BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF035H21

Length=660
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU36508.1|  hypothetical protein MIMGU_mgv1a008665mg                204   3e-60   Erythranthe guttata [common monkey flower]
gb|AFK36862.1|  unknown                                                 192   2e-58   Lotus japonicus
ref|XP_010105909.1|  putative methyltransferase                         195   6e-58   
gb|KGN60339.1|  hypothetical protein Csa_3G895850                       194   7e-58   Cucumis sativus [cucumbers]
gb|KHN19749.1|  Putative methyltransferase, chloroplastic               197   9e-58   Glycine soja [wild soybean]
ref|XP_003522802.1|  PREDICTED: uncharacterized methyltransferase...    197   9e-58   Glycine max [soybeans]
ref|XP_002285799.1|  PREDICTED: uncharacterized methyltransferase...    197   1e-57   Vitis vinifera
ref|XP_004136403.1|  PREDICTED: uncharacterized methyltransferase...    194   5e-57   
ref|XP_011074175.1|  PREDICTED: uncharacterized methyltransferase...    195   7e-57   Sesamum indicum [beniseed]
emb|CDP01043.1|  unnamed protein product                                195   1e-56   Coffea canephora [robusta coffee]
gb|KDO80932.1|  hypothetical protein CISIN_1g018003mg                   191   2e-56   Citrus sinensis [apfelsine]
ref|XP_006434004.1|  hypothetical protein CICLE_v10001682mg             190   2e-56   
ref|XP_007018799.1|  S-adenosylmethionine-dependent methyltransfe...    194   2e-56   
gb|AFK47008.1|  unknown                                                 194   3e-56   Lotus japonicus
ref|XP_004161765.1|  PREDICTED: uncharacterized methyltransferase...    193   6e-56   
ref|XP_007222212.1|  hypothetical protein PRUPE_ppa007824mg             192   1e-55   Prunus persica
ref|XP_010269234.1|  PREDICTED: uncharacterized methyltransferase...    191   2e-55   Nelumbo nucifera [Indian lotus]
ref|XP_010059991.1|  PREDICTED: uncharacterized methyltransferase...    192   2e-55   Eucalyptus grandis [rose gum]
ref|XP_011016296.1|  PREDICTED: uncharacterized methyltransferase...    192   3e-55   Populus euphratica
ref|XP_006472620.1|  PREDICTED: uncharacterized methyltransferase...    191   4e-55   
ref|XP_006472621.1|  PREDICTED: uncharacterized methyltransferase...    190   4e-55   
ref|XP_004500619.1|  PREDICTED: uncharacterized methyltransferase...    190   4e-55   Cicer arietinum [garbanzo]
gb|KDO80931.1|  hypothetical protein CISIN_1g018003mg                   191   5e-55   Citrus sinensis [apfelsine]
ref|XP_006434005.1|  hypothetical protein CICLE_v10001682mg             190   5e-55   
ref|XP_003527908.1|  PREDICTED: uncharacterized methyltransferase...    187   8e-55   
gb|KEH34908.1|  S-adenosylmethionine-dependent methyltransferase        189   1e-54   Medicago truncatula
ref|XP_008219673.1|  PREDICTED: uncharacterized methyltransferase...    189   1e-54   Prunus mume [ume]
ref|XP_002302290.2|  hypothetical protein POPTR_0002s09570g             189   2e-54   Populus trichocarpa [western balsam poplar]
ref|XP_010428929.1|  PREDICTED: uncharacterized methyltransferase...    189   2e-54   Camelina sativa [gold-of-pleasure]
gb|KDP41368.1|  hypothetical protein JCGZ_15775                         189   2e-54   Jatropha curcas
ref|XP_010428930.1|  PREDICTED: uncharacterized methyltransferase...    189   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_007136240.1|  hypothetical protein PHAVU_009G030200g             189   2e-54   Phaseolus vulgaris [French bean]
ref|XP_008466034.1|  PREDICTED: uncharacterized methyltransferase...    189   2e-54   Cucumis melo [Oriental melon]
ref|XP_009106463.1|  PREDICTED: uncharacterized methyltransferase...    187   6e-54   
ref|XP_009106462.1|  PREDICTED: uncharacterized methyltransferase...    187   6e-54   Brassica rapa
ref|XP_002513908.1|  S-adenosylmethionine-dependent methyltransfe...    186   2e-53   
ref|XP_004299641.1|  PREDICTED: uncharacterized methyltransferase...    186   2e-53   Fragaria vesca subsp. vesca
gb|KHN03912.1|  Putative methyltransferase, chloroplastic               182   2e-53   Glycine soja [wild soybean]
ref|XP_006390018.1|  hypothetical protein EUTSA_v10018789mg             186   3e-53   Eutrema salsugineum [saltwater cress]
ref|XP_002889176.1|  predicted protein                                  186   3e-53   
ref|XP_002306578.1|  methyltransferase-related family protein           182   3e-53   
emb|CDY14625.1|  BnaC02g24880D                                          186   3e-53   Brassica napus [oilseed rape]
emb|CDX88421.1|  BnaC06g38650D                                          186   4e-53   
ref|XP_010416782.1|  PREDICTED: uncharacterized methyltransferase...    185   5e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010416783.1|  PREDICTED: uncharacterized methyltransferase...    185   6e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010061813.1|  PREDICTED: uncharacterized methyltransferase...    184   2e-52   Eucalyptus grandis [rose gum]
gb|KCW67137.1|  hypothetical protein EUGRSUZ_F00926                     182   2e-52   Eucalyptus grandis [rose gum]
ref|XP_010472019.1|  PREDICTED: uncharacterized methyltransferase...    184   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010472020.1|  PREDICTED: uncharacterized methyltransferase...    184   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_009128280.1|  PREDICTED: uncharacterized methyltransferase...    183   2e-52   Brassica rapa
emb|CDY26853.1|  BnaA02g18780D                                          183   3e-52   Brassica napus [oilseed rape]
gb|KJB59931.1|  hypothetical protein B456_009G281700                    183   3e-52   Gossypium raimondii
gb|KJB59929.1|  hypothetical protein B456_009G281700                    183   3e-52   Gossypium raimondii
ref|NP_565170.1|  S-adenosyl-L-methionine-dependent methyltransfe...    183   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006300528.1|  hypothetical protein CARUB_v10020572mg             183   4e-52   
ref|XP_006386404.1|  hypothetical protein POPTR_0002s09570g             183   5e-52   
ref|XP_010064389.1|  PREDICTED: uncharacterized methyltransferase...    182   6e-52   
gb|AAG52104.1|AC012680_15  hypothetical protein; 38642-36701            181   9e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010064206.1|  PREDICTED: uncharacterized methyltransferase...    181   1e-51   Eucalyptus grandis [rose gum]
ref|XP_010937469.1|  PREDICTED: uncharacterized methyltransferase...    181   2e-51   Elaeis guineensis
gb|KHG01878.1|  hypothetical protein F383_23026                         180   4e-51   Gossypium arboreum [tree cotton]
ref|XP_009373157.1|  PREDICTED: uncharacterized methyltransferase...    180   6e-51   Pyrus x bretschneideri [bai li]
ref|XP_010667997.1|  PREDICTED: uncharacterized methyltransferase...    179   7e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008391145.1|  PREDICTED: uncharacterized methyltransferase...    177   9e-51   
ref|XP_008374425.1|  PREDICTED: uncharacterized methyltransferase...    177   5e-50   
ref|XP_008374488.1|  PREDICTED: uncharacterized methyltransferase...    177   6e-50   
emb|CDX87473.1|  BnaA07g34000D                                          177   6e-50   
ref|XP_008808068.1|  PREDICTED: uncharacterized methyltransferase...    175   2e-49   Phoenix dactylifera
ref|XP_008391080.1|  PREDICTED: uncharacterized methyltransferase...    176   2e-49   
ref|XP_010534071.1|  PREDICTED: uncharacterized methyltransferase...    175   4e-49   
ref|XP_010534070.1|  PREDICTED: uncharacterized methyltransferase...    174   6e-49   Tarenaya hassleriana [spider flower]
ref|XP_009394965.1|  PREDICTED: uncharacterized methyltransferase...    172   3e-48   
ref|XP_009394964.1|  PREDICTED: uncharacterized methyltransferase...    173   3e-48   
ref|XP_010939635.1|  PREDICTED: uncharacterized methyltransferase...    168   9e-47   Elaeis guineensis
ref|XP_008790837.1|  PREDICTED: uncharacterized methyltransferase...    165   1e-45   
ref|XP_008790838.1|  PREDICTED: uncharacterized methyltransferase...    164   3e-45   Phoenix dactylifera
gb|KJB14720.1|  hypothetical protein B456_002G140100                    165   7e-45   Gossypium raimondii
gb|KDO80930.1|  hypothetical protein CISIN_1g018003mg                   161   6e-44   Citrus sinensis [apfelsine]
ref|XP_010928270.1|  PREDICTED: uncharacterized methyltransferase...    151   2e-40   
ref|XP_010928269.1|  PREDICTED: uncharacterized methyltransferase...    151   2e-40   
ref|XP_009386973.1|  PREDICTED: uncharacterized methyltransferase...    152   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001150427.1|  S-adenosylmethionine-dependent methyltransfe...    151   4e-40   Zea mays [maize]
ref|XP_010928268.1|  PREDICTED: uncharacterized methyltransferase...    151   6e-40   
ref|XP_010928267.1|  PREDICTED: uncharacterized methyltransferase...    151   6e-40   Elaeis guineensis
ref|XP_008788786.1|  PREDICTED: uncharacterized methyltransferase...    150   7e-40   
ref|XP_006659389.1|  PREDICTED: uncharacterized methyltransferase...    151   7e-40   
gb|EEE66113.1|  hypothetical protein OsJ_22149                          147   8e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002445476.1|  hypothetical protein SORBIDRAFT_07g020130          150   1e-39   Sorghum bicolor [broomcorn]
ref|XP_003563313.1|  PREDICTED: uncharacterized methyltransferase...    149   2e-39   Brachypodium distachyon [annual false brome]
ref|XP_003574470.1|  PREDICTED: uncharacterized methyltransferase...    149   3e-39   Brachypodium distachyon [annual false brome]
ref|NP_001061786.1|  Os08g0411200                                       149   5e-39   
ref|XP_004973409.1|  PREDICTED: uncharacterized methyltransferase...    148   6e-39   Setaria italica
ref|NP_001058196.1|  Os06g0646000                                       147   1e-38   
gb|AFW76188.1|  hypothetical protein ZEAMMB73_680706                    143   1e-38   
ref|XP_004974685.1|  PREDICTED: uncharacterized methyltransferase...    146   2e-38   
gb|EEE68668.1|  hypothetical protein OsJ_27281                          147   2e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004488470.1|  PREDICTED: uncharacterized methyltransferase...    147   2e-38   Cicer arietinum [garbanzo]
dbj|BAJ91607.1|  predicted protein                                      145   7e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006657188.1|  PREDICTED: uncharacterized methyltransferase...    145   7e-38   
dbj|BAJ94151.1|  predicted protein                                      145   7e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002438745.1|  hypothetical protein SORBIDRAFT_10g025400          144   2e-37   Sorghum bicolor [broomcorn]
gb|EMT07919.1|  Putative methyltransferase                              144   2e-37   
gb|EMT30153.1|  Putative methyltransferase                              145   2e-37   
ref|XP_004965743.1|  PREDICTED: uncharacterized methyltransferase...    143   2e-37   Setaria italica
gb|ACG27569.1|  S-adenosylmethionine-dependent methyltransferase        143   4e-37   Zea mays [maize]
gb|ACF85541.1|  unknown                                                 143   4e-37   Zea mays [maize]
ref|NP_001132053.1|  uncharacterized LOC100193465                       143   5e-37   Zea mays [maize]
ref|XP_004965742.1|  PREDICTED: uncharacterized methyltransferase...    142   1e-36   Setaria italica
ref|XP_011470644.1|  PREDICTED: uncharacterized methyltransferase...    142   1e-36   Fragaria vesca subsp. vesca
ref|XP_011470680.1|  PREDICTED: uncharacterized methyltransferase...    141   2e-36   Fragaria vesca subsp. vesca
ref|XP_004287240.1|  PREDICTED: uncharacterized methyltransferase...    141   2e-36   Fragaria vesca subsp. vesca
ref|XP_010099510.1|  putative methyltransferase                         141   3e-36   Morus notabilis
gb|KDP30197.1|  hypothetical protein JCGZ_16979                         140   9e-36   Jatropha curcas
ref|XP_003546595.1|  PREDICTED: uncharacterized methyltransferase...    139   1e-35   Glycine max [soybeans]
emb|CDP10502.1|  unnamed protein product                                139   2e-35   Coffea canephora [robusta coffee]
gb|EMT00494.1|  Putative methyltransferase                              141   2e-35   
ref|XP_011017926.1|  PREDICTED: uncharacterized methyltransferase...    139   2e-35   Populus euphratica
ref|XP_008336947.1|  PREDICTED: uncharacterized methyltransferase...    137   5e-35   
gb|EYU34934.1|  hypothetical protein MIMGU_mgv1a009522mg                137   5e-35   Erythranthe guttata [common monkey flower]
ref|XP_011078555.1|  PREDICTED: uncharacterized methyltransferase...    137   5e-35   Sesamum indicum [beniseed]
ref|XP_008456635.1|  PREDICTED: uncharacterized methyltransferase...    137   1e-34   Cucumis melo [Oriental melon]
ref|XP_006586686.1|  PREDICTED: uncharacterized protein LOC100798...    136   1e-34   Glycine max [soybeans]
ref|NP_001242875.1|  uncharacterized protein LOC100798970               136   1e-34   
gb|KHN28439.1|  Putative methyltransferase, chloroplastic               136   1e-34   Glycine soja [wild soybean]
ref|XP_002268107.1|  PREDICTED: uncharacterized methyltransferase...    136   1e-34   Vitis vinifera
ref|XP_010050326.1|  PREDICTED: uncharacterized methyltransferase...    136   2e-34   Eucalyptus grandis [rose gum]
ref|XP_006381066.1|  methyltransferase-related family protein           135   2e-34   
gb|KJB53960.1|  hypothetical protein B456_009G013400                    135   2e-34   Gossypium raimondii
ref|XP_008242913.1|  PREDICTED: uncharacterized methyltransferase...    134   3e-34   
ref|XP_007013645.1|  S-adenosyl-L-methionine-dependent methyltran...    135   4e-34   
gb|KEH37884.1|  S-adenosylmethionine-dependent methyltransferase        134   4e-34   Medicago truncatula
ref|XP_011020252.1|  PREDICTED: uncharacterized methyltransferase...    135   4e-34   Populus euphratica
ref|XP_002324579.2|  methyltransferase-related family protein           135   4e-34   
gb|KJB53958.1|  hypothetical protein B456_009G013400                    135   5e-34   Gossypium raimondii
ref|XP_004139262.1|  PREDICTED: uncharacterized methyltransferase...    134   6e-34   Cucumis sativus [cucumbers]
ref|XP_009337420.1|  PREDICTED: uncharacterized methyltransferase...    128   6e-34   Pyrus x bretschneideri [bai li]
ref|XP_009337419.1|  PREDICTED: uncharacterized methyltransferase...    128   8e-34   Pyrus x bretschneideri [bai li]
ref|XP_004167998.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    134   9e-34   
gb|KHG21340.1|  hypothetical protein F383_03824                         135   1e-33   Gossypium arboreum [tree cotton]
ref|XP_008336950.1|  PREDICTED: uncharacterized methyltransferase...    134   1e-33   
ref|XP_008456627.1|  PREDICTED: uncharacterized methyltransferase...    134   1e-33   Cucumis melo [Oriental melon]
gb|ACJ84583.1|  unknown                                                 133   2e-33   Medicago truncatula
ref|XP_002268200.1|  PREDICTED: uncharacterized methyltransferase...    133   2e-33   Vitis vinifera
emb|CBI25578.3|  unnamed protein product                                133   2e-33   Vitis vinifera
ref|XP_010656529.1|  PREDICTED: uncharacterized methyltransferase...    133   2e-33   Vitis vinifera
ref|XP_002531454.1|  phosphatidylethanolamine n-methyltransferase...    132   3e-33   
gb|EMT14235.1|  Putative methyltransferase                              134   3e-33   
gb|AFK46366.1|  unknown                                                 133   3e-33   Medicago truncatula
ref|XP_007202300.1|  hypothetical protein PRUPE_ppa007882mg             133   3e-33   Prunus persica
ref|XP_002988667.1|  hypothetical protein SELMODRAFT_46133              130   5e-33   
gb|KGN60753.1|  hypothetical protein Csa_2G009410                       131   9e-33   Cucumis sativus [cucumbers]
ref|XP_008344066.1|  PREDICTED: uncharacterized methyltransferase...    131   9e-33   
gb|KJB27062.1|  hypothetical protein B456_004G275300                    131   1e-32   Gossypium raimondii
ref|XP_010047200.1|  PREDICTED: uncharacterized methyltransferase...    131   1e-32   Eucalyptus grandis [rose gum]
ref|XP_009338403.1|  PREDICTED: uncharacterized methyltransferase...    131   1e-32   Pyrus x bretschneideri [bai li]
ref|XP_010687777.1|  PREDICTED: uncharacterized methyltransferase...    131   1e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009358530.1|  PREDICTED: uncharacterized methyltransferase...    131   2e-32   
ref|XP_008348560.1|  PREDICTED: uncharacterized methyltransferase...    132   2e-32   
ref|XP_002986403.1|  hypothetical protein SELMODRAFT_235009             130   2e-32   Selaginella moellendorffii
ref|XP_006411367.1|  hypothetical protein EUTSA_v10016844mg             130   3e-32   Eutrema salsugineum [saltwater cress]
emb|CDY06948.1|  BnaA04g23670D                                          134   3e-32   
ref|XP_009141962.1|  PREDICTED: uncharacterized methyltransferase...    130   3e-32   Brassica rapa
gb|KHG26587.1|  hypothetical protein F383_01046                         130   3e-32   Gossypium arboreum [tree cotton]
ref|XP_006453728.1|  hypothetical protein CICLE_v10008875mg             129   5e-32   Citrus clementina [clementine]
gb|KDO59312.1|  hypothetical protein CISIN_1g019950mg                   129   5e-32   Citrus sinensis [apfelsine]
gb|KDO59313.1|  hypothetical protein CISIN_1g019950mg                   129   5e-32   Citrus sinensis [apfelsine]
ref|XP_009338401.1|  PREDICTED: uncharacterized methyltransferase...    129   6e-32   Pyrus x bretschneideri [bai li]
ref|XP_006473930.1|  PREDICTED: uncharacterized methyltransferase...    129   9e-32   
ref|XP_010533098.1|  PREDICTED: uncharacterized methyltransferase...    129   1e-31   Tarenaya hassleriana [spider flower]
emb|CDY57579.1|  BnaC04g56820D                                          129   1e-31   Brassica napus [oilseed rape]
ref|XP_009602551.1|  PREDICTED: uncharacterized methyltransferase...    124   2e-31   
ref|XP_008374562.1|  PREDICTED: uncharacterized methyltransferase...    127   3e-31   
ref|XP_004287239.1|  PREDICTED: uncharacterized methyltransferase...    125   6e-31   Fragaria vesca subsp. vesca
ref|XP_009802104.1|  PREDICTED: uncharacterized methyltransferase...    127   6e-31   Nicotiana sylvestris
ref|XP_006852799.1|  hypothetical protein AMTR_s00033p00159870          126   6e-31   
ref|NP_181637.2|  uncharacterized methyltransferase                     126   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879904.1|  hypothetical protein ARALYDRAFT_903411             126   1e-30   
ref|XP_010517586.1|  PREDICTED: uncharacterized methyltransferase...    126   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010508773.1|  PREDICTED: uncharacterized methyltransferase...    125   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010505866.1|  PREDICTED: uncharacterized methyltransferase...    125   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_001778776.1|  predicted protein                                  124   2e-30   
ref|XP_008336951.1|  PREDICTED: uncharacterized methyltransferase...    125   3e-30   
gb|KFK36957.1|  hypothetical protein AALP_AA4G194500                    125   3e-30   Arabis alpina [alpine rockcress]
ref|XP_009363912.1|  PREDICTED: uncharacterized methyltransferase...    124   4e-30   Pyrus x bretschneideri [bai li]
ref|XP_006293382.1|  hypothetical protein CARUB_v10023510mg             124   5e-30   Capsella rubella
ref|XP_006359517.1|  PREDICTED: uncharacterized methyltransferase...    123   9e-30   Solanum tuberosum [potatoes]
gb|KDO80933.1|  hypothetical protein CISIN_1g018003mg                   123   2e-29   Citrus sinensis [apfelsine]
gb|EEC83568.1|  hypothetical protein OsI_29220                          121   8e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_004242719.1|  PREDICTED: uncharacterized methyltransferase...    120   1e-28   Solanum lycopersicum
ref|XP_004242718.1|  PREDICTED: uncharacterized methyltransferase...    119   3e-28   Solanum lycopersicum
ref|XP_003056709.1|  predicted protein                                  119   6e-28   Micromonas pusilla CCMP1545
ref|XP_009394966.1|  PREDICTED: uncharacterized methyltransferase...    117   8e-28   
gb|KIY98469.1|  putative methyltransferase                              115   2e-27   Monoraphidium neglectum
ref|XP_007510827.1|  predicted protein                                  116   7e-27   Bathycoccus prasinos
ref|XP_006359516.1|  PREDICTED: uncharacterized methyltransferase...    115   8e-27   Solanum tuberosum [potatoes]
ref|XP_002968407.1|  hypothetical protein SELMODRAFT_89857              114   2e-26   
ref|XP_002954755.1|  hypothetical protein VOLCADRAFT_106536             114   2e-26   Volvox carteri f. nagariensis
gb|ABR16838.1|  unknown                                                 114   2e-26   Picea sitchensis
ref|XP_001418638.1|  predicted protein                                  108   4e-25   Ostreococcus lucimarinus CCE9901
ref|XP_002506188.1|  predicted protein                                  109   2e-24   Micromonas commoda
ref|XP_003080221.1|  methyltransferase-related (ISS)                    108   2e-24   Ostreococcus tauri
ref|XP_001694737.1|  predicted protein                                  104   3e-23   Chlamydomonas reinhardtii
ref|XP_002500021.1|  predicted protein                                  104   9e-23   Micromonas commoda
ref|XP_007227385.1|  hypothetical protein PRUPE_ppb016862mg             101   1e-22   
emb|CAN77779.1|  hypothetical protein VITISV_004172                     104   6e-22   Vitis vinifera
gb|KJB27061.1|  hypothetical protein B456_004G275300                    100   2e-21   Gossypium raimondii
gb|KCW79026.1|  hypothetical protein EUGRSUZ_C00449                   98.6    5e-21   Eucalyptus grandis [rose gum]
gb|KCW79027.1|  hypothetical protein EUGRSUZ_C00449                   98.6    7e-21   Eucalyptus grandis [rose gum]
dbj|BAC99645.1|  hypothetical protein                                 98.6    7e-21   Oryza sativa Japonica Group [Japonica rice]
gb|KDO59315.1|  hypothetical protein CISIN_1g019950mg                 97.8    1e-20   Citrus sinensis [apfelsine]
gb|KDO59316.1|  hypothetical protein CISIN_1g019950mg                 97.4    2e-20   Citrus sinensis [apfelsine]
ref|XP_005643537.1|  S-adenosyl-L-methionine-dependent methyltran...  93.2    7e-19   Coccomyxa subellipsoidea C-169
ref|XP_002967385.1|  hypothetical protein SELMODRAFT_408369           93.2    5e-18   
ref|XP_003057905.1|  predicted protein                                84.7    3e-16   Micromonas pusilla CCMP1545
ref|XP_002502147.1|  predicted protein                                82.4    5e-15   Micromonas commoda
ref|XP_005536724.1|  hypothetical protein, conserved                  81.6    1e-14   Cyanidioschyzon merolae strain 10D
ref|XP_002960327.1|  hypothetical protein SELMODRAFT_402502           80.9    5e-14   
gb|EMS47735.1|  hypothetical protein TRIUR3_02804                     77.4    7e-14   Triticum urartu
ref|XP_007514982.1|  predicted protein                                76.3    7e-13   Bathycoccus prasinos
ref|XP_005824779.1|  hypothetical protein GUITHDRAFT_116106           75.5    1e-12   Guillardia theta CCMP2712
ref|XP_002185698.1|  predicted protein                                75.1    2e-12   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_005713645.1|  unnamed protein product                          73.6    3e-12   Chondrus crispus [carageen]
gb|KJB59930.1|  hypothetical protein B456_009G281700                  72.8    3e-12   Gossypium raimondii
ref|XP_006434006.1|  hypothetical protein CICLE_v10001682mg           73.2    3e-12   
ref|XP_010040339.1|  PREDICTED: uncharacterized methyltransferase...  72.8    4e-12   Eucalyptus grandis [rose gum]
gb|EWM24600.1|  phosphatidylethanolamine n                            73.9    5e-12   Nannochloropsis gaditana
ref|XP_005855405.1|  hypothetical protein NGA_2005920                 73.9    5e-12   Nannochloropsis gaditana CCMP526
gb|EJK66010.1|  hypothetical protein THAOC_13088                      72.4    2e-11   Thalassiosira oceanica
ref|XP_008389527.1|  PREDICTED: uncharacterized methyltransferase...  70.9    3e-11   
gb|KJB53959.1|  hypothetical protein B456_009G013400                  70.1    3e-11   Gossypium raimondii
gb|AAD12007.1|  hypothetical protein                                  70.1    4e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002503324.1|  chloroplast envelope protein translocase family  71.6    6e-11   Micromonas commoda
gb|AEJ88263.1|  putative S-adenosylmethionine-dependent methyltra...  69.3    6e-11   Wolffia arrhiza
emb|CBJ26935.1|  S-adenosyl-L-methionine-dependent methyltransfer...  70.5    8e-11   Ectocarpus siliculosus
ref|XP_008356589.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  67.8    2e-10   
gb|KDO59317.1|  hypothetical protein CISIN_1g019950mg                 67.8    4e-10   Citrus sinensis [apfelsine]
ref|XP_005781281.1|  hypothetical protein EMIHUDRAFT_442892           68.2    6e-10   Emiliania huxleyi CCMP1516
ref|WP_037584032.1|  hypothetical protein                             66.2    6e-10   
gb|ADO73882.1|  Methyltransferase type 11                             66.2    7e-10   Stigmatella aurantiaca DW4/3-1
ref|WP_022122196.1|  hypothetical protein                             64.7    2e-09   
ref|XP_006826926.1|  hypothetical protein AMTR_s00010p00172800        64.3    2e-09   
ref|WP_033335056.1|  hypothetical protein                             61.6    3e-09   
gb|KIE07218.1|  hypothetical protein DA73_0239355                     64.7    3e-09   Tolypothrix bouteillei VB521301
ref|WP_011557522.1|  MULTISPECIES: SAM-dependent methyltransferase    63.2    7e-09   Mycobacteriaceae
ref|WP_006242682.1|  SAM-dependent methyltransferase                  63.2    8e-09   Mycolicibacterium tusciae
ref|XP_005705444.1|  phosphatidylethanolamine n-methyltransferase...  63.9    1e-08   Galdieria sulphuraria
ref|WP_027728386.1|  SAM-dependent methyltransferase                  61.6    1e-08   Treponema sp. C6A8
ref|WP_044509270.1|  SAM-dependent methyltransferase                  62.4    2e-08   Mycobacterium simiae
ref|XP_010250394.1|  PREDICTED: uncharacterized protein LOC104592660  63.9    2e-08   
ref|XP_002992310.1|  hypothetical protein SELMODRAFT_430530           61.2    2e-08   
ref|WP_005984449.1|  SAM-dependent methyltransferase                  61.2    3e-08   Actinomyces graevenitzii
ref|WP_034501983.1|  SAM-dependent methyltransferase                  60.8    3e-08   Actinomyces sp. S6-Spd3
ref|WP_003790083.1|  SAM-dependent methyltransferase                  60.5    5e-08   Actinomyces odontolyticus
ref|WP_003794338.1|  SAM-dependent methyltransferase                  60.1    6e-08   Actinomyces odontolyticus
ref|WP_034465932.1|  SAM-dependent methyltransferase                  60.1    6e-08   Actinomyces sp. ICM54
ref|WP_009647626.1|  SAM-dependent methyltransferase                  59.3    1e-07   Actinomyces sp. ICM47
ref|WP_036881765.1|  ubiquinone biosynthesis methyltransferase UbiE   59.7    1e-07   Porphyromonas sp. COT-239 OH1446
ref|WP_008332456.1|  methyltransferase, UbiE/COQ5 family protein      58.5    2e-07   Maritimibacter alkaliphilus
ref|WP_007588477.1|  SAM-dependent methyltransferase                  58.5    2e-07   Actinomyces sp. ICM39
ref|XP_003079346.1|  non-transporter ABC protein (ISS)                60.5    3e-07   
ref|XP_007514207.1|  predicted protein                                58.2    3e-07   Bathycoccus prasinos
emb|CEF97980.1|  Methyltransferase type 11                            58.9    4e-07   Ostreococcus tauri
ref|WP_009273390.1|  menaquinone biosynthesis methyltransferase UbiE  57.8    5e-07   unclassified Erysipelotrichaceae (miscellaneous)
ref|WP_024448835.1|  SAM-dependent methyltransferase                  58.2    5e-07   
ref|WP_037972343.1|  2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4...  58.2    5e-07   
ref|XP_003056909.1|  predicted protein                                58.9    5e-07   Micromonas pusilla CCMP1545
ref|WP_018358192.1|  hypothetical protein                             57.8    6e-07   Porphyromonas levii
ref|WP_021603648.1|  methyltransferase domain protein                 57.4    7e-07   Actinomyces graevenitzii
ref|WP_040692770.1|  hypothetical protein                             57.4    7e-07   
gb|ACL04197.1|  Methyltransferase type 11                             58.2    8e-07   Desulfatibacillum alkenivorans AK-01
ref|WP_021591497.1|  hypothetical protein                             57.0    8e-07   Actinomadura madurae
ref|WP_014739643.1|  ubiquinone biosynthesis methyltransferase UbiE   57.0    9e-07   Modestobacter marinus
ref|WP_011777434.1|  SAM-dependent methyltransferase                  57.4    9e-07   Mycolicibacterium
ref|WP_036368657.1|  SAM-dependent methyltransferase                  57.4    9e-07   Mycolicibacterium austroafricanum
ref|WP_036550599.1|  hypothetical protein                             56.2    1e-06   
ref|WP_032753181.1|  methyltransferase                                57.0    1e-06   Streptomyces alboviridis
ref|WP_012828704.1|  type 11 methyltransferase                        57.4    1e-06   Haliangium ochraceum
ref|WP_043403276.1|  hypothetical protein                             57.0    2e-06   
ref|WP_008521718.1|  MULTISPECIES: methyltransferase                  56.6    2e-06   Jonquetella
ref|WP_007167123.1|  SAM-dependent methyltransferase                  57.0    2e-06   
ref|WP_007577247.1|  putative methyltransferase                       57.0    2e-06   
ref|WP_030394695.1|  MULTISPECIES: 2-polyprenyl-3-methyl-5-hydrox...  56.6    2e-06   
ref|WP_015608375.1|  Methyltransferase type 11                        56.6    2e-06   
ref|WP_028509762.1|  SAM-dependent methyltransferase                  56.2    2e-06   
ref|WP_024984910.1|  methylase                                        57.0    2e-06   
gb|KFA90141.1|  hypothetical protein Q664_29640                       57.0    2e-06   
ref|WP_013330439.1|  type 11 methyltransferase                        56.2    2e-06   
ref|WP_031126010.1|  hypothetical protein                             55.5    2e-06   
ref|WP_034433269.1|  methyltransferase                                55.8    2e-06   
ref|WP_003387235.1|  hypothetical protein                             56.6    2e-06   
ref|WP_031116772.1|  MULTISPECIES: hypothetical protein               56.6    2e-06   
gb|EUA43477.1|  ubiE/COQ5 methyltransferase family protein            53.9    2e-06   
ref|WP_020221539.1|  hypothetical protein                             54.7    2e-06   
ref|WP_007978534.1|  type 11 methyltransferase                        55.5    2e-06   
ref|WP_021611333.1|  methyltransferase domain protein                 55.8    3e-06   
ref|WP_011305165.1|  demethylmenaquinone methyltransferase            55.1    3e-06   
ref|WP_005039618.1|  ubiquinone/menaquinone biosynthesis methyltr...  55.5    3e-06   
ref|WP_009058751.1|  SAM-dependent methyltransferase                  55.5    3e-06   
ref|WP_018562919.1|  hypothetical protein                             56.2    3e-06   
ref|WP_033721305.1|  SAM-dependent methyltransferase                  56.2    3e-06   
gb|ETB46623.1|  SAM-dependent methyltransferase                       56.2    3e-06   
ref|WP_028263827.1|  SAM-dependent methyltransferase                  55.5    3e-06   
ref|WP_031348458.1|  SAM-dependent methyltransferase                  55.8    3e-06   
ref|WP_003874284.1|  SAM-dependent methyltransferase                  55.8    3e-06   
gb|ETB14793.1|  SAM-dependent methyltransferase                       56.2    3e-06   
ref|WP_040710863.1|  SAM-dependent methyltransferase                  55.5    3e-06   
gb|AJR18080.1|  methyltransferase                                     55.8    4e-06   
ref|WP_011726543.1|  SAM-dependent methyltransferase                  55.8    4e-06   
gb|ETA95861.1|  SAM-dependent methyltransferase                       56.2    4e-06   
gb|ETB32802.1|  SAM-dependent methyltransferase                       55.8    4e-06   
ref|WP_033712326.1|  MULTISPECIES: SAM-dependent methyltransferase    55.8    4e-06   
ref|WP_028655549.1|  hypothetical protein                             55.5    4e-06   
ref|WP_036227573.1|  hypothetical protein                             54.7    4e-06   
ref|WP_043644505.1|  hypothetical protein                             54.7    4e-06   
ref|WP_016521175.1|  hypothetical protein                             55.1    4e-06   
gb|ETB02671.1|  SAM-dependent methyltransferase                       55.8    4e-06   
ref|WP_031353789.1|  SAM-dependent methyltransferase                  55.8    4e-06   
ref|WP_036465838.1|  SAM-dependent methyltransferase                  55.8    4e-06   
gb|ETB01440.1|  SAM-dependent methyltransferase                       55.8    4e-06   
ref|WP_021779624.1|  2-heptaprenyl-1,4-naphthoquinone methyltrans...  55.1    4e-06   
ref|WP_017733585.1|  hypothetical protein                             55.5    5e-06   
ref|WP_022753571.1|  MULTISPECIES: methyltransferase                  55.5    5e-06   
ref|WP_009979883.1|  SAM-dependent methyltransferase                  55.5    5e-06   
ref|WP_042432128.1|  methyltransferase                                54.3    5e-06   
ref|WP_035040441.1|  SAM-dependent methyltransferase                  55.1    5e-06   
ref|WP_034483566.1|  methyltransferase                                55.5    5e-06   
ref|WP_022766187.1|  methyltransferase                                55.5    5e-06   
ref|WP_037345954.1|  hypothetical protein                             53.9    5e-06   
ref|WP_006538082.1|  methyltransferase                                55.8    5e-06   
gb|ESL03201.1|  methyltransferase domain protein                      55.1    5e-06   
ref|WP_031028461.1|  2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4...  55.1    6e-06   
ref|WP_036430237.1|  SAM-dependent methyltransferase                  55.1    6e-06   
ref|WP_013643503.1|  methyltransferase                                55.1    6e-06   
ref|WP_039694375.1|  methyltransferase                                55.1    6e-06   
ref|WP_026523167.1|  SAM-dependent methyltransferase                  54.7    6e-06   
ref|WP_006530961.1|  MULTISPECIES: methyltransferase                  54.7    6e-06   
ref|WP_014620256.1|  methyltransferase                                54.7    6e-06   
ref|WP_007157173.1|  methyltransferase                                55.1    6e-06   
ref|WP_026220375.1|  2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4...  55.1    6e-06   
ref|WP_040580452.1|  ubiquinone biosynthesis methyltransferase UbiE   54.7    6e-06   
ref|WP_029472326.1|  ubiquinone biosynthesis methyltransferase UbiE   54.7    7e-06   
ref|WP_016471571.1|  MULTISPECIES: 3-demethylubiquinone-9 3-O-met...  55.1    7e-06   
ref|WP_040742155.1|  hypothetical protein                             55.1    7e-06   
ref|WP_030408594.1|  2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4...  55.1    7e-06   
gb|AGB25690.1|  methylase involved in ubiquinone/menaquinone bios...  55.1    7e-06   
ref|WP_014357257.1|  S-adenosylmethionine-dependent methyltransfe...  54.7    7e-06   
ref|WP_041315040.1|  SAM-dependent methyltransferase                  55.1    7e-06   
ref|WP_022181454.1|  putative methyltransferase                       54.7    8e-06   
ref|WP_006617666.1|  methyltransferase type 11                        54.3    8e-06   
ref|WP_037324629.1|  methyltransferase                                54.7    8e-06   
ref|WP_037908141.1|  methyltransferase                                55.1    8e-06   
ref|WP_040589166.1|  hypothetical protein                             53.5    8e-06   
ref|WP_023059264.1|  methionine biosynthesis protein MetW-like pr...  54.3    8e-06   
ref|WP_024468379.1|  methyltransferase                                53.5    8e-06   
ref|WP_003505027.1|  methyltransferase [                              54.3    9e-06   
ref|WP_028504361.1|  methyltransferase                                54.7    9e-06   
ref|WP_021054799.1|  methylase involved in ubiquinone/menaquinone...  54.7    9e-06   
ref|WP_013823230.1|  ubiquinone biosynthesis protein UbiE             54.3    9e-06   
ref|WP_009254158.1|  MULTISPECIES: methyltransferase                  54.3    1e-05   
ref|WP_014210042.1|  SAM-dependent methyltransferase                  54.7    1e-05   
ref|WP_027357282.1|  ubiquinone biosynthesis protein UbiE             53.9    1e-05   
ref|WP_007722294.1|  methylase                                        54.7    1e-05   
ref|WP_044505825.1|  methyltransferase type 11                        54.3    1e-05   
ref|WP_010842823.1|  Methyltransferase                                54.3    1e-05   
gb|AFR47307.1|  Methyltransferase                                     53.9    1e-05   
gb|EEN83064.1|  methyltransferase domain protein                      54.7    1e-05   
ref|WP_035297923.1|  methylase                                        54.7    1e-05   
ref|WP_023554536.1|  methylase                                        54.7    1e-05   
ref|WP_006906917.1|  methyltransferase                                53.1    1e-05   
gb|ADZ19620.1|  Putative methyltransferase                            53.9    1e-05   
ref|WP_034581745.1|  SAM-dependent methlyltransferase                 53.9    1e-05   
ref|WP_025491690.1|  methyltransferase                                53.9    1e-05   
ref|WP_006905290.1|  type 11 methyltransferase                        53.9    1e-05   
ref|WP_009366846.1|  SAM-dependent methlyltransferase                 53.9    1e-05   
ref|WP_010963888.1|  fibrillarin-like rRNA methylase                  53.9    1e-05   
ref|WP_034547175.1|  methyltransferase                                53.5    1e-05   
ref|WP_016741716.1|  methylase                                        54.3    1e-05   
ref|WP_022107680.1|  methyltransferase domain protein                 53.5    2e-05   
ref|WP_020681005.1|  hypothetical protein                             53.5    2e-05   
ref|WP_028922352.1|  hypothetical protein                             54.3    2e-05   
ref|WP_003921361.1|  SAM-dependent methyltransferase                  53.9    2e-05   
ref|WP_017247314.1|  methylase                                        54.3    2e-05   
ref|WP_032076775.1|  ubiquinone/menaquinone biosynthesis protein      53.5    2e-05   
ref|WP_004058245.1|  ubiquinone/menaquinone biosynthesis methyltr...  53.5    2e-05   
ref|WP_018911115.1|  methyltransferase UbiE                           53.9    2e-05   
gb|AFS14590.1|  Ubiquinone/menaquinone biosynthesis methyl transf...  53.5    2e-05   
ref|WP_036517890.1|  methyltransferase type 11                        53.1    2e-05   
ref|WP_038683354.1|  hypothetical protein                             52.0    2e-05   
ref|WP_007769532.1|  SAM-dependent methyltransferase                  53.9    2e-05   
ref|WP_034251379.1|  SAM-dependent methyltransferase                  53.1    2e-05   
gb|ADU21708.1|  Methyltransferase type 11                             54.3    2e-05   
ref|WP_003891430.1|  SAM-dependent methyltransferase                  53.5    2e-05   
ref|WP_043013118.1|  hypothetical protein                             53.9    2e-05   
ref|WP_029231175.1|  hypothetical protein                             53.9    2e-05   
ref|WP_003464373.1|  transcriptional regulator                        53.9    2e-05   
ref|WP_043954873.1|  SAM-dependent methyltransferase                  53.1    2e-05   
ref|WP_012684915.1|  methylase                                        53.5    3e-05   
ref|WP_007168876.1|  SAM-dependent methyltransferase                  53.5    3e-05   
ref|WP_022848725.1|  type 11 methyltransferase                        53.1    3e-05   
ref|WP_035770868.1|  hypothetical protein                             53.1    3e-05   
ref|WP_033328581.1|  methyltransferase                                53.5    3e-05   
ref|WP_007419871.1|  methylase involved in ubiquinone/menaquinone...  53.5    3e-05   
ref|WP_035544367.1|  hypothetical protein                             53.5    3e-05   
ref|WP_025843753.1|  methylase                                        53.5    3e-05   
ref|WP_029113106.1|  ubiquinone biosynthesis protein                  52.8    3e-05   
ref|WP_005827317.1|  MULTISPECIES: methylase                          53.5    3e-05   
ref|WP_044543828.1|  SAM-dependent methyltransferase                  53.1    3e-05   
gb|AGP64201.1|  ubiquinone/menaquinone biosynthesis methyltransfe...  52.8    3e-05   
ref|WP_034929816.1|  methyltransferase                                53.1    3e-05   
ref|WP_020074409.1|  methyltransferase [                              52.8    3e-05   
ref|WP_007049331.1|  hypothetical protein                             52.8    3e-05   
ref|WP_043717337.1|  hypothetical protein                             53.5    3e-05   
ref|WP_016460104.1|  hypothetical protein                             52.8    3e-05   
ref|WP_037328854.1|  methyltransferase                                52.8    3e-05   
ref|WP_018511596.1|  methyltransferase                                53.1    3e-05   
ref|WP_006825141.1|  type 11 methyltransferase                        52.8    4e-05   
ref|WP_034437733.1|  methyltransferase                                52.4    4e-05   
gb|ERH11874.1|  methylase involved in ubiquinone/menaquinone bios...  52.8    4e-05   
ref|WP_011572453.1|  SAM-dependent methlyltransferase                 52.8    4e-05   
ref|WP_036455806.1|  MULTISPECIES: SAM-dependent methyltransferase    52.8    4e-05   
ref|WP_006665667.1|  type 11 methyltransferase                        52.4    4e-05   
gb|EKY16220.1|  methyltransferase domain protein                      52.8    4e-05   
ref|WP_011024227.1|  fibrillarin-like rRNA methylase                  52.0    4e-05   
ref|WP_006107805.1|  type 11 methyltransferase                        52.4    4e-05   
ref|WP_033082084.1|  biotin biosynthesis protein bioC                 53.1    4e-05   
ref|WP_006695867.1|  methyltransferase                                52.4    4e-05   
ref|WP_014556897.1|  SAM-dependent methlyltransferase                 52.8    4e-05   
ref|WP_033359706.1|  hypothetical protein                             53.1    4e-05   
gb|EJO90509.1|  ubiquinone/menaquinone biosynthesis methyltransfe...  51.2    4e-05   
ref|WP_033092997.1|  biotin biosynthesis protein bioC                 53.1    4e-05   
ref|WP_035928605.1|  methyltransferase                                50.8    4e-05   
gb|KIZ22021.1|  methyltransferase                                     52.8    5e-05   
ref|WP_026498217.1|  SAM-dependent methyltransferase                  52.4    5e-05   
ref|WP_005313006.1|  biotin biosynthesis protein BioC                 53.1    5e-05   
ref|WP_024500970.1|  ubiquinone biosynthesis methyltransferase UbiE   52.8    5e-05   
ref|WP_023465902.1|  ubiquinone/menaquinone biosynthesis methyltr...  52.8    5e-05   
ref|WP_021349912.1|  ubiquinone/menaquinone biosynthesis methyltr...  52.8    5e-05   
gb|EEJ52634.1|  methyltransferase domain protein                      52.4    5e-05   
ref|WP_032791224.1|  methyltransferase                                52.8    5e-05   
gb|KGP68999.1|  ubiquinone biosynthesis methyltransferase UbiE        52.8    5e-05   
ref|WP_021816190.1|  ubiquinone/menaquinone biosynthesis methyltr...  52.8    5e-05   
ref|WP_030483212.1|  hypothetical protein                             52.4    5e-05   
ref|WP_022763520.1|  SAM-dependent methyltransferase                  52.0    5e-05   
ref|WP_021137939.1|  biotin biosynthesis protein BioC                 52.8    5e-05   
ref|WP_003683485.1|  ubiquinone/menaquinone biosynthesis methyltr...  52.8    5e-05   
ref|WP_003525492.1|  methyltransferase [                              52.4    5e-05   
ref|WP_021052652.1|  methylase involved in ubiquinone/menaquinone...  52.4    5e-05   
ref|WP_006694759.1|  methyltransferase                                52.4    5e-05   
ref|WP_034938878.1|  hypothetical protein                             50.8    5e-05   
ref|WP_041812816.1|  ubiquinone biosynthesis methyltransferase UbiE   52.8    5e-05   
ref|WP_004374630.1|  MULTISPECIES: methyltransferase UbiE             52.4    5e-05   
ref|WP_044483243.1|  SAM-dependent methyltransferase                  52.8    5e-05   
ref|WP_029410613.1|  methyltransferase                                52.0    5e-05   
ref|WP_035253465.1|  hypothetical protein                             50.4    6e-05   
ref|WP_019028125.1|  hypothetical protein                             52.8    6e-05   
ref|WP_020099682.1|  hypothetical protein                             52.0    6e-05   
ref|WP_009251535.1|  methyltransferase                                52.0    6e-05   
ref|WP_014375678.1|  ubiquinone biosynthesis methyltransferase UbiE   52.0    6e-05   
ref|WP_015408247.1|  S-adenosylmethionine-dependent methyltransfe...  52.4    6e-05   
ref|WP_029121150.1|  methyltransferase type 11                        51.6    6e-05   
ref|WP_015037532.1|  methyltransferase                                52.4    6e-05   
ref|WP_024295109.1|  MULTISPECIES: methyltransferase                  52.0    6e-05   
gb|EGB91889.1|  methyltransferase, UbiE/COQ5 family                   51.6    6e-05   
ref|WP_030700688.1|  methyltransferase                                52.4    6e-05   
ref|WP_003969306.1|  methyltransferase                                52.4    6e-05   
ref|WP_028759611.1|  methyltransferase type 11                        52.0    6e-05   
ref|WP_019127220.1|  hypothetical protein                             52.0    6e-05   
ref|WP_008257156.1|  ubiquinone/menaquinone biosynthesis methyltr...  52.4    6e-05   
ref|WP_027435503.1|  SAM-dependent methyltransferase                  52.0    6e-05   
ref|WP_040630743.1|  hypothetical protein                             51.6    6e-05   
ref|WP_028506503.1|  hypothetical protein                             51.6    6e-05   
gb|AHG00272.1|  SAM-dependent methlyltransferase                      52.0    6e-05   
ref|WP_026669429.1|  SAM-dependent methyltransferase                  51.6    6e-05   
ref|WP_022512870.1|  hypothetical protein                             52.0    6e-05   
ref|WP_034740464.1|  hypothetical protein                             50.4    6e-05   
ref|WP_042651325.1|  biotin biosynthesis protein BioC                 52.4    7e-05   
ref|WP_042914009.1|  SAM-dependent methyltransferase                  52.4    7e-05   
ref|WP_034670354.1|  MULTISPECIES: hypothetical protein               50.4    7e-05   
ref|WP_009954460.1|  SAM-dependent methyltransferase                  52.4    7e-05   
gb|ETZ29734.1|  methyltransferase domain protein                      52.0    7e-05   
ref|WP_008262302.1|  MULTISPECIES: SAM-dependent methyltransferase    52.4    7e-05   
ref|WP_028448913.1|  malonyl-CoA O-methyltransferase                  52.4    7e-05   
ref|WP_040624354.1|  hypothetical protein                             52.0    7e-05   
ref|WP_031564703.1|  hypothetical protein                             52.4    7e-05   
ref|WP_041331604.1|  hypothetical protein                             52.0    7e-05   
ref|WP_039645698.1|  ubiquinone biosynthesis methyltransferase UbiE   52.0    7e-05   
ref|WP_026511611.1|  SAM-dependent methyltransferase                  51.6    8e-05   
gb|ABU56970.1|  Methyltransferase type 11                             52.4    8e-05   
gb|KDE57920.1|  SAM-dependent methlyltransferase                      51.6    8e-05   
ref|WP_028519393.1|  SAM-dependent methyltransferase                  51.6    8e-05   
ref|WP_011043405.1|  biotin biosynthesis protein bioC                 52.4    8e-05   
ref|WP_035316534.1|  methyltransferase                                51.6    9e-05   
ref|WP_012381042.1|  methyltransferase                                52.0    9e-05   
ref|XP_007602903.1|  hypothetical protein CFIO01_09568                52.4    9e-05   
ref|WP_042912008.1|  SAM-dependent methyltransferase                  51.6    9e-05   
ref|WP_033397012.1|  hypothetical protein                             50.1    9e-05   
ref|WP_041554685.1|  hypothetical protein                             50.1    9e-05   
ref|WP_033724207.1|  SAM-dependent methyltransferase                  50.8    9e-05   
ref|WP_032775963.1|  methyltransferase                                52.0    9e-05   
ref|WP_021770373.1|  methyltransferase domain protein                 51.6    9e-05   



