482

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GSGFGQK+G +H RTTILP  + + +++E F +F+ +F+ +Y
Sbjct  483  GSGFGQKQGTYHFRTTILPQPDKLKSMLEKFAEFHSQFIKKY  524



>gb|EYC32543.1| hypothetical protein Y032_0003g1641 [Ancylostoma ceylanicum]
Length=529

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 111/163 (68%), Gaps = 0/163 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V   + +++   L     GQ+ +  +VNPPKPG+ SYD +++E   +L+SL++RA ++
Sbjct  367  PQVFVLFKKMISAKLCSTILGQVVMDCVVNPPKPGEPSYDLWLKEKTAVLDSLKQRATLV  426

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
             + + S   + CN  +GAMY+FPQI++P +AIE A+ L + PD +Y ++LLE+TG+  VP
Sbjct  427  KEAYGSIEGIRCNEVQGAMYAFPQIQIPQKAIEKARSLNQEPDFFYAMQLLESTGVCIVP  486

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  137
            GSGFGQKEG +H RTTILP  E M  ++  FK F+ +F+ +Y+
Sbjct  487  GSGFGQKEGTYHFRTTILPQPELMKDMLNRFKSFHTKFLQEYK  529



>ref|NP_001016805.1| alanine aminotransferase 2 [Xenopus (Silurana) tropicalis]
 sp|Q28DB5.1|ALAT2_XENTR RecName: Full=Alanine aminotransferase 2; Short=ALT2; AltName: 
Full=Glutamate pyruvate transaminase 2; Short=GPT 2; AltName: 
Full=Glutamic--alanine transaminase 2; AltName: Full=Glutamic--pyruvic 
transaminase 2 [Xenopus (Silurana) tropicalis]
 emb|CAJ81963.1| glutamic pyruvate transaminase (alanine aminotransferase) 2 [Xenopus 
(Silurana) tropicalis]
Length=524

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 110/162 (68%), Gaps = 0/162 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V ++ T+L+   L    PGQ  L ++VNPPKPG+ SY QF+ E + +L +L ++AR+ 
Sbjct  362  PAVKQQLTKLVSVRLCPPVPGQALLDVIVNPPKPGEPSYKQFMAEKQAVLGNLAEKARLT  421

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
             +  N    + CN  +GAMYSFP+I +P +AI+ AQ  G+APD+++C+KLLE TGI  VP
Sbjct  422  EEILNQSPGIRCNPVQGAMYSFPRIHIPEKAIKLAQAEGQAPDMFFCMKLLEETGICVVP  481

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GSGFGQ+EG  H R TILP  + + +++E  K F+ +F ++Y
Sbjct  482  GSGFGQREGTHHFRMTILPPTDKLKSLLERLKDFHQKFTEEY  523



>gb|KJB68683.1| hypothetical protein B456_011G0552001, partial [Gossypium raimondii]
Length=331

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 99/156 (63%), Gaps = 0/156 (0%)
 Frame = -1

Query  601  RLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCR  422
            +L    L     GQI   L+++PPK GD SY+ ++ E  GIL SL +RA+ + D FN   
Sbjct  176  KLASVNLCSNITGQILASLVMSPPKVGDKSYESYIAERDGILSSLARRAKTLEDAFNKLE  235

Query  421  NVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKE  242
             + CN  EGAMY FP+I LP +AI+ A+ +  APD++YC +LL  TGI  VPGSGFGQ  
Sbjct  236  GITCNKAEGAMYLFPRINLPKKAIKAAEEVKTAPDLFYCRRLLNETGIVFVPGSGFGQVP  295

Query  241  GVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            G +H R TILP EE +PAI+     F+  FMD++ D
Sbjct  296  GTWHFRCTILPQEEKIPAIVTRLTDFHKRFMDEFRD  331



>ref|XP_003055208.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60460.1| predicted protein [Micromonas pusilla CCMP1545]
Length=477

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 104/163 (64%), Gaps = 0/163 (0%)
 Frame = -1

Query  622  GVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMT  443
            GV  +  +L    L     GQI + L++ PPK GD SY  + +E   IL SL++RA  + 
Sbjct  315  GVAEQLYKLSSVGLCSNLAGQIVMALVMKPPKEGDASYPLYKQEKDDILSSLKRRAVTLV  374

Query  442  DGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPG  263
            +G N+   V C   EGAMY+FP+I LP + ++ A+G G APD  YC++LLEATGI  VPG
Sbjct  375  NGLNALEGVSCQEAEGAMYAFPKIDLPAKFLKEAEGSGMAPDALYCMRLLEATGIVVVPG  434

Query  262  SGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            SGFGQ EG +H RTT LPAE D+  +++   KF+ +FMD Y +
Sbjct  435  SGFGQVEGTWHFRTTFLPAEADIEGVVQKMTKFHGDFMDAYRN  477



>gb|ETL42327.1| hypothetical protein L916_06840 [Phytophthora parasitica]
Length=207

 Score =   155 bits (393),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 108/164 (66%), Gaps = 0/164 (0%)
 Frame = -1

Query  622  GVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMT  443
            G   ++ +L+   L     GQ+ +G+M NPP+ GD SY +++ +  G L SL++RA  + 
Sbjct  39   GAKDQFYKLMSVNLCSNIEGQLMVGMMTNPPQSGDASYQRYIEQRDGTLHSLKRRAIKLV  98

Query  442  DGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPG  263
              FN+   + CN TEGA+Y+FP   LP +A+E A+  G APD +YC+++L+ TGI  VPG
Sbjct  99   KAFNNLEGITCNETEGALYTFPSTSLPAKAVEAAKEAGMAPDAFYCMQMLDETGIVVVPG  158

Query  262  SGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  131
            SGFGQK G +H R+TILP EE +  ++E   KF+ +FMD+Y ++
Sbjct  159  SGFGQKAGTWHFRSTILPPEEAVDEVIEKTAKFHAKFMDKYREN  202



>gb|KGB32667.1| Alanine aminotransferase 2 [Schistosoma haematobium]
Length=493

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 104/150 (69%), Gaps = 3/150 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
             ++CP   GQ+ L  +VNPPKPG+ SY  FV+E   +L +L+ +A I     NS  N+ C
Sbjct  343  ARLCPPLMGQVALEAIVNPPKPGEASYSLFVKERDDVLSALKDKADITYSALNSMPNMSC  402

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  +GAMY+FP+I LPP+AI+ A+  G+APD +YCL+LLE  GI  VPGSGFGQ+EG +H
Sbjct  403  NPVQGAMYAFPRIHLPPKAIQEAKRRGEAPDFFYCLQLLEEKGICVVPGSGFGQQEGTYH  462

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
             RTTILP+ E M  +M+  ++F+  FM +Y
Sbjct  463  FRTTILPSVEKMKYVMKQVEEFHISFMKKY  492



