BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF035G23

Length=699
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001183608.1|  uncharacterized protein LOC100502202               281   2e-92   
gb|AAM91528.1|  putative casein kinase                                  285   3e-92   Arabidopsis thaliana [mouse-ear cress]
emb|CDP14324.1|  unnamed protein product                                296   1e-91   Coffea canephora [robusta coffee]
ref|XP_011075041.1|  PREDICTED: uncharacterized protein LOC105159627    296   1e-91   Sesamum indicum [beniseed]
gb|EPS68531.1|  hypothetical protein M569_06230                         295   1e-91   Genlisea aurea
gb|KDO55049.1|  hypothetical protein CISIN_1g005214mg                   291   1e-91   Citrus sinensis [apfelsine]
ref|XP_009615719.1|  PREDICTED: uncharacterized protein LOC104108400    294   5e-91   Nicotiana tomentosiformis
ref|XP_009621585.1|  PREDICTED: uncharacterized protein LOC104113184    294   6e-91   Nicotiana tomentosiformis
ref|XP_009771625.1|  PREDICTED: uncharacterized protein LOC104222130    294   6e-91   Nicotiana sylvestris
ref|XP_009788026.1|  PREDICTED: uncharacterized protein LOC104235895    294   6e-91   Nicotiana sylvestris
ref|XP_002525432.1|  casein kinase, putative                            293   9e-91   Ricinus communis
gb|AAO41895.1|  putative casein kinase                                  281   2e-90   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006443418.1|  hypothetical protein CICLE_v10019090mg             292   2e-90   Citrus clementina [clementine]
ref|XP_004147533.1|  PREDICTED: uncharacterized protein LOC101221479    292   3e-90   Cucumis sativus [cucumbers]
ref|XP_006479104.1|  PREDICTED: uncharacterized protein LOC102619...    292   3e-90   Citrus sinensis [apfelsine]
ref|XP_004249304.1|  PREDICTED: uncharacterized protein LOC101268442    292   3e-90   Solanum lycopersicum
ref|XP_008441978.1|  PREDICTED: uncharacterized protein LOC103485979    292   3e-90   Cucumis melo [Oriental melon]
ref|XP_011078778.1|  PREDICTED: uncharacterized protein LOC105162459    291   4e-90   Sesamum indicum [beniseed]
ref|XP_002325416.1|  kinase family protein                              291   5e-90   
ref|XP_011021493.1|  PREDICTED: uncharacterized protein LOC105123555    291   5e-90   Populus euphratica
gb|EYU20664.1|  hypothetical protein MIMGU_mgv1a002165mg                291   5e-90   Erythranthe guttata [common monkey flower]
ref|XP_004157014.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    292   5e-90   
ref|XP_006351365.1|  PREDICTED: uncharacterized protein LOC102603072    291   9e-90   Solanum tuberosum [potatoes]
ref|XP_010088042.1|  Casein kinase I isoform delta                      291   9e-90   
gb|KDP39706.1|  hypothetical protein JCGZ_02726                         290   2e-89   Jatropha curcas
gb|AAF00624.1|AC009540_1  unknown protein, 5' partial                   284   3e-89   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009366444.1|  PREDICTED: uncharacterized protein LOC103956210    289   3e-89   Pyrus x bretschneideri [bai li]
ref|XP_007204249.1|  hypothetical protein PRUPE_ppa002161mg             289   3e-89   Prunus persica
emb|CBI29940.3|  unnamed protein product                                286   4e-89   Vitis vinifera
ref|XP_007030718.1|  Kinase family protein                              289   4e-89   Theobroma cacao [chocolate]
ref|XP_010036218.1|  PREDICTED: uncharacterized protein LOC104425268    288   5e-89   Eucalyptus grandis [rose gum]
ref|XP_004288418.1|  PREDICTED: uncharacterized protein LOC101290807    288   5e-89   Fragaria vesca subsp. vesca
ref|XP_003548750.1|  PREDICTED: uncharacterized protein LOC100801...    288   7e-89   Glycine max [soybeans]
ref|XP_008240478.1|  PREDICTED: uncharacterized protein LOC103338977    288   1e-88   Prunus mume [ume]
gb|KJB45108.1|  hypothetical protein B456_007G289500                    288   1e-88   Gossypium raimondii
ref|XP_004493152.1|  PREDICTED: uncharacterized protein LOC101504...    287   2e-88   Cicer arietinum [garbanzo]
ref|XP_002281952.1|  PREDICTED: uncharacterized protein LOC100267624    287   2e-88   Vitis vinifera
gb|ABR25333.1|  protein kinase family protein                           269   3e-88   Oryza sativa Indica Group [Indian rice]
ref|XP_003624626.1|  Casein kinase I isoform alpha                      286   4e-88   Medicago truncatula
ref|XP_010558719.1|  PREDICTED: uncharacterized protein LOC104827...    286   4e-88   Tarenaya hassleriana [spider flower]
ref|XP_010558720.1|  PREDICTED: uncharacterized protein LOC104827...    286   4e-88   
gb|ADE75678.1|  unknown                                                 273   5e-88   Picea sitchensis
emb|CDY29971.1|  BnaC01g40370D                                          286   5e-88   Brassica napus [oilseed rape]
ref|XP_007161937.1|  hypothetical protein PHAVU_001G110300g             286   5e-88   Phaseolus vulgaris [French bean]
ref|NP_187044.1|  protein kinase family protein                         286   7e-88   Arabidopsis thaliana [mouse-ear cress]
gb|KHG27523.1|  hypothetical protein F383_15264                         286   8e-88   Gossypium arboreum [tree cotton]
ref|XP_006297091.1|  hypothetical protein CARUB_v10013094mg             285   9e-88   Capsella rubella
ref|XP_006408240.1|  hypothetical protein EUTSA_v10020173mg             285   9e-88   Eutrema salsugineum [saltwater cress]
ref|XP_002884421.1|  kinase family protein                              285   9e-88   Arabidopsis lyrata subsp. lyrata
gb|KHG17118.1|  Casein kinase I isoform delta                           285   1e-87   Gossypium arboreum [tree cotton]
ref|XP_010276388.1|  PREDICTED: uncharacterized protein LOC104611151    285   1e-87   
emb|CDY21155.1|  BnaA01g33860D                                          285   2e-87   Brassica napus [oilseed rape]
gb|KJB82579.1|  hypothetical protein B456_013G203000                    285   2e-87   Gossypium raimondii
gb|KJB82583.1|  hypothetical protein B456_013G203000                    285   2e-87   Gossypium raimondii
ref|XP_010485760.1|  PREDICTED: uncharacterized protein LOC104764...    285   2e-87   Camelina sativa [gold-of-pleasure]
ref|XP_010463863.1|  PREDICTED: uncharacterized protein LOC104744499    285   2e-87   Camelina sativa [gold-of-pleasure]
ref|XP_010516062.1|  PREDICTED: uncharacterized protein LOC104791...    285   2e-87   Camelina sativa [gold-of-pleasure]
gb|KHG04306.1|  Casein kinase I-like protein                            284   2e-87   Gossypium arboreum [tree cotton]
emb|CDY42890.1|  BnaC05g47610D                                          284   3e-87   Brassica napus [oilseed rape]
gb|KJB80965.1|  hypothetical protein B456_013G123300                    284   3e-87   Gossypium raimondii
gb|KJB80963.1|  hypothetical protein B456_013G123300                    284   3e-87   Gossypium raimondii
ref|XP_010672054.1|  PREDICTED: uncharacterized protein LOC104888...    284   5e-87   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009413883.1|  PREDICTED: uncharacterized protein LOC103995100    284   5e-87   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009102089.1|  PREDICTED: uncharacterized protein LOC103828226    283   5e-87   Brassica rapa
ref|XP_009130401.1|  PREDICTED: uncharacterized protein LOC103855200    283   7e-87   Brassica rapa
ref|XP_003569928.1|  PREDICTED: uncharacterized protein LOC100845295    282   1e-86   Brachypodium distachyon [annual false brome]
ref|XP_010908708.1|  PREDICTED: uncharacterized protein LOC105035016    282   2e-86   Elaeis guineensis
gb|EEC71557.1|  hypothetical protein OsI_03913                          280   2e-86   Oryza sativa Indica Group [Indian rice]
gb|ABF99312.1|  protein kinase family protein, putative, expressed      276   4e-86   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008805378.1|  PREDICTED: uncharacterized protein LOC103718369    281   4e-86   Phoenix dactylifera
ref|XP_010257690.1|  PREDICTED: uncharacterized protein LOC104597684    281   4e-86   Nelumbo nucifera [Indian lotus]
ref|NP_001044393.1|  Os01g0772600                                       281   5e-86   
dbj|BAJ90552.1|  predicted protein                                      280   5e-86   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006400366.1|  hypothetical protein EUTSA_v10012841mg             280   5e-86   Eutrema salsugineum [saltwater cress]
ref|XP_009418951.1|  PREDICTED: uncharacterized protein LOC103999...    281   7e-86   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_197320.1|  protein kinase                                        280   8e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009418950.1|  PREDICTED: uncharacterized protein LOC103999...    281   1e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010492820.1|  PREDICTED: uncharacterized protein LOC104770147    280   1e-85   Camelina sativa [gold-of-pleasure]
emb|CDY38493.1|  BnaA10g16650D                                          279   1e-85   Brassica napus [oilseed rape]
ref|XP_006644782.1|  PREDICTED: uncharacterized protein LOC102714869    280   1e-85   Oryza brachyantha
emb|CDY25451.1|  BnaC09g39660D                                          279   2e-85   Brassica napus [oilseed rape]
ref|XP_010424160.1|  PREDICTED: uncharacterized protein LOC104709208    278   2e-85   Camelina sativa [gold-of-pleasure]
ref|XP_004970128.1|  PREDICTED: uncharacterized protein LOC101772174    279   2e-85   Setaria italica
ref|XP_006287189.1|  hypothetical protein CARUB_v10000361mg             278   3e-85   Capsella rubella
ref|XP_009121003.1|  PREDICTED: uncharacterized protein LOC103845859    278   4e-85   Brassica rapa
ref|XP_010454044.1|  PREDICTED: uncharacterized protein LOC104735873    278   4e-85   Camelina sativa [gold-of-pleasure]
ref|XP_008655390.1|  PREDICTED: uncharacterized protein LOC100502...    280   5e-85   
ref|XP_010485763.1|  PREDICTED: uncharacterized protein LOC104764...    278   5e-85   Camelina sativa [gold-of-pleasure]
ref|NP_001058996.1|  Os07g0171300                                       278   5e-85   
ref|XP_010516137.1|  PREDICTED: uncharacterized protein LOC104791...    278   6e-85   Camelina sativa [gold-of-pleasure]
gb|EAY92152.1|  hypothetical protein OsI_13865                          278   7e-85   Oryza sativa Indica Group [Indian rice]
dbj|BAN15568.1|  heading date 16                                        278   7e-85   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051531.1|  Os03g0793500                                       278   7e-85   
gb|KHF98002.1|  hypothetical protein F383_12939                         277   7e-85   Gossypium arboreum [tree cotton]
ref|XP_006657490.1|  PREDICTED: uncharacterized protein LOC102719500    278   8e-85   Oryza brachyantha
ref|XP_002873876.1|  kinase family protein                              277   1e-84   
emb|CDY50866.1|  BnaA05g37270D                                          279   1e-84   Brassica napus [oilseed rape]
ref|XP_010228600.1|  PREDICTED: uncharacterized protein LOC100829940    277   2e-84   
dbj|BAJ93086.1|  predicted protein                                      277   2e-84   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003557523.1|  PREDICTED: uncharacterized protein LOC100821235    276   3e-84   Brachypodium distachyon [annual false brome]
gb|KJB46016.1|  hypothetical protein B456_007G343500                    276   3e-84   Gossypium raimondii
ref|XP_009132256.1|  PREDICTED: uncharacterized protein LOC103856881    275   3e-84   Brassica rapa
emb|CDY51243.1|  BnaA03g06950D                                          275   4e-84   Brassica napus [oilseed rape]
ref|XP_004955583.1|  PREDICTED: uncharacterized protein LOC101773...    276   4e-84   Setaria italica
emb|CDX70801.1|  BnaC03g08850D                                          275   4e-84   
ref|XP_008651588.1|  PREDICTED: ATP binding protein isoform X1          276   5e-84   Zea mays [maize]
ref|XP_004955580.1|  PREDICTED: uncharacterized protein LOC101773...    276   5e-84   Setaria italica
ref|NP_001152463.1|  ATP binding protein                                275   5e-84   Zea mays [maize]
gb|ADE77861.1|  unknown                                                 260   6e-84   Picea sitchensis
ref|XP_010672056.1|  PREDICTED: uncharacterized protein LOC104888...    275   8e-84   
gb|ACN36158.1|  unknown                                                 275   1e-83   Zea mays [maize]
ref|NP_001152101.1|  LOC100285738                                       275   1e-83   Zea mays [maize]
emb|CDY02641.1|  BnaC02g07940D                                          272   6e-83   
gb|EMS51431.1|  Casein kinase I isoform beta                            272   1e-82   Triticum urartu
ref|XP_009126244.1|  PREDICTED: uncharacterized protein LOC103851164    271   1e-82   Brassica rapa
ref|XP_002466312.1|  hypothetical protein SORBIDRAFT_01g005460          271   2e-82   Sorghum bicolor [broomcorn]
ref|XP_004981469.1|  PREDICTED: uncharacterized protein LOC101783...    271   2e-82   
emb|CDY53253.1|  BnaA02g04010D                                          272   2e-82   Brassica napus [oilseed rape]
ref|XP_006842223.1|  hypothetical protein AMTR_s00078p00181940          270   5e-82   
ref|XP_010552201.1|  PREDICTED: serine/threonine-protein kinase s...    269   1e-81   Tarenaya hassleriana [spider flower]
ref|XP_010500967.1|  PREDICTED: uncharacterized protein LOC104778...    260   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_010936996.1|  PREDICTED: casein kinase I isoform gamma-1-l...    266   2e-81   
ref|XP_010936995.1|  PREDICTED: casein kinase I isoform gamma-1-l...    266   2e-81   
gb|EYU39997.1|  hypothetical protein MIMGU_mgv1a002328mg                268   3e-81   Erythranthe guttata [common monkey flower]
ref|XP_010472589.1|  PREDICTED: uncharacterized protein LOC104752210    255   5e-81   Camelina sativa [gold-of-pleasure]
gb|AAC42254.1|  unknown protein                                         255   8e-81   Arabidopsis thaliana [mouse-ear cress]
gb|KHN37292.1|  Casein kinase I                                         264   1e-80   Glycine soja [wild soybean]
tpg|DAA54811.1|  TPA: hypothetical protein ZEAMMB73_098757              251   1e-80   
gb|EMT21659.1|  Casein kinase I-RAG8-like protein                       265   2e-80   
ref|XP_006651899.1|  PREDICTED: uncharacterized protein LOC102717146    266   2e-80   Oryza brachyantha
ref|XP_010542444.1|  PREDICTED: serine/threonine-protein kinase S...    266   2e-80   Tarenaya hassleriana [spider flower]
ref|XP_010534909.1|  PREDICTED: serine/threonine-protein kinase S...    266   2e-80   Tarenaya hassleriana [spider flower]
ref|XP_003536792.1|  PREDICTED: uncharacterized protein LOC100783819    265   3e-80   Glycine max [soybeans]
gb|KHN27094.1|  Casein kinase I                                         264   4e-80   Glycine soja [wild soybean]
ref|XP_003556554.1|  PREDICTED: uncharacterized protein LOC100807373    264   5e-80   Glycine max [soybeans]
gb|KDP33655.1|  hypothetical protein JCGZ_07226                         264   5e-80   Jatropha curcas
ref|XP_008797930.1|  PREDICTED: uncharacterized protein LOC103712...    265   6e-80   Phoenix dactylifera
ref|XP_008797939.1|  PREDICTED: uncharacterized protein LOC103712...    265   7e-80   Phoenix dactylifera
ref|XP_008797915.1|  PREDICTED: uncharacterized protein LOC103712...    265   7e-80   Phoenix dactylifera
ref|XP_008797922.1|  PREDICTED: uncharacterized protein LOC103712...    265   7e-80   Phoenix dactylifera
gb|ADE76410.1|  unknown                                                 258   8e-80   Picea sitchensis
ref|XP_009382978.1|  PREDICTED: uncharacterized protein LOC103970784    265   9e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001770883.1|  predicted protein                                  261   1e-79   
emb|CDP13154.1|  unnamed protein product                                261   1e-79   Coffea canephora [robusta coffee]
ref|XP_001764211.1|  predicted protein                                  261   1e-79   
ref|XP_008787870.1|  PREDICTED: uncharacterized protein LOC103705792    264   2e-79   Phoenix dactylifera
ref|XP_008367866.1|  PREDICTED: casein kinase I                         259   2e-79   
emb|CDY23629.1|  BnaC05g39650D                                          259   2e-79   Brassica napus [oilseed rape]
ref|XP_010939947.1|  PREDICTED: uncharacterized protein LOC105058...    264   2e-79   Elaeis guineensis