>gb|EYU36508.1| hypothetical protein MIMGU_mgv1a008665mg [Erythranthe guttata]
Length=366

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN+I+VRADISRLPF SSSVDAVHAGAALHCWPSPS+AVAEISRVL+PGG+FVATTYIV
Sbjct  245  EENLIMVRADISRLPFPSSSVDAVHAGAALHCWPSPSSAVAEISRVLKPGGMFVATTYIV  304

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG++S+ P  RPLR+N AQISGSH+FL EKELE+LCT+CGLV F   RNR F+M++AMKP
Sbjct  305  DGLFSYLPLSRPLRQNIAQISGSHVFLSEKELEELCTSCGLVNFTSTRNRMFVMISAMKP  364



>gb|AFK36862.1| unknown [Lotus japonicus]
Length=132

 Score =   192 bits (488),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -2

Query  656  ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVD  477
             N ILVRADI+RLPF +SSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI+D
Sbjct  13   RNFILVRADIARLPFVTSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYILD  72

Query  476  GIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            G ++F PF+  +R+N  Q SGS+IFL E+ELEDLC  CGLVGFKCIRN  F+M++A KP
Sbjct  73   GPFTFVPFLSTVRQNIRQASGSYIFLSERELEDLCRACGLVGFKCIRNGPFVMISAAKP  131



>ref|XP_010105909.1| putative methyltransferase [Morus notabilis]
 gb|EXC06728.1| putative methyltransferase [Morus notabilis]
Length=266

 Score =   195 bits (496),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             ENIILVRADISRLPF SSS+DAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI+
Sbjct  146  KENIILVRADISRLPFVSSSIDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIL  205

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG ++F PF+R LR+   QISG++ FL E+ELEDLC  CGLVGF C+RN  F+M++A KP
Sbjct  206  DGPFTFVPFLRELRQYTRQISGNYSFLSERELEDLCKACGLVGFTCVRNGAFVMISATKP  265

Query  299  S  297
            +
Sbjct  266  T  266



>gb|KGN60339.1| hypothetical protein Csa_3G895850 [Cucumis sativus]
Length=220

 Score =   194 bits (492),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            NE ++L+RADI+RLPFASSSVDAVHAGAALHCWPSPSAAVAEISR+LRPGGVFVA+T+I+
Sbjct  100  NERLVLIRADIARLPFASSSVDAVHAGAALHCWPSPSAAVAEISRILRPGGVFVASTFIM  159

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG YSF PF+R   E   QISGS IFL E+ELE+LCT CGLV FKC+RNR+F+ML+A K 
Sbjct  160  DGPYSFVPFLRIQIEGIQQISGSRIFLSERELEELCTACGLVDFKCLRNRQFVMLSATKC  219

Query  299  S  297
            S
Sbjct  220  S  220



>gb|KHN19749.1| Putative methyltransferase, chloroplastic [Glycine soja]
Length=353

 Score =   197 bits (502),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN ILVRADISRLPF SSSVDAVHAGAALHCWPSP AAVAEISRVLRPGGVFVATTYI+
Sbjct  233  KENFILVRADISRLPFVSSSVDAVHAGAALHCWPSPLAAVAEISRVLRPGGVFVATTYIL  292

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG +S  PF+  LR+N  Q+SGS+IFL E+ELEDLC  CGLVGFKCIRN  F+M++A KP
Sbjct  293  DGPFSVIPFLSSLRQNVRQVSGSYIFLSERELEDLCRACGLVGFKCIRNGLFVMISATKP  352

Query  299  S  297
            S
Sbjct  353  S  353



>ref|XP_003522802.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Glycine max]
Length=352

 Score =   197 bits (502),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN ILVRADISRLPF SSSVDAVHAGAALHCWPSP AAVAEISRVLRPGGVFVATTYI+
Sbjct  232  KENFILVRADISRLPFVSSSVDAVHAGAALHCWPSPLAAVAEISRVLRPGGVFVATTYIL  291

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG +S  PF+  LR+N  Q+SGS+IFL E+ELEDLC  CGLVGFKCIRN  F+M++A KP
Sbjct  292  DGPFSVIPFLSSLRQNVRQVSGSYIFLSERELEDLCRACGLVGFKCIRNGLFVMISATKP  351

Query  299  S  297
            S
Sbjct  352  S  352



>ref|XP_002285799.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Vitis vinifera]
 emb|CBI19149.3| unnamed protein product [Vitis vinifera]
Length=350

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             ENI+LVRADISRLPFASSSVDAVHAGAALHCWPSPS AVAEISRVLRPGGVFVATTY++
Sbjct  230  KENILLVRADISRLPFASSSVDAVHAGAALHCWPSPSIAVAEISRVLRPGGVFVATTYLL  289

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG +S  PF++ LR+N  +++GSH FL E+ELEDLCT CGL GF C+RN RF+M++A KP
Sbjct  290  DGPFSVLPFLKTLRQNMVRVAGSHAFLSERELEDLCTACGLGGFTCVRNGRFVMISATKP  349

Query  299  S  297
            S
Sbjct  350  S  350



>ref|XP_004136403.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Cucumis sativus]
Length=313

 Score =   194 bits (494),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            NE ++L+RADI+RLPFASSSVDAVHAGAALHCWPSPSAAVAEISR+LRPGGVFVA+T+I+
Sbjct  193  NERLVLIRADIARLPFASSSVDAVHAGAALHCWPSPSAAVAEISRILRPGGVFVASTFIM  252

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG YSF PF+R   E   QISGS IFL E+ELE+LCT CGLV FKC+RNR+F+ML+A K 
Sbjct  253  DGPYSFVPFLRIQIEGIQQISGSRIFLSERELEELCTACGLVDFKCLRNRQFVMLSATKC  312

Query  299  S  297
            S
Sbjct  313  S  313



>ref|XP_011074175.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Sesamum indicum]
Length=360