>ref|XP_005847240.1| hypothetical protein CHLNCDRAFT_57929 [Chlorella variabilis]
 gb|EFN55138.1| hypothetical protein CHLNCDRAFT_57929 [Chlorella variabilis]
Length=529

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 108/162 (67%), Gaps = 0/162 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            PG +    + +   L     GQ+ + LMVNPPKPGD SY Q+  E    L SLR+RA  M
Sbjct  367  PGTVDELYKAVSINLSPNTTGQVAMSLMVNPPKPGDESYAQWKAEHDEGLASLRRRAHAM  426

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            TDGFN+   V C FTEGAMYSFP++ LPP+AI  A   GK  D +YCL+LLEATGI TVP
Sbjct  427  TDGFNALDGVTCTFTEGAMYSFPRLHLPPKAIAAAAAAGKPADTFYCLQLLEATGIVTVP  486

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GSGFGQ+EG FHLRTTILP E  +   ++ F+ F+  FM +Y
Sbjct  487  GSGFGQEEGTFHLRTTILPPEAKIGEFVKLFQDFHKAFMAKY  528



>gb|KJB68682.1| hypothetical protein B456_011G0552001 [Gossypium raimondii]
Length=329

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 99/156 (63%), Gaps = 0/156 (0%)
 Frame = -1

Query  601  RLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCR  422
            +L    L     GQI   L+++PPK GD SY+ ++ E  GIL SL +RA+ + D FN   
Sbjct  174  KLASVNLCSNITGQILASLVMSPPKVGDKSYESYIAERDGILSSLARRAKTLEDAFNKLE  233

Query  421  NVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKE  242
             + CN  EGAMY FP+I LP +AI+ A+ +  APD++YC +LL  TGI  VPGSGFGQ  
Sbjct  234  GITCNKAEGAMYLFPRINLPKKAIKAAEEVKTAPDLFYCRRLLNETGIVFVPGSGFGQVP  293

Query  241  GVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            G +H R TILP EE +PAI+     F+  FMD++ D
Sbjct  294  GTWHFRCTILPQEEKIPAIVTRLTDFHKRFMDEFRD  329



>ref|XP_003573850.1| PREDICTED: alanine aminotransferase 2 [Brachypodium distachyon]
Length=481

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 99/152 (65%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L++NPPK GD SY  +  E   IL SL +RA+ + D FN+   + C
Sbjct  330  VNLCSNITGQILASLVMNPPKAGDESYASYQAEKDRILTSLARRAKALEDAFNNLEGITC  389

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FP+I LP +AI+ A    KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H
Sbjct  390  NKAEGAMYLFPRINLPQKAIDAANAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWH  449

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
             R TILP EE +PAI+  FK F++ FM ++ D
Sbjct  450  FRCTILPQEEKIPAIISRFKVFHEAFMAEHRD  481



>ref|XP_006634237.1| PREDICTED: alanine aminotransferase 2-like [Lepisosteus oculatus]
Length=489

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 107/162 (66%), Gaps = 0/162 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V  +  +L+   L    PGQ  + L+VNPP+ G+ S+ QF++E   +L SL +RAR++
Sbjct  327  PAVKAQLLKLVSVRLCPPVPGQALMDLVVNPPQEGEPSHPQFIKERTAVLSSLAERARLV  386

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
                NS   + CN  +GAMYSFP+I +P RAI+ AQ +G+APD++YCL+LLE TGI  VP
Sbjct  387  EQLLNSIPGISCNPVQGAMYSFPRINIPERAIKEAQAMGQAPDMFYCLRLLEETGICLVP  446

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GSGFGQK+G +H R TILP  E +  ++   K+F+  F  +Y
Sbjct  447  GSGFGQKDGTYHFRMTILPPTEKLEVLLSKLKEFHQRFTREY  488



>ref|XP_009380146.1| PREDICTED: alanine aminotransferase 2-like [Musa acuminata subsp. 
malaccensis]
Length=523

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 101/152 (66%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L++NPPK GD SY+ F  E  GIL SL +RA+ + D FN    V C
Sbjct  372  VNLCSNISGQILASLVMNPPKVGDESYESFDAEKTGILSSLARRAKALEDAFNGLEEVTC  431

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FP++ LP +AIE A+ +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H
Sbjct  432  NKAEGAMYLFPRLHLPKKAIEAAKAVKAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWH  491

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            +R TILP E+ +PAI+   K F++ FM+++ D
Sbjct  492  VRCTILPHEDKIPAIISRLKAFHEAFMEEFRD  523



>ref|XP_008800517.1| PREDICTED: alanine aminotransferase 2-like [Phoenix dactylifera]
Length=530

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 99/152 (65%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L++NPPK GD SY+ F  E  GIL SL +RA+ + D FN    V C
Sbjct  379  VNLCSNISGQILASLVMNPPKVGDESYESFAAEKNGILSSLARRAKALEDAFNGLVGVTC  438

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FP++ LP +AIE A+ +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H
Sbjct  439  NKAEGAMYLFPRLHLPQKAIEAAKAVNAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWH  498

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
             R TILP E+ +PAI+   K F++ FM ++ D
Sbjct  499  FRCTILPQEDKIPAIIARLKAFHESFMGEFRD  530



>ref|XP_004303756.1| PREDICTED: alanine aminotransferase 2 [Fragaria vesca subsp. 
vesca]
Length=541

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 104/164 (63%), Gaps = 0/164 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V  +  ++    L     GQI   L+++PPK GD SY+ ++ E  GIL SL++RA+ +
Sbjct  378  PEVREQIYKMASVNLCSNISGQILSSLVMSPPKVGDESYELYLSEKDGILSSLKRRAKTL  437

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
             D  NS   V CN  EGAMY FP+I LP +AI  A+    APD +YC +LL ATGI  VP
Sbjct  438  EDALNSLEGVTCNRAEGAMYLFPRIELPQKAIHAAEAAKTAPDAFYCKRLLNATGIVVVP  497

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            GSGFGQ  G +H R TILP E+ +PA+++   +F+ +FMD++ D
Sbjct  498  GSGFGQVPGTWHFRCTILPQEDKIPAVVDRLTEFHKKFMDEFRD  541



>gb|KFB49063.1| AGAP000901-PA-like protein [Anopheles sinensis]
Length=546

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 106/157 (68%), Gaps = 3/157 (2%)
 Frame = -1

Query  598  LLQYPLVQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNS  428
            LL+    Q+CP   GQ  L  +VNPP+PG+ SY+ F +E   +LESLR+RA ++   FNS
Sbjct  390  LLKCISAQLCPTTAGQAVLDCVVNPPRPGEPSYELFAKEKAAVLESLRERAELVARTFNS  449

Query  427  CRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQ  248
                 CN  +GAMY+FPQIRLPP+A+E A+  GK  D +Y  +LLE TGI  VPGSGFGQ
Sbjct  450  IEGFSCNPVQGAMYAFPQIRLPPKALEAAKADGKPADTFYAFQLLEETGICIVPGSGFGQ  509