ref|XP_010939945.1|  PREDICTED: uncharacterized protein LOC105058...    264   2e-79   
ref|XP_002967119.1|  hypothetical protein SELMODRAFT_144765             261   2e-79   
ref|XP_006445886.1|  hypothetical protein CICLE_v10014444mg             263   2e-79   Citrus clementina [clementine]
ref|XP_002960894.1|  hypothetical protein SELMODRAFT_139482             261   2e-79   
emb|CBI28086.3|  unnamed protein product                                261   3e-79   Vitis vinifera
ref|XP_006407187.1|  hypothetical protein EUTSA_v10020172mg             263   3e-79   Eutrema salsugineum [saltwater cress]
ref|XP_007024284.1|  Casein kinase I protein isoform 1                  263   3e-79   
ref|XP_006849555.1|  hypothetical protein AMTR_s00024p00176520          263   4e-79   Amborella trichopoda
tpg|DAA54810.1|  TPA: hypothetical protein ZEAMMB73_098757              252   4e-79   
ref|XP_008351086.1|  PREDICTED: uncharacterized protein LOC103414488    257   4e-79   
ref|XP_003532324.1|  PREDICTED: serine/threonine-protein kinase V...    262   4e-79   Glycine max [soybeans]
gb|KHN24964.1|  Casein kinase I isoform alpha                           263   4e-79   Glycine soja [wild soybean]
ref|XP_009413490.1|  PREDICTED: uncharacterized protein LOC103994778    263   5e-79   
ref|XP_003552750.1|  PREDICTED: serine/threonine-protein kinase V...    262   5e-79   Glycine max [soybeans]
ref|XP_003621013.1|  Casein kinase I isoform alpha                      259   6e-79   Medicago truncatula
emb|CBI16476.3|  unnamed protein product                                260   6e-79   Vitis vinifera
ref|XP_009404157.1|  PREDICTED: uncharacterized protein LOC103987553    262   7e-79   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY55141.1|  BnaC01g44810D                                          260   7e-79   Brassica napus [oilseed rape]
ref|XP_007139114.1|  hypothetical protein PHAVU_008G002500g             261   8e-79   Phaseolus vulgaris [French bean]
ref|XP_006297084.1|  hypothetical protein CARUB_v10013087mg             261   9e-79   Capsella rubella
ref|XP_002882838.1|  kinase family protein                              261   9e-79   Arabidopsis lyrata subsp. lyrata
ref|XP_010656334.1|  PREDICTED: uncharacterized protein LOC100254414    261   9e-79   Vitis vinifera
tpg|DAA54809.1|  TPA: hypothetical protein ZEAMMB73_098757              252   9e-79   
gb|KFK38714.1|  hypothetical protein AALP_AA3G150500                    261   1e-78   Arabis alpina [alpine rockcress]
emb|CDY51730.1|  BnaA01g37130D                                          261   1e-78   Brassica napus [oilseed rape]
emb|CDX75726.1|  BnaC03g38090D                                          260   1e-78   
ref|XP_010500960.1|  PREDICTED: uncharacterized protein LOC104778...    261   1e-78   Camelina sativa [gold-of-pleasure]
ref|XP_010465212.1|  PREDICTED: uncharacterized protein LOC104745616    261   1e-78   Camelina sativa [gold-of-pleasure]
ref|XP_010487127.1|  PREDICTED: serine/threonine-protein kinase S...    261   1e-78   
gb|KDP44321.1|  hypothetical protein JCGZ_19188                         261   2e-78   Jatropha curcas
gb|KHN18151.1|  Casein kinase I like 2                                  255   2e-78   Glycine soja [wild soybean]
emb|CDX97505.1|  BnaA05g25740D                                          259   2e-78   
ref|XP_009146466.1|  PREDICTED: uncharacterized protein LOC103870106    260   2e-78   Brassica rapa
emb|CAN69523.1|  hypothetical protein VITISV_040873                     260   2e-78   Vitis vinifera
ref|XP_008352012.1|  PREDICTED: uncharacterized protein LOC103415457    260   2e-78   
gb|KDO79864.1|  hypothetical protein CISIN_1g005420mg                   256   2e-78   Citrus sinensis [apfelsine]
ref|NP_187977.1|  protein kinase family protein                         260   3e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004142151.1|  PREDICTED: uncharacterized protein LOC101213194    260   3e-78   Cucumis sativus [cucumbers]
ref|XP_010257513.1|  PREDICTED: uncharacterized protein LOC104597586    261   3e-78   Nelumbo nucifera [Indian lotus]
ref|XP_004162011.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    260   3e-78   
ref|XP_008338530.1|  PREDICTED: casein kinase I homolog 2-like          256   3e-78   
gb|KJB56821.1|  hypothetical protein B456_009G137100                    261   3e-78   Gossypium raimondii
ref|XP_007013209.1|  Kinase family protein isoform 5                    254   3e-78   
gb|EMS55588.1|  Casein kinase I-like protein 2                          258   3e-78   Triticum urartu
ref|XP_002283346.1|  PREDICTED: uncharacterized protein LOC100263956    260   3e-78   Vitis vinifera
ref|XP_010915404.1|  PREDICTED: uncharacterized protein LOC105040538    259   3e-78   Elaeis guineensis
ref|XP_008228435.1|  PREDICTED: uncharacterized protein LOC103327845    260   3e-78   Prunus mume [ume]
dbj|BAJ99119.1|  predicted protein                                      254   3e-78   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBI36074.3|  unnamed protein product                                258   4e-78   Vitis vinifera
ref|XP_009406168.1|  PREDICTED: uncharacterized protein LOC103989128    259   4e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004491691.1|  PREDICTED: serine/threonine-protein kinase V...    259   4e-78   Cicer arietinum [garbanzo]
ref|XP_007014775.1|  Kinase family protein isoform 2                    260   4e-78   
ref|XP_008655737.1|  PREDICTED: uncharacterized protein LOC103634938    250   4e-78   
gb|KJB21848.1|  hypothetical protein B456_004G018000                    260   4e-78   Gossypium raimondii
ref|XP_009117581.1|  PREDICTED: uncharacterized protein LOC103842673    259   5e-78   Brassica rapa
ref|XP_009395056.1|  PREDICTED: uncharacterized protein LOC103980...    259   5e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002531638.1|  casein kinase, putative                            259   5e-78   Ricinus communis
ref|XP_009395055.1|  PREDICTED: uncharacterized protein LOC103980...    259   5e-78   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK32550.1|  hypothetical protein AALP_AA6G257400                    259   5e-78   Arabis alpina [alpine rockcress]
gb|KHG14825.1|  hypothetical protein F383_08945                         260   6e-78   Gossypium arboreum [tree cotton]
emb|CDX82524.1|  BnaA03g32970D                                          258   6e-78   
ref|XP_009135319.1|  PREDICTED: uncharacterized protein LOC103859531    259   7e-78   Brassica rapa
ref|XP_007024285.1|  Kinase family protein isoform 2                    254   7e-78   
ref|XP_004963353.1|  PREDICTED: probable casein kinase I homolog ...    257   8e-78   Setaria italica
ref|XP_010249522.1|  PREDICTED: uncharacterized protein LOC104592...    259   8e-78   Nelumbo nucifera [Indian lotus]
ref|XP_002283957.2|  PREDICTED: uncharacterized protein LOC100253221    259   9e-78   Vitis vinifera
ref|XP_010249521.1|  PREDICTED: uncharacterized protein LOC104592...    259   9e-78   Nelumbo nucifera [Indian lotus]
emb|CAN77676.1|  hypothetical protein VITISV_013722                     259   9e-78   Vitis vinifera
ref|XP_010526089.1|  PREDICTED: casein kinase I-like                    256   1e-77   Tarenaya hassleriana [spider flower]
ref|XP_008378069.1|  PREDICTED: uncharacterized protein LOC103441148    258   1e-77   
ref|XP_010267169.1|  PREDICTED: uncharacterized protein LOC104604...    258   1e-77   Nelumbo nucifera [Indian lotus]
gb|EEC78673.1|  hypothetical protein OsI_18806                          256   1e-77   Oryza sativa Indica Group [Indian rice]
gb|ACO87665.1|  protein kinase                                          257   1e-77   Brachypodium sylvaticum
dbj|BAG92829.1|  unnamed protein product                                256   2e-77   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002516524.1|  casein kinase, putative                            258   2e-77   
ref|XP_010033842.1|  PREDICTED: uncharacterized protein LOC104423081    258   2e-77   
gb|AAT44311.1|  putative casein kinase                                  256   2e-77   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010267167.1|  PREDICTED: uncharacterized protein LOC104604...    258   2e-77   
ref|XP_006853659.1|  hypothetical protein AMTR_s00056p00104010          258   2e-77   Amborella trichopoda
ref|XP_010047289.1|  PREDICTED: uncharacterized protein LOC104436263    256   2e-77   Eucalyptus grandis [rose gum]
ref|XP_007208054.1|  hypothetical protein PRUPE_ppa002206mg             258   2e-77   Prunus persica
emb|CDY21505.1|  BnaC03g26920D                                          256   2e-77   Brassica napus [oilseed rape]
ref|XP_010546534.1|  PREDICTED: uncharacterized protein LOC104818596    258   2e-77   Tarenaya hassleriana [spider flower]
gb|KJB07481.1|  hypothetical protein B456_001G026300                    253   2e-77   Gossypium raimondii
ref|XP_008791563.1|  PREDICTED: uncharacterized protein LOC103708420    257   2e-77   Phoenix dactylifera
gb|KJB21850.1|  hypothetical protein B456_004G018100                    258   2e-77   Gossypium raimondii
gb|EMT06030.1|  Casein kinase I-2-like protein                          255   3e-77   
ref|XP_007217013.1|  hypothetical protein PRUPE_ppa002136mg             258   3e-77   Prunus persica
ref|XP_008390151.1|  PREDICTED: uncharacterized protein LOC103452441    258   3e-77   
ref|XP_011019588.1|  PREDICTED: uncharacterized protein LOC105122...    252   3e-77   Populus euphratica
ref|XP_009375296.1|  PREDICTED: uncharacterized protein LOC103964127    258   3e-77   
ref|XP_008338507.1|  PREDICTED: uncharacterized protein LOC103401...    258   3e-77   
gb|KHN39248.1|  Casein kinase I isoform delta-like                      257   3e-77   Glycine soja [wild soybean]
emb|CDY11509.1|  BnaA09g40750D                                          254   3e-77   Brassica napus [oilseed rape]
ref|NP_001141429.1|  uncharacterized protein LOC100273539               252   3e-77   
ref|XP_008338505.1|  PREDICTED: uncharacterized protein LOC103401...    257   3e-77   
ref|XP_009364099.1|  PREDICTED: uncharacterized protein LOC103954016    257   3e-77   Pyrus x bretschneideri [bai li]
ref|XP_004294964.1|  PREDICTED: uncharacterized protein LOC101294343    258   3e-77   Fragaria vesca subsp. vesca
gb|KHN10182.1|  Casein kinase I like 2                                  255   4e-77   Glycine soja [wild soybean]
ref|XP_007014774.1|  Casein kinase I protein isoform 1                  260   4e-77   
ref|XP_010243375.1|  PREDICTED: uncharacterized protein LOC104587456    258   4e-77   Nelumbo nucifera [Indian lotus]
ref|XP_006408871.1|  hypothetical protein EUTSA_v10001925mg             256   4e-77   Eutrema salsugineum [saltwater cress]
ref|NP_001054881.2|  Os05g0200500                                       256   4e-77   
ref|XP_003592802.1|  Casein kinase-like protein                         256   4e-77   Medicago truncatula
ref|XP_008804603.1|  PREDICTED: negative regulator of sexual conj...    253   5e-77   
ref|XP_011006418.1|  PREDICTED: uncharacterized protein LOC105112417    257   5e-77   Populus euphratica
ref|XP_008445007.1|  PREDICTED: uncharacterized protein LOC103488176    257   5e-77   Cucumis melo [Oriental melon]
dbj|BAD73224.1|  putative serine/threonine protein kinase               247   5e-77   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009117039.1|  PREDICTED: casein kinase I                         254   5e-77   Brassica rapa
ref|XP_010093160.1|  Casein kinase I                                    259   5e-77   
ref|XP_009388687.1|  PREDICTED: casein kinase I isoform delta-like      254   5e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009367436.1|  PREDICTED: uncharacterized protein LOC103957076    256   6e-77   Pyrus x bretschneideri [bai li]
ref|XP_007135639.1|  hypothetical protein PHAVU_010G145900g             257   6e-77   Phaseolus vulgaris [French bean]
emb|CDX76739.1|  BnaC08g33250D                                          254   6e-77   
ref|XP_003577056.1|  PREDICTED: uncharacterized protein LOC100836999    256   6e-77   Brachypodium distachyon [annual false brome]
emb|CBI20566.3|  unnamed protein product                                254   7e-77   Vitis vinifera
ref|XP_006583050.1|  PREDICTED: uncharacterized protein LOC100800869    257   7e-77   Glycine max [soybeans]
ref|XP_006476018.1|  PREDICTED: uncharacterized protein LOC102627...    256   7e-77   Citrus sinensis [apfelsine]
ref|XP_006450715.1|  hypothetical protein CICLE_v10007635mg             256   7e-77   
gb|KDO79859.1|  hypothetical protein CISIN_1g005420mg                   256   7e-77   Citrus sinensis [apfelsine]
ref|XP_004517304.1|  PREDICTED: uncharacterized protein LOC101495334    254   7e-77   
gb|KGN45587.1|  hypothetical protein Csa_7G452910                       257   8e-77   Cucumis sativus [cucumbers]
ref|XP_003523750.1|  PREDICTED: uncharacterized protein LOC100778...    256   8e-77   Glycine max [soybeans]
ref|XP_004141661.1|  PREDICTED: uncharacterized protein LOC101213589    256   9e-77   Cucumis sativus [cucumbers]
ref|XP_010249770.1|  PREDICTED: uncharacterized protein LOC104592236    256   9e-77   Nelumbo nucifera [Indian lotus]
ref|XP_004155952.1|  PREDICTED: uncharacterized protein LOC101230855    256   9e-77   
ref|XP_003523751.1|  PREDICTED: uncharacterized protein LOC100779...    256   9e-77   Glycine max [soybeans]
ref|XP_011081763.1|  PREDICTED: uncharacterized protein LOC105164726    254   9e-77   Sesamum indicum [beniseed]
emb|CDO97984.1|  unnamed protein product                                254   1e-76   Coffea canephora [robusta coffee]
ref|XP_002324211.2|  hypothetical protein POPTR_0018s08230g             256   1e-76   
ref|XP_006644695.1|  PREDICTED: casein kinase I homolog 1-like          254   1e-76   
ref|XP_004148393.1|  PREDICTED: uncharacterized protein LOC101218249    256   1e-76   
ref|XP_010102418.1|  Casein kinase I-2-like protein                     256   1e-76   
ref|XP_003526502.1|  PREDICTED: uncharacterized protein LOC100800...    254   1e-76   
ref|XP_002880706.1|  kinase family protein                              255   1e-76   
ref|XP_003565003.1|  PREDICTED: uncharacterized protein LOC100839189    254   1e-76   
gb|KGN62809.1|  hypothetical protein Csa_2G373520                       256   1e-76   
ref|XP_003531651.1|  PREDICTED: uncharacterized protein LOC100799630    256   1e-76   
ref|XP_008462429.1|  PREDICTED: uncharacterized protein LOC103500783    256   1e-76   
ref|XP_006293796.1|  hypothetical protein CARUB_v10022778mg             255   1e-76   
ref|XP_008220112.1|  PREDICTED: uncharacterized protein LOC103320244    255   1e-76   
ref|XP_007013205.1|  Kinase family protein isoform 1                    255   1e-76   
ref|XP_002272679.2|  PREDICTED: serine/threonine-protein kinase S...    256   2e-76   
ref|XP_010925551.1|  PREDICTED: uncharacterized protein LOC105048062    255   2e-76   
dbj|BAD87518.1|  putative serine/threonine protein kinase               253   2e-76   
ref|XP_002515975.1|  casein kinase, putative                            255   2e-76   
ref|XP_010924659.1|  PREDICTED: uncharacterized protein LOC105047...    255   2e-76   
gb|KJB07483.1|  hypothetical protein B456_001G026300                    253   2e-76   
ref|XP_002297651.2|  hypothetical protein POPTR_0001s04710g             256   2e-76   
ref|XP_010924661.1|  PREDICTED: uncharacterized protein LOC105047...    255   2e-76   
ref|XP_010472590.1|  PREDICTED: uncharacterized protein LOC104752211    255   2e-76   
ref|NP_973532.1|  protein kinase family protein                         255   2e-76   
gb|KDP34168.1|  hypothetical protein JCGZ_07739                         255   2e-76   
ref|XP_008392669.1|  PREDICTED: uncharacterized protein LOC103454855    255   2e-76   
ref|XP_002309535.1|  kinase family protein                              253   2e-76   
ref|NP_180147.2|  protein kinase family protein                         254   2e-76   
ref|XP_011037977.1|  PREDICTED: uncharacterized protein LOC105135003    255   2e-76   
ref|XP_010044966.1|  PREDICTED: uncharacterized protein LOC104433...    255   2e-76   
ref|XP_009349729.1|  PREDICTED: uncharacterized protein LOC103941...    255   2e-76   
ref|XP_007225173.1|  hypothetical protein PRUPE_ppa002269mg             255   2e-76   
ref|XP_009349728.1|  PREDICTED: uncharacterized protein LOC103941...    255   2e-76   
ref|XP_010044967.1|  PREDICTED: uncharacterized protein LOC104433...    255   3e-76   