 Score =   195 bits (496),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN+ILVRADISRLPFASS+VDAVHAGAALHCWPSPSA VAEISRVL+PGG+FVA+TYI 
Sbjct  240  EENLILVRADISRLPFASSTVDAVHAGAALHCWPSPSAGVAEISRVLKPGGMFVASTYIA  299

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG+ S+ P    LR+N AQ SGSH+FL + ELEDLC +CGL+ F C RNRRF+ML+AMKP
Sbjct  300  DGLVSYIPLRGALRQNIAQFSGSHVFLSDTELEDLCKSCGLIDFTCTRNRRFVMLSAMKP  359



>emb|CDP01043.1| unnamed protein product [Coffea canephora]
Length=358

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             E IILVRADISRLPFAS +VDAVHAGAALHCWPSPS AVAEISRVLRPGG+FVATTYI+
Sbjct  238  KEKIILVRADISRLPFASGTVDAVHAGAALHCWPSPSVAVAEISRVLRPGGMFVATTYIL  297

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG++S+ P V PLR+N AQ+SGSH+FL  KELEDLCT CGLV  K  RNR F+M+ A KP
Sbjct  298  DGLFSYIPLVGPLRQNVAQVSGSHVFLSNKELEDLCTACGLVDAKVTRNRMFVMICATKP  357



>gb|KDO80932.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=235

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN +LVRADISRLPFASSS+DAVHAGAA+HCW SPS  VAEISRVLRPGGVFV TTYIV
Sbjct  113  KENFLLVRADISRLPFASSSIDAVHAGAAIHCWSSPSTGVAEISRVLRPGGVFVGTTYIV  172

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG ++  PF R LR+N  QISGS+ FL E+E+EDLC  CGLV FKC RNR F+M TA KP
Sbjct  173  DGPFNLIPFSRLLRQNMMQISGSYTFLSEREIEDLCRACGLVDFKCTRNRGFVMFTATKP  232

Query  299  S  297
            S
Sbjct  233  S  233



>ref|XP_006434004.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47244.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
Length=233

 Score =   190 bits (483),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN +LVRADISRLPFASSS+DAVHAGAA+HCW SPS  VAEISRVLRPGGVFV TTYIV
Sbjct  113  KENFLLVRADISRLPFASSSIDAVHAGAAIHCWSSPSTGVAEISRVLRPGGVFVGTTYIV  172

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG ++  PF R LR+N  QISGS+ FL E+E+EDLC  CGLV FKC RNR F+M TA KP
Sbjct  173  DGPFNLIPFSRLLRQNMMQISGSYTFLSEREIEDLCRACGLVDFKCTRNRGFVMFTATKP  232

Query  299  S  297
            S
Sbjct  233  S  233



>ref|XP_007018799.1| S-adenosylmethionine-dependent methyltransferase, putative [Theobroma 
cacao]
 gb|EOY16024.1| S-adenosylmethionine-dependent methyltransferase, putative [Theobroma 
cacao]
Length=366

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             E + LVRADISRLPF SSSVDAVHAGAALHCWPSPS AVAEISRVLRPGGVFVATTYI+
Sbjct  246  KEKVTLVRADISRLPFKSSSVDAVHAGAALHCWPSPSTAVAEISRVLRPGGVFVATTYIL  305

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG + F PF+R  R+N   I+GSHIFL E+EL+DLC TCGLVGF C+RN  F+M++A KP
Sbjct  306  DGPFGFVPFLRTFRQNIMGIAGSHIFLSERELKDLCRTCGLVGFTCVRNGLFVMISARKP  365

Query  299  S  297
            S
Sbjct  366  S  366



>gb|AFK47008.1| unknown [Lotus japonicus]
Length=352

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN ILVRADI+RLPF +SSVDAVHAGAALHCWPSPSA VAEISRVLRPGGVFVATTYI+
Sbjct  232  KENFILVRADIARLPFVTSSVDAVHAGAALHCWPSPSAVVAEISRVLRPGGVFVATTYIL  291

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG ++F PF+  +R+N  Q SGS+IFL E+ELEDLC  CGLVGFKCIRN  F+M++A KP
Sbjct  292  DGPFTFVPFLSTVRQNIRQASGSYIFLSERELEDLCRACGLVGFKCIRNGPFVMISAAKP  351



>ref|XP_004161765.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Cucumis sativus]
Length=376

 Score =   193 bits (491),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            NE ++L+RADI+RLPFASSSVDAVHAGAALHCWPSPSAAVAEISR+LRPGGVFVA+T+I+
Sbjct  256  NERLVLIRADIARLPFASSSVDAVHAGAALHCWPSPSAAVAEISRILRPGGVFVASTFIM  315

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG YSF PF+R   E   QISGS IFL E+ELE+LCT CGLV FKC+RNR+F+ML+A K 
Sbjct  316  DGPYSFVPFLRIQIEGIQQISGSRIFLSERELEELCTACGLVDFKCLRNRQFVMLSATKC  375

Query  299  S  297
            S
Sbjct  376  S  376



>ref|XP_007222212.1| hypothetical protein PRUPE_ppa007824mg [Prunus persica]
 gb|EMJ23411.1| hypothetical protein PRUPE_ppa007824mg [Prunus persica]
Length=354

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -2

Query  656  ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVD  477
            ENIILVRADISRLPFA+SSVDAVHAGAALHCWPSPS AVAEISRVLRPGGVFVATTYI+D
Sbjct  235  ENIILVRADISRLPFATSSVDAVHAGAALHCWPSPSTAVAEISRVLRPGGVFVATTYILD  294

Query  476  GIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  297
            G  S+ PF+R + +   QISGS IF  E+ELEDLC  CGLVG+ C+RN  F+M++A KPS
Sbjct  295  GPLSYIPFLRNITQRTKQISGSQIFTSERELEDLCKACGLVGYTCVRNGLFVMISATKPS  354



>ref|XP_010269234.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Nelumbo nucifera]
Length=349

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN+ILVRADISRLPF SSS+DAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV
Sbjct  229  KENLILVRADISRLPFVSSSIDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  288

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DGI    P  R LR+   QIS SHIFL E+ELEDLC  CGLVGF C RN  FIM++A KP
Sbjct  289  DGIVGALPVSRILRQYIGQISSSHIFLSERELEDLCKACGLVGFTCTRNGPFIMMSATKP  348

Query  299  S  297
            +
Sbjct  349  T  349



>ref|XP_010059991.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW66499.1| hypothetical protein EUGRSUZ_F00306 [Eucalyptus grandis]
 gb|KCW66500.1| hypothetical protein EUGRSUZ_F00306 [Eucalyptus grandis]
Length=364

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             E + LVRADISRLPFAS S+DAVHAGAALHCWPSPS AVAEISRVLRPGGVFVATTY++
Sbjct  244  EEKLALVRADISRLPFASGSIDAVHAGAALHCWPSPSTAVAEISRVLRPGGVFVATTYLL  303

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG ++  P +RPL +N +QISGSHIFL E ELEDLC TCGL+GFK +RN RF+M++A +P
Sbjct  304  DGPFALFPLLRPLCQNISQISGSHIFLSEGELEDLCRTCGLIGFKFLRNERFVMISASRP  363



>ref|XP_011016296.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Populus euphratica]
Length=379

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN ILVRADI+RLPF S S+DAVHAGAA+HCWPSPSAAVAE+SRVLRPGGVFVATTYI+
Sbjct  259  KENFILVRADIARLPFVSGSLDAVHAGAAIHCWPSPSAAVAEVSRVLRPGGVFVATTYIL  318

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG +SF PF++P+ + F Q+SGS+ FL E+ELE +C  CGLV F C RNR+FIM +A KP
Sbjct  319  DGPFSFIPFLKPISQRFTQVSGSNFFLSERELEAVCRACGLVNFTCTRNRQFIMFSATKP  378

Query  299  S  297
            S
Sbjct  379  S  379



>ref|XP_006472620.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=351

 Score =   191 bits (484),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN +LVRADISRLPFA+SS+DAVHAGAA+HCWPSPS  VAEISRVLRPGGVFV TTYI 
Sbjct  229  KENFLLVRADISRLPFAASSIDAVHAGAAIHCWPSPSTGVAEISRVLRPGGVFVGTTYIF  288

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG ++  PF R LR+N  QISGS+ FL E+E+EDLC  CGLV FKC RNR F+M TA KP
Sbjct  289  DGPFNLIPFSRLLRQNMMQISGSYTFLSEREIEDLCRACGLVDFKCTRNRGFVMFTATKP  348

Query  299  S  297
            S
Sbjct  349  S  349



>ref|XP_006472621.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=333

 Score =   190 bits (483),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN +LVRADISRLPFA+SS+DAVHAGAA+HCWPSPS  VAEISRVLRPGGVFV TTYI 
Sbjct  211  KENFLLVRADISRLPFAASSIDAVHAGAAIHCWPSPSTGVAEISRVLRPGGVFVGTTYIF  270

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG ++  PF R LR+N  QISGS+ FL E+E+EDLC  CGLV FKC RNR F+M TA KP
Sbjct  271  DGPFNLIPFSRLLRQNMMQISGSYTFLSEREIEDLCRACGLVDFKCTRNRGFVMFTATKP  330

Query  299  S  297
            S
Sbjct  331  S  331



>ref|XP_004500619.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Cicer arietinum]
Length=338

 Score =   190 bits (483),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN  LVRADI+RLPF SSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI+
Sbjct  218  KENFNLVRADIARLPFVSSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIL  277

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG ++  PF+  LR+N  Q+SGS+IFL E+ELE LC  CGLVGFKCIRN  F+M++A KP
Sbjct  278  DGPFTPVPFLSTLRQNIRQVSGSYIFLSERELEALCKACGLVGFKCIRNGLFVMISATKP  337



>gb|KDO80931.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=351

 Score =   191 bits (484),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN +LVRADISRLPFASSS+DAVHAGAA+HCW SPS  VAEISRVLRPGGVFV TTYIV
Sbjct  229  KENFLLVRADISRLPFASSSIDAVHAGAAIHCWSSPSTGVAEISRVLRPGGVFVGTTYIV  288

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG ++  PF R LR+N  QISGS+ FL E+E+EDLC  CGLV FKC RNR F+M TA KP
Sbjct  289  DGPFNLIPFSRLLRQNMMQISGSYTFLSEREIEDLCRACGLVDFKCTRNRGFVMFTATKP  348

Query  299  S  297
            S
Sbjct  349  S  349



>ref|XP_006434005.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 ref|XP_006434007.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47245.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47247.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
Length=349

 Score =   190 bits (483),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN +LVRADISRLPFASSS+DAVHAGAA+HCW SPS  VAEISRVLRPGGVFV TTYIV
Sbjct  229  KENFLLVRADISRLPFASSSIDAVHAGAAIHCWSSPSTGVAEISRVLRPGGVFVGTTYIV  288

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG ++  PF R LR+N  QISGS+ FL E+E+EDLC  CGLV FKC RNR F+M TA KP
Sbjct  289  DGPFNLIPFSRLLRQNMMQISGSYTFLSEREIEDLCRACGLVDFKCTRNRGFVMFTATKP  348

Query  299  S  297
            S
Sbjct  349  S  349



>ref|XP_003527908.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Glycine max]
Length=248

 Score =   187 bits (474),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN ILVRADISRLPF SSSVDAVHAGAALHCWPSP A VAEISRVLRPGGVFV TTY++
Sbjct  128  KENFILVRADISRLPFVSSSVDAVHAGAALHCWPSPIAVVAEISRVLRPGGVFVVTTYML  187

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG +S  PF+  LR+N  Q+SGS+IFL E+ELED C  CGLVGFKCIRN  F M++A KP
Sbjct  188  DGPFSVIPFLSTLRQNARQVSGSYIFLSERELEDHCRACGLVGFKCIRNGLFEMISATKP  247

Query  299  S  297
            S
Sbjct  248  S  248



>gb|KEH34908.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=342

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN ILVRADI+RLPF SSS+DAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI+
Sbjct  222  KENFILVRADIARLPFVSSSIDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIL  281

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG ++  PF+  LR+   Q+SG + FL E+ELE LC TCGLVGFKCIRN  F+M++A KP
Sbjct  282  DGPFTIVPFLSTLRQTINQVSGIYTFLSERELEALCKTCGLVGFKCIRNGPFVMISAAKP  341



>ref|XP_008219673.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Prunus mume]
Length=354

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  656  ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVD  477
            ENIILVRADISRLPFA+SSVDAVHAGAALHCWPSP+  VAEISRVLRPGGVFVATTYI+D
Sbjct  235  ENIILVRADISRLPFATSSVDAVHAGAALHCWPSPATGVAEISRVLRPGGVFVATTYILD  294

Query  476  GIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  297
            G  S+ PF+R + +   QISGS IF  E+ELEDLC  CGLVG+ C+RN  F+M++A KPS
Sbjct  295  GPLSYIPFLRNITQRTKQISGSQIFTSERELEDLCKACGLVGYTCVRNGLFVMISATKPS  354



>ref|XP_002302290.2| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
 gb|EEE81563.2| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
Length=349

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN+ILVRADI+RLPF S S+DAVHAGAA+HCWPSPSAAVAE+SRVLRPGGVFVATTYI+
Sbjct  229  KENLILVRADIARLPFVSGSLDAVHAGAAIHCWPSPSAAVAEVSRVLRPGGVFVATTYIL  288

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG +SF PF++P+ + F Q SG++ FL E+ELE +C  CGLV F C RNR+FIM +A KP
Sbjct  289  DGPFSFIPFLKPISQRFTQASGNNFFLSERELEAVCRACGLVNFTCTRNRQFIMFSATKP  348

Query  299  S  297
            S
Sbjct  349  S  349



>ref|XP_010428929.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X1 [Camelina sativa]
Length=356

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I 
Sbjct  236  KENLVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIY  295

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG++SF PFV+  R+   + SG+H+FL E+ELEDLCT CGLVGF  +RN  FIML+A KP
Sbjct  296  DGLFSFIPFVKNFRQEIMRYSGAHVFLSERELEDLCTACGLVGFTRVRNGPFIMLSATKP  355



>gb|KDP41368.1| hypothetical protein JCGZ_15775 [Jatropha curcas]
Length=350

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN+ILVRADISRLPF S SVDAVHAGAA+HCWPSPS AVAEISRVLRPGGV VA+TYI+
Sbjct  230  KENLILVRADISRLPFRSGSVDAVHAGAAIHCWPSPSVAVAEISRVLRPGGVLVASTYIL  289

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG ++F P + PLR+N AQ+SGS IFL E+ELED+C  CGLVGF   RNR+F+M +A KP
Sbjct  290  DGPFNFVPLLGPLRQNIAQVSGSQIFLRERELEDICRACGLVGFTATRNRQFVMFSARKP  349



>ref|XP_010428930.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X2 [Camelina sativa]
Length=355

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I 
Sbjct  235  KENLVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIY  294

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG++SF PFV+  R+   + SG+H+FL E+ELEDLCT CGLVGF  +RN  FIML+A KP
Sbjct  295  DGLFSFIPFVKNFRQEIMRYSGAHVFLSERELEDLCTACGLVGFTRVRNGPFIMLSATKP  354



>ref|XP_007136240.1| hypothetical protein PHAVU_009G030200g [Phaseolus vulgaris]
 gb|ESW08234.1| hypothetical protein PHAVU_009G030200g [Phaseolus vulgaris]
Length=376

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N ILVRADISRLPF S+SVDAVHAGAALHCWPSP AAVAEISRVLRPGGVFVATTYI+DG
Sbjct  258  NFILVRADISRLPFVSNSVDAVHAGAALHCWPSPLAAVAEISRVLRPGGVFVATTYILDG  317

Query  473  IYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  297
              S  PF   LR+N  Q SGS+IFL E+ELEDLC  CGLVGFKCIRN  F+M++A KPS
Sbjct  318  PLSVIPFRSTLRQNIRQASGSYIFLSERELEDLCRACGLVGFKCIRNGLFVMISARKPS  376



>ref|XP_008466034.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Cucumis melo]
Length=356

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            NE ++L+RADI+RLPFASSSVDAVHAGAA+HCWPSPSA VAEISR+LRPGGVFVA+T+I+
Sbjct  236  NERLVLIRADIARLPFASSSVDAVHAGAAVHCWPSPSAGVAEISRILRPGGVFVASTFIM  295

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG +SF PF+R   E   QI+GS IFL E+ELE+LCT CGLV FKC+RNR+F+ML+A K 
Sbjct  296  DGPFSFVPFLRIQIEGIQQIAGSRIFLSERELEELCTACGLVDFKCLRNRQFVMLSATKR  355

Query  299  S  297
            S
Sbjct  356  S  356



>ref|XP_009106463.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Brassica rapa]
Length=337

 Score =   187 bits (475),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  650  IILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGI  471
            ++L RADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I DG+
Sbjct  219  VVLARADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIYDGL  278

Query  470  YSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  297
            + F PF++ LR+   + SGSH+FL E+ELEDLC +CGLVGF C+RN  FIML+A KP+
Sbjct  279  FRFVPFLKELRQEIMRYSGSHMFLSERELEDLCKSCGLVGFTCVRNGLFIMLSATKPT  336



>ref|XP_009106462.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Brassica rapa]
Length=348

 Score =   187 bits (476),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  650  IILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGI  471
            ++L RADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I DG+
Sbjct  230  VVLARADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIYDGL  289

Query  470  YSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  297
            + F PF++ LR+   + SGSH+FL E+ELEDLC +CGLVGF C+RN  FIML+A KP+
Sbjct  290  FRFVPFLKELRQEIMRYSGSHMFLSERELEDLCKSCGLVGFTCVRNGLFIMLSATKPT  347



>ref|XP_002513908.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF48491.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=351

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN+I VRADISRLPF   SVDAVHAGAA+HCWPSPSAAVAEISRVLRPGGVFVA+T+I+
Sbjct  231  TENLISVRADISRLPFLFGSVDAVHAGAAIHCWPSPSAAVAEISRVLRPGGVFVASTFIL  290

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG +SF P + PLR+N AQISGS IFL E ELED+C  CGLVGF  IR+R+F+M +A KP
Sbjct  291  DGPFSFVPLMGPLRQNIAQISGSQIFLREYELEDICRACGLVGFTAIRDRQFVMFSARKP  350



>ref|XP_004299641.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=345

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             ENI LVRADISRLPFA+SS+DAVHAGAA+HCWPSP+ AVAEISRVLRPGGVFVATTYI+
Sbjct  225  KENITLVRADISRLPFATSSIDAVHAGAAIHCWPSPTGAVAEISRVLRPGGVFVATTYIL  284

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG ++F PF+R   +   Q+SGS IFL E ELED+CT CGLVG   +RNR+F+M++A KP
Sbjct  285  DGPFAFVPFLREGTKRARQVSGSQIFLSEGELEDICTACGLVGVTVVRNRQFVMISATKP  344

Query  299  S  297
            S
Sbjct  345  S  345



>gb|KHN03912.1| Putative methyltransferase, chloroplastic, partial [Glycine soja]
Length=213

 Score =   182 bits (462),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 100/121 (83%), Gaps = 1/121 (1%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN ILVRADISRLPF SSSVDAVHAGAALHCWPSP  AVAEISRVLRPGGVFV TTY++
Sbjct  94   KENFILVRADISRLPFVSSSVDAVHAGAALHCWPSP-IAVAEISRVLRPGGVFVVTTYML  152

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG +S  PF+  LR+N  Q+SGS+IFL E+ELED C  CGLVGFKCIRN  F M++A KP
Sbjct  153  DGPFSVIPFLSTLRQNARQVSGSYIFLSERELEDHCRACGLVGFKCIRNGLFEMISATKP  212

Query  299  S  297
            S
Sbjct  213  S  213



>ref|XP_006390018.1| hypothetical protein EUTSA_v10018789mg [Eutrema salsugineum]
 gb|ESQ27304.1| hypothetical protein EUTSA_v10018789mg [Eutrema salsugineum]
Length=351

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             E ++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVL+PGGVFVATT+I 
Sbjct  230  KEKVVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLKPGGVFVATTFIY  289

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG +SF PF++ +R+   + SGSHIFL E+EL+D+C  CGLVGF C+RN  FIML+A KP
Sbjct  290  DGPFSFIPFLKNIRQEIMRYSGSHIFLSERELKDICGACGLVGFTCVRNGPFIMLSATKP  349

Query  299  S  297
            S
Sbjct  350  S  350



>ref|XP_002889176.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65435.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=352

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -2

Query  656  ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVD  477
            E ++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I D
Sbjct  233  EKLVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIYD  292

Query  476  GIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  297
            G +SF PF++ LR+   + SGSH+FL+E+ELEDLC  CGLVGF  +RN  FIML+A KPS
Sbjct  293  GPFSFIPFLKNLRQELMRYSGSHMFLNERELEDLCKACGLVGFTRVRNGPFIMLSATKPS  352



>ref|XP_002306578.1| methyltransferase-related family protein [Populus trichocarpa]
 gb|EEE93574.1| methyltransferase-related family protein [Populus trichocarpa]
Length=244

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN+ILVRADI+RLPF S S+DAV AGAA+HCWPSPS AVAE+SRVLRPGGVFVATTYI+
Sbjct  124  KENLILVRADIARLPFISGSLDAVPAGAAIHCWPSPSVAVAEVSRVLRPGGVFVATTYIL  183

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG +S  PF++P+ + F Q+SGS+IFL E+ELED+C  CGLV F C RN RF+M +A KP
Sbjct  184  DGHFSLIPFLKPISQRFTQVSGSNIFLSERELEDVCRACGLVDFTCTRNGRFVMFSATKP  243



>emb|CDY14625.1| BnaC02g24880D [Brassica napus]
Length=339

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I 
Sbjct  218  KENVVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIY  277

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG +SF PF++ LR+   + SGSHIFL E+ELEDLC   GLVGF  +RN  FIML+A KP
Sbjct  278  DGPFSFIPFLKNLRQELMRYSGSHIFLSERELEDLCKAGGLVGFTRVRNGLFIMLSATKP  337

Query  299  S  297
            S
Sbjct  338  S  338



>emb|CDX88421.1| BnaC06g38650D [Brassica napus]
Length=353

 Score =   186 bits (471),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  650  IILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGI  471
            ++L RADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I DG+
Sbjct  230  VVLARADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIYDGL  289

Query  470  YSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS*L  291
              F PF++ LR+     SGSH+FL E+ELEDLC +CGLVGF C+RN  FIML+A KP+ +
Sbjct  290  VRFVPFLKELRQEVMGYSGSHMFLSERELEDLCKSCGLVGFTCVRNGLFIMLSATKPTDM  349

Query  290  L  288
            L
Sbjct  350  L  350



>ref|XP_010416782.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=360

 Score =   185 bits (470),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             E ++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I 
Sbjct  240  KEKLVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIY  299

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG++SF PF++  R+   + SG+H+FL E+ELEDLCT CGLVGF  +RN  FIML+A KP
Sbjct  300  DGLFSFIPFLKNFRQEIMRYSGAHVFLSERELEDLCTACGLVGFTRVRNGPFIMLSATKP  359



>ref|XP_010416783.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=359

 Score =   185 bits (470),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             E ++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I 
Sbjct  239  KEKLVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIY  298

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG++SF PF++  R+   + SG+H+FL E+ELEDLCT CGLVGF  +RN  FIML+A KP
Sbjct  299  DGLFSFIPFLKNFRQEIMRYSGAHVFLSERELEDLCTACGLVGFTRVRNGPFIMLSATKP  358



>ref|XP_010061813.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW68836.1| hypothetical protein EUGRSUZ_F02436 [Eucalyptus grandis]
Length=346

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             E++ILVRADISRLPF SSSVDAVHAGAA+HCW SPS+AVAEISRVLRPGG+FVATT+I 
Sbjct  226  KEDLILVRADISRLPFVSSSVDAVHAGAAVHCWSSPSSAVAEISRVLRPGGIFVATTFIY  285

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG Y+  PF + +++N  +ISG   FL E ELEDLC TCGL  FKC RNRRF+M++A KP
Sbjct  286  DGPYALNPFSKLMQKNMFRISGGQFFLSEHELEDLCKTCGLEDFKCTRNRRFVMISATKP  345

Query  299  S  297
            S
Sbjct  346  S  346



>gb|KCW67137.1| hypothetical protein EUGRSUZ_F00926, partial [Eucalyptus grandis]
Length=294

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN  LVRADISRLPFASSS+DAVHAGAALHCWPSPS A+AEISRVLRPGGVFVATT+++
Sbjct  174  EENFALVRADISRLPFASSSIDAVHAGAALHCWPSPSTAIAEISRVLRPGGVFVATTFLL  233

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG  +  P +RPL +   Q+SGSHIFL E ELE LC TCGL+G K +RN RF+M++A KP
Sbjct  234  DGPSALFPLLRPLCQISTQLSGSHIFLSEGELEGLCRTCGLIGVKFVRNERFVMISASKP  293

Query  299  S  297
            S
Sbjct  294  S  294



>ref|XP_010472019.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X1 [Camelina sativa]
Length=357

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             E ++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I 
Sbjct  237  KEKLVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIY  296

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG +SF PF++  R+   + SG+H+FL E+ELEDLCT CGLVGF  +RN  FIML+A KP
Sbjct  297  DGPFSFIPFLKNFRQEIMRYSGAHVFLSERELEDLCTACGLVGFTRVRNGPFIMLSATKP  356



>ref|XP_010472020.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X2 [Camelina sativa]
Length=356

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             E ++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I 
Sbjct  236  KEKLVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIY  295

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG +SF PF++  R+   + SG+H+FL E+ELEDLCT CGLVGF  +RN  FIML+A KP
Sbjct  296  DGPFSFIPFLKNFRQEIMRYSGAHVFLSERELEDLCTACGLVGFTRVRNGPFIMLSATKP  355



>ref|XP_009128280.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Brassica rapa]
Length=341

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             E ++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I 
Sbjct  220  KEKVVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIY  279

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG +SF PF++ LR+   + SGSHIFL E+ELEDLC   GLVGF  +RN  FIML+A KP
Sbjct  280  DGPFSFIPFLKNLRQELMRYSGSHIFLSERELEDLCKAGGLVGFTRVRNGLFIMLSATKP  339

Query  299  S  297
            S
Sbjct  340  S  340



>emb|CDY26853.1| BnaA02g18780D [Brassica napus]
Length=341

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             E ++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I 
Sbjct  220  KEKVVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIY  279

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG +SF PF++ LR+   + SGSHIFL E+ELEDLC   GLVGF  +RN  FIML+A KP
Sbjct  280  DGPFSFIPFLKNLRQELMRYSGSHIFLSERELEDLCKAGGLVGFTRVRNGLFIMLSATKP  339

Query  299  S  297
            S
Sbjct  340  S  340



>gb|KJB59931.1| hypothetical protein B456_009G281700 [Gossypium raimondii]
Length=339

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             E + LVRADISRLPF SSS+DAVHAGAALHCWPSPS AVAEISRVLRPGGVFVATTYIV
Sbjct  218  KEKVTLVRADISRLPFESSSIDAVHAGAALHCWPSPSTAVAEISRVLRPGGVFVATTYIV  277

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG ++F PFV   R+N   I+GS+  + E+ELEDLC TCGLVGF C+RN  F+M++A K 
Sbjct  278  DGPFTFLPFVNAFRQNMMGIAGSYFAVSERELEDLCRTCGLVGFTCMRNGPFVMISARKR  337

Query  299  S  297
            S
Sbjct  338  S  338



>gb|KJB59929.1| hypothetical protein B456_009G281700 [Gossypium raimondii]
Length=349

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             E + LVRADISRLPF SSS+DAVHAGAALHCWPSPS AVAEISRVLRPGGVFVATTYIV
Sbjct  228  KEKVTLVRADISRLPFESSSIDAVHAGAALHCWPSPSTAVAEISRVLRPGGVFVATTYIV  287

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG ++F PFV   R+N   I+GS+  + E+ELEDLC TCGLVGF C+RN  F+M++A K 
Sbjct  288  DGPFTFLPFVNAFRQNMMGIAGSYFAVSERELEDLCRTCGLVGFTCMRNGPFVMISARKR  347