Query  247  KEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  137
            + G +H RTTILP  E +  ++  FK F+++F+ +Y+
Sbjct  510  RPGTYHFRTTILPQPEKLKEMLGLFKSFHEKFLAKYK  546



>ref|XP_008150574.1| PREDICTED: alanine aminotransferase 2 isoform X2 [Eptesicus fuscus]
Length=471

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 111/157 (71%), Gaps = 3/157 (2%)
 Frame = -1

Query  601  RLLQYPLVQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFN  431
            +L++   V++CP   GQ  + ++VNPP+PG+ S++QF+RE + +L +L ++A++  D FN
Sbjct  314  QLVKLLSVRLCPPVSGQAAMDIVVNPPRPGEESFEQFIREKESVLSNLAEKAKLTEDLFN  373

Query  430  SCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFG  251
                + CN  +GAMY+FP+I LPPRA+E AQ    APD++YC+KLLE TGI  VPGSGFG
Sbjct  374  QVPGIRCNPLQGAMYAFPRIFLPPRAVEAAQAHNMAPDMFYCMKLLEETGICVVPGSGFG  433

Query  250  QKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            Q+EG +H R TILP  E +  +++  K F+ +F+ ++
Sbjct  434  QREGTYHFRMTILPPVEKLKTVLQRVKDFHIQFLGEF  470



>gb|ELK29365.1| Alanine aminotransferase 2 [Myotis davidii]
Length=416

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 110/157 (70%), Gaps = 3/157 (2%)
 Frame = -1

Query  601  RLLQYPLVQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFN  431
            +L++   V++CP   GQ  + +MVNPP PG+ S++QF+RE + +L +L ++A++  D FN
Sbjct  259  QLVKLLSVRLCPPVSGQAAMDIMVNPPVPGEESFEQFLREKESVLSNLAEKAKLTEDLFN  318

Query  430  SCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFG  251
                + CN  +GAMY+FP+I LPPRA+E AQ    APD++YC+KLLE TG+  VPGSGFG
Sbjct  319  QVPGIHCNPLQGAMYAFPRIVLPPRAVEAAQAHNMAPDMFYCMKLLEETGVCVVPGSGFG  378

Query  250  QKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            Q+EG +H R TILP  E +  +++  K F+ +F+ ++
Sbjct  379  QREGTYHFRMTILPPMEKLKTVLQRVKDFHIQFLGEF  415



>sp|P52894.1|ALA2_HORVU RecName: Full=Alanine aminotransferase 2; Short=ALAAT-2; AltName: 
Full=Glutamate pyruvate transaminase 2; Short=GPT; AltName: 
Full=Glutamic--alanine transaminase 2; AltName: Full=Glutamic--pyruvic 
transaminase 2 [Hordeum vulgare]
 emb|CAA81231.1| alanine aminotransferase [Hordeum vulgare subsp. vulgare]
Length=482

 Score =   161 bits (407),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 97/152 (64%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L++NPPK  D SY  +  E  GIL SL +RA+ +   FN    + C
Sbjct  331  VNLCSNITGQILASLVMNPPKASDESYASYKAEKDGILASLARRAKALEHAFNKLEGITC  390

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FPQI LP +AIE A+   KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H
Sbjct  391  NEAEGAMYVFPQICLPQKAIEAAKAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWH  450

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
             R TILP E+ +PA++  F  F++ FM +Y D
Sbjct  451  FRCTILPQEDKIPAVISRFTVFHEAFMSEYRD  482



>ref|XP_010235387.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Brachypodium 
distachyon]
Length=514

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 105/152 (69%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L++NPPK GD SY+ F+ E  GIL SL +RA+ + + FNS   + C
Sbjct  302  VNLCSNIGGQILSSLVMNPPKAGDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITC  361

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FP++ LP +AI  AQ  G +PD YY L+LL+ATGI  VPGSGFGQ  G +H
Sbjct  362  NKAEGAMYLFPRLHLPQKAIGAAQAAGASPDAYYALRLLQATGIVVVPGSGFGQAPGTYH  421

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
             R TILP E+ +PAI+  FK+F+++FMD+Y +
Sbjct  422  FRCTILPQEDKIPAIISRFKEFHEKFMDEYRE  453



>ref|XP_002681562.1| alanine aminotransferase [Naegleria gruberi]
 gb|EFC48818.1| alanine aminotransferase [Naegleria gruberi]
Length=492

 Score =   161 bits (407),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 102/151 (68%), Gaps = 3/151 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +CP   GQI + LMV PP  G+ SY ++V E   IL SL++RA  +    NS   V C
Sbjct  342  VNLCPNADGQIMVDLMVRPPSQGEASYQEYVAERDNILNSLKRRAEKLVKMLNSLEGVSC  401

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
               EGAMY+FPQI LP +AI+ A+ +G APD+ Y L+LLE TGI  VPGSGF QK G +H
Sbjct  402  QPVEGAMYAFPQITLPEKAIQKAKEMGVAPDLMYVLELLEETGICVVPGSGFQQKPGTYH  461

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYE  137
             RTTILP+EE +  ++++  KF+D+FM QY+
Sbjct  462  FRTTILPSEEQIEGVVQTLAKFHDKFMKQYK  492



>ref|XP_010471259.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Camelina 
sativa]
 ref|XP_010471260.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Camelina 
sativa]
Length=548

 Score =   162 bits (409),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 99/152 (65%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L+++PPKPGD SYD ++ E  GIL S+ KRA+ + D  N+   V C
Sbjct  397  VNLCSNISGQILASLVMSPPKPGDDSYDSYMVERDGILSSMAKRAKTLEDALNNLEGVTC  456

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FP+I LP +AIE A+    APD +YC +LL ATG+  VPGSGFGQ  G +H
Sbjct  457  NRAEGAMYLFPRINLPHKAIEAAEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWH  516

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
             R TILP E+ + AI++    F+  FMD++ D
Sbjct  517  FRCTILPQEDKILAIVDRLTAFHKSFMDEFRD  548



>ref|XP_008150573.1| PREDICTED: alanine aminotransferase 2 isoform X1 [Eptesicus fuscus]
Length=523

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 111/157 (71%), Gaps = 3/157 (2%)
 Frame = -1

Query  601  RLLQYPLVQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFN  431
            +L++   V++CP   GQ  + ++VNPP+PG+ S++QF+RE + +L +L ++A++  D FN
Sbjct  366  QLVKLLSVRLCPPVSGQAAMDIVVNPPRPGEESFEQFIREKESVLSNLAEKAKLTEDLFN  425

Query  430  SCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFG  251
                + CN  +GAMY+FP+I LPPRA+E AQ    APD++YC+KLLE TGI  VPGSGFG
Sbjct  426  QVPGIRCNPLQGAMYAFPRIFLPPRAVEAAQAHNMAPDMFYCMKLLEETGICVVPGSGFG  485