ref|XP_009416478.1|  PREDICTED: uncharacterized protein LOC103997068    255   3e-76   
ref|XP_011025189.1|  PREDICTED: uncharacterized protein LOC105126132    255   3e-76   
emb|CDM82151.1|  unnamed protein product                                253   3e-76   
dbj|BAJ94407.1|  predicted protein                                      253   3e-76   
ref|XP_002979683.1|  hypothetical protein SELMODRAFT_177864             252   3e-76   
gb|KHG18897.1|  Casein kinase I                                         255   3e-76   
ref|XP_011072424.1|  PREDICTED: serine/threonine-protein kinase S...    255   3e-76   
ref|XP_010915579.1|  PREDICTED: uncharacterized protein LOC105040...    254   3e-76   
ref|XP_004960930.1|  PREDICTED: uncharacterized protein LOC101765228    253   4e-76   
ref|XP_002304015.1|  kinase family protein                              254   4e-76   
ref|XP_011072423.1|  PREDICTED: serine/threonine-protein kinase S...    255   4e-76   
gb|ADI78885.1|  casein kinase I                                         254   4e-76   
ref|XP_010429582.1|  PREDICTED: uncharacterized protein LOC104714043    254   4e-76   
ref|XP_010668618.1|  PREDICTED: uncharacterized protein LOC104885660    255   4e-76   
ref|XP_010915613.1|  PREDICTED: uncharacterized protein LOC105040...    254   4e-76   
gb|KJB70401.1|  hypothetical protein B456_011G072100                    255   5e-76   
gb|EEE55368.1|  hypothetical protein OsJ_03423                          253   5e-76   
gb|KDP40868.1|  hypothetical protein JCGZ_24867                         254   5e-76   
gb|AES58679.2|  casein kinase I-like protein                            254   5e-76   
ref|XP_010673525.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    255   5e-76   
ref|XP_011019579.1|  PREDICTED: casein kinase I homolog 1-like is...    252   5e-76   
ref|XP_010417347.1|  PREDICTED: uncharacterized protein LOC104703...    254   5e-76   
ref|XP_008810649.1|  PREDICTED: uncharacterized protein LOC103722...    254   6e-76   
ref|XP_008810650.1|  PREDICTED: uncharacterized protein LOC103722...    254   6e-76   
ref|XP_010417348.1|  PREDICTED: uncharacterized protein LOC104703...    254   6e-76   
ref|XP_009787105.1|  PREDICTED: uncharacterized protein LOC104235125    254   6e-76   
ref|XP_002985391.1|  hypothetical protein SELMODRAFT_269002             252   6e-76   
gb|KJB07478.1|  hypothetical protein B456_001G026300                    253   7e-76   
ref|XP_006465683.1|  PREDICTED: uncharacterized protein LOC102607770    254   7e-76   
ref|XP_006426889.1|  hypothetical protein CICLE_v10025028mg             254   7e-76   
gb|EEC71464.1|  hypothetical protein OsI_03705                          253   7e-76   
ref|NP_001044224.1|  Os01g0744300                                       254   7e-76   
gb|KJB54778.1|  hypothetical protein B456_009G048800                    251   7e-76   
ref|XP_008804602.1|  PREDICTED: uncharacterized protein LOC103717...    253   8e-76   
ref|XP_008804601.1|  PREDICTED: uncharacterized protein LOC103717...    253   8e-76   
gb|KHG27580.1|  Casein kinase I                                         254   8e-76   
ref|XP_011458971.1|  PREDICTED: uncharacterized protein LOC101301711    253   9e-76   
emb|CDP08183.1|  unnamed protein product                                254   9e-76   
ref|XP_011003700.1|  PREDICTED: uncharacterized protein LOC105110375    254   9e-76   
ref|XP_008672449.1|  PREDICTED: uncharacterized protein LOC100273...    251   9e-76   
gb|KJB54779.1|  hypothetical protein B456_009G048800                    251   1e-75   
ref|XP_002440770.1|  hypothetical protein SORBIDRAFT_09g006270          251   1e-75   
ref|XP_004497365.1|  PREDICTED: casein kinase I isoform delta-like      253   1e-75   
gb|KHG03332.1|  hypothetical protein F383_28165                         253   1e-75   
tpg|DAA52911.1|  TPA: hypothetical protein ZEAMMB73_402791              248   1e-75   
ref|XP_002303307.2|  hypothetical protein POPTR_0003s04820g             248   1e-75   
gb|KHG22911.1|  Casein kinase I                                         251   1e-75   
ref|XP_004968538.1|  PREDICTED: casein kinase I-like                    251   2e-75   
gb|EMT25395.1|  Casein kinase I-2-like protein                          250   2e-75   
ref|XP_009592153.1|  PREDICTED: uncharacterized protein LOC104089043    253   2e-75   
ref|XP_004969923.1|  PREDICTED: uncharacterized protein LOC101760429    252   2e-75   
ref|XP_004291170.1|  PREDICTED: uncharacterized protein LOC101299149    252   2e-75   
ref|NP_001169571.1|  hypothetical protein                               251   2e-75   
dbj|BAJ99167.1|  predicted protein                                      252   2e-75   
ref|XP_004510300.1|  PREDICTED: uncharacterized protein LOC101511720    253   2e-75   
ref|XP_009596024.1|  PREDICTED: uncharacterized protein LOC104092197    253   2e-75   
ref|XP_009587685.1|  PREDICTED: uncharacterized protein LOC104085378    253   3e-75   
ref|XP_003057011.1|  Serine/Threonine protein kinase                    252   3e-75   
ref|XP_005850218.1|  hypothetical protein CHLNCDRAFT_34546              250   4e-75   
ref|XP_010062521.1|  PREDICTED: uncharacterized protein LOC104449912    252   4e-75   
gb|EPS63371.1|  hypothetical protein M569_11412                         240   4e-75   
ref|XP_008226475.1|  PREDICTED: protein kinase 3                        252   4e-75   
gb|EYU29288.1|  hypothetical protein MIMGU_mgv1a002190mg                252   4e-75   
ref|XP_002298239.1|  hypothetical protein POPTR_0001s18990g             252   5e-75   
ref|XP_009776610.1|  PREDICTED: uncharacterized protein LOC104226336    252   5e-75   
ref|XP_002455001.1|  hypothetical protein SORBIDRAFT_03g002790          249   5e-75   
emb|CDM84047.1|  unnamed protein product                                250   5e-75   
ref|XP_007012164.1|  Casein kinase I protein                            252   6e-75   
ref|XP_003568762.1|  PREDICTED: uncharacterized protein LOC100825718    249   6e-75   
gb|KDO50862.1|  hypothetical protein CISIN_1g005947mg                   251   6e-75   
ref|XP_009801165.1|  PREDICTED: uncharacterized protein LOC104246947    252   6e-75   
ref|XP_002954481.1|  hypothetical protein VOLCADRAFT_76324              249   6e-75   
ref|XP_004253105.1|  PREDICTED: uncharacterized protein LOC101244359    251   6e-75   
ref|XP_007137240.1|  hypothetical protein PHAVU_009G111300g             251   6e-75   
ref|XP_001701465.1|  MUT9-related serine/threonine protein kinase       249   7e-75   
ref|XP_006451129.1|  hypothetical protein CICLE_v10007666mg             251   7e-75   
ref|XP_002882289.1|  hypothetical protein ARALYDRAFT_340491             239   7e-75   
gb|EMS66552.1|  Casein kinase I-like protein 2                          249   7e-75   
dbj|BAK02283.1|  predicted protein                                      249   8e-75   
ref|XP_009336928.1|  PREDICTED: uncharacterized protein LOC103929445    250   1e-74   
ref|XP_006342517.1|  PREDICTED: uncharacterized protein LOC102599332    251   1e-74   
ref|XP_008386593.1|  PREDICTED: uncharacterized protein LOC103449090    250   1e-74   
ref|XP_008673564.1|  PREDICTED: casein kinase I isoform X2              248   1e-74   
ref|XP_011013369.1|  PREDICTED: uncharacterized protein LOC105117...    245   1e-74   
ref|XP_007161527.1|  hypothetical protein PHAVU_001G076900g             250   1e-74   
ref|XP_008242613.1|  PREDICTED: uncharacterized protein LOC103340922    250   1e-74   
ref|XP_011013372.1|  PREDICTED: uncharacterized protein LOC105117...    245   1e-74   
ref|XP_004302863.1|  PREDICTED: uncharacterized protein LOC101305860    250   2e-74   
ref|XP_002884419.1|  hypothetical protein ARALYDRAFT_340552             239   2e-74   
ref|XP_003569789.1|  PREDICTED: serine/threonine-protein kinase VRK1    249   3e-74   
ref|XP_011092199.1|  PREDICTED: uncharacterized protein LOC105172435    250   3e-74   
ref|XP_008673563.1|  PREDICTED: uncharacterized protein LOC103649...    248   3e-74   
ref|XP_008380865.1|  PREDICTED: uncharacterized protein LOC103443751    249   3e-74   
ref|XP_008794114.1|  PREDICTED: uncharacterized protein LOC103710237    249   3e-74   
ref|XP_006643875.1|  PREDICTED: casein kinase I homolog 2-like          248   4e-74   
ref|XP_002502422.1|  predicted protein                                  247   4e-74   
gb|KJB82881.1|  hypothetical protein B456_013G219500                    247   5e-74   
ref|XP_007203777.1|  hypothetical protein PRUPE_ppa002378mg             248   5e-74   
ref|XP_010098134.1|  Casein kinase I-2-like protein                     249   5e-74   
ref|XP_006340257.1|  PREDICTED: uncharacterized protein LOC102583902    249   6e-74   
gb|EEC70115.1|  hypothetical protein OsI_00774                          247   7e-74   
ref|XP_004251171.2|  PREDICTED: uncharacterized protein LOC101245026    248   7e-74   
dbj|BAD73223.1|  putative serine/threonine protein kinase               247   7e-74   
ref|NP_001042306.1|  Os01g0198200                                       247   7e-74   
ref|XP_009353558.1|  PREDICTED: uncharacterized protein LOC103944824    249   8e-74   
gb|EMT27276.1|  Casein kinase I-2-like protein                          248   8e-74   
ref|XP_004228598.1|  PREDICTED: casein kinase I isoform gamma-3         248   1e-73   
ref|XP_006354169.1|  PREDICTED: casein kinase I isoform gamma-3-like    248   1e-73   
ref|XP_005649643.1|  MUT9-related serine/threonine protein kinase       246   1e-73   
gb|KEH36077.1|  casein kinase I-like protein                            247   1e-73   
gb|EEE54054.1|  hypothetical protein OsJ_00747                          247   2e-73   
gb|KJB27133.1|  hypothetical protein B456_004G279600                    247   2e-73   
ref|XP_004252842.1|  PREDICTED: casein kinase I-like                    245   2e-73   
gb|EYU21509.1|  hypothetical protein MIMGU_mgv1a002137mg                247   3e-73   
gb|KJB82582.1|  hypothetical protein B456_013G203000                    247   3e-73   
ref|XP_009347165.1|  PREDICTED: uncharacterized protein LOC103938...    246   4e-73   
ref|XP_009347166.1|  PREDICTED: uncharacterized protein LOC103938...    246   4e-73   
emb|CEG01140.1|  Serine/threonine-protein kinase, active site           244   8e-73   
ref|XP_011013374.1|  PREDICTED: uncharacterized protein LOC105117...    246   1e-72   
ref|XP_011013373.1|  PREDICTED: uncharacterized protein LOC105117...    246   1e-72   
ref|XP_003075213.1|  protein kinase family protein (ISS)                244   2e-72   
ref|NP_187043.1|  protein kinase-related protein                        234   2e-72   
ref|XP_001416335.1|  predicted protein                                  241   5e-72   
ref|XP_002514324.1|  casein kinase, putative                            243   5e-72   
ref|XP_008337442.1|  PREDICTED: uncharacterized protein LOC103400...    243   6e-72   
ref|XP_008337441.1|  PREDICTED: uncharacterized protein LOC103400...    243   6e-72   
ref|XP_005850945.1|  hypothetical protein CHLNCDRAFT_140695             234   6e-71   
gb|EMT06466.1|  Casein kinase I isoform alpha                           240   7e-71   
gb|EMS55265.1|  Casein kinase I isoform alpha                           240   9e-71   
ref|XP_008655345.1|  PREDICTED: hypothetical protein isoform X3         240   9e-71   
ref|XP_008655344.1|  PREDICTED: hypothetical protein isoform X2         240   9e-71   
ref|XP_007514232.1|  predicted protein                                  238   1e-70   
gb|EMS54400.1|  Casein kinase I-like protein 2                          238   2e-69   
ref|XP_003588428.1|  Casein kinase I isoform alpha                      237   2e-69   
ref|XP_010690200.1|  PREDICTED: casein kinase I isoform gamma-2-like    235   3e-69   
gb|KHG22741.1|  Casein kinase I isoform delta                           234   4e-69   
gb|KJB54170.1|  hypothetical protein B456_009G024100                    234   1e-68   
ref|XP_009781261.1|  PREDICTED: casein kinase I isoform gamma-3         234   1e-68   
ref|XP_009625624.1|  PREDICTED: casein kinase I isoform gamma-3-like    234   2e-68   
ref|XP_006299519.1|  hypothetical protein CARUB_v10015691mg             222   3e-68   
gb|KJB54173.1|  hypothetical protein B456_009G024100                    231   1e-67   
ref|XP_008655343.1|  PREDICTED: hypothetical protein isoform X1         230   8e-67   
gb|KDD72198.1|  hypothetical protein H632_c3713p0                       219   9e-67   
gb|KDD76924.1|  hypothetical protein H632_c65p1                         228   1e-66   
ref|XP_011396021.1|  Casein kinase I isoform delta-like protein         226   2e-66   
ref|XP_004309533.2|  PREDICTED: casein kinase I isoform delta-A-like    226   3e-66   
ref|XP_010088832.1|  Casein kinase I isoform alpha                      226   2e-65   
ref|XP_007014776.1|  Kinase family protein isoform 3                    225   4e-65   
ref|XP_004963352.1|  PREDICTED: probable casein kinase I homolog ...    223   5e-65   
tpg|DAA35739.1|  TPA: putative homeodomain-like transcription fac...    223   1e-63   
gb|AET01488.2|  casein kinase I-like protein                            221   2e-63   
gb|KJB46017.1|  hypothetical protein B456_007G343500                    221   2e-63   
ref|XP_010915572.1|  PREDICTED: uncharacterized protein LOC105040...    220   6e-63   
ref|XP_010915562.1|  PREDICTED: uncharacterized protein LOC105040...    220   6e-63   
gb|EMT12651.1|  Casein kinase I-2-like protein                          220   8e-63   
ref|XP_010915554.1|  PREDICTED: uncharacterized protein LOC105040...    220   8e-63   
ref|XP_010915546.1|  PREDICTED: uncharacterized protein LOC105040...    220   9e-63   
gb|AAP80674.1|  casein kinase-like protein                              203   1e-62   
ref|XP_003627012.1|  Casein kinase-like protein                         219   1e-62   
gb|EPS62497.1|  hypothetical protein M569_12290                         217   2e-62   
ref|XP_002443446.1|  hypothetical protein SORBIDRAFT_08g019600          217   3e-62   
gb|KFK37829.1|  hypothetical protein AALP_AA3G034600                    210   5e-62   
gb|KJB07477.1|  hypothetical protein B456_001G026300                    216   5e-62   
emb|CAN74986.1|  hypothetical protein VITISV_008771                     221   1e-61   
gb|AFW85111.1|  hypothetical protein ZEAMMB73_338907                    206   5e-61   
ref|XP_010229461.1|  PREDICTED: casein kinase I isoform alpha-like      209   1e-59   
tpg|DAA56574.1|  TPA: hypothetical protein ZEAMMB73_926529              204   2e-59   
ref|XP_002958584.1|  histone kinase                                     209   3e-59   
ref|XP_011400089.1|  Casein kinase I-like protein 2                     206   4e-59   
ref|XP_001695320.1|  serine/threonine protein kinase, transcripti...    209   5e-59   
gb|AIS72786.1|  casein kinase-like protein                              192   1e-58   
ref|XP_004245392.1|  PREDICTED: uncharacterized protein LOC101249392    205   8e-58   
ref|XP_008452134.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    190   1e-56   
gb|KJB54177.1|  hypothetical protein B456_009G024100                    201   1e-56   
gb|EMT07061.1|  Casein kinase I-2-like protein                          203   2e-56   
ref|XP_006574072.1|  PREDICTED: LOW QUALITY PROTEIN: casein kinas...    198   9e-56   
ref|XP_002458472.1|  hypothetical protein SORBIDRAFT_03g034330          184   1e-55   
gb|AEO89321.1|  serine/threonine protein kinase                         194   8e-54   
gb|EMT25758.1|  Casein kinase I isoform delta-like protein              187   3e-51   
gb|EMS61861.1|  Casein kinase I isoform delta-like protein              186   1e-50   
gb|EMT21083.1|  Casein kinase I-2-like protein                          185   1e-50   
gb|KIY93350.1|  hypothetical protein MNEG_14612                         170   4e-50   
gb|AEW08952.1|  hypothetical protein CL2426Contig1_01                   168   2e-49   
ref|XP_005648473.1|  kinase-like protein                                177   1e-47   
ref|XP_010103948.1|  hypothetical protein L484_020200                   162   4e-45   
ref|XP_010090279.1|  hypothetical protein L484_001310                   166   2e-44   
gb|EYU34156.1|  hypothetical protein MIMGU_mgv1a003255mg                160   5e-42   
ref|XP_010109262.1|  hypothetical protein L484_014856                   156   2e-41   
ref|XP_010090282.1|  hypothetical protein L484_001313                   152   4e-41   