Query  299  S  297
            S
Sbjct  348  S  348



>ref|NP_565170.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
 sp|Q8LBV4.1|Y1814_ARATH RecName: Full=Uncharacterized methyltransferase At1g78140, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAM64539.1| unknown [Arabidopsis thaliana]
 gb|AAO42148.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50518.1| unknown protein [Arabidopsis thaliana]
 gb|AEE36071.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
Length=355

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             E ++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I 
Sbjct  235  KEKLVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIY  294

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG +SF PF++ LR+   + SGSHIFL+E+ELED+C  CGLV F  +RN  FIML+A KP
Sbjct  295  DGPFSFIPFLKNLRQEIMRYSGSHIFLNERELEDICKACGLVNFTRVRNGPFIMLSATKP  354

Query  299  S  297
            S
Sbjct  355  S  355



>ref|XP_006300528.1| hypothetical protein CARUB_v10020572mg [Capsella rubella]
 gb|EOA33426.1| hypothetical protein CARUB_v10020572mg [Capsella rubella]
Length=348

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             E ++LVRADI+RLPF S S+DAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I 
Sbjct  226  KEKLVLVRADIARLPFLSGSLDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIY  285

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  303
            DG +SF PF++ LR+ F   SGSH+FL E+ELEDLC  CGLVGF  +RN  FIML+A K
Sbjct  286  DGPFSFIPFLKNLRQEFMSYSGSHVFLSERELEDLCKACGLVGFTRVRNGPFIMLSATK  344



>ref|XP_006386404.1| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
 gb|ERP64201.1| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
Length=355

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 102/127 (80%), Gaps = 6/127 (5%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAA------VAEISRVLRPGGVFV  498
             EN+ILVRADI+RLPF S S+DAVHAGAA+HCWPSPSAA      VAE+SRVLRPGGVFV
Sbjct  229  KENLILVRADIARLPFVSGSLDAVHAGAAIHCWPSPSAALFFNSQVAEVSRVLRPGGVFV  288

Query  497  ATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIM  318
            ATTYI+DG +SF PF++P+ + F Q SG++ FL E+ELE +C  CGLV F C RNR+FIM
Sbjct  289  ATTYILDGPFSFIPFLKPISQRFTQASGNNFFLSERELEAVCRACGLVNFTCTRNRQFIM  348

Query  317  LTAMKPS  297
             +A KPS
Sbjct  349  FSATKPS  355



>ref|XP_010064389.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
Length=354

 Score =   182 bits (463),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN  LVRADISRLPFASSS+DAVHAGAALHCWPSPS A+AEISRVLRPGGVFVATT+++
Sbjct  234  EENFALVRADISRLPFASSSIDAVHAGAALHCWPSPSTAIAEISRVLRPGGVFVATTFLL  293

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG  +  P +RPL +   Q+SGSHIFL E ELE LC TCGL+G K +RN RF+M++A KP
Sbjct  294  DGPSALFPLLRPLCQISTQLSGSHIFLSEGELEGLCRTCGLIGVKFVRNERFVMISASKP  353

Query  299  S  297
            S
Sbjct  354  S  354



>gb|AAG52104.1|AC012680_15 hypothetical protein; 38642-36701 [Arabidopsis thaliana]
Length=317

 Score =   181 bits (459),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            +  ++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I 
Sbjct  197  SRKLVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIY  256

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG +SF PF++ LR+   + SGSHIFL+E+ELED+C  CGLV F  +RN  FIML+A KP
Sbjct  257  DGPFSFIPFLKNLRQEIMRYSGSHIFLNERELEDICKACGLVNFTRVRNGPFIMLSATKP  316

Query  299  S  297
            S
Sbjct  317  S  317



>ref|XP_010064206.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW66498.1| hypothetical protein EUGRSUZ_F00305 [Eucalyptus grandis]
Length=354

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN +LVRADISRLPFASSS+DAVHAGAALHCWPSPS A+AEISRVLRPGGV VATT ++
Sbjct  234  EENFLLVRADISRLPFASSSIDAVHAGAALHCWPSPSTAIAEISRVLRPGGVLVATTLLL  293

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG ++  P +RPL +   Q+SGSHIF  E ELE LC TCGL+G K +RN+RF+M++A KP
Sbjct  294  DGPFALFPLLRPLSQISTQLSGSHIFRSEGELEGLCRTCGLIGVKFVRNKRFVMISASKP  353

Query  299  S  297
            S
Sbjct  354  S  354



>ref|XP_010937469.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Elaeis guineensis]
Length=345

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN+ILVRADISRLPF SSS+DAVHAGAALHCWPSPS AVAEISRVLRPGGVFVATT+++
Sbjct  221  KENLILVRADISRLPFVSSSIDAVHAGAALHCWPSPSTAVAEISRVLRPGGVFVATTFVL  280

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            D I    P  R +RE F++ SG H++L E ELED+C  CGL+GF CIRN  FIM++A KP
Sbjct  281  DTIPPAVPIFRAIREFFSRNSGQHLYLSEGELEDICRACGLIGFTCIRNGFFIMISATKP  340

Query  299  S  297
            S
Sbjct  341  S  341



>gb|KHG01878.1| hypothetical protein F383_23026 [Gossypium arboreum]
Length=349

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             E + LVRADISRLPF S+S+DAVHAGAALHCWPSPS AVAEISRVLRPGGVFVATTYI 
Sbjct  228  KEKVTLVRADISRLPFESNSIDAVHAGAALHCWPSPSTAVAEISRVLRPGGVFVATTYIF  287

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG ++F PFV   R+N   I+GS+  + E+ELEDLC TCGLVGF C+RN  F+M++A K 
Sbjct  288  DGPFTFLPFVNTFRQNMMGIAGSYFAVSEQELEDLCRTCGLVGFTCMRNGPFVMISARKR  347

Query  299  S  297
            S
Sbjct  348  S  348



>ref|XP_009373157.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Pyrus x bretschneideri]
Length=348

 Score =   180 bits (456),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN+ILVRADISRLPFA+SSVDAVHAGAA+HCWPSPS+AVAEISRVLRPGGVFVATT+I 
Sbjct  228  KENMILVRADISRLPFATSSVDAVHAGAAIHCWPSPSSAVAEISRVLRPGGVFVATTFIW  287

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG +S  PF R + +   Q+SG+ +F  E ELED+C  CGLVGF  +RNRRF+M++  KP
Sbjct  288  DGPFSLIPFQRNIAQRTKQMSGNQLFTSESELEDICQACGLVGFTKVRNRRFVMISCTKP  347



>ref|XP_010667997.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=349

 Score =   179 bits (455),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             E +ILVRADISRLPF S S+DAVHAGAALHCWPSPS A AEISR+LRPGGVFVATT I 
Sbjct  229  KEKLILVRADISRLPFVSGSIDAVHAGAALHCWPSPSNAGAEISRILRPGGVFVATTTIG  288

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG ++  PF    RE   QISGS IFL E+ELEDLCTTCGLV F+C RN  F+M++A KP
Sbjct  289  DGPFTLVPFRSNFREYLQQISGSRIFLSERELEDLCTTCGLVDFRCTRNGLFVMISATKP  348

Query  299  S  297
            +
Sbjct  349  N  349



>ref|XP_008391145.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Malus domestica]
Length=291

 Score =   177 bits (450),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN+ILVRADISRLPFA+SSVDAVHAGAA+HCWPSPS+AVAEISRVLRPGGVFVATT+I 
Sbjct  171  KENMILVRADISRLPFATSSVDAVHAGAAIHCWPSPSSAVAEISRVLRPGGVFVATTFIW  230

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG +S  PF R + +   Q+SG+ +F  E EL+D+C  CGLVGF  +RN RF+M++A KP
Sbjct  231  DGPFSLIPFQRNIAQRTKQMSGNQLFTSESELQDICQACGLVGFTKVRNGRFVMISATKP  290



>ref|XP_008374425.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Malus domestica]
Length=355

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN ILVRADISRLPFA+SSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA+TYI+
Sbjct  235  KENXILVRADISRLPFATSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVASTYIL  294

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG +S  PF+R +     QISGS +F  E E EDLC  CGLVGF  +R   F+M++A KP
Sbjct  295  DGRFSLIPFLRNITRVTKQISGSQVFTSESEFEDLCQACGLVGFTKVRYGLFVMISATKP  354

Query  299  S  297
            +
Sbjct  355  T  355



>ref|XP_008374488.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Malus domestica]
Length=348

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN ILVRADISRLPFA+SSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA+TYI+
Sbjct  228  KENXILVRADISRLPFATSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVASTYIL  287

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG +S  PF+R +     QISGS +F  E E EDLC  CGLVGF  +R   F+M++A KP
Sbjct  288  DGRFSLIPFLRNITRVTKQISGSQVFTSESEFEDLCQACGLVGFTKVRYGLFVMISATKP  347

Query  299  S  297
            +
Sbjct  348  T  348



>emb|CDX87473.1| BnaA07g34000D [Brassica napus]
Length=356

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 100/126 (79%), Gaps = 8/126 (6%)
 Frame = -2

Query  650  IILVRADISRL--------PFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA  495
            ++L RADI+RL        PF S  VDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVA
Sbjct  230  VVLARADIARLQGHGPARLPFLSGVVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVA  289

Query  494  TTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIML  315
            TT+I DG++ F PF++ LR+   + SGSH+FL E+ELEDLC +CGLVGF C+RN  FIML
Sbjct  290  TTFIYDGLFRFVPFLKKLRQEVMRYSGSHMFLSERELEDLCESCGLVGFTCVRNGLFIML  349

Query  314  TAMKPS  297
            +A KP+
Sbjct  350  SATKPT  355



>ref|XP_008808068.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Phoenix dactylifera]
Length=339

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN+ILVRADISRLPF SSS+DAVHAGAALHCWPSPS AVAEISRVLRPGGVFVATT+++
Sbjct  219  KENLILVRADISRLPFVSSSIDAVHAGAALHCWPSPSTAVAEISRVLRPGGVFVATTFVL  278

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            D I    P  R +RE + + SG H++L E ELED+C+ CGL+GF  IRN  FIM++A KP
Sbjct  279  DTIPPAVPIFRAIRELYTRTSGQHLYLSEGELEDICSACGLIGFTRIRNGSFIMISATKP  338



>ref|XP_008391080.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Malus domestica]
Length=355

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             E +ILVRADISRLPFA+ SVDAVHAGAA+HCWPSPS AVAEISRVLRPGGVFVA+TYI+
Sbjct  235  KEXMILVRADISRLPFATGSVDAVHAGAAIHCWPSPSTAVAEISRVLRPGGVFVASTYIL  294

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DG +S  PF+R + +   QISG  +F  E ELED+C  CGLV F  +RNR F+M++A KP
Sbjct  295  DGPFSLIPFLRNITQRTKQISGGQVFTSESELEDICQACGLVXFTKVRNRLFVMISATKP  354

Query  299  S  297
            +
Sbjct  355  T  355



>ref|XP_010534071.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=349

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             E I+LVRADISRLPF S SVDAVHAGAALHCWPSP++AVAE+SRVLRPGGVFVATT+I 
Sbjct  230  KEKIVLVRADISRLPFLSGSVDAVHAGAALHCWPSPASAVAEVSRVLRPGGVFVATTFIN  289

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            + + SF PF R +R+   + SGSH FL E+ELED+C  CGLVGF C+RN  FIML+A KP
Sbjct  290  EPL-SFIPFSRNIRQGVIRYSGSHFFLSERELEDVCRACGLVGFNCVRNGPFIMLSATKP  348



>ref|XP_010534070.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=356

 Score =   174 bits (442),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             E I+LVRADISRLPF S SVDAVHAGAALHCWPSP++AVAE+SRVLRPGGVFVATT+I 
Sbjct  237  KEKIVLVRADISRLPFLSGSVDAVHAGAALHCWPSPASAVAEVSRVLRPGGVFVATTFIN  296

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            + + SF PF R +R+   + SGSH FL E+ELED+C  CGLVGF C+RN  FIML+A KP
Sbjct  297  EPL-SFIPFSRNIRQGVIRYSGSHFFLSERELEDVCRACGLVGFNCVRNGPFIMLSATKP  355



>ref|XP_009394965.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=352

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -2

Query  656  ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVD  477
            EN+ILVRADISRLPF SSSVDAVHAGAA+HCWPSPSA VAEISRVLRPGGVFVATT+I+D
Sbjct  233  ENLILVRADISRLPFVSSSVDAVHAGAAIHCWPSPSAGVAEISRVLRPGGVFVATTFILD  292

Query  476  GIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  297
             +    P ++ +R+ + + S ++++L E ELEDLC TCGLV F C+RN  F+M++A KPS
Sbjct  293  VLPPVIPILKTVRQYYIRASSNYLYLSEGELEDLCQTCGLVNFTCVRNGPFVMISATKPS  352



>ref|XP_009394964.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=355

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -2

Query  656  ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVD  477
            EN+ILVRADISRLPF SSSVDAVHAGAA+HCWPSPSA VAEISRVLRPGGVFVATT+I+D
Sbjct  236  ENLILVRADISRLPFVSSSVDAVHAGAAIHCWPSPSAGVAEISRVLRPGGVFVATTFILD  295

Query  476  GIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  297
             +    P ++ +R+ + + S ++++L E ELEDLC TCGLV F C+RN  F+M++A KPS
Sbjct  296  VLPPVIPILKTVRQYYIRASSNYLYLSEGELEDLCQTCGLVNFTCVRNGPFVMISATKPS  355



>ref|XP_010939635.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Elaeis guineensis]
Length=313

 Score =   168 bits (425),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             +N+ILVRAD+SRLPF SSS+DAVHAGAALHCW SPSAAVAEISR+LRPGGVFVATT+I 
Sbjct  193  KKNLILVRADVSRLPFVSSSIDAVHAGAALHCWSSPSAAVAEISRILRPGGVFVATTFIF  252

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            D I    P +R LR+ +   SG ++FL E EL+DLC  CGLV   CIRNR F+M+ A KP
Sbjct  253  DAIPIAVPVLRMLRKFYIGNSGKYMFLSEGELKDLCQACGLVDVTCIRNRLFVMIAATKP  312

Query  299  S  297
            S
Sbjct  313  S  313



>ref|XP_008790837.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Phoenix dactylifera]
Length=315

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -2

Query  656  ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVD  477
            EN+ILVRADI RLPF SSS+DAVHAGAALHCW SPSAAVAEISR+LRPGGVFVATT+I D
Sbjct  196  ENLILVRADICRLPFVSSSIDAVHAGAALHCWSSPSAAVAEISRILRPGGVFVATTFIFD  255

Query  476  GIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  297
             I    P +R LR+ +   S ++IFL E EL+DLC  CGLVG  CIR+R F+M++A+KP+
Sbjct  256  VIPIAVPVLRMLRKFYIGNSSNYIFLSEGELKDLCEACGLVGVTCIRHRLFVMISAIKPN  315



>ref|XP_008790838.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Phoenix dactylifera]
Length=313

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             +N+ILVRADI RLPF SSS+DAVHAGAALHCW SPSAAVAEISR+LRPGGVFVATT+I 
Sbjct  193  KKNLILVRADICRLPFVSSSIDAVHAGAALHCWSSPSAAVAEISRILRPGGVFVATTFIF  252

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            D I    P +R LR+ +   S ++IFL E EL+DLC  CGLVG  CIR+R F+M++A+KP
Sbjct  253  DVIPIAVPVLRMLRKFYIGNSSNYIFLSEGELKDLCEACGLVGVTCIRHRLFVMISAIKP  312

Query  299  S  297
            +
Sbjct  313  N  313



>gb|KJB14720.1| hypothetical protein B456_002G140100, partial [Gossypium raimondii]
Length=386

 Score =   165 bits (417),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 95/123 (77%), Gaps = 6/123 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAA----VAEISRVLRPGGVFVATTY  486
             + LVRADISRLPF SSSVDA+HAGAALHCWPSPS A      ++ +VLRPGG+FVATTY
Sbjct  266  KMTLVRADISRLPFKSSSVDALHAGAALHCWPSPSTACLLYAGQLQQVLRPGGLFVATTY  325

Query  485  IVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAM  306
            I+DG   F PF+R   +N   I+GSH+FL E+ELEDLC TCGL+GF CIRN  F+M++A 
Sbjct  326  ILDG--PFIPFLRTFHQNVMGIAGSHVFLSERELEDLCRTCGLIGFTCIRNSCFVMISAR  383

Query  305  KPS  297
            K S
Sbjct  384  KRS  386



>gb|KDO80930.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=334

 Score =   161 bits (407),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = -2

Query  614  FASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRE  435
            F   S+DAVHAGAA+HCW SPS  VAEISRVLRPGGVFV TTYIVDG ++  PF R LR+
Sbjct  227  FPKDSIDAVHAGAAIHCWSSPSTGVAEISRVLRPGGVFVGTTYIVDGPFNLIPFSRLLRQ  286

Query  434  NFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  297
            N  QISGS+ FL E+E+EDLC  CGLV FKC RNR F+M TA KPS
Sbjct  287  NMMQISGSYTFLSEREIEDLCRACGLVDFKCTRNRGFVMFTATKPS  332



>ref|XP_010928270.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X4 [Elaeis guineensis]
Length=314

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 91/122 (75%), Gaps = 6/122 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRADISRLPFAS SVDA+HAGAALHCWPSPS AVAEISRVLR GGVFVATT++   
Sbjct  195  NLALVRADISRLPFASCSVDAIHAGAALHCWPSPSNAVAEISRVLRSGGVFVATTFLSSP  254

Query  473  IYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAM  306
            + S  PF    +RPLR+ F Q + S+ +  EKE+EDLC +CGL+ +     R FIM +A 
Sbjct  255  LNS--PFSSGALRPLRQFFGQENSSYNYFTEKEIEDLCKSCGLINYTSKVQRSFIMFSAQ  312

Query  305  KP  300
            KP
Sbjct  313  KP  314



>ref|XP_010928269.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X3 [Elaeis guineensis]
Length=315

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 91/122 (75%), Gaps = 6/122 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRADISRLPFAS SVDA+HAGAALHCWPSPS AVAEISRVLR GGVFVATT++   
Sbjct  196  NLALVRADISRLPFASCSVDAIHAGAALHCWPSPSNAVAEISRVLRSGGVFVATTFLSSP  255

Query  473  IYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAM  306
            + S  PF    +RPLR+ F Q + S+ +  EKE+EDLC +CGL+ +     R FIM +A 
Sbjct  256  LNS--PFSSGALRPLRQFFGQENSSYNYFTEKEIEDLCKSCGLINYTSKVQRSFIMFSAQ  313

Query  305  KP  300
            KP
Sbjct  314  KP  315



>ref|XP_009386973.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=353

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 91/120 (76%), Gaps = 2/120 (2%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRAD+SRLPFAS S+DAVHAGAALHCWPSPS AVAEISRVLR GGVFVATT++V  
Sbjct  234  NLALVRADVSRLPFASGSIDAVHAGAALHCWPSPSNAVAEISRVLRSGGVFVATTFLVSP  293

Query  473  IYSFTPF--VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            + +  P    + LR++F Q++ S+ +  EKE+EDLC +CGLV +     R FIM +A KP
Sbjct  294  LNTPLPLEAFQSLRQSFGQVTNSYNYFTEKEIEDLCRSCGLVNYTSTVRRSFIMFSAQKP  353



>ref|NP_001150427.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
 gb|ACG39054.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
 tpg|DAA49108.1| TPA: S-adenosylmethionine-dependent methyltransferase [Zea mays]
Length=348

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            +E ++LVRADISRLPF S S+DA+HAGAA+HCWPSP+ AVA+ISRVLRPGG+FVA+T++ 
Sbjct  228  DERLVLVRADISRLPFVSGSIDALHAGAAIHCWPSPACAVADISRVLRPGGIFVASTFVA  287

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  303
            D I    P ++ +R   +QI+G++ FL E ELEDLC  CGLV FK +R+  +IM +A K
Sbjct  288  DVIPPAIPVLKIVRPYISQITGNNTFLSEVELEDLCKACGLVDFKFVRSGFYIMFSATK  346



>ref|XP_010928268.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X2 [Elaeis guineensis]
Length=354

 Score =   151 bits (381),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 91/122 (75%), Gaps = 6/122 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRADISRLPFAS SVDA+HAGAALHCWPSPS AVAEISRVLR GGVFVATT++   
Sbjct  235  NLALVRADISRLPFASCSVDAIHAGAALHCWPSPSNAVAEISRVLRSGGVFVATTFLSSP  294

Query  473  IYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAM  306
            + S  PF    +RPLR+ F Q + S+ +  EKE+EDLC +CGL+ +     R FIM +A 
Sbjct  295  LNS--PFSSGALRPLRQFFGQENSSYNYFTEKEIEDLCKSCGLINYTSKVQRSFIMFSAQ  352

Query  305  KP  300
            KP
Sbjct  353  KP  354



>ref|XP_010928267.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X1 [Elaeis guineensis]
Length=355

 Score =   151 bits (381),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 91/122 (75%), Gaps = 6/122 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRADISRLPFAS SVDA+HAGAALHCWPSPS AVAEISRVLR GGVFVATT++   
Sbjct  236  NLALVRADISRLPFASCSVDAIHAGAALHCWPSPSNAVAEISRVLRSGGVFVATTFLSSP  295

Query  473  IYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAM  306
            + S  PF    +RPLR+ F Q + S+ +  EKE+EDLC +CGL+ +     R FIM +A 
Sbjct  296  LNS--PFSSGALRPLRQFFGQENSSYNYFTEKEIEDLCKSCGLINYTSKVQRSFIMFSAQ  353

Query  305  KP  300
            KP
Sbjct  354  KP  355



>ref|XP_008788786.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Phoenix dactylifera]
Length=348

 Score =   150 bits (380),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 91/122 (75%), Gaps = 6/122 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRADISRLPFAS SVDA+HAGAALHCWPSPS AVAEISRVLR GGVFVATT++   
Sbjct  229  NLALVRADISRLPFASCSVDAIHAGAALHCWPSPSNAVAEISRVLRSGGVFVATTFLSSP  288

Query  473  IYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAM  306
            + +  PF    +RPLR+ F Q + S+ +  EKE+EDLC +CGL+ +     R FIM +A 
Sbjct  289  LNN--PFSSEALRPLRQFFGQENNSYNYFTEKEIEDLCKSCGLINYTSKVQRSFIMFSAQ  346

Query  305  KP  300
            KP
Sbjct  347  KP  348



>ref|XP_006659389.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Oryza brachyantha]
Length=358

 Score =   151 bits (381),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 90/121 (74%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            +E + LVRADISRLPF S S+DAVHAGAA+HCWPSP+ AVAEISRVLRPGGVFVA+T++ 
Sbjct  238  DEKLALVRADISRLPFVSGSIDAVHAGAAIHCWPSPACAVAEISRVLRPGGVFVASTFVA  297

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            D +    P +R  R   +Q +G++IFL E E EDLC  CGLV F  +RN  +IM +A K 
Sbjct  298  DILPPAVPVLRIGRPYISQFTGTNIFLSEVEFEDLCRACGLVDFTFVRNGFYIMFSATKA  357

Query  299  S  297
            S
Sbjct  358  S  358



>gb|EEE66113.1| hypothetical protein OsJ_22149 [Oryza sativa Japonica Group]
Length=237

 Score =   147 bits (372),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 89/124 (72%), Gaps = 6/124 (5%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRADISRLPFASSS+DA+HAGAA+HCWPSPS AVAEISRVLRPGGVFVATT++ 
Sbjct  116  NTNLALVRADISRLPFASSSIDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVATTFLS  175

Query  479  DGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLT  312
                   PF    +RPLR+    ++ S+ +  E ELEDLC +CGLV +     R FIM +
Sbjct  176  SP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYSSKVQRSFIMFS  233

Query  311  AMKP  300
              KP
Sbjct  234  GQKP  237



>ref|XP_002445476.1| hypothetical protein SORBIDRAFT_07g020130 [Sorghum bicolor]
 gb|EES14971.1| hypothetical protein SORBIDRAFT_07g020130 [Sorghum bicolor]
Length=352

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 91/121 (75%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            +E + LVRADISRLPF S S+DAVHAGAA+HCWPSP+ AVA+ISRVLRPGGVFVA+T++ 
Sbjct  232  DERLALVRADISRLPFVSGSIDAVHAGAAIHCWPSPACAVADISRVLRPGGVFVASTFVA  291

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            D I    P +R  R   +QI+G++ FL E E EDLC  CGLV FK +R+  +IM +A K 
Sbjct  292  DVIPPVIPVLRIGRPYISQITGNNTFLSEVEFEDLCKACGLVDFKFVRSGFYIMFSATKA  351

Query  299  S  297
            S
Sbjct  352  S  352



>ref|XP_003563313.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Brachypodium distachyon]
Length=356

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 90/124 (73%), Gaps = 5/124 (4%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRADISRLPFAS S+DA+HAGAA+HCWPSPS AVAEISRVLRPGGVFVATT++ 
Sbjct  234  NTNLALVRADISRLPFASCSIDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVATTFLS  293

Query  479  ----DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLT  312
                 G +S  P +RPLR+    ++ S+ F  E ELEDLC +CGLV +     R FIM +
Sbjct  294  TPTNSGPFSVGP-LRPLRQIVGPVNSSYNFFTEAELEDLCKSCGLVNYSSKVQRSFIMFS  352

Query  311  AMKP  300
              KP
Sbjct  353  GQKP  356



>ref|XP_003574470.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Brachypodium distachyon]
 ref|XP_010235114.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Brachypodium distachyon]
Length=361

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            +E + LVRADISRLPF + S+D VHAGAALHCWPSP+ AVAEISRVLRPGG+FVA+T++ 
Sbjct  241  DERLALVRADISRLPFVNGSIDVVHAGAALHCWPSPACAVAEISRVLRPGGIFVASTFVA  300

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  303
            D +    P +R  R    Q++G++ FL E ELEDLC  CGLV F  +RN  +I+ +A K
Sbjct  301  DVLPPVVPLLRIGRSYIGQLTGNNTFLSEAELEDLCKACGLVDFTFVRNGFYIIFSATK  359



>ref|NP_001061786.1| Os08g0411200 [Oryza sativa Japonica Group]
 dbj|BAF23700.1| Os08g0411200 [Oryza sativa Japonica Group]
 dbj|BAH00216.1| unnamed protein product [Oryza sativa Japonica Group]
Length=358

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 89/121 (74%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            ++ + L RADISRLPF S S+DAVHA AA+HCWPSP+ AVAEISRVLRPGGVFVA+T++ 
Sbjct  238  DKTLALARADISRLPFVSGSIDAVHAAAAIHCWPSPACAVAEISRVLRPGGVFVASTFVA  297

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            D +    P +R  R   +Q +GS+IFL E E EDLC  CGL+ FK +RN  +IM +A K 
Sbjct  298  DILPPAVPVLRIGRPYISQFTGSNIFLSEAEFEDLCRACGLIDFKFVRNGFYIMFSATKA  357

Query  299  S  297
            S
Sbjct  358  S  358



>ref|XP_004973409.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Setaria italica]
Length=350

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 90/121 (74%), Gaps = 0/121 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            +E + LVRADISRLPF + S+DAVHAGAA+HCWPSP+ AVAEISRVLR GG+FVA+T++ 
Sbjct  230  DERLALVRADISRLPFVNGSIDAVHAGAAIHCWPSPACAVAEISRVLRSGGIFVASTFVA  289

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            D I    P +R  R   +QI G++ FL E ELEDLC  CGLV FK +R+  +IM +A K 
Sbjct  290  DVIPPAIPILRIARPYISQIGGNNTFLSEVELEDLCKACGLVDFKFVRSGFYIMFSATKA  349

Query  299  S  297
            S
Sbjct  350  S  350



>ref|NP_001058196.1| Os06g0646000 [Oryza sativa Japonica Group]
 dbj|BAD37452.1| methyltransferase-like [Oryza sativa Japonica Group]
 dbj|BAD37605.1| methyltransferase-like [Oryza sativa Japonica Group]
 dbj|BAF20110.1| Os06g0646000 [Oryza sativa Japonica Group]
 dbj|BAG91023.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81074.1| hypothetical protein OsI_23892 [Oryza sativa Indica Group]
Length=345