Query  250  QKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            Q+EG +H R TILP  E +  +++  K F+ +F+ ++
Sbjct  486  QREGTYHFRMTILPPVEKLKTVLQRVKDFHIQFLGEF  522



>dbj|BAN21041.1| alanine aminotransferase [Riptortus pedestris]
Length=522

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 106/149 (71%), Gaps = 3/149 (2%)
 Frame = -1

Query  574  MCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNF  404
            +CP   GQ  +  +VNPPK GD SY  F++E +G+L SL +RAR++T+ FNS   + CN 
Sbjct  374  LCPNTIGQATIDCVVNPPKEGDPSYATFIKEKQGVLSSLAERARMVTETFNSVEGMSCNT  433

Query  403  TEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLR  224
             +GAMY+FP+I LP +AI+ A+ L + P V+Y  +LLE TGI  VPGSGFGQ EG +H R
Sbjct  434  VQGAMYAFPRIHLPQKAIDKAKSLNQDPSVFYAFQLLEETGICIVPGSGFGQVEGTYHFR  493

Query  223  TTILPAEEDMPAIMESFKKFNDEFMDQYE  137
            TTILP  E + +++++FK F+ +F+ +Y+
Sbjct  494  TTILPQPEQLKSMLKTFKTFHQKFVQEYK  522



>ref|XP_010939849.1| PREDICTED: alanine aminotransferase 2 isoform X2 [Elaeis guineensis]
Length=475

 Score =   160 bits (406),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 97/156 (62%), Gaps = 0/156 (0%)
 Frame = -1

Query  601  RLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCR  422
            +L    L     GQI   L++N PK GD SY+ F  E  GIL SL +RA+ + D FNS  
Sbjct  320  KLASVNLCSNISGQILASLVMNTPKVGDESYESFTAEKNGILSSLARRAKALEDAFNSLE  379

Query  421  NVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKE  242
             V CN  EGAMY FP++ LP +AIE A  +  APD +Y  +LL+ATGI  VPGSGFGQ  
Sbjct  380  GVTCNKAEGAMYLFPRLHLPQKAIEAANAVNAAPDAFYARRLLDATGIVVVPGSGFGQVP  439

Query  241  GVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            G +H R TILP E  +PAI+   K F++ F+ ++ D
Sbjct  440  GTWHFRCTILPQENKIPAIIARLKAFHESFLGEFRD  475



>gb|ADE77246.1| unknown [Picea sitchensis]
Length=329

 Score =   157 bits (398),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 101/159 (64%), Gaps = 3/159 (2%)
 Frame = -1

Query  601  RLLQYPLVQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFN  431
            +L +   V +C    GQI   L++NPPK GD S++ F  E  GIL SL +RA+ + D  N
Sbjct  171  QLYKVASVNLCSNISGQILASLVMNPPKSGDESFEMFFAERDGILSSLARRAKTLVDALN  230

Query  430  SCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFG  251
                V CN  EGAMY FP+I LP +AI+ A+ +   PD +Y  +LLEATGI TVPGSGFG
Sbjct  231  QLEGVTCNEAEGAMYVFPRIHLPQQAIKAAEAVNMVPDAFYSQRLLEATGIVTVPGSGFG  290

Query  250  QKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            Q  G +H R+TILP E+ +P I+     F+ +FM+++ D
Sbjct  291  QVPGTWHFRSTILPPEDKIPTIVSRMTTFHQKFMEEFHD  329



>gb|ETI43741.1| hypothetical protein F443_11357 [Phytophthora parasitica P1569]
Length=491

 Score =   160 bits (406),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 110/164 (67%), Gaps = 0/164 (0%)
 Frame = -1

Query  622  GVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMT  443
            G   ++ +L+   L     GQ+ +G+M NPP+PGD SY +++ +  G L SL++RA  + 
Sbjct  323  GAKDQFYKLMSVNLCSNIEGQLMVGMMTNPPQPGDASYQRYIEQRDGTLHSLKRRAIKLV  382

Query  442  DGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPG  263
              FN+   + CN TEGA+Y+FP I LP +A+E A+  G APD +YC+++L+ TGI  VPG
Sbjct  383  KAFNNLEGITCNETEGALYTFPSISLPAKAVEAAKEAGMAPDAFYCMQMLDETGIVVVPG  442

Query  262  SGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  131
            SGFGQK G +H R+TILP EE +  ++E   KF+ +FMD+Y ++
Sbjct  443  SGFGQKAGTWHFRSTILPPEEAVDEVIEKTAKFHAKFMDKYREN  486



>ref|XP_002970914.1| hypothetical protein SELMODRAFT_94316 [Selaginella moellendorffii]
 gb|EFJ28240.1| hypothetical protein SELMODRAFT_94316 [Selaginella moellendorffii]
Length=503

 Score =   161 bits (407),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 102/152 (67%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI + L+ NPPK GD SY+ +VRE  GIL SL +RA+++ +GFN    V C
Sbjct  352  VNLCSNISGQILMSLVSNPPKAGDESYEDYVRERDGILASLARRAKLLAEGFNKLEGVSC  411

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FP++ LP RA++ A  +  A D +Y  +LL+ATGI  VPGSGFGQ  G +H
Sbjct  412  NQAEGAMYLFPRLHLPERALKAAAAVSMAADTFYARRLLDATGIVVVPGSGFGQVPGTWH  471

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            +R TILPAEE MPA++     F+  FMD++ D
Sbjct  472  IRCTILPAEEKMPALITRLTSFHQRFMDEFRD  503



>ref|XP_002969652.1| hypothetical protein SELMODRAFT_91640 [Selaginella moellendorffii]
 gb|EFJ29740.1| hypothetical protein SELMODRAFT_91640 [Selaginella moellendorffii]
Length=503

 Score =   161 bits (407),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 102/152 (67%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI + L+ NPPK GD SY+ +VRE  GIL SL +RA+++ +GFN    V C
Sbjct  352  VNLCSNISGQILMSLVSNPPKAGDESYEDYVRERDGILASLARRAKLLAEGFNKLEGVSC  411

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FP++ LP RA++ A  +  A D +Y  +LL+ATGI  VPGSGFGQ  G +H
Sbjct  412  NQAEGAMYLFPRLHLPERALKAAAAVSMAADTFYARRLLDATGIVVVPGSGFGQVPGTWH  471

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            +R TILPAEE MPA++     F+  FMD++ D
Sbjct  472  IRCTILPAEEKMPALITRLTSFHQRFMDEFRD  503



>pdb|3TCM|A Chain A, Crystal Structure Of Alanine Aminotransferase From Hordeum 
Vulgare
 pdb|3TCM|B Chain B, Crystal Structure Of Alanine Aminotransferase From Hordeum 
Vulgare
Length=500