>ref|NP_001183608.1| uncharacterized protein LOC100502202 [Zea mays]
 gb|ACR37739.1| unknown [Zea mays]
Length=162

 Score =   281 bits (718),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQV
Sbjct  22   LVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQV  81

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS H
Sbjct  82   VELDFLYPSEGIHRRWENGYRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNH  141

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLYIASICYGRTV
Sbjct  142  VKEKWAKNLYIASICYGRTV  161



>gb|AAM91528.1| putative casein kinase [Arabidopsis thaliana]
Length=303

 Score =   285 bits (729),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQV
Sbjct  163  LVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQV  222

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTH
Sbjct  223  VELDFLYPSEGIHRRWESGYRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTH  282

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASICYGRTVC
Sbjct  283  VKEKWAKNLYIASICYGRTVC  303



>emb|CDP14324.1| unnamed protein product [Coffea canephora]
Length=709

 Score =   296 bits (757),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW
Sbjct  555  YYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  614

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE
Sbjct  615  GVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  674

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  675  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  709


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 68/122 (56%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + ++K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  489  YNVADSRLRQHVDKGNEDGLYISCVASATNLWALIMDAGTGFSSQVYELSAVFLHKDWIM  548

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  549  EQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  605

Query  257  SI  252
            S+
Sbjct  606  SM  607



>ref|XP_011075041.1| PREDICTED: uncharacterized protein LOC105159627 [Sesamum indicum]
Length=705

 Score =   296 bits (757),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW
Sbjct  551  YYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  610

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE
Sbjct  611  GVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  670

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  671  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  705



>gb|EPS68531.1| hypothetical protein M569_06230 [Genlisea aurea]
Length=704

 Score =   295 bits (756),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW
Sbjct  550  FYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  609

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAF+LSIPRRKMMDE
Sbjct  610  GVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFVLSIPRRKMMDE  669

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPS+HVKEKWSKNLYIASICYGRTVC
Sbjct  670  TQETLRTSAFPSSHVKEKWSKNLYIASICYGRTVC  704



>gb|KDO55049.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=537

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAG+RWGVVMSRN+GYSEQV
Sbjct  397  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGNRWGVVMSRNSGYSEQV  456

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILS+PRRKM+DETQETLRTSAFPSTH
Sbjct  457  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRRKMVDETQETLRTSAFPSTH  516

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKWSKNLYIASICYGRTVC
Sbjct  517  VKEKWSKNLYIASICYGRTVC  537



>ref|XP_009615719.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615725.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615727.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615731.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
Length=708

 Score =   294 bits (752),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 151/155 (97%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW
Sbjct  554  YYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  613

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILS+PRRKM+DE
Sbjct  614  GVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRRKMIDE  673

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  674  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 69/123 (56%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + ++K  ++G +++ + +A + W ++M    G+S QV +L   FL+  + I
Sbjct  488  YNVADSRLQQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSAVFLH-KDWI  546

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  260  ASI  252
             S+
Sbjct  604  TSM  606



>ref|XP_009621585.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621586.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621587.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
Length=714

 Score =   294 bits (752),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 151/155 (97%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW
Sbjct  560  YYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  619

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILS+PRRKM+DE
Sbjct  620  GVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRRKMIDE  679

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  680  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  714


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 68/122 (56%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + ++K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  494  YNVADSRLRQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSAVFLHKDWIM  553

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  554  EQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  610

Query  257  SI  252
            S+
Sbjct  611  SM  612



>ref|XP_009771625.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771626.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771627.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
Length=714

 Score =   294 bits (752),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 151/155 (97%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW
Sbjct  560  YYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  619

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILS+PRRKM+DE
Sbjct  620  GVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRRKMIDE  679

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  680  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  714


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 68/122 (56%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + ++K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  494  YNVADSRLRQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSAVFLHKDWIM  553

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  554  EQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  610

Query  257  SI  252
            S+
Sbjct  611  SM  612



>ref|XP_009788026.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788027.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788028.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788029.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
Length=708

 Score =   294 bits (752),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 151/155 (97%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW
Sbjct  554  YYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  613

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILS+PRRKM+DE
Sbjct  614  GVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRRKMIDE  673

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  674  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 69/123 (56%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + ++K  ++G +++ + +A + W ++M    G+S QV +L   FL+  + I
Sbjct  488  YNVADSRLQQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSAVFLH-KDWI  546

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  260  ASI  252
             S+
Sbjct  604  TSM  606



>ref|XP_002525432.1| casein kinase, putative [Ricinus communis]
 gb|EEF36922.1| casein kinase, putative [Ricinus communis]
Length=705

 Score =   293 bits (751),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 150/155 (97%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISSIAGA+NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAG+RW
Sbjct  551  FYISSIAGASNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGNRW  610

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAGYS+QVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIP+RKM+DE
Sbjct  611  GVVMSRNAGYSDQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPKRKMVDE  670

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  671  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  705



>gb|AAO41895.1| putative casein kinase [Arabidopsis thaliana]
Length=307

 Score =   281 bits (718),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTTAG+RWGVVMSRN+GYS+QV
Sbjct  167  LVVMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGYSDQV  226

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPS+GIHRRWESGYRITSMAATADQAAFILS+P+RKMMDETQETLRT+AFPSTH
Sbjct  227  VELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSVPKRKMMDETQETLRTTAFPSTH  286

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASIC+GRTVC
Sbjct  287  VKEKWAKNLYIASICFGRTVC  307



>ref|XP_006443418.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 ref|XP_006479105.1| PREDICTED: uncharacterized protein LOC102619111 isoform X2 [Citrus 
sinensis]
 gb|ESR56658.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 gb|KDO55047.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=704

 Score =   292 bits (748),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAG+RWGVVMSRN+GYSEQV
Sbjct  564  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGNRWGVVMSRNSGYSEQV  623

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILS+PRRKM+DETQETLRTSAFPSTH
Sbjct  624  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRRKMVDETQETLRTSAFPSTH  683

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKWSKNLYIASICYGRTVC
Sbjct  684  VKEKWSKNLYIASICYGRTVC  704



>ref|XP_004147533.1| PREDICTED: uncharacterized protein LOC101221479 [Cucumis sativus]
 gb|KGN53942.1| Casein kinase [Cucumis sativus]
Length=708

 Score =   292 bits (747),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 150/155 (97%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW
Sbjct  554  FYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  613

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRIT MAATADQAAFILSIP+RK+MDE
Sbjct  614  GVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITCMAATADQAAFILSIPKRKLMDE  673

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  674  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + I K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  488  YNVADSRLRQHIEKGNEDGLLISCVASASNLWALIMDAGTGFSSQVYELSSVFLH-KDWI  546

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  + I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNFYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  260  ASI  252
             S+
Sbjct  604  TSM  606



>ref|XP_006479104.1| PREDICTED: uncharacterized protein LOC102619111 isoform X1 [Citrus 
sinensis]
 gb|KDO55048.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=708

 Score =   292 bits (747),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAG+RWGVVMSRN+GYSEQV
Sbjct  568  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGNRWGVVMSRNSGYSEQV  627

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILS+PRRKM+DETQETLRTSAFPSTH
Sbjct  628  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRRKMVDETQETLRTSAFPSTH  687

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKWSKNLYIASICYGRTVC
Sbjct  688  VKEKWSKNLYIASICYGRTVC  708



>ref|XP_004249304.1| PREDICTED: uncharacterized protein LOC101268442 [Solanum lycopersicum]
Length=709

 Score =   292 bits (747),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 150/155 (97%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW
Sbjct  555  YYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  614

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAGY+EQVVELDFLYPSEGIHRRWE G+RITSMAATADQAAFILSIPRRKM+DE
Sbjct  615  GVVMSRNAGYAEQVVELDFLYPSEGIHRRWEGGFRITSMAATADQAAFILSIPRRKMIDE  674

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  675  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  709


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 69/123 (56%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + ++K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  489  YNVADTRLRQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSAAFLH-KDWI  547

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  548  MEQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  604

Query  260  ASI  252
             S+
Sbjct  605  TSM  607



>ref|XP_008441978.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
 ref|XP_008441979.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
Length=708

 Score =   292 bits (747),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 150/155 (97%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW
Sbjct  554  FYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  613

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRIT MAATADQAAFILSIP+RK+MDE
Sbjct  614  GVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITCMAATADQAAFILSIPKRKLMDE  673

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  674  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + I K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  488  YNVADSRLRQHIEKGNEDGLLISCVASASNLWALIMDAGTGFSSQVYELSSVFLH-KDWI  546

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  + I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNFYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  260  ASI  252
             S+
Sbjct  604  TSM  606



>ref|XP_011078778.1| PREDICTED: uncharacterized protein LOC105162459 [Sesamum indicum]
Length=705

 Score =   291 bits (746),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 150/155 (97%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW
Sbjct  551  YYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  610

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITSMAAT DQAAFILSIPRRKM+DE
Sbjct  611  GVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSMAATGDQAAFILSIPRRKMIDE  670

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  671  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  705



>ref|XP_002325416.1| kinase family protein [Populus trichocarpa]
 gb|EEE99797.1| kinase family protein [Populus trichocarpa]
Length=720

 Score =   291 bits (746),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYS+QV
Sbjct  580  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSDQV  639

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESG+RITSMAATADQAAFILSIP+RKM+DETQETLRTSAFPSTH
Sbjct  640  VELDFLYPSEGIHRRWESGFRITSMAATADQAAFILSIPKRKMVDETQETLRTSAFPSTH  699

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKWSKNLYIASICYGRTVC
Sbjct  700  VKEKWSKNLYIASICYGRTVC  720



>ref|XP_011021493.1| PREDICTED: uncharacterized protein LOC105123555 [Populus euphratica]
Length=707

 Score =   291 bits (746),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYS+QV
Sbjct  567  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSDQV  626

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESG+RITSMAATADQAAFILSIP+RKM+DETQETLRTSAFPSTH
Sbjct  627  VELDFLYPSEGIHRRWESGFRITSMAATADQAAFILSIPKRKMVDETQETLRTSAFPSTH  686

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKWSKNLYIASICYGRTVC
Sbjct  687  VKEKWSKNLYIASICYGRTVC  707



>gb|EYU20664.1| hypothetical protein MIMGU_mgv1a002165mg [Erythranthe guttata]
Length=706

 Score =   291 bits (746),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YISSIAGAANGSSLV+MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAG+RW
Sbjct  552  YYISSIAGAANGSSLVIMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGNRW  611

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRIT+MAATADQ AFILSIPRRKMMDE
Sbjct  612  GVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITAMAATADQGAFILSIPRRKMMDE  671

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  672  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  706


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 67/122 (55%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + + K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  486  YNVADSRLRQHVEKGNEDGLYISCVASASNLWALIMDAGTGFSSQVYELSAVFLHKDWIM  545

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  546  EQWEKNYYISSIAGAANGSSLVI---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  602

Query  257  SI  252
            S+
Sbjct  603  SM  604



>ref|XP_004157014.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101221479 
[Cucumis sativus]
Length=742

 Score =   292 bits (748),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 150/155 (97%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW
Sbjct  588  FYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  647

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRIT MAATADQAAFILSIP+RK+MDE
Sbjct  648  GVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITCMAATADQAAFILSIPKRKLMDE  707

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  708  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  742


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + I K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  522  YNVADSRLRQHIEKGNEDGLLISCVASASNLWALIMDAGTGFSSQVYELSSVFLH-KDWI  580

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  + I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  581  MEQWEKNFYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  637

Query  260  ASI  252
             S+
Sbjct  638  TSM  640



>ref|XP_006351365.1| PREDICTED: uncharacterized protein LOC102603072 [Solanum tuberosum]
Length=709

 Score =   291 bits (744),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 136/141 (96%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAG+RWGVVMSRNAGY+EQV
Sbjct  569  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGNRWGVVMSRNAGYAEQV  628

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE G+RITSMAATADQAAFILSIPRRKM+DETQETLRTSAFPSTH
Sbjct  629  VELDFLYPSEGIHRRWEGGFRITSMAATADQAAFILSIPRRKMIDETQETLRTSAFPSTH  688

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKWSKNLYIASICYGRTVC
Sbjct  689  VKEKWSKNLYIASICYGRTVC  709


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + ++K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  489  YNVADTRLRQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSAAFLH-KDWI  547

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  548  MEQWEKNYYISSIAGATNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  604

Query  260  ASI  252
             S+
Sbjct  605  TSM  607



>ref|XP_010088042.1| Casein kinase I isoform delta [Morus notabilis]
 gb|EXB31261.1| Casein kinase I isoform delta [Morus notabilis]
Length=706

 Score =   291 bits (744),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 149/155 (96%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW
Sbjct  552  FYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  611

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAGY+EQVVELDFLYPSEGIH+RWE+GYRITSMAATADQAAFILSIP+RK+MDE
Sbjct  612  GVVMSRNAGYAEQVVELDFLYPSEGIHKRWENGYRITSMAATADQAAFILSIPKRKLMDE  671

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPS+HVKEKWSKNLYIASICYGRTVC
Sbjct  672  TQETLRTSAFPSSHVKEKWSKNLYIASICYGRTVC  706



>gb|KDP39706.1| hypothetical protein JCGZ_02726 [Jatropha curcas]
Length=705

 Score =   290 bits (742),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/141 (96%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTP+TQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAG+S+QV
Sbjct  565  LVVMSKGTPFTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGFSDQV  624

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIP+RKM+DETQETLRTSAFPSTH
Sbjct  625  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPKRKMVDETQETLRTSAFPSTH  684

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKWSKNLYIASICYGRTVC
Sbjct  685  VKEKWSKNLYIASICYGRTVC  705



>gb|AAF00624.1|AC009540_1 unknown protein, 5' partial [Arabidopsis thaliana]
Length=494

 Score =   284 bits (726),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQV
Sbjct  354  LVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQV  413

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTH
Sbjct  414  VELDFLYPSEGIHRRWESGYRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTH  473

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASICYGRTVC
Sbjct  474  VKEKWAKNLYIASICYGRTVC  494



>ref|XP_009366444.1| PREDICTED: uncharacterized protein LOC103956210 [Pyrus x bretschneideri]
Length=707

 Score =   289 bits (740),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAG+RW
Sbjct  553  FYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGNRW  612

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAG+S+QVVELDF+YPSEGIHRRWESGYRITSMAATADQAAFILSIP+RK+MDE
Sbjct  613  GVVMSRNAGFSDQVVELDFVYPSEGIHRRWESGYRITSMAATADQAAFILSIPKRKLMDE  672

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPS+HVKEKWSKNLYIASICYGRTVC
Sbjct  673  TQETLRTSAFPSSHVKEKWSKNLYIASICYGRTVC  707



>ref|XP_007204249.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
 gb|EMJ05448.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
Length=707

 Score =   289 bits (740),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAG RW
Sbjct  553  FYISSIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGIRW  612

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAGYS+QVVELDFLYPSEGIHRRWESGYRITSMAAT DQAAFILSIP+RK+MDE
Sbjct  613  GVVMSRNAGYSDQVVELDFLYPSEGIHRRWESGYRITSMAATTDQAAFILSIPKRKLMDE  672