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 89/124 (72%), Gaps = 6/124 (5%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRADISRLPFASSS+DA+HAGAA+HCWPSPS AVAEISRVLRPGGVFVATT++ 
Sbjct  224  NTNLALVRADISRLPFASSSIDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVATTFLS  283

Query  479  DGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLT  312
                   PF    +RPLR+    ++ S+ +  E ELEDLC +CGLV +     R FIM +
Sbjct  284  SP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYSSKVQRSFIMFS  341

Query  311  AMKP  300
              KP
Sbjct  342  GQKP  345



>gb|AFW76188.1| hypothetical protein ZEAMMB73_680706 [Zea mays]
Length=206

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 87/124 (70%), Gaps = 6/124 (5%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRADISRLPFAS SVDA+HAGAA+HCWPSPS AVAEISRVLRPGGVFV TT++ 
Sbjct  84   NVNLALVRADISRLPFASCSVDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVGTTFLS  143

Query  479  DGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLT  312
                   PF    +RPLR+    ++ S+ +  E ELEDLC +CGLV +     R FIM +
Sbjct  144  SP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYSSNVQRSFIMFS  201

Query  311  AMKP  300
              KP
Sbjct  202  GQKP  205



>ref|XP_004974685.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like, 
partial [Setaria italica]
Length=323

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 91/121 (75%), Gaps = 1/121 (1%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            +E + LVRADISRLPF + S+DAVHAGAA+HCWPSPS AVAEISRVLRPGGV VA+T++ 
Sbjct  204  DERLALVRADISRLPFVNGSIDAVHAGAAIHCWPSPSCAVAEISRVLRPGGVLVASTFVE  263

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            D I    P +R  R   ++I+G +IFL E ELEDLC  CGLV F+ +RN  +IM +A K 
Sbjct  264  D-IPLAIPILRIGRPYISRITGMNIFLSEAELEDLCRACGLVDFEFVRNGFYIMFSATKA  322

Query  299  S  297
            S
Sbjct  323  S  323



>gb|EEE68668.1| hypothetical protein OsJ_27281 [Oryza sativa Japonica Group]
Length=369

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
             + L RADISRLPF S S+DAVHA AA+HCWPSP+ AVAEISRVLRPGGVFVA+T++ D 
Sbjct  251  TLALARADISRLPFVSGSIDAVHAAAAIHCWPSPACAVAEISRVLRPGGVFVASTFVADI  310

Query  473  IYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  297
            +    P +R  R   +Q +GS+IFL E E EDLC  CGL+ FK +RN  +IM +A K S
Sbjct  311  LPPAVPVLRIGRPYISQFTGSNIFLSEAEFEDLCRACGLIDFKFVRNGFYIMFSATKAS  369



>ref|XP_004488470.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Cicer arietinum]
Length=346

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 88/119 (74%), Gaps = 6/119 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            NI LVRAD+SRLPFAS SVDAVHAGAALHCWPSPS AVAEI+RVLR GGVFV TT++   
Sbjct  233  NIALVRADVSRLPFASGSVDAVHAGAALHCWPSPSNAVAEITRVLRSGGVFVGTTFLR--  290

Query  473  IYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
              S TP++ RP RE  +Q  G   FL E+E++DLCT+CGL  + C     FIM TA KP
Sbjct  291  YTSSTPWILRPFRERTSQGYG---FLKEEEIKDLCTSCGLTNYSCKIQNSFIMFTAQKP  346



>dbj|BAJ91607.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   145 bits (366),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 90/124 (73%), Gaps = 5/124 (4%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRADISRLPFAS S+DA+HAGAA+HCWPSPS A+AEISRVL+PGGVFVATT++ 
Sbjct  226  NTNLALVRADISRLPFASCSIDAIHAGAAIHCWPSPSNAIAEISRVLKPGGVFVATTFLS  285

Query  479  ----DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLT  312
                 G++S    ++PLR+    ++ S+ F  E ELEDLC +CGLV +     R FIM +
Sbjct  286  TPTNSGLFSIDA-LKPLRQIVGPVNSSYNFFTEGELEDLCRSCGLVNYSSKVQRSFIMFS  344

Query  311  AMKP  300
              KP
Sbjct  345  GQKP  348



>ref|XP_006657188.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Oryza brachyantha]
Length=353

 Score =   145 bits (366),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 89/124 (72%), Gaps = 6/124 (5%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRADISRLPFAS S+DA+HAGAA+HCWPSPS AVAEISRVLRPGGVFVATT++ 
Sbjct  231  NTNLALVRADISRLPFASCSIDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVATTFLS  290

Query  479  DGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLT  312
                +  PF    +RPLR+    ++ S+ +  E ELEDLC +CGLV +     R FIM +
Sbjct  291  SPRNN--PFSVEALRPLRQVVGPVNTSYNYFTEGELEDLCKSCGLVNYSSKVQRAFIMFS  348

Query  311  AMKP  300
              KP
Sbjct  349  GQKP  352



>dbj|BAJ94151.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   145 bits (366),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 90/124 (73%), Gaps = 5/124 (4%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRADISRLPFAS S+DA+HAGAA+HCWPSPS A+AEISRVL+PGGVFVATT++ 
Sbjct  226  NTNLALVRADISRLPFASCSIDAIHAGAAIHCWPSPSNAIAEISRVLKPGGVFVATTFLS  285

Query  479  ----DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLT  312
                 G++S    ++PLR+    ++ S+ F  E ELEDLC +CGLV +     R FIM +
Sbjct  286  TPTNSGLFSIDA-LKPLRQIVGPVNSSYNFFTEGELEDLCRSCGLVNYSSKVQRSFIMFS  344

Query  311  AMKP  300
              KP
Sbjct  345  GQKP  348



>ref|XP_002438745.1| hypothetical protein SORBIDRAFT_10g025400 [Sorghum bicolor]
 gb|EER90112.1| hypothetical protein SORBIDRAFT_10g025400 [Sorghum bicolor]
Length=352

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 87/124 (70%), Gaps = 6/124 (5%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRADISRLPFAS SVDA+HAGAA+HCWPSPS AVAEISRVLRPGGVFV TT++ 
Sbjct  230  NANLALVRADISRLPFASCSVDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVGTTFLS  289

Query  479  DGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLT  312
                   PF    +RPLR+    ++ S+ +  E ELEDLC +CGLV +     R FIM +
Sbjct  290  SP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYSSKVQRSFIMFS  347

Query  311  AMKP  300
              KP
Sbjct  348  GQKP  351



>gb|EMT07919.1| Putative methyltransferase [Aegilops tauschii]
Length=358

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 89/124 (72%), Gaps = 5/124 (4%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRADISRLPFAS S+DA+HAGAA+HCWPSPS A+AEISRVL+PGGVFVATT++ 
Sbjct  236  NTNLALVRADISRLPFASCSIDAIHAGAAIHCWPSPSNAIAEISRVLKPGGVFVATTFLS  295

Query  479  DGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLT  312
                S  PF    +RPLR+    ++ S+ F  E EL+DLC +CGLV +     R FIM +
Sbjct  296  TPTNS-GPFSIDALRPLRQIVGPVNSSYNFFTEGELKDLCISCGLVNYSSKVQRSFIMFS  354

Query  311  AMKP  300
              KP
Sbjct  355  GQKP  358



>gb|EMT30153.1| Putative methyltransferase [Aegilops tauschii]
Length=416

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 90/124 (73%), Gaps = 5/124 (4%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRADISRLPFAS S+DA+HAGAA+HCWPSPS A+AEISRVL+PGGVFVATT++ 
Sbjct  294  NTNLALVRADISRLPFASCSIDAIHAGAAIHCWPSPSNAIAEISRVLKPGGVFVATTFLS  353

Query  479  ----DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLT  312
                 G++S    ++PLR+    ++ S+ F  E ELEDLC +CGLV +     R FIM +
Sbjct  354  TPTNSGLFSIDA-LKPLRQIVGPVNSSYNFFTEGELEDLCRSCGLVNYSSKVQRSFIMFS  412

Query  311  AMKP  300
              KP
Sbjct  413  GQKP  416



>ref|XP_004965743.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Setaria italica]
Length=299

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 87/122 (71%), Gaps = 6/122 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRADISRLPFAS SVDA+HAGAA+HCWPSPS AVAEISRVLRPGGVFV TT++   
Sbjct  179  NLALVRADISRLPFASCSVDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVGTTFLSSP  238

Query  473  IYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAM  306
              +  PF    +RPLR+    ++ S+ +  E ELEDLC +CGLV +     R FIM +  
Sbjct  239  RNN--PFSVEALRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYSSKVQRSFIMFSGQ  296

Query  305  KP  300
            KP
Sbjct  297  KP  298



>gb|ACG27569.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
Length=344

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 87/124 (70%), Gaps = 6/124 (5%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRADISRLPFAS SVDA+HAGAA+HCWPSPS AVAEISRVLRPGGVFV TT++ 
Sbjct  222  NVNLALVRADISRLPFASCSVDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVGTTFLS  281

Query  479  DGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLT  312
                   PF    +RPLR+    ++ S+ +  E ELEDLC +CGLV +     R FIM +
Sbjct  282  SP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYSSNVQRSFIMFS  339

Query  311  AMKP  300
              KP
Sbjct  340  GQKP  343



>gb|ACF85541.1| unknown [Zea mays]
 gb|ACF88073.1| unknown [Zea mays]
Length=346

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 87/124 (70%), Gaps = 6/124 (5%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRADISRLPFAS SVDA+HAGAA+HCWPSPS AVAEISRVLRPGGVFV TT++ 
Sbjct  224  NVNLALVRADISRLPFASCSVDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVGTTFLS  283

Query  479  DGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLT  312
                   PF    +RPLR+    ++ S+ +  E ELEDLC +CGLV +     R FIM +
Sbjct  284  SP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYSSNVQRSFIMFS  341

Query  311  AMKP  300
              KP
Sbjct  342  GQKP  345



>ref|NP_001132053.1| uncharacterized LOC100193465 [Zea mays]
 gb|ACF80738.1| unknown [Zea mays]
 gb|AFW76186.1| LOW QUALITY PROTEIN: S-adenosylmethionine-dependent methyltransferase 
[Zea mays]
Length=356

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 87/124 (70%), Gaps = 6/124 (5%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRADISRLPFAS SVDA+HAGAA+HCWPSPS AVAEISRVLRPGGVFV TT++ 
Sbjct  234  NVNLALVRADISRLPFASCSVDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVGTTFLS  293

Query  479  DGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLT  312
                   PF    +RPLR+    ++ S+ +  E ELEDLC +CGLV +     R FIM +
Sbjct  294  SP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYSSNVQRSFIMFS  351

Query  311  AMKP  300
              KP
Sbjct  352  GQKP  355



>ref|XP_004965742.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Setaria italica]
Length=354

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 86/122 (70%), Gaps = 6/122 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRADISRLPFAS SVDA+HAGAA+HCWPSPS AVAEISRVLRPGGVFV TT++   
Sbjct  234  NLALVRADISRLPFASCSVDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVGTTFLSSP  293

Query  473  IYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAM  306
                 PF    +RPLR+    ++ S+ +  E ELEDLC +CGLV +     R FIM +  
Sbjct  294  --RNNPFSVEALRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYSSKVQRSFIMFSGQ  351

Query  305  KP  300
            KP
Sbjct  352  KP  353



>ref|XP_011470644.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=337

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 88/122 (72%), Gaps = 12/122 (10%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRAD+SRLPFAS SVDAVHAGAALHCWPSPS AVAEI+RVLR GGVFV TT++   
Sbjct  224  NLALVRADVSRLPFASGSVDAVHAGAALHCWPSPSNAVAEITRVLRSGGVFVGTTFL---  280

Query  473  IYSFTP----FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAM  306
               +TP    ++RP RE  AQ    + +L E+E++DLCT+CGL  +     + FIM +A 
Sbjct  281  --RYTPTTPWYIRPFRERIAQ---GYSYLTEEEIQDLCTSCGLTNYSSKVQQSFIMFSAQ  335

Query  305  KP  300
            KP
Sbjct  336  KP  337



>ref|XP_011470680.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X3 [Fragaria vesca subsp. vesca]
Length=336

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 89/122 (73%), Gaps = 11/122 (9%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRAD+SRLPFAS SVDAVHAGAALHCWPSPS AVAEI+RVLR GGVFV TT++   
Sbjct  222  NLALVRADVSRLPFASGSVDAVHAGAALHCWPSPSNAVAEITRVLRSGGVFVGTTFL---  278

Query  473  IYSFTP----FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAM  306
               +TP    ++RP RE   +I+  + +L E+E++DLCT+CGL  +     + FIM +A 
Sbjct  279  --RYTPTTPWYIRPFREQ--RIAQGYSYLTEEEIQDLCTSCGLTNYSSKVQQSFIMFSAQ  334

Query  305  KP  300
            KP
Sbjct  335  KP  336



>ref|XP_004287240.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=338

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 89/122 (73%), Gaps = 11/122 (9%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRAD+SRLPFAS SVDAVHAGAALHCWPSPS AVAEI+RVLR GGVFV TT++   
Sbjct  224  NLALVRADVSRLPFASGSVDAVHAGAALHCWPSPSNAVAEITRVLRSGGVFVGTTFL---  280

Query  473  IYSFTP----FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAM  306
               +TP    ++RP RE   +I+  + +L E+E++DLCT+CGL  +     + FIM +A 
Sbjct  281  --RYTPTTPWYIRPFREQ--RIAQGYSYLTEEEIQDLCTSCGLTNYSSKVQQSFIMFSAQ  336

Query  305  KP  300
            KP
Sbjct  337  KP  338



>ref|XP_010099510.1| putative methyltransferase [Morus notabilis]
 gb|EXB79361.1| putative methyltransferase [Morus notabilis]
Length=346

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 89/121 (74%), Gaps = 6/121 (5%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRAD+SRLPF+S SVDAVHAGAALHCWPSP+ AVAEI+R+LR GG+FV TT++ 
Sbjct  231  NSNLALVRADVSRLPFSSGSVDAVHAGAALHCWPSPTNAVAEITRILRSGGIFVGTTFLR  290

Query  479  DGIYSFTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  303
                S TP  VRPLR+   Q   ++ +L E+E+EDLCT+CGL  +     + FIM +A K
Sbjct  291  --YTSSTPLIVRPLRQRVLQ---NYNYLTEEEIEDLCTSCGLTNYSSKVQQSFIMFSAQK  345

Query  302  P  300
            P
Sbjct  346  P  346



>gb|KDP30197.1| hypothetical protein JCGZ_16979 [Jatropha curcas]
Length=345

 Score =   140 bits (352),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 88/123 (72%), Gaps = 8/123 (7%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRAD+SRLPF S SVDAVHAGAALHCWPSPS A+AEI RVLR GGVFV TT++ 
Sbjct  228  NTNLALVRADVSRLPFPSGSVDAVHAGAALHCWPSPSNAIAEICRVLRSGGVFVGTTFLQ  287

Query  479  DGIYSFTP--FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAM  306
               YS T    +RP R+   +I  ++ +  E+E+EDLCT+CGL  +K    + FIM +A 
Sbjct  288  ---YSATTSWILRPFRQ---RIQENYFYFTEEEIEDLCTSCGLTNYKSKVQQSFIMFSAE  341

Query  305  KPS  297
            KPS
Sbjct  342  KPS  344



>ref|XP_003546595.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Glycine max]
 gb|KHN41316.1| Putative methyltransferase, chloroplastic [Glycine soja]
Length=341

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 86/119 (72%), Gaps = 6/119 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            NI LVRAD+SRLPF S SVDAVHAGAALHCWPSPS AVAEI+RVL+ GGVFV +T++   
Sbjct  228  NIALVRADVSRLPFPSGSVDAVHAGAALHCWPSPSNAVAEITRVLKSGGVFVGSTFLR--  285

Query  473  IYSFTP-FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
              S TP F+RP RE   Q  G   +L E+E++DLCT+CGL  +     + FIM TA KP
Sbjct  286  YSSLTPWFLRPFRERIPQGYG---YLTEEEIKDLCTSCGLTNYSSKIQQAFIMFTAQKP  341



>emb|CDP10502.1| unnamed protein product [Coffea canephora]
Length=335

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 88/121 (73%), Gaps = 7/121 (6%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRADISRLPF S SVD VHAGAALHCWPSPS AVAEI+R+LR GGVFV TT++ 
Sbjct  221  NSNLALVRADISRLPFPSGSVDGVHAGAALHCWPSPSNAVAEINRILRSGGVFVGTTFLR  280

Query  479  DGIYSFTP-FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  303
                S TP F+RPLR    Q   ++ +L E+E+ED+CT+CGL+ +     + FIM +A K
Sbjct  281  --FSSSTPAFLRPLR----QAGRNYNYLTEEEIEDVCTSCGLINYTSKVQQSFIMFSAQK  334

Query  302  P  300
            P
Sbjct  335  P  335



>gb|EMT00494.1| Putative methyltransferase [Aegilops tauschii]
Length=493

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 89/124 (72%), Gaps = 5/124 (4%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRADI RLPFAS S+DA+HAGAA+HCWPSPS A+AEISRVL+PGGVFVATT++ 
Sbjct  371  NTNLALVRADILRLPFASCSIDAIHAGAAIHCWPSPSNAIAEISRVLKPGGVFVATTFLS  430

Query  479  ----DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLT  312
                 G++S    ++PLR+    ++ S+ F  E ELEDLC +CGLV +     R FIM +
Sbjct  431  TPTNSGLFSIDA-LKPLRQIVGPVNSSYNFFIEGELEDLCRSCGLVNYSSKVQRSFIMFS  489

Query  311  AMKP  300
              KP
Sbjct  490  RQKP  493



>ref|XP_011017926.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
 ref|XP_011017927.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
 ref|XP_011017928.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
Length=336

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 87/119 (73%), Gaps = 6/119 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRAD+SRLPFAS SVDAVHAGAA+HCWPSPS AVAEI RVLR GGVFV TT++   
Sbjct  223  NLGLVRADVSRLPFASGSVDAVHAGAAMHCWPSPSNAVAEICRVLRSGGVFVGTTFLR--  280

Query  473  IYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
              S TP + RP RE   +IS ++ F  E+E+EDLC+TCGL  +     R FIM +A KP
Sbjct  281  YSSTTPRIERPFRE---RISRNYNFFTEEEIEDLCSTCGLTNYSKKVQRTFIMFSAQKP  336



>ref|XP_008336947.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Malus domestica]
 ref|XP_008336948.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Malus domestica]
 ref|XP_008336949.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Malus domestica]
Length=325

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 88/120 (73%), Gaps = 5/120 (4%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRAD+SRLPFAS SVDAVHAGAALHCWPSPS AVAEI+R+LR G +FV TT++   
Sbjct  209  NLGLVRADVSRLPFASGSVDAVHAGAALHCWPSPSNAVAEITRILRSGAIFVGTTFLRSS  268

Query  473  IYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  297
             Y  TP++ +P RE  ++ S S  +L E+E+EDLC +CGL  +     + FIM +A KP+
Sbjct  269  PY--TPWIFKPFREKMSRSSNS--YLTEREIEDLCRSCGLTNYSSKVQQSFIMFSARKPA  324



>gb|EYU34934.1| hypothetical protein MIMGU_mgv1a009522mg [Erythranthe guttata]
Length=339

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 94/122 (77%), Gaps = 7/122 (6%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRAD+SRLPFAS SVDAVHAGAALHCWPSPS A+AEI+R+LR GGVFV +T++ 
Sbjct  223  NSNLALVRADVSRLPFASGSVDAVHAGAALHCWPSPSNAIAEINRILRSGGVFVGSTFLR  282

Query  479  DGIYSFTP-FVRPL-RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAM  306
              + S TP ++RPL RE   +I+ ++ +L E+E+E++C +CGLV +  I  + FIM +A 
Sbjct  283  --VSSSTPTWLRPLIRE---RITSNYNYLTEEEIEEVCKSCGLVNYTKIVQQSFIMFSAQ  337

Query  305  KP  300
            KP
Sbjct  338  KP  339



>ref|XP_011078555.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Sesamum indicum]
Length=338

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 89/119 (75%), Gaps = 6/119 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRAD+SRLPF S SVDAVHAGAALHCWPSPS AVAEI+R+LR GGVFV +T++   
Sbjct  225  NLALVRADVSRLPFPSGSVDAVHAGAALHCWPSPSNAVAEINRILRSGGVFVGSTFLR--  282

Query  473  IYSFTP-FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            I S TP  +RP R+   +I+  + +L E+E+EDLCT+CGLV +     + FIM +A KP
Sbjct  283  ISSSTPILLRPFRQ---RITNDYNYLTEEEIEDLCTSCGLVNYSKKVQQSFIMFSAEKP  338



>ref|XP_008456635.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X2 [Cucumis melo]
Length=338

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 88/121 (73%), Gaps = 6/121 (5%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRADISRLPF+S SVDAVHAGAALHCWPSPS A+AEI+R++R GGVFV TT++ 
Sbjct  223  NSNLALVRADISRLPFSSGSVDAVHAGAALHCWPSPSNAIAEITRIMRSGGVFVGTTFLR  282

Query  479  DGIYSFTP-FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  303
                S TP ++R LRE   Q  G   +L E+E+E+LC +CGL+ +     R FIM +A K
Sbjct  283  --YTSSTPWYLRFLRERGFQPYG---YLTEEEIEELCKSCGLINYSSKVQRSFIMFSAQK  337

Query  302  P  300
            P
Sbjct  338  P  338



>ref|XP_006586686.1| PREDICTED: uncharacterized protein LOC100798970 isoform X1 [Glycine 
max]
Length=336

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 86/119 (72%), Gaps = 6/119 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            NI LVRAD+SRLPF+S SVDAVHAGAALHCWPSPS AVAEI+R L+ GGVFV +T++   
Sbjct  223  NIALVRADVSRLPFSSGSVDAVHAGAALHCWPSPSNAVAEITRTLKNGGVFVGSTFLR--  280

Query  473  IYSFTP-FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
              S TP F+RP RE   Q  G   +L E+E++DLCT+CGL  +     + FIM TA KP
Sbjct  281  YSSKTPWFLRPFRERTPQGYG---YLTEEEIKDLCTSCGLTNYSSKIQQAFIMFTAQKP  336



>ref|NP_001242875.1| uncharacterized protein LOC100798970 [Glycine max]
 gb|ACU18789.1| unknown [Glycine max]
Length=341

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 86/119 (72%), Gaps = 6/119 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            NI LVRAD+SRLPF+S SVDAVHAGAALHCWPSPS AVAEI+R L+ GGVFV +T++   
Sbjct  228  NIALVRADVSRLPFSSGSVDAVHAGAALHCWPSPSNAVAEITRTLKNGGVFVGSTFLR--  285

Query  473  IYSFTP-FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
              S TP F+RP RE   Q  G   +L E+E++DLCT+CGL  +     + FIM TA KP
Sbjct  286  YSSKTPWFLRPFRERTPQGYG---YLTEEEIKDLCTSCGLTNYSSKIQQAFIMFTAQKP  341



>gb|KHN28439.1| Putative methyltransferase, chloroplastic [Glycine soja]
Length=341

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 86/119 (72%), Gaps = 6/119 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            NI LVRAD+SRLPF+S SVDAVHAGAALHCWPSPS AVAEI+R L+ GGVFV +T++   
Sbjct  228  NIALVRADVSRLPFSSGSVDAVHAGAALHCWPSPSNAVAEITRTLKNGGVFVGSTFLR--  285

Query  473  IYSFTP-FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
              S TP F+RP RE   Q  G   +L E+E++DLCT+CGL  +     + FIM TA KP
Sbjct  286  YSSKTPWFLRPFRERTPQGYG---YLTEEEIKDLCTSCGLTNYSSKIQQAFIMFTAQKP  341



>ref|XP_002268107.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Vitis vinifera]
 emb|CBI25579.3| unnamed protein product [Vitis vinifera]
Length=343

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 88/119 (74%), Gaps = 3/119 (3%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVD-  477
            N+ LVRAD+SRLPF++ SVDAVHAGAALHCWPSPS AVAEI+R+LR GG+FV TT++   
Sbjct  225  NLALVRADVSRLPFSTGSVDAVHAGAALHCWPSPSNAVAEITRILRSGGIFVGTTFLRPS  284

Query  476  -GIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  303
             G  S T  +RP R+ + +   ++  L EKE+EDLCT+CGL+ ++    R FIM +A K
Sbjct  285  FGNSSITSILRPFRQ-WERSLQNYNNLTEKEIEDLCTSCGLINYRSKVQRSFIMFSAQK  342



>ref|XP_010050326.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
Length=350

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 87/122 (71%), Gaps = 12/122 (10%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRAD+SRLPF+S SVDAVHAGAALHCWPSPS A+AEISRVLR GGVFV TT++   
Sbjct  237  NLALVRADVSRLPFSSGSVDAVHAGAALHCWPSPSNAIAEISRVLRSGGVFVGTTFL---  293

Query  473  IYSFTP----FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAM  306
               +TP     ++P R+  +Q   ++ FL  +E+EDLCT+CGL  +     + FIM +A 
Sbjct  294  --RYTPSTPWIIQPFRQRASQ---NYSFLTAEEIEDLCTSCGLTNYTSKTQQSFIMFSAQ  348

Query  305  KP  300
            KP
Sbjct  349  KP  350



>ref|XP_006381066.1| methyltransferase-related family protein [Populus trichocarpa]
 gb|ERP58863.1| methyltransferase-related family protein [Populus trichocarpa]
Length=308

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 83/120 (69%), Gaps = 8/120 (7%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRAD+SRLPFAS SVDA+HAGAALHCWPS S AVAEI R LR GGVFV TT++   
Sbjct  195  NLALVRADVSRLPFASGSVDAIHAGAALHCWPSASNAVAEICRALRSGGVFVGTTFLQ--  252

Query  473  IYSFTP--FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
             YS T     RP RE   Q   ++ +  E+E+EDLCTTCGL  +  I  R FIM +A KP
Sbjct  253  -YSSTTSWIERPFRERIMQ---NYNYFTEEEIEDLCTTCGLTNYTRIVQRSFIMFSAQKP  308



>gb|KJB53960.1| hypothetical protein B456_009G013400 [Gossypium raimondii]
Length=300

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 86/119 (72%), Gaps = 6/119 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            NI LVRAD+SRLPF+S S+DAVHAGAALHCWPSPS A+AEISR+LR GGVFV +T++   
Sbjct  187  NIALVRADVSRLPFSSGSIDAVHAGAALHCWPSPSNAIAEISRILRSGGVFVGSTFLR--  244

Query  473  IYSFTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
              S TP+ +RP RE   Q   S+ +L E+E+E++CT  GL  F     R FIM +A KP
Sbjct  245  YTSSTPWIIRPFRERVMQ---SYNYLTEEEIEEVCTNSGLTNFSKKVQRSFIMFSAQKP  300



>ref|XP_008242913.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic, 
partial [Prunus mume]
Length=263

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 86/119 (72%), Gaps = 6/119 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRAD+SRLPF S S+ AVHAGAALHCWPSPS A+AEISR+LR GG+FV TT++   
Sbjct  150  NLALVRADVSRLPFPSGSIGAVHAGAALHCWPSPSNAIAEISRILRSGGIFVGTTFLR--  207

Query  473  IYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
              S TP++ RPLRE   Q    + +L E+E+EDLCT+ GL+ +     + FIM +A KP
Sbjct  208  YTSSTPWILRPLRERALQ---DYSYLTEEEIEDLCTSSGLINYSSKVQQSFIMFSAQKP  263



>ref|XP_007013645.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY31264.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=340

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 87/119 (73%), Gaps = 6/119 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            NI LVRAD+SRLPF+S S+DAVHAGAALHCWPS S AVAEISR+LR GGVFV +T++   
Sbjct  227  NIALVRADVSRLPFSSGSIDAVHAGAALHCWPSTSNAVAEISRILRSGGVFVGSTFLR--  284