 Score =   160 bits (406),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 97/152 (64%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L++NPPK  D SY  +  E  GIL SL +RA+ +   FN    + C
Sbjct  349  VNLCSNITGQILASLVMNPPKASDESYASYKAEKDGILASLARRAKALEHAFNKLEGITC  408

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FPQI LP +AIE A+   KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H
Sbjct  409  NEAEGAMYVFPQICLPQKAIEAAKAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWH  468

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
             R TILP E+ +PA++  F  F++ FM +Y D
Sbjct  469  FRCTILPQEDKIPAVISRFTVFHEAFMSEYRD  500



>ref|XP_004510570.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cicer 
arietinum]
Length=531

 Score =   161 bits (407),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 102/164 (62%), Gaps = 0/164 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V  +  ++    L     GQI   L+++PPK GD SY+ F+ E   IL SL  RA+ +
Sbjct  368  PDVREQIYKVSSVNLCSNITGQILASLVMSPPKVGDESYESFMAEKGSILSSLATRAKSL  427

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
             +  N    V CN  EGAMY FPQIRLP +AIE A+    APD +YC +LL ATG+  VP
Sbjct  428  EEALNKLEGVTCNKAEGAMYLFPQIRLPKKAIEAAEAENTAPDAFYCKRLLNATGVVVVP  487

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            GSGFGQ  G +H R TILP E+ +PAI+    +F+++FMD++ D
Sbjct  488  GSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTEFHEKFMDEFRD  531



>gb|KDD76740.1| aminotransferase [Helicosporidium sp. ATCC 50920]
Length=485

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 106/158 (67%), Gaps = 3/158 (2%)
 Frame = -1

Query  604  TRLLQYPLVQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGF  434
             +L +   + +CP   GQ  +GL VNPP  G  +  +   E++ I ES+++RA  +T  F
Sbjct  327  AQLYKIASINLCPNTVGQACVGLAVNPPSQGTKAGKEHATETRAIHESMQRRAAKVTAAF  386

Query  433  NSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGF  254
            N+   V CN TEGAMY+FP++ LPP+A+E A+  GKAPD +YCL LL+ TGI TVPG+GF
Sbjct  387  NALPGVTCNPTEGAMYAFPRLHLPPKAVEAARAAGKAPDTFYCLALLDYTGIVTVPGTGF  446

Query  253  GQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GQ +G +H+RTTILP E+ +      F +F+ +FMD+Y
Sbjct  447  GQVDGTWHMRTTILPQEDVLDDFCNRFAEFHQQFMDKY  484



>emb|CCD81366.1| putative alanine aminotransferase [Schistosoma mansoni]
Length=481

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 104/150 (69%), Gaps = 3/150 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
             ++CP   GQ+ L  +VNPP+PG+ SY  FV+E   +L +L+ +A I     NS  N+ C
Sbjct  331  ARLCPPLMGQVALDAIVNPPRPGEPSYSLFVKERDDVLSALKDKADITYSALNSMPNMSC  390

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  +GAMY+FP+I LPP+AI+ A+  G+APD +YCL+LLE  GI  VPGSGFGQ+EG +H
Sbjct  391  NPVQGAMYAFPRIHLPPKAIQEAKRRGEAPDFFYCLQLLEEKGICVVPGSGFGQQEGTYH  450

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
             RTTILP+ E M  +M+  ++F+  FM +Y
Sbjct  451  FRTTILPSIEKMKYVMKQIEEFHISFMKKY  480



>gb|KDR12685.1| Alanine aminotransferase 2 [Zootermopsis nevadensis]
Length=538

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 108/159 (68%), Gaps = 3/159 (2%)
 Frame = -1

Query  604  TRLLQYPLVQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGF  434
            T L +     +CP   GQ  + ++VNPP PG+ SY++F +E K +L SL +RA+++ + F
Sbjct  380  TMLFKSISAMLCPTVLGQSVMDVVVNPPVPGEPSYEEFTKEKKAVLNSLAERAKMVAETF  439

Query  433  NSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGF  254
            NS   V CN  +GAMY+FP++ LP +AIE A+ LG+  DV+Y  +LLE TGI  VPGSGF
Sbjct  440  NSIEGVSCNEVQGAMYAFPKLDLPKKAIEKAESLGQCADVFYAFQLLENTGICIVPGSGF  499

Query  253  GQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  137
            GQK G FH RTTILP  + +  ++  FK+F+ +F+ QY+
Sbjct  500  GQKAGTFHFRTTILPQPDKLKIMLNKFKEFHLKFLTQYK  538



>ref|XP_004235528.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
X2 [Solanum lycopersicum]
Length=484

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 102/162 (63%), Gaps = 0/162 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P +  +  +L    L     GQI   L+++PPK GD SY+ F  E   IL SL +RA+I+
Sbjct  321  PEIREQIYKLASVNLCSNISGQILASLIMSPPKVGDESYESFSAEKDAILSSLARRAKIL  380

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
             D FNS   V C   EGA+YSFP+I LP +AI+ A+    APD +Y  +LL ATGI  V 
Sbjct  381  EDAFNSLEGVTCYKAEGALYSFPRINLPDKAIKAAEEAKTAPDAFYAWRLLNATGIVVVS  440

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GSGFGQ+ G +H R TILP EE +PAI+  F +F+ +FMD++
Sbjct  441  GSGFGQRPGTWHFRCTILPQEEKIPAIVSRFTQFHKQFMDEF  482



>ref|XP_009515719.1| hypothetical protein PHYSODRAFT_477603 [Phytophthora sojae]
 gb|EGZ28444.1| hypothetical protein PHYSODRAFT_477603 [Phytophthora sojae]
Length=499

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 108/161 (67%), Gaps = 0/161 (0%)
 Frame = -1

Query  622  GVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMT  443
            G   ++ +L+   L     GQ+ +GLM NPP+PGD SY +++ +  G LE+L++RA  + 
Sbjct  338  GAKDQFYKLMSVNLCSNVEGQLMVGLMTNPPQPGDASYKRYIEQRDGTLEALKRRAVKLV  397

Query  442  DGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPG  263
               N    V CN TEGAMY+FP+I +P +A+E A+  G APD +YC+++L+ TGI  VPG
Sbjct  398  KACNELEGVTCNETEGAMYTFPKITIPAKAVEAAKAAGMAPDAFYCMQMLDETGIVVVPG  457

Query  262  SGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            SGFGQKEG +H R+TILP EE +  ++E   KF+  FMD+Y
Sbjct  458  SGFGQKEGTWHFRSTILPPEEAVDEVIEKTVKFHANFMDKY  498



>ref|XP_010318452.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
X1 [Solanum lycopersicum]
Length=487

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 102/162 (63%), Gaps = 0/162 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P +  +  +L    L     GQI   L+++PPK GD SY+ F  E   IL SL +RA+I+
Sbjct  324  PEIREQIYKLASVNLCSNISGQILASLIMSPPKVGDESYESFSAEKDAILSSLARRAKIL  383