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPS+HVKEKWSKNLYIASICYGRTVC
Sbjct  673  TQETLRTSAFPSSHVKEKWSKNLYIASICYGRTVC  707


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + ++K  ++G  ++S+ +A + W ++M    G+S QV EL   FL+  + I
Sbjct  487  YNVADTRLSQHVDKGNEDGLFISSVASAANLWALIMDAGTGFSSQVYELSTVFLH-KDWI  545

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  + I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  546  MEQWEKNFYISSIAGATNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  602

Query  260  ASI  252
             S+
Sbjct  603  TSM  605



>emb|CBI29940.3| unnamed protein product [Vitis vinifera]
Length=593

 Score =   286 bits (732),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/141 (95%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GY++QV
Sbjct  453  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYTDQV  512

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE GYRITSMAAT DQAAFILSIP+RKMMDETQETLRTSAFPSTH
Sbjct  513  VELDFLYPSEGIHRRWECGYRITSMAATNDQAAFILSIPKRKMMDETQETLRTSAFPSTH  572

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKWSKNLYIA+ICYGRTVC
Sbjct  573  VKEKWSKNLYIAAICYGRTVC  593


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 67/122 (55%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + + K  ++G H++ + ++ + W ++M    GYS QV EL  ++  +  I 
Sbjct  373  YNVADSRLPQHVEKGNEDGLHISCVASSSNLWALIMDAGTGYSSQVYELSAVFLHKDWIM  432

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  433  EQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  489

Query  257  SI  252
            S+
Sbjct  490  SM  491



>ref|XP_007030718.1| Kinase family protein [Theobroma cacao]
 gb|EOY11220.1| Kinase family protein [Theobroma cacao]
Length=705

 Score =   289 bits (739),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YISSIAGA N SSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW
Sbjct  551  YYISSIAGANNASSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  610

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRN+G+S+QVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIP+RKMMDE
Sbjct  611  GVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPKRKMMDE  670

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  671  TQETLRTSAFPSAHVKEKWAKNLYIASICYGRTVC  705



>ref|XP_010036218.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036219.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036220.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036222.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 gb|KCW47748.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47749.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47750.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
Length=702

 Score =   288 bits (738),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 135/141 (96%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSE+FPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+G+S+QV
Sbjct  562  LVVMSKGTPYTQQSYKVSEAFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGFSDQV  621

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIP+RK+MDETQETLRTSAFPSTH
Sbjct  622  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPKRKVMDETQETLRTSAFPSTH  681

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKWSKNLYIASICYGRTVC
Sbjct  682  VKEKWSKNLYIASICYGRTVC  702


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/122 (24%), Positives = 66/122 (54%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V+++   + + K  ++G  ++ + ++ + W ++M    G+S QV EL  ++  +  I 
Sbjct  482  YNVADTRLNQHVEKGNEDGLFISCVASSSNLWALIMDAGTGFSSQVYELSAVFLHKDWIM  541

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A  ++ ++ ++     K    TQ++ + S AFP   + +KW +  ++ 
Sbjct  542  EQWERNYYISSIAGASNGSSLVV---MSKGTPYTQQSYKVSEAFPFKWINKKWKEGFHVT  598

Query  257  SI  252
            S+
Sbjct  599  SM  600



>ref|XP_004288418.1| PREDICTED: uncharacterized protein LOC101290807 [Fragaria vesca 
subsp. vesca]
Length=692

 Score =   288 bits (738),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAG+RW
Sbjct  538  FYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGNRW  597

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRITSMAAT+DQAAFILSIP+RK+MDE
Sbjct  598  GVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATSDQAAFILSIPKRKLMDE  657

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPS+HVKEKWSKNLYIASIC+GRTVC
Sbjct  658  TQETLRTSAFPSSHVKEKWSKNLYIASICFGRTVC  692


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 69/123 (56%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + ++K  ++G +++S+ +A + W ++M    G+S QV EL   FL+  + I
Sbjct  472  YNVADSRLRQHVDKGNEDGLYISSVASAANLWALIMDAGTGFSSQVYELSAVFLH-KDWI  530

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +W+  + I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  531  MEQWDKNFYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  587

Query  260  ASI  252
             S+
Sbjct  588  TSM  590



>ref|XP_003548750.1| PREDICTED: uncharacterized protein LOC100801967 isoform X1 [Glycine 
max]
 ref|XP_006598981.1| PREDICTED: uncharacterized protein LOC100801967 isoform X2 [Glycine 
max]
 gb|KHN46781.1| Casein kinase I like hhp1 [Glycine soja]
Length=709

 Score =   288 bits (738),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/141 (95%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYS+QV
Sbjct  569  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSDQV  628

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITSMAAT+DQAAFILSIP+RK++DETQETLRTSAFPSTH
Sbjct  629  VELDFLYPSEGIHRRWENGYRITSMAATSDQAAFILSIPKRKLLDETQETLRTSAFPSTH  688

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASICYGRTVC
Sbjct  689  VKEKWAKNLYIASICYGRTVC  709


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + ++K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  489  YNVADTRLRQHVDKGIEDGLYISCVASAANLWALIMDAGTGFSSQVYELSPAFLH-KDWI  547

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  548  MEQWEKNYYISSIAGAVNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  604

Query  260  ASI  252
             S+
Sbjct  605  TSM  607



>ref|XP_008240478.1| PREDICTED: uncharacterized protein LOC103338977 [Prunus mume]
Length=707

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAG RW
Sbjct  553  FYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGIRW  612

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAGYS+QVVELDFLYPSEGIHRRWESGYRITSMAAT DQAAFILSIP+RK+MDE
Sbjct  613  GVVMSRNAGYSDQVVELDFLYPSEGIHRRWESGYRITSMAATTDQAAFILSIPKRKLMDE  672

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPS+HVKEKWSKNLYIASIC+GRTVC
Sbjct  673  TQETLRTSAFPSSHVKEKWSKNLYIASICHGRTVC  707


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + ++K  ++G  ++S+ +A + W ++M    G+S QV EL   FL+  + I
Sbjct  487  YNVADTRLSQHVDKGNEDGLFISSVASASNLWALIMDAGTGFSSQVYELSTVFLH-KDWI  545

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  + I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  546  MEQWEKNFYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  602

Query  260  ASI  252
             S+
Sbjct  603  TSM  605



>gb|KJB45108.1| hypothetical protein B456_007G289500 [Gossypium raimondii]
Length=706

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/141 (96%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAG+S+QV
Sbjct  566  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGFSDQV  625

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITSMAAT DQAAFILSIP+RK MDETQETLRTSAFPSTH
Sbjct  626  VELDFLYPSEGIHRRWESGYRITSMAATVDQAAFILSIPKRKTMDETQETLRTSAFPSTH  685

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASICYGRTVC
Sbjct  686  VKEKWAKNLYIASICYGRTVC  706



>ref|XP_004493152.1| PREDICTED: uncharacterized protein LOC101504885 isoform X1 [Cicer 
arietinum]
 ref|XP_004493153.1| PREDICTED: uncharacterized protein LOC101504885 isoform X2 [Cicer 
arietinum]
Length=708

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/141 (95%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYS+QV
Sbjct  568  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSDQV  627

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+ YRITSMAAT+DQAAFILSIP+RK++DETQETLRTSAFPSTH
Sbjct  628  VELDFLYPSEGIHRRWENNYRITSMAATSDQAAFILSIPKRKLLDETQETLRTSAFPSTH  687

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKWSKNLYIASICYGRTVC
Sbjct  688  VKEKWSKNLYIASICYGRTVC  708


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + ++K  ++G +++ + ++ + W ++M    G+S QV EL   FL+  + I
Sbjct  488  YNVADNRLRQHVDKGIEDGLYISCVASSANLWALIMDAGTGFSSQVYELSPAFLH-KDWI  546

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNYYISSIAGAVNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  260  ASI  252
             S+
Sbjct  604  TSM  606



>ref|XP_002281952.1| PREDICTED: uncharacterized protein LOC100267624 [Vitis vinifera]
 emb|CAN59733.1| hypothetical protein VITISV_003914 [Vitis vinifera]
Length=708

 Score =   287 bits (734),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/141 (95%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GY++QV
Sbjct  568  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYTDQV  627

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE GYRITSMAAT DQAAFILSIP+RKMMDETQETLRTSAFPSTH
Sbjct  628  VELDFLYPSEGIHRRWECGYRITSMAATNDQAAFILSIPKRKMMDETQETLRTSAFPSTH  687

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKWSKNLYIA+ICYGRTVC
Sbjct  688  VKEKWSKNLYIAAICYGRTVC  708


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/123 (28%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + + K  ++G H++ + ++ + W ++M    GYS QV EL   FL+  + I
Sbjct  488  YNVADSRLPQHVEKGNEDGLHISCVASSSNLWALIMDAGTGYSSQVYELSAVFLH-KDWI  546

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  260  ASI  252
             S+
Sbjct  604  TSM  606



>gb|ABR25333.1| protein kinase family protein [Oryza sativa Indica Group]
Length=137

 Score =   269 bits (687),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  641  SKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD  462
            SKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRNAGYS QVVELD
Sbjct  1    SKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNAGYSHQVVELD  60

Query  461  FLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEK  282
            FLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK MDETQETLRTS+FPS HVKEK
Sbjct  61   FLYPSEGIHRRWETGYRITSTAATPDQAAFILSIPKRKPMDETQETLRTSSFPSNHVKEK  120

Query  281  WSKNLYIASICYGRTVC  231
            WSKNLYIASICYGRTVC
Sbjct  121  WSKNLYIASICYGRTVC  137



>ref|XP_003624626.1| Casein kinase I isoform alpha [Medicago truncatula]
 gb|AES80844.1| casein kinase I-like protein [Medicago truncatula]
Length=708

 Score =   286 bits (733),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/141 (95%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYS+QV
Sbjct  568  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSDQV  627

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+ YRITSMAAT DQAAFILSIP+RK++DETQETLRTSAFPSTH
Sbjct  628  VELDFLYPSEGIHRRWENNYRITSMAATNDQAAFILSIPKRKLLDETQETLRTSAFPSTH  687

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKWSKNLYIASICYGRTVC
Sbjct  688  VKEKWSKNLYIASICYGRTVC  708


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + ++K  ++G +++ + ++ + W ++M    G+S QV EL   FL+  + I
Sbjct  488  YNVADNRLRQHVDKGIEDGLYISCVASSANLWALIMDAGTGFSSQVYELSPAFLH-KDWI  546

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNYYISSIAGAVNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  260  ASI  252
             S+
Sbjct  604  TSM  606



>ref|XP_010558719.1| PREDICTED: uncharacterized protein LOC104827271 isoform X1 [Tarenaya 
hassleriana]
Length=703

 Score =   286 bits (732),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/141 (94%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYS+QV
Sbjct  563  LVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSDQV  622

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE GYRITSMAATADQAAFILSIP+RKM+DETQETLRT+AFPSTH
Sbjct  623  VELDFLYPSEGIHRRWEGGYRITSMAATADQAAFILSIPKRKMLDETQETLRTTAFPSTH  682

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VK+KW+KNLYIASICYGRTVC
Sbjct  683  VKDKWAKNLYIASICYGRTVC  703



>ref|XP_010558720.1| PREDICTED: uncharacterized protein LOC104827271 isoform X2 [Tarenaya 
hassleriana]
Length=704

 Score =   286 bits (732),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/141 (94%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYS+QV
Sbjct  564  LVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSDQV  623

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE GYRITSMAATADQAAFILSIP+RKM+DETQETLRT+AFPSTH
Sbjct  624  VELDFLYPSEGIHRRWEGGYRITSMAATADQAAFILSIPKRKMLDETQETLRTTAFPSTH  683

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VK+KW+KNLYIASICYGRTVC
Sbjct  684  VKDKWAKNLYIASICYGRTVC  704



>gb|ADE75678.1| unknown [Picea sitchensis]
Length=260

 Score =   273 bits (697),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYIS+IAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWI+KKWKEGF+VTSMTTAGSRW
Sbjct  106  FYISAIAGATNGSSLVVMSKGTPYTQQSYKVSDSFPFKWISKKWKEGFYVTSMTTAGSRW  165

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAG+S+QVVELDFLYPSEGIHRRWE+GYRIT+ AAT DQAAFILS+P+RK+ DE
Sbjct  166  GVVMSRNAGFSDQVVELDFLYPSEGIHRRWENGYRITATAATCDQAAFILSVPKRKLTDE  225

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFPSTHVKEKWSKNLYIA++CYGRTV
Sbjct  226  TQETLRTSAFPSTHVKEKWSKNLYIAAVCYGRTV  259



>emb|CDY29971.1| BnaC01g40370D [Brassica napus]
Length=703

 Score =   286 bits (731),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSRW
Sbjct  549  FYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSRW  608

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRN+GYSEQVVELDFLYPSEGIHRRWESG+RITSMAATADQAA ILSIP+RK+ DE
Sbjct  609  GVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITSMAATADQAALILSIPKRKITDE  668

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPSTHVKEKW+KNLY+ASICYGRTVC
Sbjct  669  TQETLRTSAFPSTHVKEKWTKNLYLASICYGRTVC  703


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+E+   K + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  483  YNVAETRLQKHVEKGTEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLH-KDWI  541

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  + I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  542  MEQWEKNFYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  598

Query  260  ASI  252
             S+
Sbjct  599  TSM  601



>ref|XP_007161937.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
 gb|ESW33931.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
Length=708

 Score =   286 bits (732),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 132/141 (94%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYS+QV
Sbjct  568  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSDQV  627

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VE+DFLYPSEGIHRRWE+GYRITSMAAT+DQAAFILSIP+RK++DETQETLRTSAFPSTH
Sbjct  628  VEIDFLYPSEGIHRRWENGYRITSMAATSDQAAFILSIPKRKLLDETQETLRTSAFPSTH  687

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASICYGRTVC
Sbjct  688  VKEKWAKNLYIASICYGRTVC  708


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/122 (23%), Positives = 66/122 (54%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V+++   + ++K  ++G +++ + ++ + W ++M    G+S QV EL   +  +  I 
Sbjct  488  YNVADTRLRQHVDKGIEDGLYISCVASSANLWALIMDAGTGFSSQVYELSLAFLHKDWIM  547

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  548  EQWEKNYYISSIAGAVNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  604

Query  257  SI  252
            S+
Sbjct  605  SM  606



>ref|NP_187044.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AAF05853.1|AC011698_4 putative casein kinase [Arabidopsis thaliana]
 gb|AEE74014.1| protein kinase family protein [Arabidopsis thaliana]
Length=701

 Score =   286 bits (731),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQV
Sbjct  561  LVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQV  620

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTH
Sbjct  621  VELDFLYPSEGIHRRWESGYRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTH  680

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASICYGRTVC
Sbjct  681  VKEKWAKNLYIASICYGRTVC  701



>gb|KHG27523.1| hypothetical protein F383_15264 [Gossypium arboreum]
Length=706

 Score =   286 bits (731),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT+GSRWGVVMSRN+G+S+QV
Sbjct  566  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTSGSRWGVVMSRNSGFSDQV  625

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITSMAAT DQAAFILSIP+RK MDETQETLRTSAFPSTH
Sbjct  626  VELDFLYPSEGIHRRWESGYRITSMAATGDQAAFILSIPKRKTMDETQETLRTSAFPSTH  685

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASICYGRTVC
Sbjct  686  VKEKWAKNLYIASICYGRTVC  706



>ref|XP_006297091.1| hypothetical protein CARUB_v10013094mg [Capsella rubella]
 gb|EOA29989.1| hypothetical protein CARUB_v10013094mg [Capsella rubella]
Length=701

 Score =   285 bits (730),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQV
Sbjct  561  LVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQV  620

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTH
Sbjct  621  VELDFLYPSEGIHRRWESGYRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTH  680

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASICYGRTVC
Sbjct  681  VKEKWAKNLYIASICYGRTVC  701


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  481  YNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLH-KDWI  539

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  540  MEQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  596

Query  260  ASI  252
             S+
Sbjct  597  TSM  599



>ref|XP_006408240.1| hypothetical protein EUTSA_v10020173mg [Eutrema salsugineum]
 gb|ESQ49693.1| hypothetical protein EUTSA_v10020173mg [Eutrema salsugineum]
Length=701

 Score =   285 bits (730),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQV
Sbjct  561  LVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQV  620

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTH
Sbjct  621  VELDFLYPSEGIHRRWESGYRITSMAATADQAALILSIPKRKISDETQETLRTSAFPSTH  680

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VK+KW+KNLYIASICYGRTVC
Sbjct  681  VKDKWAKNLYIASICYGRTVC  701


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y VS++   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  481  YNVSDTRLHQHVEKGNEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLH-KDWI  539

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A + + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  540  MEQWEKNYYISSIAGSNNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  596

Query  260  ASI  252
             S+
Sbjct  597  TSM  599



>ref|XP_002884421.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60680.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=702