Query  473  IYSFTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
              S TP+ VRP RE   Q   ++ +L E+E+ED+CT+CGL  F     + FIM +A KP
Sbjct  285  YSSTTPWIVRPFRERILQ---NYNYLTEEEIEDVCTSCGLTNFTKKVQQSFIMFSAQKP  340



>gb|KEH37884.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=277

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 86/119 (72%), Gaps = 6/119 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRAD+SRLPF S SVDAVHAGAALHCWPSPS AVAEI+RVLR GGVFV TT++   
Sbjct  164  NLALVRADVSRLPFESGSVDAVHAGAALHCWPSPSNAVAEITRVLRSGGVFVGTTFLR--  221

Query  473  IYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
              S T +V R  RE   + S  + +L E+E++DLCT+CGL  + C   + FIM TA KP
Sbjct  222  YTSSTSWVARLFRE---RSSLGYGYLTEEEIKDLCTSCGLTNYSCKIQKSFIMFTAQKP  277



>ref|XP_011020252.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
Length=338

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 83/120 (69%), Gaps = 8/120 (7%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRAD+SRLPFAS SVDA+HAGAALHCWPS S AVAEI R LR GGVFV TT++   
Sbjct  225  NLALVRADVSRLPFASGSVDAIHAGAALHCWPSASNAVAEICRALRSGGVFVGTTFLQ--  282

Query  473  IYSFTP--FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
             YS T     RP RE   Q   ++ +  E+E+EDLCTTCGL  +  I  R FIM +A KP
Sbjct  283  -YSSTTSWIERPFRERIMQ---NYNYFTEEEIEDLCTTCGLTNYTRIVQRSFIMFSAQKP  338



>ref|XP_002324579.2| methyltransferase-related family protein [Populus trichocarpa]
 gb|EEF03144.2| methyltransferase-related family protein [Populus trichocarpa]
Length=332

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 86/119 (72%), Gaps = 6/119 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ L+RAD+SRLPFAS SVDAVHAGAA+HCWPSPS AVAEI RVLR GGVFV TT++   
Sbjct  219  NLGLIRADVSRLPFASGSVDAVHAGAAMHCWPSPSNAVAEICRVLRSGGVFVGTTFLR--  276

Query  473  IYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
              S TP + RP RE   +IS +  F  E+E+EDLC+TCGL  +     + FIM +A KP
Sbjct  277  YSSTTPRIERPFRE---RISRNSNFFTEEEIEDLCSTCGLTNYSKKVQQTFIMFSAQKP  332



>gb|KJB53958.1| hypothetical protein B456_009G013400 [Gossypium raimondii]
Length=343

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 86/119 (72%), Gaps = 6/119 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            NI LVRAD+SRLPF+S S+DAVHAGAALHCWPSPS A+AEISR+LR GGVFV +T++   
Sbjct  230  NIALVRADVSRLPFSSGSIDAVHAGAALHCWPSPSNAIAEISRILRSGGVFVGSTFL--R  287

Query  473  IYSFTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
              S TP+ +RP RE   Q   S+ +L E+E+E++CT  GL  F     R FIM +A KP
Sbjct  288  YTSSTPWIIRPFRERVMQ---SYNYLTEEEIEEVCTNSGLTNFSKKVQRSFIMFSAQKP  343



>ref|XP_004139262.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Cucumis sativus]
Length=338

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 86/120 (72%), Gaps = 4/120 (3%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRADISRLPF+S SVDAVHAGAALHCWPSPS A+AEI+R++R GGVFV TT++ 
Sbjct  223  NSNLALVRADISRLPFSSGSVDAVHAGAALHCWPSPSNAIAEITRIMRSGGVFVGTTFL-  281

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
                S   ++R LRE   Q  G   +L E+E+E+LC +CGL+ +     R FIM +A KP
Sbjct  282  RYTSSTLWYLRFLRERGFQPYG---YLTEEEIEELCKSCGLINYSSKVQRSFIMFSAQKP  338



>ref|XP_009337420.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
 ref|XP_009337422.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=89

 Score =   128 bits (321),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 71/81 (88%), Gaps = 4/81 (5%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             ENIILV+ADISRLPFA+SSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA+TYI+
Sbjct  12   KENIILVKADISRLPFATSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVASTYIL  71

Query  479  DGIYSFTPFVRPLRENFAQIS  417
            DG +S  PF+R    N  Q++
Sbjct  72   DGRFSHIPFLR----NITQVT  88



>ref|XP_009337419.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009337421.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=110

 Score =   128 bits (322),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 77/102 (75%), Gaps = 6/102 (6%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             ENIILV+ADISRLPFA+SSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA+TYI+
Sbjct  12   KENIILVKADISRLPFATSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVASTYIL  71

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL--CTTCG  360
            DG +S  PF+R    N  Q+  S+  L   +  D   C  C 
Sbjct  72   DGRFSHIPFLR----NITQVHLSYSKLSLLQFWDSAECAPCS  109



>ref|XP_004167998.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized methyltransferase 
At2g41040, chloroplastic-like [Cucumis sativus]
Length=338

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 86/121 (71%), Gaps = 6/121 (5%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRADISRLPF+S SVD VHAGAALHCWPSPS A+AEI+R++R GGVFV TT+  
Sbjct  223  NSNLALVRADISRLPFSSGSVDGVHAGAALHCWPSPSNAIAEITRIMRSGGVFVGTTFXR  282

Query  479  DGIYSFTP-FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  303
                S TP ++R LRE   Q  G   +L E+E+E+LC +CGL+ +     R FIM +A K
Sbjct  283  --YTSSTPWYLRFLRERGFQPYG---YLTEEEIEELCKSCGLINYSSKVQRSFIMFSAQK  337

Query  302  P  300
            P
Sbjct  338  P  338



>gb|KHG21340.1| hypothetical protein F383_03824 [Gossypium arboreum]
Length=394

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 86/119 (72%), Gaps = 6/119 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            NI LVRAD+SRLPF+S S+DAVHAGAALHCWPSPS A+AEISR+LR GGVFV +T++   
Sbjct  281  NIALVRADVSRLPFSSGSIDAVHAGAALHCWPSPSNAIAEISRILRSGGVFVGSTFL--R  338

Query  473  IYSFTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
              S TP+ +RP RE   Q   S+ +L E+E+E++CT  GL  F     R FIM +A KP
Sbjct  339  YTSSTPWIIRPFRERVMQ---SYNYLTEEEIEEVCTNSGLTNFSKKVQRSFIMFSAQKP  394



>ref|XP_008336950.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Malus domestica]
Length=324

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 86/120 (72%), Gaps = 6/120 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRAD+SRLPFAS SVDAVHAGAALHCWPSPS AVAEI+R+LR G +FV TT++   
Sbjct  209  NLGLVRADVSRLPFASGSVDAVHAGAALHCWPSPSNAVAEITRILRSGAIFVGTTFLRSS  268

Query  473  IYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  297
             Y  TP++ +P RE       S+ +L E+E+EDLC +CGL  +     + FIM +A KP+
Sbjct  269  PY--TPWIFKPFRE---MSRSSNSYLTEREIEDLCRSCGLTNYSSKVQQSFIMFSARKPA  323



>ref|XP_008456627.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X1 [Cucumis melo]
Length=339

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 88/122 (72%), Gaps = 7/122 (6%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRADISRLPF+S SVDAVHAGAALHCWPSPS A+AEI+R++R GGVFV TT++ 
Sbjct  223  NSNLALVRADISRLPFSSGSVDAVHAGAALHCWPSPSNAIAEITRIMRSGGVFVGTTFLR  282

Query  479  DGIYSFTP-FVRPLRENFA-QISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAM  306
                S TP ++R LRE    Q  G   +L E+E+E+LC +CGL+ +     R FIM +A 
Sbjct  283  --YTSSTPWYLRFLREQRGFQPYG---YLTEEEIEELCKSCGLINYSSKVQRSFIMFSAQ  337

Query  305  KP  300
            KP
Sbjct  338  KP  339



>gb|ACJ84583.1| unknown [Medicago truncatula]
 gb|KEH37883.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=342

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 86/119 (72%), Gaps = 6/119 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRAD+SRLPF S SVDAVHAGAALHCWPSPS AVAEI+RVLR GGVFV TT++   
Sbjct  229  NLALVRADVSRLPFESGSVDAVHAGAALHCWPSPSNAVAEITRVLRSGGVFVGTTFLR--  286

Query  473  IYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
              S T +V R  RE   + S  + +L E+E++DLCT+CGL  + C   + FIM TA KP
Sbjct  287  YTSSTSWVARLFRE---RSSLGYGYLTEEEIKDLCTSCGLTNYSCKIQKSFIMFTAQKP  342



>ref|XP_002268200.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Vitis vinifera]
Length=340

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 85/120 (71%), Gaps = 7/120 (6%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRADISRLPF+S SVDAVHAGAALHCWPSPS AVAEI+R+LR GG+FV TT++   
Sbjct  224  NLALVRADISRLPFSSGSVDAVHAGAALHCWPSPSNAVAEITRILRSGGIFVGTTFL-RP  282

Query  473  IY---SFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  303
            IY   S    +RP R++  Q S    +L EKE+EDLC +C L+ +     + FIM +A K
Sbjct  283  IYTNSSIPAILRPFRQSILQTSN---YLTEKEIEDLCRSCALINYTSTIQQSFIMFSAQK  339



>emb|CBI25578.3| unnamed protein product [Vitis vinifera]
Length=338

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 85/120 (71%), Gaps = 7/120 (6%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRADISRLPF+S SVDAVHAGAALHCWPSPS AVAEI+R+LR GG+FV TT++   
Sbjct  222  NLALVRADISRLPFSSGSVDAVHAGAALHCWPSPSNAVAEITRILRSGGIFVGTTFL-RP  280

Query  473  IY---SFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  303
            IY   S    +RP R++  Q S    +L EKE+EDLC +C L+ +     + FIM +A K
Sbjct  281  IYTNSSIPAILRPFRQSILQTSN---YLTEKEIEDLCRSCALINYTSTIQQSFIMFSAQK  337



>ref|XP_010656529.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Vitis vinifera]
Length=343

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 85/120 (71%), Gaps = 7/120 (6%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRADISRLPF+S SVDAVHAGAALHCWPSPS AVAEI+R+LR GG+FV TT++   
Sbjct  227  NLALVRADISRLPFSSGSVDAVHAGAALHCWPSPSNAVAEITRILRSGGIFVGTTFL-RP  285

Query  473  IY---SFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  303
            IY   S    +RP R++  Q S    +L EKE+EDLC +C L+ +     + FIM +A K
Sbjct  286  IYTNSSIPAILRPFRQSILQTSN---YLTEKEIEDLCRSCALINYTSTIQQSFIMFSAQK  342



>ref|XP_002531454.1| phosphatidylethanolamine n-methyltransferase, putative [Ricinus 
communis]
 gb|EEF30941.1| phosphatidylethanolamine n-methyltransferase, putative [Ricinus 
communis]
Length=290

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 84/120 (70%), Gaps = 4/120 (3%)
 Frame = -2

Query  656  ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVD  477
            +++ LVRAD+SRLPF+S SVDAVHAGAALHCWPSPS A+AEI R LR GGVFV TT++  
Sbjct  174  KDLALVRADVSRLPFSSGSVDAVHAGAALHCWPSPSNAIAEICRTLRSGGVFVGTTFLRY  233

Query  476  GIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  297
               S +   R  RE   +I   + +  E+E+EDLCT+CGL  ++    R FIM TA KPS
Sbjct  234  NATS-SWIERSFRE---RIMSGYNYYTEEEIEDLCTSCGLTNYQSKVQRSFIMFTAEKPS  289



>gb|EMT14235.1| Putative methyltransferase [Aegilops tauschii]
Length=465

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 82/108 (76%), Gaps = 5/108 (5%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRADISRLPFAS S+DA+HAGAA+HCWPSPS A+AEISRVL+PGGVFVATT++ 
Sbjct  209  NTNLALVRADISRLPFASCSIDAIHAGAAIHCWPSPSNAIAEISRVLKPGGVFVATTFLS  268

Query  479  DGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGF  348
                S  PF    +RPLR+    ++ S+ F  E ELEDLC +CGLV +
Sbjct  269  TPTNS-GPFSIDALRPLRQIVGPVNSSYNFFTEGELEDLCRSCGLVNY  315



>gb|AFK46366.1| unknown [Medicago truncatula]
Length=342

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 85/119 (71%), Gaps = 6/119 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRAD+SRLPF S SVDAVHAGAALHCWPSPS AVAEI+RVLR GGVFV TT+    
Sbjct  229  NLALVRADVSRLPFESGSVDAVHAGAALHCWPSPSNAVAEITRVLRSGGVFVGTTFFR--  286

Query  473  IYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
              S T +V R  RE   + S  + +L E+E++DLCT+CGL  + C   + FIM TA KP
Sbjct  287  YTSSTSWVARLFRE---RSSLGYGYLTEEEIKDLCTSCGLTNYSCKIQKSFIMFTAQKP  342



>ref|XP_007202300.1| hypothetical protein PRUPE_ppa007882mg [Prunus persica]
 gb|EMJ03499.1| hypothetical protein PRUPE_ppa007882mg [Prunus persica]
Length=352

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 87/119 (73%), Gaps = 6/119 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRAD+SRLPF S SV AVHAGAALHCWPSPS A+AEISR+LR GG+FV TT++   
Sbjct  239  NLALVRADVSRLPFPSGSVGAVHAGAALHCWPSPSNAIAEISRILRTGGIFVGTTFLR--  296

Query  473  IYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
              S TP++ RPLRE   Q   ++ +L E+E+EDLCT+ GL+ +     + FIM +A KP
Sbjct  297  YTSSTPWILRPLRERALQ---NYSYLTEEEIEDLCTSSGLINYSSKVQQSFIMFSAQKP  352



>ref|XP_002988667.1| hypothetical protein SELMODRAFT_46133, partial [Selaginella moellendorffii]
 gb|EFJ10178.1| hypothetical protein SELMODRAFT_46133, partial [Selaginella moellendorffii]
Length=269

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 82/117 (70%), Gaps = 9/117 (8%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            +I LVRAD+ RLPFAS +V A+HAGAALHCWPSPS+AVAEI RVL+PGGVFVATT++ + 
Sbjct  162  DIALVRADVIRLPFASGTVSAIHAGAALHCWPSPSSAVAEICRVLKPGGVFVATTFLSNS  221

Query  473  IYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  303
            I+ F P  R         S S  +  EKELE+LC  CGLV ++      FIMLTA K
Sbjct  222  IFPFLPQRR---------SSSLRYWTEKELEELCKLCGLVDYQKKIKGNFIMLTARK  269



>gb|KGN60753.1| hypothetical protein Csa_2G009410 [Cucumis sativus]
Length=339

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 86/121 (71%), Gaps = 5/121 (4%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRADISRLPF+S SVDAVHAGAALHCWPSPS A+AEI+R++R GGVFV TT++ 
Sbjct  223  NSNLALVRADISRLPFSSGSVDAVHAGAALHCWPSPSNAIAEITRIMRSGGVFVGTTFL-  281

Query  479  DGIYSFTPFVRPLRENFA-QISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  303
                S   ++R LRE    Q  G   +L E+E+E+LC +CGL+ +     R FIM +A K
Sbjct  282  RYTSSTLWYLRFLREQRGFQPYG---YLTEEEIEELCKSCGLINYSSKVQRSFIMFSAQK  338

Query  302  P  300
            P
Sbjct  339  P  339



>ref|XP_008344066.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
Length=327

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 85/124 (69%), Gaps = 12/124 (10%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            + N+ LVRAD++RLPF S SVDAVHAGAALHCWPSPS A+AEI+R+LR GGVFV TT++ 
Sbjct  212  DTNLALVRADVARLPFPSGSVDAVHAGAALHCWPSPSNAIAEITRILRSGGVFVGTTFL-  270

Query  479  DGIYSFTP----FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLT  312
                 +TP      R LRE+  Q    + +L E+E+EDLC +CGL  +     + FIM +
Sbjct  271  ----RYTPSTPWITRQLRESALQ---GYNYLTEEEIEDLCASCGLTNYTSNVQQAFIMFS  323

Query  311  AMKP  300
            A KP
Sbjct  324  AQKP  327



>gb|KJB27062.1| hypothetical protein B456_004G275300 [Gossypium raimondii]
Length=337

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 85/119 (71%), Gaps = 6/119 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            NI LVRAD+SRLPF+S SVDAVHAGAALHCWPSP  AVAEISR+LR GGVFV +T++   
Sbjct  224  NIALVRADVSRLPFSSGSVDAVHAGAALHCWPSPLNAVAEISRILRSGGVFVGSTFL--R  281

Query  473  IYSFTP-FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
              S TP  +RP RE   Q   ++ +L E+E+E LCT+CGL  +     + FIM +A KP
Sbjct  282  YTSSTPRIIRPFRERILQ---NYSYLTEEEIEALCTSCGLTNYTRNIQQSFIMFSAQKP  337



>ref|XP_010047200.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW79025.1| hypothetical protein EUGRSUZ_C00449 [Eucalyptus grandis]
Length=336

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 86/122 (70%), Gaps = 12/122 (10%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRAD+SRLPF+S SVDAVHAGAALHCWPSPS A+AEI+RVLR GGVFV TT++   
Sbjct  223  NLALVRADVSRLPFSSCSVDAVHAGAALHCWPSPSNAIAEITRVLRSGGVFVGTTFL---  279

Query  473  IYSFTP----FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAM  306
               +TP     + P R+  AQ   ++ +L  +E+EDLCT+CGL  +     + FIM +A 
Sbjct  280  --RYTPSTPWIILPFRQRTAQ---NYSYLTAEEIEDLCTSCGLTNYTRKIQQSFIMFSAQ  334

Query  305  KP  300
            KP
Sbjct  335  KP  336



>ref|XP_009338403.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=345

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 86/124 (69%), Gaps = 12/124 (10%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            + N+ LVRAD++RLPF+S SVDAVHAGAALHCWPSPS A+AEI+R+LR GGVFV TT++ 
Sbjct  230  DTNLALVRADVARLPFSSGSVDAVHAGAALHCWPSPSNAIAEITRILRSGGVFVGTTFL-  288

Query  479  DGIYSFTPFV----RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLT  312
                 +TP      R LRE   Q   S+ +L E+E+ DLCT+CGL  +     + FIM +
Sbjct  289  ----RYTPSTSWIPRQLRERARQ---SYNYLTEEEIADLCTSCGLTNYTSNVQQSFIMFS  341

Query  311  AMKP  300
            A KP
Sbjct  342  AQKP  345



>ref|XP_010687777.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=339

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 89/121 (74%), Gaps = 6/121 (5%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            + N+ LVRAD++RLPF S+S+DAVHAGAALHCWPSPS+A+A+I+RVLR GGVFV TT++ 
Sbjct  224  SNNLALVRADVARLPFPSASIDAVHAGAALHCWPSPSSAIADITRVLRSGGVFVGTTFLR  283

Query  479  DGIYSFTP-FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  303
                + TP  +RPLRE   Q   ++ +L E+E+E LC +CGLV +     + FIM +A K
Sbjct  284  --YTASTPSLLRPLRERILQ---TYSYLIEEEIEALCKSCGLVDYSSKVQQSFIMFSARK  338

Query  302  P  300
            P
Sbjct  339  P  339



>ref|XP_009358530.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Pyrus x bretschneideri]
Length=345

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 86/124 (69%), Gaps = 12/124 (10%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            + N+ LVRAD++RLPF+S SVDAVHAGAALHCWPSPS A+AEI+R+LR GGVFV TT++ 
Sbjct  230  DTNLALVRADVARLPFSSGSVDAVHAGAALHCWPSPSNAIAEITRILRSGGVFVGTTFL-  288

Query  479  DGIYSFTPFV----RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLT  312
                 +TP      R LRE   Q   S+ +L E+E+ DLCT+CGL  +     + FIM +
Sbjct  289  ----RYTPSTSWIPRQLRERARQ---SYNYLTEEEIADLCTSCGLTNYTSNVQQSFIMFS  341

Query  311  AMKP  300
            A KP
Sbjct  342  AQKP  345



>ref|XP_008348560.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Malus domestica]
Length=433

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN+ILVRADISRLPFA+ SVDAVHAGAA+HCWPSPS AVAEISRVLRPGGVFVA+TYI+
Sbjct  235  KENMILVRADISRLPFATGSVDAVHAGAAIHCWPSPSTAVAEISRVLRPGGVFVASTYIL  294

Query  479  DGIYSFTPFVRPLRENFAQISGSH  408
            DG +S  PF+R + +   QI+GS 
Sbjct  295  DGPFSLIPFLRNITQRTKQIAGSE  318



>ref|XP_002986403.1| hypothetical protein SELMODRAFT_235009 [Selaginella moellendorffii]
 gb|EFJ12612.1| hypothetical protein SELMODRAFT_235009 [Selaginella moellendorffii]
Length=340

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 82/117 (70%), Gaps = 9/117 (8%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            +I LVRAD+ RLPFAS +V A+HAGAALHCWPSPS+AVAEI RVL+PGGVFVATT++ + 
Sbjct  232  DIALVRADVIRLPFASGTVSAIHAGAALHCWPSPSSAVAEICRVLKPGGVFVATTFLSNS  291

Query  473  IYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  303
            I+ F P  R         S S  +  EKELE+LC  CGLV ++      FIMLTA K
Sbjct  292  IFPFLPQRR---------SSSLRYWTEKELEELCKLCGLVDYQKKIKGNFIMLTARK  339



>ref|XP_006411367.1| hypothetical protein EUTSA_v10016844mg [Eutrema salsugineum]
 gb|ESQ52820.1| hypothetical protein EUTSA_v10016844mg [Eutrema salsugineum]
Length=363

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 87/120 (73%), Gaps = 8/120 (7%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            NI +VRAD+SRLPF SSSVDAVHAGAALHCWPSP+ A+AEI RVLR GGVFV TT++   
Sbjct  250  NIAVVRADVSRLPFPSSSVDAVHAGAALHCWPSPTNAIAEICRVLRSGGVFVGTTFLR--  307

Query  473  IYS-FTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
             YS  TP+ +RP +E   Q   S+ +L + E++D+CT+CGL  +  +    FIM TA KP
Sbjct  308  -YSPSTPWIIRPFQERILQ---SYNYLMQDEIKDVCTSCGLTDYADVVQDSFIMFTARKP  363



>emb|CDY06948.1| BnaA04g23670D [Brassica napus]
Length=800

 Score =   134 bits (337),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 69/120 (58%), Positives = 87/120 (73%), Gaps = 8/120 (7%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            NI +VRAD+SRLPFAS SVDAVHAGAALHCWPSP+ A+AEI RVLR GGVFV TT++   
Sbjct  687  NIAVVRADVSRLPFASGSVDAVHAGAALHCWPSPTNAIAEICRVLRSGGVFVGTTFLR--  744

Query  473  IYS-FTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
             YS  TP+ +RP +    Q   ++ +L + E++D+CTTCGL  ++ I    FIM TA KP
Sbjct  745  -YSPSTPWIIRPFQSRILQ---NYNYLMQDEIKDVCTTCGLTDYEDIVQDSFIMFTARKP  800



>ref|XP_009141962.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Brassica rapa]
Length=355

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 87/120 (73%), Gaps = 8/120 (7%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            NI +VRAD+SRLPFAS SVDAVHAGAALHCWPSP+ A+AEI RVLR GGVFV TT++   
Sbjct  242  NIAVVRADVSRLPFASGSVDAVHAGAALHCWPSPTNAIAEICRVLRSGGVFVGTTFLR--  299

Query  473  IYS-FTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
             YS  TP+ +RP +    Q   ++ +L + E++D+CTTCGL  ++ I    FIM TA KP
Sbjct  300  -YSPSTPWIIRPFQSRILQ---NYNYLMQDEIKDVCTTCGLTDYEDIVQDSFIMFTARKP  355



>gb|KHG26587.1| hypothetical protein F383_01046 [Gossypium arboreum]
Length=337

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 85/119 (71%), Gaps = 6/119 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRAD+SRLPF+S S+DAVHAGAALHCWPSP  AVAEISR+LR GGVFV +T++   
Sbjct  224  NMALVRADVSRLPFSSGSIDAVHAGAALHCWPSPLNAVAEISRILRSGGVFVGSTFLR--  281

Query  473  IYSFTP-FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
              S TP  +RP RE   Q   ++ +L E+E+E LCT+CGL  +     + FIM +A KP
Sbjct  282  YTSSTPRIIRPFRERVLQ---NYSYLTEEEIEALCTSCGLANYTRKIQQSFIMFSAQKP  337



>ref|XP_006453728.1| hypothetical protein CICLE_v10008875mg [Citrus clementina]
 gb|ESR66968.1| hypothetical protein CICLE_v10008875mg [Citrus clementina]
Length=333

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 82/119 (69%), Gaps = 6/119 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI-VD  477
            N+ LVRAD+ RLPFAS  VDAVHAGAALHCWPSPS AVAEISR+LR GGVFV TT++   
Sbjct  220  NLALVRADVCRLPFASGFVDAVHAGAALHCWPSPSNAVAEISRILRSGGVFVGTTFLRYT  279

Query  476  GIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
               S T   R LRE   Q   ++ +L E+E+EDLCT+CGL  +     + FIM  A KP
Sbjct  280  SSTSLTG--RVLRERILQ---NYNYLTEEEIEDLCTSCGLTNYTSKVQQSFIMFAAQKP  333



>gb|KDO59312.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=328

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 82/119 (69%), Gaps = 6/119 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI-VD  477
            N+ LVRAD+ RLPFAS  VDAVHAGAALHCWPSPS AVAEISR+LR GGVFV TT++   
Sbjct  215  NLALVRADVCRLPFASGFVDAVHAGAALHCWPSPSNAVAEISRILRSGGVFVGTTFLRYT  274

Query  476  GIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
               S T   R LRE   Q   ++ +L E+E+EDLCT+CGL  +     + FIM  A KP
Sbjct  275  SSTSLTG--RVLRERILQ---NYNYLTEEEIEDLCTSCGLTNYTSKVQQSFIMFAAQKP  328



>gb|KDO59313.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
 gb|KDO59314.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=333

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 82/119 (69%), Gaps = 6/119 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI-VD  477
            N+ LVRAD+ RLPFAS  VDAVHAGAALHCWPSPS AVAEISR+LR GGVFV TT++   
Sbjct  220  NLALVRADVCRLPFASGFVDAVHAGAALHCWPSPSNAVAEISRILRSGGVFVGTTFLRYT  279

Query  476  GIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
               S T   R LRE   Q   ++ +L E+E+EDLCT+CGL  +     + FIM  A KP
Sbjct  280  SSTSLTG--RVLRERILQ---NYNYLTEEEIEDLCTSCGLTNYTSKVQQSFIMFAAQKP  333



>ref|XP_009338401.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=350

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 87/126 (69%), Gaps = 11/126 (9%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            + N+ LVRAD++RLPF+S SVDAVHAGAALHCWPSPS A+AEI+R+LR GGVFV TT++ 
Sbjct  230  DTNLALVRADVARLPFSSGSVDAVHAGAALHCWPSPSNAIAEITRILRSGGVFVGTTFL-  288

Query  479  DGIYSFTPFV----RPLRE--NFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIM  318
                 +TP      R LRE   + +   S+ +L E+E+ DLCT+CGL  +     + FIM
Sbjct  289  ----RYTPSTSWIPRQLREVLMWQRARQSYNYLTEEEIADLCTSCGLTNYTSNVQQSFIM  344

Query  317  LTAMKP  300
             +A KP
Sbjct  345  FSAQKP  350



>ref|XP_006473930.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Citrus sinensis]
Length=333

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 83/119 (70%), Gaps = 6/119 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRAD+ RLPFAS  VDAVHAGAALHCWPSPS AVAEISR+L+ GGVFV TT++   
Sbjct  220  NLALVRADVCRLPFASGFVDAVHAGAALHCWPSPSNAVAEISRILQSGGVFVGTTFLR--  277