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
             D FNS   V C   EGA+YSFP+I LP +AI+ A+    APD +Y  +LL ATGI  V 
Sbjct  384  EDAFNSLEGVTCYKAEGALYSFPRINLPDKAIKAAEEAKTAPDAFYAWRLLNATGIVVVS  443

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GSGFGQ+ G +H R TILP EE +PAI+  F +F+ +FMD++
Sbjct  444  GSGFGQRPGTWHFRCTILPQEEKIPAIVSRFTQFHKQFMDEF  485



>ref|XP_003429759.1| PREDICTED: LOW QUALITY PROTEIN: alanine aminotransferase 1 [Ornithorhynchus 
anatinus]
Length=491

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 109/162 (67%), Gaps = 0/162 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V ++ ++L+   L    PGQ  L ++V+PP+PGD SY QF  E + +L++L ++AR+ 
Sbjct  329  PDVKQQLSKLVSVRLCPPVPGQALLDVVVSPPQPGDPSYRQFQGEKQAVLKALAEKARLT  388

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
               FN    + CN  +GAMYSFP+I LP RA+E AQ LG+APD+++C++LLE TGI  VP
Sbjct  389  ESVFNQAPGIRCNPVQGAMYSFPRISLPARALERAQELGQAPDMFFCMRLLEETGICVVP  448

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GSGFGQKEG +H R TILP  + +  ++E   +F+  F  ++
Sbjct  449  GSGFGQKEGTYHFRMTILPPLDKLRTVLEKLTQFHARFTKEF  490



>ref|XP_006105500.1| PREDICTED: LOW QUALITY PROTEIN: alanine aminotransferase 2 [Myotis 
lucifugus]
Length=498

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 110/157 (70%), Gaps = 3/157 (2%)
 Frame = -1

Query  601  RLLQYPLVQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFN  431
            +L++   V++CP   GQ  + +MVNPP PG+ S++QF+RE + +L +L ++A++  D FN
Sbjct  341  QLVKLLSVRLCPPVSGQAAMDIMVNPPVPGEESFEQFLREKESVLSNLAEKAKLTEDLFN  400

Query  430  SCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFG  251
                + CN  +GAMY+FP+I LPPRA+E AQ    APD++YC+KLLE TG+  VPGSGFG
Sbjct  401  QVPGIRCNPLQGAMYAFPRIVLPPRAVEAAQAHNMAPDMFYCMKLLEETGVCVVPGSGFG  460

Query  250  QKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            Q+EG +H R TILP  E +  +++  K F+ +F+ ++
Sbjct  461  QREGTYHFRMTILPPVEKLKTVLQRVKDFHIQFLGEF  497



>ref|XP_637993.1| alanine transaminase [Dictyostelium discoideum AX4]
 sp|Q54MJ7.1|ALAM_DICDI RecName: Full=Probable alanine aminotransferase, mitochondrial; 
Short=ALT; AltName: Full=Glutamate pyruvate transaminase; 
Short=GPT; AltName: Full=Glutamic--alanine transaminase; AltName: 
Full=Glutamic--pyruvic transaminase; Flags: Precursor 
[Dictyostelium discoideum]
 gb|EAL64484.1| alanine transaminase [Dictyostelium discoideum AX4]
Length=534

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 108/151 (72%), Gaps = 3/151 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            + +CP   GQ+ + LMV PP  G+ S+D +++E   I ESL+KRA ++T+  N+   V C
Sbjct  384  IGLCPNVIGQLVVDLMVRPPVAGEQSHDLYLKERDNIYESLKKRANLLTNALNNLEGVTC  443

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N +EGAMY+FPQIRLP +A+E A  +GKAPD YYC++LLEATGI  VPGSGFGQK+G +H
Sbjct  444  NPSEGAMYAFPQIRLPAKAVEYANSIGKAPDAYYCIQLLEATGICVVPGSGFGQKDGTWH  503

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYE  137
             RTT LP+EE +  + +    F+  FM++Y+
Sbjct  504  FRTTFLPSEEAIEGVCKRIADFHQSFMNKYK  534



>ref|XP_002166762.2| PREDICTED: alanine aminotransferase 2-like [Hydra vulgaris]
Length=444

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 100/143 (70%), Gaps = 0/143 (0%)
 Frame = -1

Query  565  GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMY  386
            GQ+ L  +VNPPK G+ SYD FV+E   +L SL+KRAR++ +  N    V CN  +GAMY
Sbjct  302  GQLVLDCLVNPPKIGEPSYDLFVQEKFSVLSSLKKRARLVYETLNKIEGVTCNEVQGAMY  361

Query  385  SFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPA  206
            +FPQI LP +AI+ A+ L +A D +YC++ LE TGI  VPGSGF QKEG +H R TILP 
Sbjct  362  AFPQIHLPQKAIDHAKSLDQAADFFYCMQFLEQTGICVVPGSGFRQKEGTYHFRLTILPP  421

Query  205  EEDMPAIMESFKKFNDEFMDQYE  137
            E+ +   +E FK+F+ +F++ Y+
Sbjct  422  EDQLKVFLEKFKEFHIKFLEIYK  444



>ref|XP_011036545.1| PREDICTED: alanine aminotransferase 2-like [Populus euphratica]
Length=533

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 103/164 (63%), Gaps = 0/164 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            PG+  +  ++    L     GQI   L+++PPK GD SY+ +  E  GIL SL +RA+ +
Sbjct  370  PGIREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYSAEKDGILSSLARRAKTL  429

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
               FN+   V CN  EGAMY FP IRLP +AI+TA+    APD +YC +LL ATGI  VP
Sbjct  430  EVAFNNLEGVTCNKAEGAMYLFPCIRLPEKAIKTAEAAKTAPDNFYCRRLLNATGIVFVP  489

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            GSGFGQ  G +H R TILP E+ +PA++    +F+  FMD++ D
Sbjct  490  GSGFGQLPGTWHFRCTILPQEDKIPAVVSRLTEFHKSFMDEFRD  533



>ref|XP_010939848.1| PREDICTED: alanine aminotransferase 2 isoform X1 [Elaeis guineensis]
Length=518

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 97/156 (62%), Gaps = 0/156 (0%)
 Frame = -1

Query  601  RLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCR  422
            +L    L     GQI   L++N PK GD SY+ F  E  GIL SL +RA+ + D FNS  
Sbjct  363  KLASVNLCSNISGQILASLVMNTPKVGDESYESFTAEKNGILSSLARRAKALEDAFNSLE  422

Query  421  NVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKE  242
             V CN  EGAMY FP++ LP +AIE A  +  APD +Y  +LL+ATGI  VPGSGFGQ  
Sbjct  423  GVTCNKAEGAMYLFPRLHLPQKAIEAANAVNAAPDAFYARRLLDATGIVVVPGSGFGQVP  482