 Score =   285 bits (730),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQV
Sbjct  562  LVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQV  621

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTH
Sbjct  622  VELDFLYPSEGIHRRWESGYRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTH  681

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASICYGRTVC
Sbjct  682  VKEKWAKNLYIASICYGRTVC  702


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  482  YNVADSRLAQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLH-KDWI  540

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  541  MEQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  597

Query  260  ASI  252
             S+
Sbjct  598  TSM  600



>gb|KHG17118.1| Casein kinase I isoform delta [Gossypium arboreum]
 gb|KHG17119.1| Casein kinase I isoform delta [Gossypium arboreum]
Length=706

 Score =   285 bits (730),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/141 (95%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTA SRWGVVMSRNAG+S+QV
Sbjct  566  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAASRWGVVMSRNAGFSDQV  625

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITSMAAT DQAAFILSIP+RK MDETQETLRTSAFPSTH
Sbjct  626  VELDFLYPSEGIHRRWESGYRITSMAATVDQAAFILSIPKRKTMDETQETLRTSAFPSTH  685

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASICYGRTVC
Sbjct  686  VKEKWAKNLYIASICYGRTVC  706


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 65/122 (53%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  486  YNVADSRLHQHVEKGNEDGLFISCVASAANLWALIMDAGTGFSSQVYELSAVFLHKDWIM  545

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  546  EQWERNYYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  602

Query  257  SI  252
            S+
Sbjct  603  SM  604



>ref|XP_010276388.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276389.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276390.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276391.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
Length=714

 Score =   285 bits (730),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQV
Sbjct  574  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQV  633

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPSTH
Sbjct  634  VELDFLYPSEGIHRRWESGYRITSTAATHDQAAFILSIPKRKLMDETQETLRTSAFPSTH  693

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKWSKNLYIASICYGRTV
Sbjct  694  VKEKWSKNLYIASICYGRTV  713



>emb|CDY21155.1| BnaA01g33860D [Brassica napus]
Length=704

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSRW
Sbjct  550  FYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSRW  609

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            G+VMSRN+GYSEQVVELDFLYPSEGIHRRWESG+RITSMAATADQAA ILSIP+RK+ DE
Sbjct  610  GIVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITSMAATADQAALILSIPKRKITDE  669

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPSTHVKEKW+KNLY+ASICYGRTVC
Sbjct  670  TQETLRTSAFPSTHVKEKWTKNLYLASICYGRTVC  704


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+E+   K + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  484  YNVAETRLQKHVEKGTEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLH-KDWI  542

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  + I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  543  MEQWEKNFYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  599

Query  260  ASI  252
             S+
Sbjct  600  TSM  602



>gb|KJB82579.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=706

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/141 (94%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYK+SESFPFKWINKKWKEGFHVTSMTTAGS WGVVMSRN+G+S+QV
Sbjct  566  LVVMSKGTPYTQQSYKLSESFPFKWINKKWKEGFHVTSMTTAGSCWGVVMSRNSGFSDQV  625

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIP+RKMMDETQETLRTSAFPSTH
Sbjct  626  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPKRKMMDETQETLRTSAFPSTH  685

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VK+KW+KNLY+ASICYGRTVC
Sbjct  686  VKDKWAKNLYLASICYGRTVC  706



>gb|KJB82583.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=707

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/141 (94%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYK+SESFPFKWINKKWKEGFHVTSMTTAGS WGVVMSRN+G+S+QV
Sbjct  567  LVVMSKGTPYTQQSYKLSESFPFKWINKKWKEGFHVTSMTTAGSCWGVVMSRNSGFSDQV  626

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIP+RKMMDETQETLRTSAFPSTH
Sbjct  627  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPKRKMMDETQETLRTSAFPSTH  686

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VK+KW+KNLY+ASICYGRTVC
Sbjct  687  VKDKWAKNLYLASICYGRTVC  707



>ref|XP_010485760.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
 ref|XP_010485761.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
 ref|XP_010485762.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
Length=701

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/141 (94%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQV
Sbjct  561  LVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQV  620

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTH
Sbjct  621  VELDFLYPSEGIHRRWENGYRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTH  680

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASICYGRTVC
Sbjct  681  VKEKWAKNLYIASICYGRTVC  701


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  481  YNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLH-KDWI  539

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  540  MEQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  596

Query  260  ASI  252
             S+
Sbjct  597  TSM  599



>ref|XP_010463863.1| PREDICTED: uncharacterized protein LOC104744499 [Camelina sativa]
Length=701

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/141 (94%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQV
Sbjct  561  LVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQV  620

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTH
Sbjct  621  VELDFLYPSEGIHRRWENGYRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTH  680

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASICYGRTVC
Sbjct  681  VKEKWAKNLYIASICYGRTVC  701


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  481  YNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLH-KDWI  539

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  540  MEQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  596

Query  260  ASI  252
             S+
Sbjct  597  TSM  599



>ref|XP_010516062.1| PREDICTED: uncharacterized protein LOC104791759 isoform X1 [Camelina 
sativa]
Length=700

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/141 (94%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQV
Sbjct  560  LVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQV  619

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTH
Sbjct  620  VELDFLYPSEGIHRRWENGYRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTH  679

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASICYGRTVC
Sbjct  680  VKEKWAKNLYIASICYGRTVC  700


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  480  YNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLH-KDWI  538

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  539  MEQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  595

Query  260  ASI  252
             S+
Sbjct  596  TSM  598



>gb|KHG04306.1| Casein kinase I-like protein [Gossypium arboreum]
Length=706

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYK+SESFPFKWINKKWKEGFHVTSMTTAGS WGVVMSRN+G+S+QV
Sbjct  566  LVVMSKGTPYTQQSYKLSESFPFKWINKKWKEGFHVTSMTTAGSCWGVVMSRNSGFSDQV  625

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITSMAATADQAAF+LSIP+RKMMDETQETLRTSAFPSTH
Sbjct  626  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFVLSIPKRKMMDETQETLRTSAFPSTH  685

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLY+AS+CYGRTVC
Sbjct  686  VKEKWAKNLYLASVCYGRTVC  706


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/144 (26%), Positives = 74/144 (51%), Gaps = 13/144 (9%)
 Frame = -2

Query  647  VMSKGTPYTQQ-SYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVV  471
            V +   P  Q+  Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV 
Sbjct  473  VFNARCPMKQRYHYNVADSRLRQHVEKGNEDGLFISCVASAANLWALIMDAGTGFSSQVY  532

Query  470  ELD--FLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPS  300
            EL   FL+  + I  +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP 
Sbjct  533  ELSTVFLH-KDWIMEQWEKNYYISSIAGATNGSSLVV---MSKGTPYTQQSYKLSESFPF  588

Query  299  THVKEKWSKNLYIASI-----CYG  243
              + +KW +  ++ S+     C+G
Sbjct  589  KWINKKWKEGFHVTSMTTAGSCWG  612



>emb|CDY42890.1| BnaC05g47610D [Brassica napus]
Length=700

 Score =   284 bits (727),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSRWG+VMSRN+GYSEQV
Sbjct  560  LVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSRWGIVMSRNSGYSEQV  619

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESG+RITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTH
Sbjct  620  VELDFLYPSEGIHRRWESGFRITSMAATADQAALILSIPKRKLTDETQETLRTSAFPSTH  679

Query  293  VKEKWSKNLYIASICYGRTVC  231
            +KEKW+KNLYIASICYGRTVC
Sbjct  680  IKEKWAKNLYIASICYGRTVC  700


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+E+   + + K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  480  YNVAETRLPQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSTVFLH-KDWI  538

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  539  MEQWEKNYYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  595

Query  260  ASI  252
             S+
Sbjct  596  TSM  598



>gb|KJB80965.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=707

 Score =   284 bits (727),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT+GSRWGVVMSRN+G+S+QV
Sbjct  567  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTSGSRWGVVMSRNSGFSDQV  626

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITSMAAT DQAAFILSIP+RK MDETQETLRTSAFPSTH
Sbjct  627  VELDFLYPSEGIHRRWENGYRITSMAATGDQAAFILSIPKRKTMDETQETLRTSAFPSTH  686

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIAS+CYGRTVC
Sbjct  687  VKEKWAKNLYIASVCYGRTVC  707



>gb|KJB80963.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80964.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80966.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=706

 Score =   284 bits (727),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT+GSRWGVVMSRN+G+S+QV
Sbjct  566  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTSGSRWGVVMSRNSGFSDQV  625

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITSMAAT DQAAFILSIP+RK MDETQETLRTSAFPSTH
Sbjct  626  VELDFLYPSEGIHRRWENGYRITSMAATGDQAAFILSIPKRKTMDETQETLRTSAFPSTH  685

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIAS+CYGRTVC
Sbjct  686  VKEKWAKNLYIASVCYGRTVC  706



>ref|XP_010672054.1| PREDICTED: uncharacterized protein LOC104888715 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=713

 Score =   284 bits (726),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISSIAGA NG+SLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTA SRW
Sbjct  559  FYISSIAGATNGASLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAASRW  618

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAG+++QVVELDFLYPSEGIHRRWESGYRITSMAAT DQAAF+LSIP+RK MDE
Sbjct  619  GVVMSRNAGFTDQVVELDFLYPSEGIHRRWESGYRITSMAATPDQAAFVLSIPKRKTMDE  678

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  679  TQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  713


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + I+K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  493  YNVADARLKQHIDKGNEDGLYISCVASATNLWALIMDAGTGFSCQVWELSNVFLH-KDWI  551

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  + I+S+A   + A+ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  552  MEQWEKNFYISSIAGATNGASLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  608

Query  260  ASI  252
             S+
Sbjct  609  TSM  611



>ref|XP_009413883.1| PREDICTED: uncharacterized protein LOC103995100 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009413884.1| PREDICTED: uncharacterized protein LOC103995100 [Musa acuminata 
subsp. malaccensis]
Length=714

 Score =   284 bits (726),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/141 (94%), Positives = 137/141 (97%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAG RWGVVMSRN+GYS+QV
Sbjct  574  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGGRWGVVMSRNSGYSDQV  633

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS H
Sbjct  634  VELDFLYPSEGIHRRWESGYRITSTAATPDQAAFILSIPKRKLMDETQETLRTSAFPSNH  693

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASICYGRTVC
Sbjct  694  VKEKWAKNLYIASICYGRTVC  714



>ref|XP_009102089.1| PREDICTED: uncharacterized protein LOC103828226 [Brassica rapa]
Length=704

 Score =   283 bits (725),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISSIAGA NGSS VVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSRW
Sbjct  550  FYISSIAGANNGSSFVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSRW  609

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            G+VMSRN+GYSEQVVELDFLYPSEGIHRRWESG+RITSMAATADQAA ILSIP+RK+ DE
Sbjct  610  GIVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITSMAATADQAALILSIPKRKITDE  669

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPSTHVKEKW+KNLY+ASICYGRTVC
Sbjct  670  TQETLRTSAFPSTHVKEKWTKNLYLASICYGRTVC  704


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+E+   K + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  484  YNVAETRLQKHVEKGTEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLH-KDWI  542

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  + I+S+A   + ++F++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  543  MEQWEKNFYISSIAGANNGSSFVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  599

Query  260  ASI  252
             S+
Sbjct  600  TSM  602



>ref|XP_009130401.1| PREDICTED: uncharacterized protein LOC103855200 [Brassica rapa]
 ref|XP_009130402.1| PREDICTED: uncharacterized protein LOC103855200 [Brassica rapa]
 ref|XP_009130403.1| PREDICTED: uncharacterized protein LOC103855200 [Brassica rapa]
Length=695

 Score =   283 bits (723),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSRWG+VMSRN+GYSEQV
Sbjct  555  LVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSRWGIVMSRNSGYSEQV  614

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESG+RITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTH
Sbjct  615  VELDFLYPSEGIHRRWESGFRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTH  674

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VK+KW+KNLYIASICYGRTVC
Sbjct  675  VKDKWAKNLYIASICYGRTVC  695


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+E+   + + K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  475  YNVAETRLPQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSTVFLH-KDWI  533

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  534  MEQWEKNYYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  590

Query  260  ASI  252
             S+
Sbjct  591  TSM  593



>ref|XP_003569928.1| PREDICTED: uncharacterized protein LOC100845295 [Brachypodium 
distachyon]
Length=698

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQV
Sbjct  558  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQV  617

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS H
Sbjct  618  VELDFLYPSEGIHRRWENGYRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNH  677

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLYIASICYGRTV
Sbjct  678  VKEKWAKNLYIASICYGRTV  697



>ref|XP_010908708.1| PREDICTED: uncharacterized protein LOC105035016 [Elaeis guineensis]
Length=718

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YIS+IAGA+NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT MTTAGSRW
Sbjct  564  YYISAIAGASNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTCMTTAGSRW  623

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRN+GYS+QVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK+MDE
Sbjct  624  GVVMSRNSGYSDQVVELDFLYPSEGIHRRWENGYRITSTAATPDQAAFILSIPKRKLMDE  683

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  684  TQETLRTSAFPSNHVKEKWAKNLYIASICYGRTVC  718



>gb|EEC71557.1| hypothetical protein OsI_03913 [Oryza sativa Indica Group]
Length=647

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+G+SEQV
Sbjct  507  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGFSEQV  566

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS H
Sbjct  567  VELDFLYPSEGIHRRWENGYRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNH  626

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLYIASICYGRTV
Sbjct  627  VKEKWAKNLYIASICYGRTV  646



>gb|ABF99312.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=522

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/141 (92%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRNAGYS QV
Sbjct  382  LVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNAGYSHQV  441

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK MDETQETLRTS+FPS H
Sbjct  442  VELDFLYPSEGIHRRWETGYRITSTAATPDQAAFILSIPKRKPMDETQETLRTSSFPSNH  501

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKWSKNLYIASICYGRTVC
Sbjct  502  VKEKWSKNLYIASICYGRTVC  522



>ref|XP_008805378.1| PREDICTED: uncharacterized protein LOC103718369 [Phoenix dactylifera]
 ref|XP_008805379.1| PREDICTED: uncharacterized protein LOC103718369 [Phoenix dactylifera]
Length=718

 Score =   281 bits (720),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YIS+IAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT MTTAGSRW
Sbjct  564  YYISAIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTCMTTAGSRW  623

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRN+GYS+QVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK+MDE
Sbjct  624  GVVMSRNSGYSDQVVELDFLYPSEGIHRRWENGYRITSTAATPDQAAFILSIPKRKLMDE  683

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPS HVK+KW+KNLYIASICYGRTVC
Sbjct  684  TQETLRTSAFPSNHVKDKWAKNLYIASICYGRTVC  718


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + I K  ++G  ++ + ++ + W ++M    G+S QV EL   FL+  + I
Sbjct  498  YNVADARLQQHIEKGNEDGLFISCVASSANLWALIMDAGTGFSSQVYELSPMFLH-KDWI  556

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+++A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  557  MEQWEKNYYISAIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  613

Query  260  ASI  252
              +
Sbjct  614  TCM  616



>ref|XP_010257690.1| PREDICTED: uncharacterized protein LOC104597684 [Nelumbo nucifera]
Length=708

 Score =   281 bits (719),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM TAG+RWGVVMSRN+GYS+QV
Sbjct  568  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGYSDQV  627

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIH+RWESGYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPSTH
Sbjct  628  VELDFLYPSEGIHKRWESGYRITSTAATVDQAAFILSIPKRKLMDETQETLRTSAFPSTH  687

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKWSKNLYIASICYGRTV
Sbjct  688  VKEKWSKNLYIASICYGRTV  707



>ref|NP_001044393.1| Os01g0772600 [Oryza sativa Japonica Group]
 dbj|BAB89852.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF06307.1| Os01g0772600 [Oryza sativa Japonica Group]
 dbj|BAH00219.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55461.1| hypothetical protein OsJ_03624 [Oryza sativa Japonica Group]
Length=698

 Score =   281 bits (718),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+G+SEQV
Sbjct  558  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGFSEQV  617

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS H
Sbjct  618  VELDFLYPSEGIHRRWENGYRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNH  677

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLYIASICYGRTV
Sbjct  678  VKEKWAKNLYIASICYGRTV  697



>dbj|BAJ90552.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96313.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=694

 Score =   280 bits (717),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAG+RWGVVMSRN+GYSEQV
Sbjct  554  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGTRWGVVMSRNSGYSEQV  613

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS H
Sbjct  614  VELDFLYPSEGIHRRWENGYRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNH  673

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLYIASICYGRTV
Sbjct  674  VKEKWAKNLYIASICYGRTV  693



>ref|XP_006400366.1| hypothetical protein EUTSA_v10012841mg [Eutrema salsugineum]
 gb|ESQ41819.1| hypothetical protein EUTSA_v10012841mg [Eutrema salsugineum]
Length=695

 Score =   280 bits (717),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/141 (92%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTTAG+RWGVVMSRN+G+SEQV
Sbjct  555  LVVMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSEQV  614