Query  473  IYSFTPFV-RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
              S T  + R LRE   Q   ++ +L E+E+EDLCT+CGL  +     + FIM  A KP
Sbjct  278  YTSSTSLIGRVLRERILQ---NYNYLTEEEIEDLCTSCGLTNYTSKVQQSFIMFAAQKP  333



>ref|XP_010533098.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Tarenaya hassleriana]
Length=345

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 83/119 (70%), Gaps = 6/119 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRAD+SRLPF S SVDAVHAGAALHCWPSP+ A+AEISRVLR GGVFV TT++   
Sbjct  232  NLALVRADVSRLPFPSGSVDAVHAGAALHCWPSPTNAIAEISRVLRSGGVFVGTTFL--R  289

Query  473  IYSFTP-FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
              + TP F+RP RE   Q   ++ +L   E++D+CT+CGL  +       FIM  A KP
Sbjct  290  YNASTPWFIRPFRERILQ---NYNYLLRDEIKDVCTSCGLTNYSDDVRSSFIMFAAQKP  345



>emb|CDY57579.1| BnaC04g56820D [Brassica napus]
Length=353

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 86/120 (72%), Gaps = 8/120 (7%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            NI +VRAD+SRLPF S SVDAVHAGAALHCWPSP+ A+AEI RVLR GGVFV TT++   
Sbjct  240  NIAVVRADVSRLPFPSGSVDAVHAGAALHCWPSPTNAIAEICRVLRSGGVFVGTTFLR--  297

Query  473  IYS-FTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
             YS  TP+ +RP +    Q   ++ +L + E++D+CTTCGL  ++ I    FIM TA KP
Sbjct  298  -YSPSTPWIIRPFQSRILQ---NYNYLMQDEIKDVCTTCGLTDYEDIVQDSFIMFTARKP  353



>ref|XP_009602551.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Nicotiana tomentosiformis]
Length=181

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 83/120 (69%), Gaps = 4/120 (3%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            + N+ LVRAD+SRLPF S S+DAVHAGAALHCWPSPS A+AEI+RVLR GGVFV TT++ 
Sbjct  66   SSNLALVRADVSRLPFFSGSIDAVHAGAALHCWPSPSNAIAEINRVLRSGGVFVGTTFLR  125

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
                + T F R L ++  +   ++ +   +E+EDL TTCGL+ +       FIM +A KP
Sbjct  126  VNPSAPTIF-RALEQSAGR---TYSYFTREEIEDLVTTCGLINYTSKVQNSFIMFSAQKP  181



>ref|XP_008374562.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X3 [Malus domestica]
Length=334

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN ILVRADISRLPFA+SSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA+TYI+
Sbjct  235  KENXILVRADISRLPFATSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVASTYIL  294

Query  479  DGIYSFTPFVR  447
            DG +S  PF+R
Sbjct  295  DGRFSLIPFLR  305



>ref|XP_004287239.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=289

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 83/118 (70%), Gaps = 6/118 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            +++LVRAD SRLPF S SVDAVHAGAALHCWPSPS AVAEI+RVLR GG+FV TT++   
Sbjct  178  DLVLVRADASRLPFTSCSVDAVHAGAALHCWPSPSNAVAEITRVLRSGGIFVGTTFLRS-  236

Query  473  IYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
              S +   +PL E   +I  S  +  E+E+EDLCT+CGL  +     + FI+ +A KP
Sbjct  237  --SPSWIFKPLNE---RILPSGNYFTEEEIEDLCTSCGLTNYTSKVEQSFIIFSAKKP  289



>ref|XP_009802104.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Nicotiana sylvestris]
Length=345

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 84/120 (70%), Gaps = 4/120 (3%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            + N+ LVRAD+SRLPF S S+DAVHAGAALHCWPSPS A+AEI+R+LR GGVFV TT++ 
Sbjct  230  SSNLALVRADVSRLPFFSGSIDAVHAGAALHCWPSPSNAIAEINRILRSGGVFVGTTFLR  289

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
                + T F R L +N  +   ++ +  ++E+EDL TTCGL+ +       FIM +A KP
Sbjct  290  VNPSAPTIF-RALEQNVGR---TYSYFTQEEIEDLVTTCGLINYTSKVQNSFIMFSAQKP  345



>ref|XP_006852799.1| hypothetical protein AMTR_s00033p00159870 [Amborella trichopoda]
 gb|ERN14266.1| hypothetical protein AMTR_s00033p00159870 [Amborella trichopoda]
Length=343

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 76/102 (75%), Gaps = 2/102 (2%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N N+ LVRAD+SRLPF S SVDAVHAGAALHCWPSPS AVAEI R+LRPGGVFVATT++ 
Sbjct  204  NANLALVRADVSRLPFPSCSVDAVHAGAALHCWPSPSNAVAEICRILRPGGVFVATTFLS  263

Query  479  DGIYSFTP--FVRPLRENFAQISGSHIFLDEKELEDLCTTCG  360
                 + P   +RPLR+    ++ ++ +L EKE+EDLC   G
Sbjct  264  SVFSDYLPSDVLRPLRQAVQPLANTYSYLTEKEIEDLCLEPG  305



>ref|NP_181637.2| uncharacterized methyltransferase [Arabidopsis thaliana]
 sp|Q0WPT7.1|Y2104_ARATH RecName: Full=Uncharacterized methyltransferase At2g41040, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAF00862.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09918.1| uncharacterized methyltransferase [Arabidopsis thaliana]
Length=352

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 85/120 (71%), Gaps = 8/120 (7%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            NI +VRAD+SRLPF S SVDAVHAGAALHCWPSP+ A+AEI RVLR GGVFV TT++   
Sbjct  239  NIAVVRADVSRLPFPSGSVDAVHAGAALHCWPSPTNAIAEICRVLRSGGVFVGTTFLR--  296

Query  473  IYS-FTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
             YS  TP+ +RP +    Q   S+ +L + E++D+CT+CGL  ++      FIM TA KP
Sbjct  297  -YSPSTPWIIRPFQSRILQ---SYNYLMQDEIKDVCTSCGLTDYEDYIQDSFIMFTARKP  352



>ref|XP_002879904.1| hypothetical protein ARALYDRAFT_903411 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56163.1| hypothetical protein ARALYDRAFT_903411 [Arabidopsis lyrata subsp. 
lyrata]
Length=350

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 85/120 (71%), Gaps = 8/120 (7%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            NI +VRAD+SRLPF S SVDAVHAGAALHCWPSP+ A+AEI RVLR GGVFV TT++   
Sbjct  237  NIAVVRADVSRLPFPSGSVDAVHAGAALHCWPSPTNAIAEICRVLRSGGVFVGTTFLR--  294

Query  473  IYS-FTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
             YS  TP+ +RP +    Q   S+ +L + E++D+CT+CGL  ++      FIM TA KP
Sbjct  295  -YSPSTPWIIRPFQSRILQ---SYNYLMQDEIKDVCTSCGLTDYEDYIQDSFIMFTARKP  350



>ref|XP_010517586.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Camelina sativa]
Length=355

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 85/120 (71%), Gaps = 8/120 (7%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            NI +VRAD+SRLPF S SVDAVHAGAALHCWPSP+ A+AEI RVLR GGVFV TT++   
Sbjct  242  NIAVVRADVSRLPFPSGSVDAVHAGAALHCWPSPTNAIAEICRVLRSGGVFVGTTFLR--  299

Query  473  IYS-FTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
             YS  TP+ +RP +    Q   S+ +L + E++D+CT+CGL  ++      FIM TA KP
Sbjct  300  -YSPSTPWIIRPFQSRILQ---SYNYLMQDEIKDVCTSCGLTDYEDYIQDSFIMFTARKP  355



>ref|XP_010508773.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Camelina sativa]
Length=356

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 85/120 (71%), Gaps = 8/120 (7%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            NI +VRAD+SRLPF S SVDAVHAGAALHCWPSP+ A+AEI RVLR GGVFV TT++   
Sbjct  243  NIAVVRADVSRLPFPSGSVDAVHAGAALHCWPSPTNAIAEICRVLRSGGVFVGTTFLR--  300

Query  473  IYS-FTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
             YS  TP+ +RP +    Q   S+ +L + E++D+CT+CGL  ++      FIM TA KP
Sbjct  301  -YSPSTPWIIRPFQSRILQ---SYNYLMQDEIKDVCTSCGLTDYEDYIQDSFIMFTARKP  356



>ref|XP_010505866.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Camelina sativa]
Length=355

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 85/120 (71%), Gaps = 8/120 (7%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            NI +VRAD+SRLPF S S+DAVHAGAALHCWPSP+ A+AEI RVLR GGVFV TT++   
Sbjct  242  NIAVVRADVSRLPFPSGSIDAVHAGAALHCWPSPTNAIAEICRVLRSGGVFVGTTFLR--  299

Query  473  IYS-FTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
             YS  TP+ +RP +    Q   S+ +L + E++D+CT+CGL  ++      FIM TA KP
Sbjct  300  -YSPSTPWIIRPFQSRILQ---SYNYLMQDEIKDVCTSCGLTDYEDYVQDSFIMFTARKP  355



>ref|XP_001778776.1| predicted protein [Physcomitrella patens]
 gb|EDQ56362.1| predicted protein [Physcomitrella patens]
Length=309

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 87/120 (73%), Gaps = 3/120 (3%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N NI LVRAD++RLPFA+ S+DAVHAGAALHCWPSP+A +AEI+R+L+PGGVFVATT++ 
Sbjct  189  NSNIALVRADVARLPFATGSIDAVHAGAALHCWPSPAAGMAEIARILKPGGVFVATTFLT  248

Query  479  D-GIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  303
               I  F    + +R+  A  S +  + DE ELE+L   CGLV +  +R  +FIM++A +
Sbjct  249  PLPIIDFGN--KDIRKVGAISSSTLRYWDEAELEELMGVCGLVEYTRVRLNQFIMVSAKR  306



>ref|XP_008336951.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
 ref|XP_008336952.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
Length=348

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 83/124 (67%), Gaps = 12/124 (10%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            + N+ LVRAD++RLPF S SVDAVHAGAALHCWPSPS A+AEI+R+LR G VFV TT++ 
Sbjct  233  DTNLALVRADVARLPFPSGSVDAVHAGAALHCWPSPSNAIAEITRILRSGAVFVGTTFL-  291

Query  479  DGIYSFTPFV----RPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLT  312
                 +TP      R L E   Q   S+ +L E+E+ DLCT+CGL  +     + FIM +
Sbjct  292  ----RYTPSTSWIPRQLXERARQ---SYNYLTEEEIADLCTSCGLTNYTSNVQQSFIMFS  344

Query  311  AMKP  300
            A KP
Sbjct  345  AQKP  348



>gb|KFK36957.1| hypothetical protein AALP_AA4G194500 [Arabis alpina]
Length=343

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 84/120 (70%), Gaps = 8/120 (7%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            NI +VRAD+SRLPF S SVDAVHAGAALHCWPSP+ A+AEI RVLR GGVFV TT++   
Sbjct  230  NIAVVRADVSRLPFPSGSVDAVHAGAALHCWPSPTNAIAEICRVLRSGGVFVGTTFLR--  287

Query  473  IYS-FTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
             YS  TP+ ++P +    Q   ++ +L + E++D+CT CGL  +  I    FIM TA KP
Sbjct  288  -YSPTTPWIIKPFQSRILQ---NYNYLMQDEIKDVCTACGLTDYADIVKDSFIMFTARKP  343



>ref|XP_009363912.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Pyrus x bretschneideri]
Length=344

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 82/124 (66%), Gaps = 12/124 (10%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            + N+ LVRAD++RLPF S SVDAVHAGAALHCWPSPS A+AEI+R+LR GGV V TT++ 
Sbjct  229  DTNLALVRADVARLPFPSGSVDAVHAGAALHCWPSPSNAIAEITRILRSGGVLVGTTFL-  287

Query  479  DGIYSFTP----FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLT  312
                 +TP      R LR    Q    + +L E+E+EDLC +CGL  +     + FIM +
Sbjct  288  ----RYTPSTPWITRQLRGRALQ---GYNYLTEEEIEDLCASCGLTNYTSNVQQAFIMFS  340

Query  311  AMKP  300
            A KP
Sbjct  341  AQKP  344



>ref|XP_006293382.1| hypothetical protein CARUB_v10023510mg [Capsella rubella]
 gb|EOA26280.1| hypothetical protein CARUB_v10023510mg [Capsella rubella]
Length=356

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 85/120 (71%), Gaps = 8/120 (7%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            NI +VRAD++RLPF S SVDAVHAGAALHCWPSP+ A+AEI RVLR GGVFV TT++   
Sbjct  243  NIAVVRADVARLPFPSGSVDAVHAGAALHCWPSPTNAIAEICRVLRSGGVFVGTTFLR--  300

Query  473  IYS-FTPF-VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
             YS  TP+ +RP +    Q   S+ +L + E++D+CT+CGL  ++      FIM TA KP
Sbjct  301  -YSPSTPWIIRPFQSRILQ---SYNYLMQDEIKDVCTSCGLTDYEEYIKDSFIMFTARKP  356



>ref|XP_006359517.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Solanum tuberosum]
Length=345

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 84/119 (71%), Gaps = 4/119 (3%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            + N+ LVRAD+SRLPF S SVDAVHAGAALHCWPSPS A+AEI+R+LR GG+FV TT++ 
Sbjct  230  SSNLALVRADVSRLPFFSGSVDAVHAGAALHCWPSPSNAIAEINRILRSGGIFVGTTFLR  289

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  303
                S  P +R L+++  +   ++ F  ++E+EDL TTCGL+ +       FIM +A K
Sbjct  290  VNP-SAPPILRALQQSATR---TYSFFTQEEIEDLVTTCGLINYTSKVQGGFIMFSAQK  344



>gb|KDO80933.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=362

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN +LVRADISRLPFASSS+DAVHAGAA+HCW SPS  VAEISRVLRPGGVFV TTYIV
Sbjct  229  KENFLLVRADISRLPFASSSIDAVHAGAAIHCWSSPSTGVAEISRVLRPGGVFVGTTYIV  288

Query  479  DGIYSFTPFVRPLRE  435
            DG ++  PF R LR+
Sbjct  289  DGPFNLIPFSRLLRQ  303



>gb|EEC83568.1| hypothetical protein OsI_29220 [Oryza sativa Indica Group]
Length=352

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
             + LVRADISRLPF S S+DAVHA AA+HCWPSP+ AVAEISRVLRPGGVFVA+T++ D 
Sbjct  253  TLALVRADISRLPFVSGSIDAVHAAAAIHCWPSPACAVAEISRVLRPGGVFVASTFVADI  312

Query  473  IYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  375
            +    P +R  R   +Q +GS+IFL E E EDL
Sbjct  313  LPPAVPVLRIGRPYISQFTGSNIFLSEAEFEDL  345



>ref|XP_004242719.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Solanum lycopersicum]
Length=341

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 82/119 (69%), Gaps = 4/119 (3%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            + N+ LVRAD+SRLPF S SVDAVHAGAALHCWPSPS A+AEI+R+LR GGVFV TT++ 
Sbjct  226  SSNLALVRADVSRLPFFSGSVDAVHAGAALHCWPSPSNAIAEINRILRSGGVFVGTTFLR  285

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  303
                S  P  R L+++  +   ++ F   +E+EDL TTCGL+ +       FI+ +A K
Sbjct  286  VNP-STPPIFRALQQSATR---TYSFFTREEIEDLVTTCGLINYTSKVQGGFIIFSAQK  340



>ref|XP_004242718.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Solanum lycopersicum]
Length=339

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 82/117 (70%), Gaps = 4/117 (3%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRAD+SRLPF S S+DAVHAGAALHCWPSPS A+AEI+R+LR GGVFV TT++   
Sbjct  226  NLALVRADVSRLPFPSGSIDAVHAGAALHCWPSPSNAIAEINRILRSGGVFVGTTFLRVN  285

Query  473  IYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  303
              + T F R L ++  +   ++ +  ++E+EDL T+CGL+ +       FIM +A K
Sbjct  286  PSAPTIF-RALEQSALR---TYSYFTQEEIEDLVTSCGLINYTSKVQSSFIMFSAQK  338



>ref|XP_003056709.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58354.1| predicted protein [Micromonas pusilla CCMP1545]
Length=384

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 82/128 (64%), Gaps = 11/128 (9%)
 Frame = -2

Query  650  IILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTY-----  486
            +  VRAD+ RLPFA+ S DAVHAGAA+HCWPSPSAAVAEISRVLRPGGVF+A+T+     
Sbjct  252  LSFVRADVGRLPFATGSFDAVHAGAAMHCWPSPSAAVAEISRVLRPGGVFIASTFLDPTS  311

Query  485  -IVDGIYS---FTPFVRPLRENFAQISGS-HIFLDEKELEDLCT-TCGLVGFKCIRNRRF  324
             + D + S     P     RE+     G+ + F  EKEL DL T  CGL  F+  R R+F
Sbjct  312  MLGDALGSDEMVQPLSAAFRESGLGTGGAFNQFWSEKELRDLTTGMCGLERFERKRERQF  371

Query  323  IMLTAMKP  300
            I  +  KP
Sbjct  372  IFFSVRKP  379



>ref|XP_009394966.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=312

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  656  ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVD  477
            EN+ILVRADISRLPF SSSVDAVHAGAA+HCWPSPSA VAEISRVLRPGGVFVATT+I+D
Sbjct  236  ENLILVRADISRLPFVSSSVDAVHAGAAIHCWPSPSAGVAEISRVLRPGGVFVATTFILD  295

Query  476  GIYSFTPFVRPLRE  435
             +    P ++ +R+
Sbjct  296  VLPPVIPILKTVRQ  309



>gb|KIY98469.1| putative methyltransferase [Monoraphidium neglectum]
Length=249

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 82/131 (63%), Gaps = 18/131 (14%)
 Frame = -2

Query  650  IILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGI  471
            I+ VRADI+RLPFA+ SVDA+HAGAA+HCWP+P AA+AEISRVLRPGGVFVA+T++    
Sbjct  53   IVCVRADIARLPFATGSVDAIHAGAAIHCWPNPQAALAEISRVLRPGGVFVASTFLT---  109

Query  470  YSFTPF--------VRPLRENFAQI------SGSHIFLDEKELEDLCTTCGLVGFKCIRN  333
              F P         VRP+ +   +       + ++   ++ EL +L    GL    C+R 
Sbjct  110  -PFAPIGELLGDDTVRPISQALERTPWARGRAATYRQWEQAELRELAGQVGLAWRGCVRA  168

Query  332  RRFIMLTAMKP  300
             RFI+  A KP
Sbjct  169  NRFILFAADKP  179



>ref|XP_007510827.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18360.1| predicted protein [Bathycoccus prasinos]
Length=390

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 78/124 (63%), Gaps = 6/124 (5%)
 Frame = -2

Query  650  IILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI----  483
            I  VRAD+ RLPF + SVD VHAGAALHCWPSP+ AVAEISRVL+PGG FVA+T++    
Sbjct  244  ITFVRADVGRLPFETGSVDVVHAGAALHCWPSPTQAVAEISRVLKPGGTFVASTFLDPSA  303

Query  482  -VDGIYSFTPFVRPLRENFAQISGS-HIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTA  309
             ++      PF    R+      G+ + F  E+EL+DLC   GL  FK  R R++I+   
Sbjct  304  NLNNDDLTKPFSDFFRDAKLGTGGAFNRFWTEQELKDLCQMVGLEDFKRERERQYILFAV  363

Query  308  MKPS  297
             K S
Sbjct  364  KKNS  367



>ref|XP_006359516.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Solanum tuberosum]
Length=343

 Score =   115 bits (288),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 82/119 (69%), Gaps = 4/119 (3%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            + N+ LVRAD+SRLPF S S+DAVHAGAALHCWPSPS A+AEI+R+L  GGVFV TT++ 
Sbjct  228  SSNLALVRADVSRLPFPSGSIDAVHAGAALHCWPSPSNAIAEINRILCSGGVFVGTTFLR  287

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  303
                + T F R L ++  +   ++ +  ++E+EDL T+CGL+ +       FIM +A K
Sbjct  288  VNPSAPTIF-RALEQSALR---TYSYFTQEEIEDLVTSCGLINYTSKVQSSFIMFSAQK  342



>ref|XP_002968407.1| hypothetical protein SELMODRAFT_89857 [Selaginella moellendorffii]
 gb|EFJ30661.1| hypothetical protein SELMODRAFT_89857 [Selaginella moellendorffii]
Length=315

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 79/119 (66%), Gaps = 4/119 (3%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            NE ++LVRAD SRLPFAS S+ AV++GAALHCW SPS A+AEI RVLRPGGV VATT++ 
Sbjct  190  NEKVVLVRADASRLPFASGSISAVYSGAALHCWESPSIAIAEICRVLRPGGVLVATTFLP  249

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  303
                      + +R  F    G+ IF  E EL++L  T GLV ++ I+   +IM+ A K
Sbjct  250  RWKSKLQTTQKFMRLIF----GTKIFFFEDELDELFETSGLVSYQKIKIDSYIMVCARK  304



>ref|XP_002954755.1| hypothetical protein VOLCADRAFT_106536 [Volvox carteri f. nagariensis]
 gb|EFJ44161.1| hypothetical protein VOLCADRAFT_106536 [Volvox carteri f. nagariensis]
Length=369

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 81/127 (64%), Gaps = 9/127 (7%)
 Frame = -2

Query  650  IILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVD--  477
            I+L+RAD+ RLPFA+ SV AVHAGAA+HCWP+P  A+AEISRVL PGGVFVA+T++    
Sbjct  240  IMLLRADVGRLPFATGSVAAVHAGAAIHCWPNPQVALAEISRVLAPGGVFVASTFLTATA  299

Query  476  --GIYSFTPFVRPLRENFAQISGS-----HIFLDEKELEDLCTTCGLVGFKCIRNRRFIM  318
              G       VRPL +     +G      + + +E+EL DLCT  GL  ++  R  RFIM
Sbjct  300  PLGQVLGDDAVRPLSQLDPTTAGGIVGTPYRWWEEQELLDLCTAVGLQDWRRERTWRFIM  359

Query  317  LTAMKPS  297
                KP+
Sbjct  360  FAVTKPN  366



>gb|ABR16838.1| unknown [Picea sitchensis]
Length=326

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRADISRLPF + SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+++ G
Sbjct  240  NLALVRADISRLPFTAGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFVLSG  299

Query  473  IYSFTPFVRPLRE  435
            I   +  V+PLR+
Sbjct  300  ILD-SDIVKPLRQ  311



>ref|XP_001418638.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO96931.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=227

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 73/126 (58%), Gaps = 7/126 (6%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            + ++  VRADI+RLPF   S+D VHAGAA+HCWP     VAEI+RVL+PG  F  TT++ 
Sbjct  102  DADVCFVRADIARLPFPEGSLDGVHAGAAIHCWPDAKTGVAEIARVLKPGATFCGTTFMN  161

Query  479  DGIYSFTP-----FVRPLRENFAQISGSHIF--LDEKELEDLCTTCGLVGFKCIRNRRFI  321
              +  F       F   +RE    ++    F    +KEL DLCT CGLV FKC    +FI
Sbjct  162  PQVPFFDEDQQAIFDNAVREFSGTVNAERGFRWWSKKELRDLCTECGLVDFKCEIRNQFI  221

Query  320  MLTAMK  303
              +A K
Sbjct  222  FYSAKK  227



>ref|XP_002506188.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67446.1| predicted protein [Micromonas sp. RCC299]
Length=359

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 78/129 (60%), Gaps = 12/129 (9%)
 Frame = -2

Query  650  IILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTY-----  486
            +  VRAD+ RLPFA+ SVD VHAGAA+HCWPSPSAA+ E++RVLRPGGVFVA+T+     
Sbjct  230  LSFVRADVGRLPFATGSVDVVHAGAAMHCWPSPSAAMVEVARVLRPGGVFVASTFMDPTS  289

Query  485  IVDGIYSFTPFVRP-------LRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRR  327
            +++ ++               +          + F  EK+L DL   CGL GF+  R+R+
Sbjct  290  MLEDVFGAGAEAAAAPLAEAFVNSGVGTGGAFNQFWREKDLRDLTGMCGLEGFERRRSRQ  349

Query  326  FIMLTAMKP  300
            FI+    KP
Sbjct  350  FILFRVNKP  358



>ref|XP_003080221.1| methyltransferase-related (ISS) [Ostreococcus tauri]
 emb|CAL54388.1| Methyltransferase type 11 [Ostreococcus tauri]
Length=389

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 77/126 (61%), Gaps = 7/126 (6%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N ++  VRADI+RLPF  SS+D VHAGAA+HCWP  + AVAEI+RVL+PG  F  TT++ 
Sbjct  259  NADVCFVRADIARLPFPESSLDGVHAGAAIHCWPDSTTAVAEIARVLKPGATFCGTTFMN  318

Query  479  DGIYSFTPFVRPLRENFA-QISGSH------IFLDEKELEDLCTTCGLVGFKCIRNRRFI  321
              +  F    + + +    Q SG+        +  +KEL DL T CGLV FKC   ++FI
Sbjct  319  PQVPFFDEDQQEVFDGVVRQFSGTENAARGFRWWSKKELRDLFTECGLVDFKCETRQQFI  378

Query  320  MLTAMK  303
              +A K
Sbjct  379  FYSAKK  384



>ref|XP_001694737.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP02321.1| predicted protein [Chlamydomonas reinhardtii]
Length=275

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 87/119 (73%), Gaps = 5/119 (4%)
 Frame = -2

Query  650  IILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGI  471
            I+L+RAD++RLPFA+ SV A+HAGAA+HCWP+P AA+AEISRVL PGGVFVA+T++    
Sbjct  149  IMLLRADVARLPFATGSVAAIHAGAAIHCWPNPQAALAEISRVLAPGGVFVASTFLT---  205

Query  470  YSFTPFVRPLRENFAQ-ISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  297
             +  P  + L ++  + +S S  + +E+EL DLC   GL GF+  R+ +FIM +A KP+
Sbjct  206  -ASAPLGQVLGDDLVRPLSQSMKYWEEQELRDLCEAVGLQGFQRERSWQFIMFSARKPA  263



>ref|XP_002500021.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61279.1| predicted protein [Micromonas sp. RCC299]
Length=385

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 77/136 (57%), Gaps = 19/136 (14%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             E+++ VRADI+R+P  S SV  VHAGAA+HCWP P  AVAEI RVL PGG F  TT++ 
Sbjct  251  QEDLLFVRADIARIPMTSDSVGGVHAGAAIHCWPQPREAVAEICRVLEPGGSFCGTTFLT  310

Query  479  DGIYSFTPFVR---------PLRENFAQI----SGSHIF--LDEKELEDLCTTCGLVGFK  345
              +    PF            +RE  A +     G+  F   ++K+L DLC  CGLV F+
Sbjct  311  PQL----PFADDETQQRVDAAMRELQAAVVGRAGGARGFRQWNKKDLRDLCVECGLVDFE  366

Query  344  CIRNRRFIMLTAMKPS  297
            C     FI  +A KP+
Sbjct  367  CDIRGGFIFFSARKPA  382



>ref|XP_007227385.1| hypothetical protein PRUPE_ppb016862mg [Prunus persica]
 gb|EMJ28584.1| hypothetical protein PRUPE_ppb016862mg [Prunus persica]
Length=205

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 71/121 (59%), Gaps = 24/121 (20%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             +NI+LVRADISR PFA+SS DAVHA  ++    +    VA+ISRVLRPGG         
Sbjct  109  QQNIVLVRADISRPPFATSSADAVHAVYSVSNLAAMVLKVADISRVLRPGG---------  159

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
                           N + I+GS  F+ + +LEDLC  CGLV F  +RNR F+M++A KP
Sbjct  160  ---------------NISHITGSQQFVSDGKLEDLCNVCGLVSFTSVRNRAFVMISATKP  204