Query  241  GVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            G +H R TILP E  +PAI+   K F++ F+ ++ D
Sbjct  483  GTWHFRCTILPQENKIPAIIARLKAFHESFLGEFRD  518



>ref|XP_005880402.1| PREDICTED: alanine aminotransferase 2 [Myotis brandtii]
Length=587

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 111/157 (71%), Gaps = 3/157 (2%)
 Frame = -1

Query  601  RLLQYPLVQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFN  431
            +L++   V++CP   GQ  + +MVNPP PG+ S++QF+RE + +L +L ++A++  D FN
Sbjct  430  QLVKLLSVRLCPPVSGQAAMDIMVNPPVPGEESFEQFLREKESVLSNLAEKAKLTEDLFN  489

Query  430  SCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFG  251
                + CN  +GAMY+FP+I LPPRA+E AQ    APD++YC+KLLE TG+  VPGSGFG
Sbjct  490  QVPGIHCNPLQGAMYAFPRIVLPPRAVEAAQAHNMAPDMFYCMKLLEETGVCVVPGSGFG  549

Query  250  QKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            Q+EG +H R TILP  E +  +++  K F+ +F++++
Sbjct  550  QREGTYHFRMTILPPVEKLKTVLQRVKDFHIQFLEEF  586



>gb|KHN39571.1| Alanine aminotransferase 2, mitochondrial [Glycine soja]
Length=536

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 100/152 (66%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L+++PPK GD SY+ F  E + ILESL +RA+ + D FN    V C
Sbjct  385  VNLCSNISGQILASLVMSPPKVGDESYESFNAEKENILESLARRAKTLEDAFNKLEGVTC  444

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FPQIRL  +AI+ A     APD +YC +LL ATG+  VPGSGFGQ  G +H
Sbjct  445  NKAEGAMYLFPQIRLSQKAIKAAGDANTAPDNFYCKRLLNATGVVVVPGSGFGQVPGTWH  504

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
             R TILP EE +PAI+    +F+++FMD++ D
Sbjct  505  FRCTILPPEEKIPAIVTRLTEFHEKFMDEFRD  536



>gb|ESA18192.1| hypothetical protein GLOINDRAFT_334935 [Rhizophagus irregularis 
DAOM 181602]
Length=496

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 104/163 (64%), Gaps = 3/163 (2%)
 Frame = -1

Query  613  RRYTRLLQYPLVQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMT  443
            R    L +   V +CP   GQI + LMV PPK GD SY  + +E   I ESLR+R+  ++
Sbjct  334  RIIEELYKMASVSLCPNVQGQIMVDLMVQPPKRGDKSYTSYQKELNEIYESLRRRSMKLS  393

Query  442  DGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPG  263
            + FN    V CN  +G+MY FPQ+RLP +AIE A   GK PD +YCL +L+ATG+  VPG
Sbjct  394  ECFNQLEGVTCNNAQGSMYLFPQLRLPQKAIEAAHQAGKKPDEFYCLAMLDATGVCVVPG  453

Query  262  SGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            SGFGQK G +H R+T LP EE +       +KF++EF+++Y D
Sbjct  454  SGFGQKNGTWHFRSTFLPPEELLDGFCIKLQKFHNEFLEKYCD  496



>gb|EXX69945.1| alanine transaminase ALT1 [Rhizophagus irregularis DAOM 197198w]
Length=528

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 101/152 (66%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +CP   GQI + LMV PPK GD SY  + +E   I ESLR+R+  +++ FN    V C
Sbjct  377  VSLCPNVQGQIMVDLMVQPPKRGDKSYTSYQKELNEIYESLRRRSMKLSECFNQLEGVTC  436

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  +G+MY FPQ+RLP +AIE A   GK PD +YCL +L+ATG+  VPGSGFGQK G +H
Sbjct  437  NNAQGSMYLFPQLRLPQKAIEAAHQAGKKPDEFYCLAMLDATGVCVVPGSGFGQKNGTWH  496

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
             R+T LP EE +       +KF++EF+++Y D
Sbjct  497  FRSTFLPPEELLDGFCIKLQKFHNEFLEKYCD  528



>ref|XP_010235383.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Brachypodium 
distachyon]
Length=599

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 105/152 (69%), Gaps = 3/152 (2%)
 Frame = -1

Query  580  VQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVC  410
            V +C    GQI   L++NPPK GD SY+ F+ E  GIL SL +RA+ + + FNS   + C
Sbjct  387  VNLCSNIGGQILSSLVMNPPKAGDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITC  446

Query  409  NFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  230
            N  EGAMY FP++ LP +AI  AQ  G +PD YY L+LL+ATGI  VPGSGFGQ  G +H
Sbjct  447  NKAEGAMYLFPRLHLPQKAIGAAQAAGASPDAYYALRLLQATGIVVVPGSGFGQAPGTYH  506

Query  229  LRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
             R TILP E+ +PAI+  FK+F+++FMD+Y +
Sbjct  507  FRCTILPQEDKIPAIISRFKEFHEKFMDEYRE  538



>ref|XP_009826737.1| hypothetical protein H257_04062 [Aphanomyces astaci]
 gb|ETV83307.1| hypothetical protein H257_04062 [Aphanomyces astaci]
Length=486

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 102/160 (64%), Gaps = 0/160 (0%)
 Frame = -1

Query  619  VLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTD  440
            V+    +L+   L     GQ+ + LM NPPK G+ SYD +V +   I+ SL++RA  +  
Sbjct  326  VMEELYKLVSINLCSNIEGQLMVALMTNPPKAGEPSYDLYVAQRDEIVSSLKRRAVKLVA  385

Query  439  GFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGS  260
             FN    V CN TEGAMY+FP+I +P +A+  A   G+APD +Y   LL ATGI  VPGS
Sbjct  386  SFNELEGVTCNVTEGAMYTFPRITVPAKAVAEANKAGQAPDAFYAFALLNATGIVVVPGS  445

Query  259  GFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GFGQ++G FH R+TILP EE +  ++E   KF+ +FM++Y
Sbjct  446  GFGQQDGTFHFRSTILPPEEAIDEVIEKTAKFHADFMNKY  485



>ref|XP_001660471.1| AAEL009875-PA [Aedes aegypti]
 gb|EAT38207.1| AAEL009875-PA [Aedes aegypti]
Length=422

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 110/157 (70%), Gaps = 3/157 (2%)
 Frame = -1

Query  598  LLQYPLVQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNS  428
            LL+     +CP   GQ  + +MVNPPKPG+ SY+ F++E   +L SL++RA+++ D FNS
Sbjct  266  LLKSISALVCPSTIGQACMDVMVNPPKPGEPSYELFIKEKNAVLTSLKERAKLVADAFNS  325