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPS+GIHRRWESGYRITSMAATADQAAFILSIP+RKMMDETQETLRT+AFPSTH
Sbjct  615  VELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSIPKRKMMDETQETLRTTAFPSTH  674

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VK+KW+KNLYIASICYGRTVC
Sbjct  675  VKDKWAKNLYIASICYGRTVC  695



>ref|XP_009418951.1| PREDICTED: uncharacterized protein LOC103999040 isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418952.1| PREDICTED: uncharacterized protein LOC103999040 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=716

 Score =   281 bits (718),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 137/141 (97%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWG+VMSRN+GYS+QV
Sbjct  576  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGIVMSRNSGYSDQV  635

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITS AAT DQAAFILS+P+RK+MDETQETLRTS FPS H
Sbjct  636  VELDFLYPSEGIHRRWESGYRITSTAATPDQAAFILSVPKRKLMDETQETLRTSTFPSNH  695

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VK+KW+KNLYIASICYGRTVC
Sbjct  696  VKDKWAKNLYIASICYGRTVC  716



>ref|NP_197320.1| protein kinase [Arabidopsis thaliana]
 dbj|BAB09477.1| casein kinase-like protein [Arabidopsis thaliana]
 gb|AED92517.1| protein kinase [Arabidopsis thaliana]
Length=691

 Score =   280 bits (716),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTTAG+RWGVVMSRN+GYS+QV
Sbjct  551  LVVMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGYSDQV  610

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPS+GIHRRWESGYRITSMAATADQAAFILS+P+RKMMDETQETLRT+AFPSTH
Sbjct  611  VELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSVPKRKMMDETQETLRTTAFPSTH  670

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASIC+GRTVC
Sbjct  671  VKEKWAKNLYIASICFGRTVC  691



>ref|XP_009418950.1| PREDICTED: uncharacterized protein LOC103999040 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=751

 Score =   281 bits (718),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 137/141 (97%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWG+VMSRN+GYS+QV
Sbjct  611  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGIVMSRNSGYSDQV  670

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITS AAT DQAAFILS+P+RK+MDETQETLRTS FPS H
Sbjct  671  VELDFLYPSEGIHRRWESGYRITSTAATPDQAAFILSVPKRKLMDETQETLRTSTFPSNH  730

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VK+KW+KNLYIASICYGRTVC
Sbjct  731  VKDKWAKNLYIASICYGRTVC  751



>ref|XP_010492820.1| PREDICTED: uncharacterized protein LOC104770147 [Camelina sativa]
 ref|XP_010492821.1| PREDICTED: uncharacterized protein LOC104770147 [Camelina sativa]
Length=692

 Score =   280 bits (715),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/141 (91%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LV+MSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTTAG+RWGVVMSRN+GYS+QV
Sbjct  552  LVIMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGYSDQV  611

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPS+GIHRRWESGYRITSMAATADQAAFILS+P+RKMMDETQETLRT+AFPSTH
Sbjct  612  VELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSVPKRKMMDETQETLRTTAFPSTH  671

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASIC+GRTVC
Sbjct  672  VKEKWAKNLYIASICFGRTVC  692



>emb|CDY38493.1| BnaA10g16650D [Brassica napus]
Length=690

 Score =   279 bits (714),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QV
Sbjct  550  LVVMSKGTTYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQV  609

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPS+GIHRRWESGYRITSMAATADQAAFILSIP+RKMMDETQETLRT+AFPSTH
Sbjct  610  VELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSIPKRKMMDETQETLRTTAFPSTH  669

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIAS+CYGRTVC
Sbjct  670  VKEKWAKNLYIASVCYGRTVC  690



>ref|XP_006644782.1| PREDICTED: uncharacterized protein LOC102714869 [Oryza brachyantha]
Length=701

 Score =   280 bits (715),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+G+SEQV
Sbjct  561  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGFSEQV  620

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS H
Sbjct  621  VELDFLYPSEGIHRRWENGYRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNH  680

Query  293  VKEKWSKNLYIASICYGRTV  234
            VK+KW+KNLYIASICYGRTV
Sbjct  681  VKDKWAKNLYIASICYGRTV  700



>emb|CDY25451.1| BnaC09g39660D [Brassica napus]
Length=690

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QV
Sbjct  550  LVVMSKGTTYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQV  609

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPS+GIHRRWESGYRITSMAATADQAAFILSIP+RKMMDETQETLRT+AFPSTH
Sbjct  610  VELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSIPKRKMMDETQETLRTTAFPSTH  669

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIAS+CYGRTVC
Sbjct  670  VKEKWAKNLYIASVCYGRTVC  690



>ref|XP_010424160.1| PREDICTED: uncharacterized protein LOC104709208 [Camelina sativa]
Length=647

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/141 (90%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LV+MSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QV
Sbjct  507  LVIMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQV  566

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPS+GIHRRWESGYRITSMAATADQAAFILS+P+RKMMDETQETLRT+AFPSTH
Sbjct  567  VELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSVPKRKMMDETQETLRTTAFPSTH  626

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASIC+GRTVC
Sbjct  627  VKEKWAKNLYIASICFGRTVC  647



>ref|XP_004970128.1| PREDICTED: uncharacterized protein LOC101772174 [Setaria italica]
Length=697

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQV
Sbjct  557  LVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQV  616

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS H
Sbjct  617  VELDFLYPSEGIHRRWENGYRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNH  676

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLYIASIC+GRTV
Sbjct  677  VKEKWAKNLYIASICFGRTV  696



>ref|XP_006287189.1| hypothetical protein CARUB_v10000361mg [Capsella rubella]
 gb|EOA20087.1| hypothetical protein CARUB_v10000361mg [Capsella rubella]
Length=692

 Score =   278 bits (712),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/141 (91%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QV
Sbjct  552  LVVMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQV  611

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPS+GIHRRWESGYRITSMAATADQAAFILS+P+RKMMDETQETLRT+AFPSTH
Sbjct  612  VELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSVPKRKMMDETQETLRTTAFPSTH  671

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASIC+GRTVC
Sbjct  672  VKEKWAKNLYIASICFGRTVC  692



>ref|XP_009121003.1| PREDICTED: uncharacterized protein LOC103845859 [Brassica rapa]
Length=691

 Score =   278 bits (711),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/141 (91%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FH+TSMTTAG+RWGVVMSRN+G+S+QV
Sbjct  551  LVVMSKGTTYTQQSYKVSDSFPFKWINKKWKEDFHLTSMTTAGNRWGVVMSRNSGFSDQV  610

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPS+GIHRRWESGYRITSMAATADQAAFILSIP+RKMMDETQETLRT+AFPSTH
Sbjct  611  VELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSIPKRKMMDETQETLRTTAFPSTH  670

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIAS+CYGRTVC
Sbjct  671  VKEKWAKNLYIASVCYGRTVC  691



>ref|XP_010454044.1| PREDICTED: uncharacterized protein LOC104735873 [Camelina sativa]
Length=692

 Score =   278 bits (711),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/141 (90%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LV+MSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QV
Sbjct  552  LVIMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQV  611

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPS+GIHRRWESGYRITSMAATADQAAFILS+P+RKMMDETQETLRT+AFPSTH
Sbjct  612  VELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSVPKRKMMDETQETLRTTAFPSTH  671

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASIC+GRTVC
Sbjct  672  VKEKWAKNLYIASICFGRTVC  692



>ref|XP_008655390.1| PREDICTED: uncharacterized protein LOC100502202 isoform X1 [Zea 
mays]
 gb|AFW84937.1| hypothetical protein ZEAMMB73_351651 [Zea mays]
Length=812

 Score =   280 bits (717),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQV
Sbjct  672  LVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQV  731

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS H
Sbjct  732  VELDFLYPSEGIHRRWENGYRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNH  791

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLYIASICYGRTV
Sbjct  792  VKEKWAKNLYIASICYGRTV  811



>ref|XP_010485763.1| PREDICTED: uncharacterized protein LOC104764028 isoform X2 [Camelina 
sativa]
Length=700

 Score =   278 bits (711),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 138/141 (98%), Gaps = 1/141 (1%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQV
Sbjct  561  LVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQV  620

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTH
Sbjct  621  VELDFLYPSEGIHRRWENGYRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTH  680

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VK KW+KNLYIASICYGRTVC
Sbjct  681  VK-KWAKNLYIASICYGRTVC  700


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  481  YNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLH-KDWI  539

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  540  MEQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  596

Query  260  ASI  252
             S+
Sbjct  597  TSM  599



>ref|NP_001058996.1| Os07g0171300 [Oryza sativa Japonica Group]
 dbj|BAC83610.1| putative casein kinase 1, delta isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAF20910.1| Os07g0171300 [Oryza sativa Japonica Group]
 dbj|BAG89932.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81591.1| hypothetical protein OsI_25061 [Oryza sativa Indica Group]
 gb|EEE66647.1| hypothetical protein OsJ_23261 [Oryza sativa Japonica Group]
Length=699

 Score =   278 bits (711),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYI++IAG+ANGSSLVVMSKGTPY+QQSYKVSESFPFKWINKKWKEGFHVTSM TAG+RW
Sbjct  545  FYITAIAGSANGSSLVVMSKGTPYSQQSYKVSESFPFKWINKKWKEGFHVTSMATAGNRW  604

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS+AAT DQAAFILSIP+RK +DE
Sbjct  605  GVVMSRNSGYSEQVVELDFLYPSEGIHRRWETGYRITSIAATNDQAAFILSIPKRKPVDE  664

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPS HVK+KW+KNLYIASIC+GRTVC
Sbjct  665  TQETLRTSAFPSNHVKDKWAKNLYIASICFGRTVC  699



>ref|XP_010516137.1| PREDICTED: uncharacterized protein LOC104791759 isoform X2 [Camelina 
sativa]
 ref|XP_010516215.1| PREDICTED: uncharacterized protein LOC104791759 isoform X3 [Camelina 
sativa]
Length=699

 Score =   278 bits (710),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 138/141 (98%), Gaps = 1/141 (1%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQV
Sbjct  560  LVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQV  619

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTH
Sbjct  620  VELDFLYPSEGIHRRWENGYRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTH  679

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VK KW+KNLYIASICYGRTVC
Sbjct  680  VK-KWAKNLYIASICYGRTVC  699


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  480  YNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLH-KDWI  538

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  539  MEQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  595

Query  260  ASI  252
             S+
Sbjct  596  TSM  598



>gb|EAY92152.1| hypothetical protein OsI_13865 [Oryza sativa Indica Group]
Length=707

 Score =   278 bits (711),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 130/141 (92%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRNAGYS QV
Sbjct  567  LVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNAGYSHQV  626

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK MDETQETLRTS+FPS H
Sbjct  627  VELDFLYPSEGIHRRWETGYRITSTAATPDQAAFILSIPKRKPMDETQETLRTSSFPSNH  686

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKWSKNLYIASICYGRTVC
Sbjct  687  VKEKWSKNLYIASICYGRTVC  707



>dbj|BAN15568.1| heading date 16 [Oryza sativa Japonica Group]
Length=707

 Score =   278 bits (710),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 130/141 (92%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRNAGYS QV
Sbjct  567  LVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNAGYSHQV  626

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK MDETQETLRTS+FPS H
Sbjct  627  VELDFLYPSEGIHRRWETGYRITSTAATPDQAAFILSIPKRKPMDETQETLRTSSFPSNH  686

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKWSKNLYIASICYGRTVC
Sbjct  687  VKEKWSKNLYIASICYGRTVC  707



>ref|NP_001051531.1| Os03g0793500 [Oryza sativa Japonica Group]
 gb|AAO37965.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 gb|ABF99311.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13445.1| Os03g0793500 [Oryza sativa Japonica Group]
 gb|EAZ28883.1| hypothetical protein OsJ_12923 [Oryza sativa Japonica Group]
 dbj|BAH00578.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAN15567.1| heading date 16 [Oryza sativa Japonica Group]
Length=707

 Score =   278 bits (710),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 130/141 (92%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRNAGYS QV
Sbjct  567  LVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNAGYSHQV  626

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK MDETQETLRTS+FPS H
Sbjct  627  VELDFLYPSEGIHRRWETGYRITSTAATPDQAAFILSIPKRKPMDETQETLRTSSFPSNH  686

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKWSKNLYIASICYGRTVC
Sbjct  687  VKEKWSKNLYIASICYGRTVC  707



>gb|KHF98002.1| hypothetical protein F383_12939 [Gossypium arboreum]
Length=668

 Score =   277 bits (708),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YI+S+AGA N SSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGF+VTSMTTAG+RW
Sbjct  514  YYITSVAGANNESSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFYVTSMTTAGTRW  573

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRITSMAAT DQAAFILSIP+RK  D+
Sbjct  574  GVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATVDQAAFILSIPKRKTTDD  633

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRT+AFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  634  TQETLRTTAFPSTHVKEKWAKNLYIASICYGRTV  667



>ref|XP_006657490.1| PREDICTED: uncharacterized protein LOC102719500 [Oryza brachyantha]
Length=702

 Score =   278 bits (710),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYI++IAG+ NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM TAG+RW
Sbjct  548  FYITAIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATAGNRW  607

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK +DE
Sbjct  608  GVVMSRNSGYSEQVVELDFLYPSEGIHRRWETGYRITSTAATNDQAAFILSIPKRKPVDE  667

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPS HVK+KW+KNLYIASIC+GRTVC
Sbjct  668  TQETLRTSAFPSNHVKDKWAKNLYIASICFGRTVC  702



>ref|XP_002873876.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50135.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=691

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/141 (90%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFP+KWINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QV
Sbjct  551  LVVMSKGTSYTQQSYKVSDSFPYKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQV  610

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPS+GIHRRWESGYRITSMAATADQAAFILS+P+RKMMDETQETLRT+AFPSTH
Sbjct  611  VELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSVPKRKMMDETQETLRTTAFPSTH  670

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASIC+GRTVC
Sbjct  671  VKEKWAKNLYIASICFGRTVC  691



>emb|CDY50866.1| BnaA05g37270D [Brassica napus]
Length=798

 Score =   279 bits (714),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSRWG+VMSRN+GYSEQV
Sbjct  559  LVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSRWGIVMSRNSGYSEQV  618

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESG+RITSMAATADQAA ILSIP+RK+ DETQETLRTSAFPSTH
Sbjct  619  VELDFLYPSEGIHRRWESGFRITSMAATADQAALILSIPKRKITDETQETLRTSAFPSTH  678

Query  293  VKEKWSKNLYIASICYGRTV  234
            VK+KW+KNLYIASICYGRTV
Sbjct  679  VKDKWAKNLYIASICYGRTV  698


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+E+   + + K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  479  YNVAETRLPQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSTVFLH-KDWI  537

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  538  MEQWEKNYYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  594

Query  260  ASI  252
             S+
Sbjct  595  TSM  597



>ref|XP_010228600.1| PREDICTED: uncharacterized protein LOC100829940 [Brachypodium 
distachyon]
 ref|XP_010228605.1| PREDICTED: uncharacterized protein LOC100829940 [Brachypodium 
distachyon]
Length=709

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+RW
Sbjct  555  FYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMGTAGNRW  614

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAGYS+QVVELDFLYPSEG+HRRWE+GYRITS A T DQAAFILSIP+RK MDE
Sbjct  615  GVVMSRNAGYSDQVVELDFLYPSEGLHRRWETGYRITSSAGTPDQAAFILSIPKRKPMDE  674

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPS HVKEKW+KNLYIASICYGRT C
Sbjct  675  TQETLRTSAFPSNHVKEKWAKNLYIASICYGRTAC  709



>dbj|BAJ93086.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=707

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+RW
Sbjct  553  FYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMGTAGNRW  612

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAGYS+QVVELDFLYPSEG+HRRWESGYRITS A T DQAAFILSIP+RK +DE
Sbjct  613  GVVMSRNAGYSDQVVELDFLYPSEGLHRRWESGYRITSSAGTPDQAAFILSIPKRKPLDE  672

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPS HVKEKW+KNLYIASICYGRT C
Sbjct  673  TQETLRTSAFPSNHVKEKWAKNLYIASICYGRTAC  707



>ref|XP_003557523.1| PREDICTED: uncharacterized protein LOC100821235 [Brachypodium 
distachyon]
Length=702

 Score =   276 bits (706),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYI++IAGA+NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM TAG+RW
Sbjct  548  FYITAIAGASNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATAGNRW  607

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRN+GYSEQVVELDFLYPSEGIHRRWE GYRITS AAT DQAAFILS P+RK +DE
Sbjct  608  GVVMSRNSGYSEQVVELDFLYPSEGIHRRWEQGYRITSSAATIDQAAFILSKPKRKPVDE  667

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPS HVK+KW+KNLYIASICYGRTVC
Sbjct  668  TQETLRTSAFPSNHVKDKWAKNLYIASICYGRTVC  702