Query  299  S  297
            +
Sbjct  205  N  205



>emb|CAN77779.1| hypothetical protein VITISV_004172 [Vitis vinifera]
Length=714

 Score =   104 bits (259),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 60/76 (79%), Gaps = 4/76 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRADISRLPF+S SVDAVHAGAALHCWPSPS AVAEI+R+LR GG+FV TT++   
Sbjct  398  NLALVRADISRLPFSSGSVDAVHAGAALHCWPSPSNAVAEITRILRSGGIFVGTTFL-RP  456

Query  473  IY---SFTPFVRPLRE  435
            IY   S    +RP R+
Sbjct  457  IYTNSSIPAILRPFRQ  472


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 47/103 (46%), Positives = 63/103 (61%), Gaps = 19/103 (18%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ LVRAD+SRLPF++ SVDAVHAGAALHCWPSPS AV       R      +   +   
Sbjct  134  NLALVRADVSRLPFSTGSVDAVHAGAALHCWPSPSNAV-------RINSFMTSDMVLAKS  186

Query  473  IYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK  345
            I     + R L +N+  ++       EKE+EDLCT+CGL+ ++
Sbjct  187  I----EWERSL-QNYNNLT-------EKEIEDLCTSCGLINYR  217



>gb|KJB27061.1| hypothetical protein B456_004G275300 [Gossypium raimondii]
Length=332

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 59/74 (80%), Gaps = 3/74 (4%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            NI LVRAD+SRLPF+S SVDAVHAGAALHCWPSP  AVAEISR+LR GGVFV +T++   
Sbjct  224  NIALVRADVSRLPFSSGSVDAVHAGAALHCWPSPLNAVAEISRILRSGGVFVGSTFL--R  281

Query  473  IYSFTP-FVRPLRE  435
              S TP  +RP RE
Sbjct  282  YTSSTPRIIRPFRE  295



>gb|KCW79026.1| hypothetical protein EUGRSUZ_C00449 [Eucalyptus grandis]
Length=305

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI  483
            N+ LVRAD+SRLPF+S SVDAVHAGAALHCWPSPS A+AEI+RVLR GGVFV TT++
Sbjct  223  NLALVRADVSRLPFSSCSVDAVHAGAALHCWPSPSNAIAEITRVLRSGGVFVGTTFL  279



>gb|KCW79027.1| hypothetical protein EUGRSUZ_C00449 [Eucalyptus grandis]
Length=304

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI  483
            N+ LVRAD+SRLPF+S SVDAVHAGAALHCWPSPS A+AEI+RVLR GGVFV TT++
Sbjct  223  NLALVRADVSRLPFSSCSVDAVHAGAALHCWPSPSNAIAEITRVLRSGGVFVGTTFL  279



>dbj|BAC99645.1| hypothetical protein [Oryza sativa Japonica Group]
Length=323

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
             + L RADISRLPF S S+DAVHA AA+HCWPSP+ AVAEISRVLRPGGVFVA+T++ D 
Sbjct  243  TLALARADISRLPFVSGSIDAVHAAAAIHCWPSPACAVAEISRVLRPGGVFVASTFVADI  302

Query  473  IYSFTPFVR  447
            +    P +R
Sbjct  303  LPPAVPVLR  311



>gb|KDO59315.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=304

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI  483
            N+ LVRAD+ RLPFAS  VDAVHAGAALHCWPSPS AVAEISR+LR GGVFV TT++
Sbjct  220  NLALVRADVCRLPFASGFVDAVHAGAALHCWPSPSNAVAEISRILRSGGVFVGTTFL  276



>gb|KDO59316.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=314

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI  483
            N+ LVRAD+ RLPFAS  VDAVHAGAALHCWPSPS AVAEISR+LR GGVFV TT++
Sbjct  220  NLALVRADVCRLPFASGFVDAVHAGAALHCWPSPSNAVAEISRILRSGGVFVGTTFL  276



>ref|XP_005643537.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE18993.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
Length=357

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 77/124 (62%), Gaps = 6/124 (5%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI---  483
              +L+RAD+ RLPF + SV A+HAGAA+HCWP+P+ AVAEISRVLRPGGVFV +T++   
Sbjct  232  QYVLLRADVGRLPFPTGSVAAIHAGAAIHCWPNPTMAVAEISRVLRPGGVFVGSTFLKAS  291

Query  482  --VDGIYSFTPFVRPLRENFAQISGSHI-FLDEKELEDLCTTCGLVGFKCIRNRRFIMLT  312
              +  + +    VRPL        GS+  + +E EL +L    GL  F+  R  RFIM  
Sbjct  292  APLGQLLNNDDLVRPLNSLDPMSGGSNYQWWEEAELRELTAAMGLQDFQRHRTNRFIMFA  351

Query  311  AMKP  300
              KP
Sbjct  352  VQKP  355



>ref|XP_002967385.1| hypothetical protein SELMODRAFT_408369 [Selaginella moellendorffii]
 gb|EFJ31984.1| hypothetical protein SELMODRAFT_408369 [Selaginella moellendorffii]
Length=776

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 65/104 (63%), Gaps = 13/104 (13%)
 Frame = -2

Query  647  ILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI-----  483
            +L+RAD  RLP A+SSV AVH+GAA+HCWP P  AVAEISRVLRP G+FV +T++     
Sbjct  80   VLLRADAGRLPLANSSVAAVHSGAAIHCWPEPIIAVAEISRVLRPQGLFVGSTFVFPEPP  139

Query  482  --VDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGL  357
              +DGI      + P+RE   Q+        +KEL+ L    G+
Sbjct  140  PPIDGI------INPVREAIMQLQVPFKAWTQKELQQLVEAGGM  177


 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATT  489
             ++LV+AD  RLPF SSS+ AVH  AA+HCWP P  AVAEI+R+L+PGG+FVA+T
Sbjct  393  KVVLVKADAGRLPFTSSSLAAVHTSAAIHCWPQPLHAVAEIARLLQPGGIFVAST  447



>ref|XP_003057905.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH57856.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=235

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 72/131 (55%), Gaps = 11/131 (8%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            N +I  VRADI+R+PF   SV  VHAGAA+HCWP P AA AEI+R L  GG F  TT++ 
Sbjct  105  NTDITFVRADIARMPFPEGSVGGVHAGAAIHCWPDPRAAAAEIARALERGGSFCGTTFLT  164

Query  479  D--------GIYSFTPFVRPLRENFA-QISGSHIF--LDEKELEDLCTTCGLVGFKCIRN  333
                     G       +R +++  + +  G+  F   +  +L+DLC  CGLV F+    
Sbjct  165  PRVPFLDDAGQQQLDAAMREVQDAISGRAGGARGFRMWNRADLKDLCEECGLVDFESDVR  224

Query  332  RRFIMLTAMKP  300
              FI  +A KP
Sbjct  225  DGFIFFSAKKP  235



>ref|XP_002502147.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63405.1| predicted protein [Micromonas sp. RCC299]
Length=373

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 65/133 (49%), Gaps = 24/133 (18%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N   VRAD++ +PF  SSVDAVH  A  HCWP P   + E+ R+L+PGGVFV +T +   
Sbjct  250  NFAAVRADVASMPFGDSSVDAVHCSAGAHCWPDPMDGLREVERILKPGGVFVTSTVV---  306

Query  473  IYSFTPFVRPLRENFAQISG--------------SHIFLDEKELEDLCTTCGLVGFKCIR  336
                     P+RE +A+                 +  F D   +  +    GL G + ++
Sbjct  307  ------LAPPIREKYAKGGDCTDAQSYDDKVRTMNTPFWDTASVVAMLQKAGLKGVEIVK  360

Query  335  NRR-FIMLTAMKP  300
              + F+ML A KP
Sbjct  361  EDKCFVMLAARKP  373



>ref|XP_005536724.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80688.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=441

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 61/102 (60%), Gaps = 10/102 (10%)
 Frame = -2

Query  644  LVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP-----GGVFVATTYIV  480
            ++RAD+ RLPFA+ S+D +HAGAALHCWP     + E+ R+LRP      G F+ATT+  
Sbjct  319  IIRADVERLPFANESIDCIHAGAALHCWPCVQDGLHEVYRILRPSKGPGSGRFLATTF--  376

Query  479  DGIYSFTPFVRPLRE-NFAQISGSHIFLDEKELEDLCTTCGL  357
              ++S +PF   +RE      S  + F D KELE L  + G 
Sbjct  377  --LWSTSPFGLAVREGRLLSPSAGYRFFDAKELEWLVKSAGF  416



>ref|XP_002960327.1| hypothetical protein SELMODRAFT_402502 [Selaginella moellendorffii]
 gb|EFJ37866.1| hypothetical protein SELMODRAFT_402502 [Selaginella moellendorffii]
Length=604

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATT-YIVD  477
             ++LV+AD  RLPF SSS+ AVH  AA+HCWP P  AVAEI+R+L+PGG+FVA+T     
Sbjct  221  KVVLVKADAGRLPFTSSSLAAVHTSAAIHCWPQPLHAVAEIARLLQPGGIFVASTFLFPL  280

Query  476  GIYSFTPFVRPLREN  432
                    + PLR+ 
Sbjct  281  PPPPIDKLLEPLRQQ  295



>gb|EMS47735.1| hypothetical protein TRIUR3_02804 [Triticum urartu]
Length=241

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 55/87 (63%), Gaps = 5/87 (6%)
 Frame = -2

Query  548  AAVAEISRVLRPGGVFVATTYIV----DGIYSFTPFVRPLRENFAQISGSHIFLDEKELE  381
            A +AEISRVL+PGGVFVATT++       ++S    ++PLR+    ++ S+ F  E ELE
Sbjct  156  ALIAEISRVLKPGGVFVATTFLSTPTNSSLFSIDA-LKPLRQIVGPVNSSYNFFTEGELE  214

Query  380  DLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            DLC +CGLV +     R FIM +  KP
Sbjct  215  DLCRSCGLVNYSSKVQRSFIMFSGQKP  241



>ref|XP_007514982.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15222.1| predicted protein [Bathycoccus prasinos]
Length=383

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 62/127 (49%), Gaps = 9/127 (7%)
 Frame = -2

Query  656  ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV-  480
            + I  VRAD+ RLPFA+ S+  V A AA+HCWP   +A AEI RVL+PG +F  TT+   
Sbjct  258  DKIAFVRADVGRLPFANDSIGGVSASAAIHCWPDVQSACAEIFRVLKPGRIFTGTTFATP  317

Query  479  -------DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFI  321
                   D     +   R L  +    +G   F +  +L D   + G      +R + ++
Sbjct  318  NVPFLDDDQNRLLSTLSRDLSASRPGTNGLR-FWNSADLRDQLQSIGFSDVTILREKDYL  376

Query  320  MLTAMKP  300
               A KP
Sbjct  377  FWKARKP  383



>ref|XP_005824779.1| hypothetical protein GUITHDRAFT_116106 [Guillardia theta CCMP2712]
 gb|EKX37799.1| hypothetical protein GUITHDRAFT_116106 [Guillardia theta CCMP2712]
Length=365

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 59/114 (52%), Gaps = 4/114 (4%)
 Frame = -2

Query  644  LVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYS  465
            ++RAD++ LPF   S+DA+H+GAALHCWP     + E+ RVL+PGG F A+T+    ++ 
Sbjct  251  IIRADVASLPFVDGSLDAIHSGAALHCWPYVQDGLKEVHRVLKPGGRFFASTF----LWG  306

Query  464  FTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  303
                V  L+ N       + F   +ELE L    G       R  R  ++   K
Sbjct  307  VPDEVISLQANLGPRQRQYRFFSVEELEWLMRGAGFKDVNVERRDRCALIRCRK  360



>ref|XP_002185698.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|ACI65168.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=412

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI  483
            N  + L+R D+ ++P  ++SVD +HAGAA+HCWP   AA AEI RVL+PGG + ATT++
Sbjct  290  NTQLDLIRLDVGQIPMKNASVDCLHAGAAMHCWPDLPAAAAEIYRVLKPGGRYFATTFL  348



>ref|XP_005713645.1| unnamed protein product [Chondrus crispus]
 emb|CDF33826.1| unnamed protein product [Chondrus crispus]
Length=298

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -2

Query  644  LVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTY  486
            +VRAD++RLPF   +  AVH+GAALHCWP+    +AEI RVL+PGG F ATT+
Sbjct  173  VVRADVARLPFVEGAFGAVHSGAALHCWPNVQDGLAEIQRVLQPGGRFFATTF  225



>gb|KJB59930.1| hypothetical protein B456_009G281700 [Gossypium raimondii]
Length=258

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAV  540
             E + LVRADISRLPF SSS+DAVHAGAALHCWPSPS A+
Sbjct  218  KEKVTLVRADISRLPFESSSIDAVHAGAALHCWPSPSTAL  257



>ref|XP_006434006.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47246.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|KDO80934.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
 gb|KDO80935.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=288

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 41/60 (68%), Gaps = 10/60 (17%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
             EN +LVRADISRLPFASSS+DAVHAGAA+HCW SPS  V          GVF   T I+
Sbjct  229  KENFLLVRADISRLPFASSSIDAVHAGAAIHCWSSPSTGV----------GVFFQVTLII  278



>ref|XP_010040339.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
Length=269

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAV  540
            N+ LVRAD+SRLPF+SSSVDAVHAGAALHCWPSPS AV
Sbjct  223  NLALVRADVSRLPFSSSSVDAVHAGAALHCWPSPSNAV  260



>gb|EWM24600.1| phosphatidylethanolamine n [Nannochloropsis gaditana]
Length=387

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -2

Query  644  LVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVD  477
            LVRAD SR PF +SSVDA+HAGAALHCWP    ++ E  RVL+PGG   A+T+ V+
Sbjct  280  LVRADASRQPFQTSSVDAIHAGAALHCWPRLEESLRECLRVLKPGGRMYASTFEVN  335



>ref|XP_005855405.1| hypothetical protein NGA_2005920 [Nannochloropsis gaditana CCMP526]
 ref|XP_005855816.1| hypothetical protein NGA_2005910 [Nannochloropsis gaditana CCMP526]
 gb|EKU20544.1| hypothetical protein NGA_2005910 [Nannochloropsis gaditana CCMP526]
 gb|EKU20954.1| hypothetical protein NGA_2005920 [Nannochloropsis gaditana CCMP526]
Length=387

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -2

Query  644  LVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVD  477
            LVRAD SR PF +SSVDA+HAGAALHCWP    ++ E  RVL+PGG   A+T+ V+
Sbjct  280  LVRADASRQPFQTSSVDAIHAGAALHCWPRLEESLRECLRVLKPGGRMYASTFEVN  335



>gb|EJK66010.1| hypothetical protein THAOC_13088 [Thalassiosira oceanica]
Length=446

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI  483
             + LVR D+ R+P  S SVDA HAGAA+HCWP    ++ EI RVL PGG + ATT++
Sbjct  324  KLDLVRCDVGRIPMKSDSVDAFHAGAAMHCWPEIEKSLQEIHRVLVPGGRYFATTFL  380



>ref|XP_008389527.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
Length=304

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRV  522
            + N+ LVRAD++RLPF S SVDAVHAGAALHCWPSPS AV+ +S V
Sbjct  229  DTNLALVRADVARLPFPSGSVDAVHAGAALHCWPSPSNAVSCVSCV  274



>gb|KJB53959.1| hypothetical protein B456_009G013400 [Gossypium raimondii]
Length=269

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAA  543
            NI LVRAD+SRLPF+S S+DAVHAGAALHCWPSPS A
Sbjct  230  NIALVRADVSRLPFSSGSIDAVHAGAALHCWPSPSNA  266



>gb|AAD12007.1| hypothetical protein [Arabidopsis thaliana]
Length=262

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVA  537
            NI +VRAD+SRLPF S SVDAVHAGAALHCWPSP+ AV+
Sbjct  223  NIAVVRADVSRLPFPSGSVDAVHAGAALHCWPSPTNAVS  261



>ref|XP_002503324.1| chloroplast envelope protein translocase family [Micromonas sp. 
RCC299]
 gb|ACO64582.1| chloroplast envelope protein translocase family [Micromonas sp. 
RCC299]
Length=903

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -2

Query  644  LVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  480
            +VRAD+  LPF   +  AVH+ A +HCWP P+  + E+SRVL+PGG FVA+T ++
Sbjct  240  VVRADVGNLPFDDDAFAAVHSAAGIHCWPEPARGLEEVSRVLKPGGTFVASTVVL  294



>gb|AEJ88263.1| putative S-adenosylmethionine-dependent methyltransferase [Wolffia 
arrhiza]
Length=274

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAA  543
            N  I LVRAD+SRLPF S SVDAVHAGAALHCWPSPS A
Sbjct  236  NAKIALVRADVSRLPFESGSVDAVHAGAALHCWPSPSNA  274



>emb|CBJ26935.1| S-adenosyl-L-methionine-dependent methyltransferases-like [Ectocarpus 
siliculosus]
Length=471

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 56/110 (51%), Gaps = 11/110 (10%)
 Frame = -2

Query  644  LVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYS  465
            L+R D+SRLP  + S+D VHAGAALHCW     +++E+ RVL+PG  F ATT++   +  
Sbjct  357  LIRCDVSRLPLKTESLDGVHAGAALHCWSKLEESLSEVHRVLKPGRGFFATTFLNSAVLG  416

Query  464  FTP----FVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRR  327
             T          R+ F        F +  ELE L    G    K ++  R
Sbjct  417  NTAGNTVGNSRRRDGFK-------FFELAELEQLMRNAGFEDVKVVKEGR  459



>ref|XP_008356589.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized methyltransferase 
At1g78140, chloroplastic-like [Malus domestica]
Length=259

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 36/45 (80%), Gaps = 2/45 (4%)
 Frame = -2

Query  659  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISR  525
             EN+ILVRADIS+LPFA+  VD VHAG A+HCWPSPS   AE+ R
Sbjct  205  KENMILVRADISQLPFATGFVDTVHAGXAIHCWPSPSX--AEMKR  247



>gb|KDO59317.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=319

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEIS  528
            N+ LVRAD+ RLPFAS  VDAVHAGAALHCWPSPS A +  S
Sbjct  220  NLALVRADVCRLPFASGFVDAVHAGAALHCWPSPSNAASVFS  261



>ref|XP_005781281.1| hypothetical protein EMIHUDRAFT_442892 [Emiliania huxleyi CCMP1516]
 gb|EOD28852.1| hypothetical protein EMIHUDRAFT_442892 [Emiliania huxleyi CCMP1516]
Length=459

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 54/97 (56%), Gaps = 3/97 (3%)
 Frame = -2

Query  644  LVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP-GGVFVATTYIVDGIY  468
            L+R D+++LP    +VDA+HAGAALH WP+    ++EI RVLRP GG F ATT++  G Y
Sbjct  211  LLRCDVAQLPMRDGAVDAMHAGAALHSWPNLEKGLSEIRRVLRPDGGRFFATTFL-RGAY  269

Query  467  SFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGL  357
              T    P +      S    F  E+EL  L    G 
Sbjct  270  PGTTSATPGQSGGGGGS-FRFFESEEELRQLLIAAGF  305



>ref|WP_037584032.1| hypothetical protein, partial [Stigmatella aurantiaca]
Length=252

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 62/121 (51%), Gaps = 9/121 (7%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTY--IV  480
            N+  VR +  +LP + +S+ AV    +L   P+PS A+ E+SR L+PGGVF   TY    
Sbjct  138  NVFFVRGNAQQLPLSDASLGAVSCWNSLQLLPNPSEAIREVSRCLKPGGVFTCFTYRRAR  197

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            + +Y +       +  FA+  G   F DE+EL    T  GLV          ++LTA KP
Sbjct  198  EPLYGY------FQSTFARNGGVRPF-DEEELRQWLTQAGLVVEDLGGPNLALLLTARKP  250

Query  299  S  297
            +
Sbjct  251  T  251



>gb|ADO73882.1| Methyltransferase type 11 [Stigmatella aurantiaca DW4/3-1]
Length=265

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 62/121 (51%), Gaps = 9/121 (7%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTY--IV  480
            N+  VR +  +LP + +S+ AV    +L   P+PS A+ E+SR L+PGGVF   TY    
Sbjct  151  NVFFVRGNAQQLPLSDASLGAVSCWNSLQLLPNPSEAIREVSRCLKPGGVFTCFTYRRAR  210

Query  479  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  300
            + +Y +       +  FA+  G   F DE+EL    T  GLV          ++LTA KP
Sbjct  211  EPLYGY------FQSTFARNGGVRPF-DEEELRQWLTQAGLVVEDLGGPNLALLLTARKP  263

Query  299  S  297
            +
Sbjct  264  T  264



>ref|WP_022122196.1| hypothetical protein [Clostridium sp. CAG:510]
 emb|CDA68638.1| putative uncharacterized protein [Clostridium sp. CAG:510]
Length=225

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 3/80 (4%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG  474
            N+ L +ADI++L +A +S D V AG  +H  P P AA+ E++RV +PGG  +  TYI D 
Sbjct  105  NVRLAKADITKLKYADNSFDKVVAGNVIHLLPEPKAALQELTRVCKPGGRLIIPTYINDT  164

Query  473  IYSFTPFVRPLRE---NFAQ  423
              +    VR L +   NF Q
Sbjct  165  KSTNKAAVRFLEKLGANFKQ  184



>ref|XP_006826926.1| hypothetical protein AMTR_s00010p00172800, partial [Amborella 
trichopoda]
 gb|ERM94163.1| hypothetical protein AMTR_s00010p00172800, partial [Amborella 
trichopoda]
Length=215

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -2

Query  656  ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAV  540
             N++LVRADISRLPF +SSVDAVHAGAA+HC  SPS AV
Sbjct  172  RNLVLVRADISRLPFVTSSVDAVHAGAAIHCCLSPSTAV  210



>ref|WP_033335056.1| hypothetical protein, partial [Scytonema hofmanni]
Length=79

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV  498
             II++RAD+  LP A  S+DA++AGAA+HCW   +  +  I + LRPGG  +
Sbjct  28   EIIIIRADVEALPLAPDSIDAIYAGAAMHCWNDATEGIRNIYQALRPGGKLL  79



>gb|KIE07218.1| hypothetical protein DA73_0239355 [Tolypothrix bouteillei VB521301]
Length=263

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -2

Query  650  IILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI  483
            I + RAD+  LP A +S+DA++AGAA+HCW   +  +  I + LRPGG  +ATT++
Sbjct  163  IAIARADVEALPLAPNSIDAIYAGAAMHCWNDATEGIRNIYQALRPGGKLLATTFL  218



>ref|WP_011557522.1| MULTISPECIES: SAM-dependent methyltransferase [Mycobacterium]
 gb|ABG06216.1| Methyltransferase type 11 [Mycobacterium sp. MCS]
 gb|ABL89322.1| Methyltransferase type 11 [Mycobacterium sp. KMS]
 gb|ABN95897.1| Methyltransferase type 11 [Mycobacterium sp. JLS]
Length=235

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 54/107 (50%), Gaps = 15/107 (14%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPG---GVFVATTYI  483
            N+  +RAD  RLP    SVDAV + A L   P PSAA+AE+ RVLRPG    V V T   
Sbjct  127  NVGFIRADAQRLPLRDESVDAVVSVAMLQLIPDPSAAMAEMVRVLRPGRRMAVMVPTAGQ  186

Query  482  VDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKC  342
            +  + +  P            +G+ +F DE EL D     GLVG + 
Sbjct  187  MARLINVLPN-----------AGARVF-DEDELGDALEGLGLVGVRT  221



>ref|WP_006242682.1| SAM-dependent methyltransferase [Mycobacterium tusciae]
Length=247

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 56/120 (47%), Gaps = 23/120 (19%)
 Frame = -2

Query  653  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG---VFVATTYI  483
            N+  +RAD  RLP    +VDA  + A L   P+P+  +AEI+RVL+PGG   + V T   
Sbjct  139  NVGFMRADAQRLPLRDETVDAATSLAVLQLIPNPAQTLAEIARVLKPGGRVALMVPTAGN  198

Query  482  VDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVG--------FKCIRNRR  327
            + G+    P             G   F  E EL D+    GLVG        F+ +R RR
Sbjct  199  ISGLAHLLP------------KGGANFFAEDELADILEDLGLVGVRTKTVGTFQWVRARR  246



>ref|XP_005705444.1| phosphatidylethanolamine n-methyltransferase, putative [Galdieria 
sulphuraria]
 gb|EME28924.1| phosphatidylethanolamine n-methyltransferase, putative [Galdieria 
sulphuraria]
Length=331

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 54/96 (56%), Gaps = 12/96 (13%)
 Frame = -2

Query  644  LVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYS  465
            L+RA++  LP   + VD ++ GAALHCWP     +AE+ R+L+P  +  ATT+I +    
Sbjct  222  LIRANVDSLPLRDNVVDLIYCGAALHCWPKVQDGLAEMYRILKPDALVFATTFISN----  277

Query  464  FTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGL  357
            ++P +   R N      ++ F  +KELE L  + G 
Sbjct  278  YSPLIS--RWN------AYRFFTKKELEWLLKSRGF  305



>ref|WP_027728386.1| SAM-dependent methyltransferase [Treponema sp. C6A8]
Length=198

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 3/81 (4%)
 Frame = -2

Query  656  ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVD  477
            +N+  ++ADI++L F  +S D V AG  +H  P P  A+AE+ RV +PGG  +  TYI  
Sbjct  81   KNVTFLKADITKLEFTDASFDKVVAGNVIHLLPEPEKALAELKRVTKPGGTIIIPTYINM  140

Query  476  GIYSFT---PFVRPLRENFAQ  423
               S T    F+  L  NF +
Sbjct  141  SKGSGTAAVKFIELLSANFKR  161



>ref|WP_044509270.1| SAM-dependent methyltransferase [Mycobacterium simiae]
Length=245

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 56/103 (54%), Gaps = 15/103 (15%)
 Frame = -2

Query  641  VRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG---VFVATTYIVDGI  471
            +RAD  RLPF  ++VDAV + A L   P+PSAA+AE++RVLRPGG   V V T      +
Sbjct  141  IRADAQRLPFRDNTVDAVISLAVLQLIPNPSAALAEMARVLRPGGRLAVMVPTVGRAARL  200

Query  470  YSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKC  342
            +   P       NF    G+H+F  E E+ D+    G V  + 
Sbjct  201  WQLLP-------NF----GAHVF-GEDEIGDVLEEHGFVSVRV  231



>ref|XP_010250394.1| PREDICTED: uncharacterized protein LOC104592660 [Nelumbo nucifera]
Length=795

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 3/84 (4%)
 Frame = -2

Query  551  SAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQI-SGSHIFLDEKELEDL  375
            +  VAEI+R+LR GG+FV TT++         F   +  N  Q+ S  + +L EKE+EDL
Sbjct  713  TGVVAEITRILRSGGIFVGTTFLAPRFGD--SFRSEIYRNLRQLASNGYGYLTEKEIEDL  770

Query  374  CTTCGLVGFKCIRNRRFIMLTAMK  303
            C +CGL+ +     + FIM +A K
Sbjct  771  CISCGLINYTSKVQQSFIMFSAQK  794



>ref|XP_002992310.1| hypothetical protein SELMODRAFT_430530 [Selaginella moellendorffii]
 gb|EFJ06586.1| hypothetical protein SELMODRAFT_430530 [Selaginella moellendorffii]
Length=212

 Score = 61.2 bits (147),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 9/73 (12%)
 Frame = -2

Query  521  LRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKC  342
            L+PGGVFVATT++ + I+SF P  R         S S  +  EKELE+LC  CGLV ++ 
Sbjct  148  LKPGGVFVATTFLSNSIFSFLPKRR---------SSSLRYWTEKELEELCKLCGLVDYQK  198

Query  341  IRNRRFIMLTAMK  303
                 +IML+A K
Sbjct  199  KMKGNYIMLSARK  211


 Score = 24.3 bits (51),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 0/28 (0%)
 Frame = -3

Query  643  WLELISRGFHLHQAPWMLCMLVLLCIVG  560
            W E +   F L   P++L MLVL CI G
Sbjct  110  WFERMLFVFLLRPEPFLLFMLVLHCIAG  137



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1023687230320