Query  427  CRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQ  248
                 CN  +GAMY+FP+I+LP +AI+ A+  G+ PDV+Y  +LLE TGI  VPGSGFGQ
Sbjct  326  FEGFSCNPVQGAMYAFPRIQLPEKAIQAARKAGQLPDVFYVYQLLEQTGICVVPGSGFGQ  385

Query  247  KEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  137
            K+G +H+R+TILP  E +  +++  + +++ F+ QY+
Sbjct  386  KDGTYHIRSTILPQPEKLKHMLDVLRLYHENFLRQYQ  422



>ref|XP_006530622.1| PREDICTED: alanine aminotransferase 2 isoform X2 [Mus musculus]
Length=290

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 109/157 (69%), Gaps = 3/157 (2%)
 Frame = -1

Query  601  RLLQYPLVQMCP---GQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFN  431
            +L++   V++CP   GQ  + ++VNPP+PG+ S++QF RE + +L +L K+A++  D FN
Sbjct  133  QLVKLLSVRLCPPVSGQAAMDIVVNPPEPGEESFEQFSREKEFVLGNLAKKAKLTEDLFN  192

Query  430  SCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFG  251
                + CN  +GAMY+FP+I +P +A+E AQ    APD++YC+KLLE TGI  VPGSGFG
Sbjct  193  QVPGIQCNPLQGAMYAFPRILIPAKAVEAAQSHKMAPDMFYCMKLLEETGICVVPGSGFG  252

Query  250  QKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            Q+EG +H R TILP  + +  ++   K F+ +F++QY
Sbjct  253  QREGTYHFRMTILPPVDKLKTVLHKVKDFHLKFLEQY  289



>ref|XP_007548658.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Poecilia 
formosa]
Length=522

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 107/160 (67%), Gaps = 0/160 (0%)
 Frame = -1

Query  619  VLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTD  440
            V  + T+LL   L    PGQ  + L+VNPP+PG+ SY++F++E    L +L ++AR+   
Sbjct  362  VKDQLTKLLSVRLCSPVPGQALMDLVVNPPQPGEPSYERFIKERTATLSALAEKARLTEQ  421

Query  439  GFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGS  260
              N+   + CN  +GAMYSFP+I +P +AI+ A+ LG+ PD++YC+K+LE TGI  VPGS
Sbjct  422  VLNTVEGIRCNPVQGAMYSFPRITIPEKAIQEAKKLGQQPDMFYCMKMLEETGICLVPGS  481

Query  259  GFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GFGQKEG +H R TILP  + +  ++ + K+F+  F  QY
Sbjct  482  GFGQKEGTYHFRMTILPPTDKLKILLNNVKEFHQRFTQQY  521



>gb|KHG30536.1| Alanine aminotransferase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=482

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 99/156 (63%), Gaps = 0/156 (0%)
 Frame = -1

Query  601  RLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCR  422
            +L    L     GQI   L+++PPK GD SY+ ++ E  GIL SL +RA+ + D FN   
Sbjct  327  KLASVNLCSNITGQILASLVMSPPKVGDKSYESYIAERDGILSSLARRAKTLEDAFNKLE  386

Query  421  NVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKE  242
             + CN  EGAMY FP+I LP +AI+ A+ +  APD++YC +LL  TGI  VPGSGFGQ  
Sbjct  387  GITCNKAEGAMYLFPRINLPKKAIKAAEEVKTAPDLFYCRRLLNETGIVFVPGSGFGQVP  446

Query  241  GVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            G +H R TILP EE +PAI+     F+  FMD++ D
Sbjct  447  GTWHFRCTILPQEEKIPAIVTRLTDFHKRFMDEFRD  482



>ref|XP_006746371.1| PREDICTED: alanine aminotransferase 1 [Leptonychotes weddellii]
Length=295

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 105/162 (65%), Gaps = 0/162 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V ++  +L+   L    PGQ+ L ++V+PP P D S+ QF  E + +L  L  +A++ 
Sbjct  133  PAVQQQMQKLMSVRLCPPVPGQVLLSMVVSPPAPSDPSFAQFQAERQVVLAELAAKAKLT  192

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
               FN    + CN  +GAMYSFP+++LPPRA++ AQ LG APD+++C+ LLE TGI  VP
Sbjct  193  EQVFNEAPGIRCNPVQGAMYSFPRVQLPPRAVQRAQELGLAPDMFFCMSLLEETGICVVP  252

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  140
            GSGFGQ+EG +H R TILP  E +  ++E   +F+ +F  +Y
Sbjct  253  GSGFGQREGTYHFRMTILPPMEKLRPLLEKLSQFHAKFTREY  294



>gb|ETP13552.1| hypothetical protein F441_11274 [Phytophthora parasitica CJ01A1]
Length=491

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 109/164 (66%), Gaps = 0/164 (0%)
 Frame = -1

Query  622  GVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMT  443
            G   ++ +L+   L     GQ+ +G+M NPP+PGD SY +++ +  G L SL++RA  + 
Sbjct  323  GAKDQFYKLMSVNLCSNIEGQLMVGMMTNPPQPGDASYQRYIEQRDGTLHSLKRRAIKLV  382

Query  442  DGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPG  263
              FN+   V CN TEGA+Y+FP   LP +A+E A+  G APD +YC+++L+ TGI  VPG
Sbjct  383  KAFNNLEGVTCNETEGALYTFPSTSLPAKAVEAAKEAGMAPDAFYCMQMLDETGIVVVPG  442

Query  262  SGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  131
            SGFGQK G +H R+TILP EE +  ++E   KF+ +FMD+Y ++
Sbjct  443  SGFGQKAGTWHFRSTILPPEEAVDEVIEKTAKFHAKFMDKYREN  486



>ref|XP_001622550.1| hypothetical protein NEMVEDRAFT_v1g236165 [Nematostella vectensis]
 gb|EDO30450.1| predicted protein [Nematostella vectensis]
Length=496

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 106/164 (65%), Gaps = 0/164 (0%)
 Frame = -1

Query  625  PGVLRRYTRLLQYPLVQMCPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIM  446
            P V     ++L   L     GQ  +  +VNPP+PGD SYD+F +E + +L S ++RA+++
Sbjct  333  PEVKFHLNKMLSAKLCSCITGQAMMDCLVNPPRPGDESYDEFTKEKEAVLASFKERAQLI  392

Query  445  TDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVP  266
            T  FNS   + CN + GAMYSFP + LP +A+  A+  G  PD +Y ++LLE TG+  VP
Sbjct  393  TKTFNSVEGIQCNESMGAMYSFPGLELPHKAVVAAKSRGLHPDSFYAMELLEQTGLCVVP  452

Query  265  GSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  134
            G+GFGQK+G +H R TILP  E +  + ESFK F+ +F+ +Y+D
Sbjct  453  GNGFGQKDGTYHFRLTILPPIEKLKPLFESFKDFHSKFLAKYKD  496



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250