>gb|KJB46016.1| hypothetical protein B456_007G343500 [Gossypium raimondii]
Length=711

 Score =   276 bits (706),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGF+VTSMTTAG+RWGVVMSRNAG+S+QV
Sbjct  571  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFYVTSMTTAGTRWGVVMSRNAGFSDQV  630

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITSMAAT DQAAFILSIP+RK  D+TQETLRT+AFPSTH
Sbjct  631  VELDFLYPSEGIHRRWESGYRITSMAATVDQAAFILSIPKRKTTDDTQETLRTTAFPSTH  690

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLYIASICYGRTV
Sbjct  691  VKEKWAKNLYIASICYGRTV  710


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++    + ++K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  491  YNVADLRLSQHVSKGNEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLH-KDWI  549

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y ITS+A   + ++ ++     K    TQ++ + S +FP   + +KW +  Y+
Sbjct  550  MEQWEKNYYITSVAGANNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFYV  606

Query  260  ASI  252
             S+
Sbjct  607  TSM  609



>ref|XP_009132256.1| PREDICTED: uncharacterized protein LOC103856881 [Brassica rapa]
Length=676

 Score =   275 bits (704),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y+QQSYKVS+SFPFKWINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QV
Sbjct  536  LVVMSKGTTYSQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQV  595

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPS+GIHRRWE+GYRITSMAATADQAAFILSIP+RKM+DETQETLRT+AFPSTH
Sbjct  596  VELDFLYPSDGIHRRWENGYRITSMAATADQAAFILSIPKRKMVDETQETLRTTAFPSTH  655

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VK+KW+KNLYIASICYGRTVC
Sbjct  656  VKDKWAKNLYIASICYGRTVC  676



>emb|CDY51243.1| BnaA03g06950D [Brassica napus]
Length=684

 Score =   275 bits (704),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y+QQSYKVS+SFPFKWINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QV
Sbjct  544  LVVMSKGTTYSQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQV  603

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPS+GIHRRWE+GYRITSMAATADQAAFILSIP+RKM+DETQETLRT+AFPSTH
Sbjct  604  VELDFLYPSDGIHRRWENGYRITSMAATADQAAFILSIPKRKMVDETQETLRTTAFPSTH  663

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VK+KW+KNLYIASICYGRTVC
Sbjct  664  VKDKWAKNLYIASICYGRTVC  684



>ref|XP_004955583.1| PREDICTED: uncharacterized protein LOC101773166 isoform X4 [Setaria 
italica]
Length=707

 Score =   276 bits (705),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/141 (91%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRN+GYS QV
Sbjct  567  LVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGYSNQV  626

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILS+P+RK MDETQETLRTSAFPS H
Sbjct  627  VELDFLYPSEGIHRRWETGYRITSTAATNDQAAFILSMPKRKPMDETQETLRTSAFPSGH  686

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASICYGRTVC
Sbjct  687  VKEKWAKNLYIASICYGRTVC  707



>emb|CDX70801.1| BnaC03g08850D [Brassica napus]
Length=684

 Score =   275 bits (704),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y+QQSYKVS+SFPFKWINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QV
Sbjct  544  LVVMSKGTTYSQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQV  603

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPS+GIHRRWE+GYRITSMAATADQAAFILSIP+RKM+DETQETLRT+AFPSTH
Sbjct  604  VELDFLYPSDGIHRRWENGYRITSMAATADQAAFILSIPKRKMVDETQETLRTTAFPSTH  663

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VK+KW+KNLYIASICYGRTVC
Sbjct  664  VKDKWAKNLYIASICYGRTVC  684



>ref|XP_008651588.1| PREDICTED: ATP binding protein isoform X1 [Zea mays]
 gb|ACR36803.1| unknown [Zea mays]
 tpg|DAA59714.1| TPA: ATP binding protein isoform 1 [Zea mays]
 tpg|DAA59715.1| TPA: ATP binding protein isoform 2 [Zea mays]
Length=704

 Score =   276 bits (705),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/141 (91%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRN+G+S QV
Sbjct  564  LVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGFSTQV  623

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITS AAT DQAAFILS+P+RK MDETQETLRTSAFPS+H
Sbjct  624  VELDFLYPSEGIHRRWESGYRITSTAATNDQAAFILSMPKRKPMDETQETLRTSAFPSSH  683

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASICYGRTVC
Sbjct  684  VKEKWAKNLYIASICYGRTVC  704



>ref|XP_004955580.1| PREDICTED: uncharacterized protein LOC101773166 isoform X1 [Setaria 
italica]
 ref|XP_004955581.1| PREDICTED: uncharacterized protein LOC101773166 isoform X2 [Setaria 
italica]
 ref|XP_004955582.1| PREDICTED: uncharacterized protein LOC101773166 isoform X3 [Setaria 
italica]
Length=732

 Score =   276 bits (706),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/141 (91%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRN+GYS QV
Sbjct  592  LVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGYSNQV  651

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILS+P+RK MDETQETLRTSAFPS H
Sbjct  652  VELDFLYPSEGIHRRWETGYRITSTAATNDQAAFILSMPKRKPMDETQETLRTSAFPSGH  711

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASICYGRTVC
Sbjct  712  VKEKWAKNLYIASICYGRTVC  732



>ref|NP_001152463.1| ATP binding protein [Zea mays]
 gb|ACG47741.1| ATP binding protein [Zea mays]
Length=704

 Score =   275 bits (704),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/141 (91%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRN+G+S QV
Sbjct  564  LVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGFSTQV  623

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITS AAT DQAAFILS+P+RK MDETQETLRTSAFPS+H
Sbjct  624  VELDFLYPSEGIHRRWESGYRITSTAATNDQAAFILSMPKRKPMDETQETLRTSAFPSSH  683

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASICYGRTVC
Sbjct  684  VKEKWAKNLYIASICYGRTVC  704



>gb|ADE77861.1| unknown [Picea sitchensis]
Length=186

 Score =   260 bits (664),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGF+VTSM +AGSRWGVVMSRNAG+++QV
Sbjct  46   LVVMSKGTNYTQQSYKVSDSFPFKWINKKWREGFYVTSMASAGSRWGVVMSRNAGFTDQV  105

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+ GYRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTH
Sbjct  106  VELDFLYPSEGIHRRWDHGYRITATAATWDQAAFVLSVPRRKPTDETQETLRTSAFPSTH  165

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLYIAS+CYGRTV
Sbjct  166  VKEKWAKNLYIASVCYGRTV  185



>ref|XP_010672056.1| PREDICTED: uncharacterized protein LOC104888715 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=711

 Score =   275 bits (703),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 149/155 (96%), Gaps = 2/155 (1%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISSIAGA NG+SLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTA SRW
Sbjct  559  FYISSIAGATNGASLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAASRW  618

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAG+++QVVELDFLYPSEGIHRRWESGYRITSMAAT DQAAF+LSIP+RK MDE
Sbjct  619  GVVMSRNAGFTDQVVELDFLYPSEGIHRRWESGYRITSMAATPDQAAFVLSIPKRKTMDE  678

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTSAFPSTH  EKW+KNLYIASICYGRTVC
Sbjct  679  TQETLRTSAFPSTH--EKWAKNLYIASICYGRTVC  711


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + I+K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  493  YNVADARLKQHIDKGNEDGLYISCVASATNLWALIMDAGTGFSCQVWELSNVFLH-KDWI  551

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  + I+S+A   + A+ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  552  MEQWEKNFYISSIAGATNGASLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  608

Query  260  ASI  252
             S+
Sbjct  609  TSM  611



>gb|ACN36158.1| unknown [Zea mays]
Length=704

 Score =   275 bits (702),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/141 (90%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRN+G+S QV
Sbjct  564  LVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGFSTQV  623

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITS AAT DQAAFILS+P+RK MDETQETLRTSAFPS+H
Sbjct  624  VELDFLYPSEGIHRRWESGYRITSTAATNDQAAFILSMPKRKPMDETQETLRTSAFPSSH  683

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASIC+GRTVC
Sbjct  684  VKEKWAKNLYIASICFGRTVC  704



>ref|NP_001152101.1| LOC100285738 [Zea mays]
 ref|XP_008668149.1| PREDICTED: LOC100285738 isoform X1 [Zea mays]
 gb|ACG45775.1| ATP binding protein [Zea mays]
 tpg|DAA42572.1| TPA: ATP binding protein isoform 1 [Zea mays]
 tpg|DAA42573.1| TPA: ATP binding protein isoform 2 [Zea mays]
 tpg|DAA42574.1| TPA: ATP binding protein isoform 3 [Zea mays]
Length=704

 Score =   275 bits (702),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/141 (90%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRN+G+S QV
Sbjct  564  LVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGFSTQV  623

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITS AAT DQAAFILS+P+RK MDETQETLRTSAFPS+H
Sbjct  624  VELDFLYPSEGIHRRWESGYRITSTAATNDQAAFILSMPKRKPMDETQETLRTSAFPSSH  683

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASIC+GRTVC
Sbjct  684  VKEKWAKNLYIASICFGRTVC  704



>emb|CDY02641.1| BnaC02g07940D [Brassica napus]
Length=686

 Score =   272 bits (696),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y+QQSYKVS+SFP+KWINKKWKE FHVTSMTTAG+RWGV+MSRN+G+S+QV
Sbjct  546  LVVMSKGTSYSQQSYKVSDSFPYKWINKKWKEDFHVTSMTTAGNRWGVIMSRNSGFSDQV  605

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPS+GIHRRWESGYRITSMAATADQAAFILSIP+RK+ DETQETLRT+AFPSTH
Sbjct  606  VELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSIPKRKLNDETQETLRTTAFPSTH  665

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VK+KW+KNLYIASICYGRTVC
Sbjct  666  VKDKWAKNLYIASICYGRTVC  686



>gb|EMS51431.1| Casein kinase I isoform beta [Triticum urartu]
Length=695

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM TAG+RW
Sbjct  541  FYITAIAGALNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATAGNRW  600

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRN+GYSEQ+VELDFLYPSEGIHRRWE GYRITS AAT DQAAFILS P+RK +DE
Sbjct  601  GVVMSRNSGYSEQIVELDFLYPSEGIHRRWEHGYRITSSAATGDQAAFILSKPKRKPVDE  660

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFPS HVK+KW+KNLYIASICYGRTV
Sbjct  661  TQETLRTSAFPSNHVKDKWAKNLYIASICYGRTV  694



>ref|XP_009126244.1| PREDICTED: uncharacterized protein LOC103851164 [Brassica rapa]
Length=684

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y+QQSYKVS+SFP+KWINKKWKE FHVTSMTTAG+RWGV+MSRN+G+S+QV
Sbjct  544  LVVMSKGTSYSQQSYKVSDSFPYKWINKKWKEDFHVTSMTTAGNRWGVIMSRNSGFSDQV  603

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPS+GIHRRWE+GYRITSMAATADQAAFILSIP+RK+ DETQETLRT+AFPSTH
Sbjct  604  VELDFLYPSDGIHRRWENGYRITSMAATADQAAFILSIPKRKLNDETQETLRTTAFPSTH  663

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VK+KW+KNLYIASICYGRTVC
Sbjct  664  VKDKWAKNLYIASICYGRTVC  684



>ref|XP_002466312.1| hypothetical protein SORBIDRAFT_01g005460 [Sorghum bicolor]
 gb|EER93310.1| hypothetical protein SORBIDRAFT_01g005460 [Sorghum bicolor]
Length=707

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            L+VMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+RWGV++SRNAGYS QV
Sbjct  567  LIVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNRWGVIVSRNAGYSTQV  626

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITS+AAT DQAAFILSIP+RK MDETQE LRTSAFPS+H
Sbjct  627  VELDFLYPSEGIHRRWETGYRITSIAATPDQAAFILSIPKRKPMDETQEILRTSAFPSSH  686

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW KNLYI+S+CYGRTVC
Sbjct  687  VKEKWVKNLYISSVCYGRTVC  707



>ref|XP_004981469.1| PREDICTED: uncharacterized protein LOC101783890 isoform X1 [Setaria 
italica]
 ref|XP_004981470.1| PREDICTED: uncharacterized protein LOC101783890 isoform X2 [Setaria 
italica]
 ref|XP_004981471.1| PREDICTED: uncharacterized protein LOC101783890 isoform X3 [Setaria 
italica]
 ref|XP_004981472.1| PREDICTED: uncharacterized protein LOC101783890 isoform X4 [Setaria 
italica]
 ref|XP_004981473.1| PREDICTED: uncharacterized protein LOC101783890 isoform X5 [Setaria 
italica]
Length=706

 Score =   271 bits (693),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRN+GY+ QV
Sbjct  566  LVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGYATQV  625

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIH RWE+GYRITS AAT DQAAFILSIP+RK MDETQETLRTSAFPS H
Sbjct  626  VELDFLYPSEGIHHRWETGYRITSTAATPDQAAFILSIPKRKPMDETQETLRTSAFPSNH  685

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW KNLYI+SICYGRTVC
Sbjct  686  VKEKWVKNLYISSICYGRTVC  706



>emb|CDY53253.1| BnaA02g04010D [Brassica napus]
Length=762

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y+QQSYKVS+SFP+KWINKKWKE FHVTSMTTAG+RWGV+MSRN+G+S+QV
Sbjct  622  LVVMSKGTSYSQQSYKVSDSFPYKWINKKWKEDFHVTSMTTAGNRWGVIMSRNSGFSDQV  681

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPS+GIHRRWESGYRITSMAATADQAAFILSIP+RK+ DETQETLRT+AFPSTH
Sbjct  682  VELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSIPKRKLNDETQETLRTTAFPSTH  741

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VK+KW+KNLYIASICYGRTVC
Sbjct  742  VKDKWAKNLYIASICYGRTVC  762



>ref|XP_006842223.1| hypothetical protein AMTR_s00078p00181940 [Amborella trichopoda]
 gb|ERN03898.1| hypothetical protein AMTR_s00078p00181940 [Amborella trichopoda]
Length=705

 Score =   270 bits (691),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPY+QQSYKVS+SFPFKWINKKW+EGF+VTSMTT+G+RWGVVMSRNAG+S+QV
Sbjct  565  LVVMSKGTPYSQQSYKVSDSFPFKWINKKWREGFYVTSMTTSGNRWGVVMSRNAGFSDQV  624

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+G+RITS AAT DQAAFILS+P+RKM DETQETLRTSAFPSTH
Sbjct  625  VELDFLYPSEGIHRRWENGFRITSTAATVDQAAFILSVPKRKMSDETQETLRTSAFPSTH  684

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKWSKNLYIAS+CYGRTV
Sbjct  685  VKEKWSKNLYIASVCYGRTV  704



>ref|XP_010552201.1| PREDICTED: serine/threonine-protein kinase ste20-like [Tarenaya 
hassleriana]
Length=702

 Score =   269 bits (688),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT +TQQSYKVS+SFPFKWINKKWKEGFHVTSM TAGSRWGVVMSRNAGYSEQV
Sbjct  562  LVVMSKGTQFTQQSYKVSDSFPFKWINKKWKEGFHVTSMATAGSRWGVVMSRNAGYSEQV  621

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW SGYRITS AATADQ A +LSIPRR+++DETQETLRTS FPSTH
Sbjct  622  VELDFLYPSEGIHRRWNSGYRITSTAATADQTALVLSIPRRRLVDETQETLRTSQFPSTH  681

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLY+ASICYGRTV
Sbjct  682  VKEKWGKNLYLASICYGRTV  701



>ref|XP_010500967.1| PREDICTED: uncharacterized protein LOC104778257 isoform X2 [Camelina 
sativa]
Length=390

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQV
Sbjct  250  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQV  309

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTH
Sbjct  310  VELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTH  369

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLY+AS+ YGRTV
Sbjct  370  VKEKWGKNLYLASLSYGRTV  389



>ref|XP_010936996.1| PREDICTED: casein kinase I isoform gamma-1-like isoform X2 [Elaeis 
guineensis]
Length=600

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T+GSRWG+VMSRNAG+S+QV
Sbjct  460  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATSGSRWGIVMSRNAGFSDQV  519

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++GYRITSMAAT DQAA ILS+P+RK  DETQETLRTSAFPS H
Sbjct  520  VELDFLYPSEGIHRRWDNGYRITSMAATWDQAALILSVPKRKPGDETQETLRTSAFPSAH  579

Query  293  VKEKWSKNLYIASICYGRTV  234
            VK+KW+KNLY+AS+CYGRTV
Sbjct  580  VKDKWAKNLYLASVCYGRTV  599



>ref|XP_010936995.1| PREDICTED: casein kinase I isoform gamma-1-like isoform X1 [Elaeis 
guineensis]
Length=601

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T+GSRWG+VMSRNAG+S+QV
Sbjct  461  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATSGSRWGIVMSRNAGFSDQV  520

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++GYRITSMAAT DQAA ILS+P+RK  DETQETLRTSAFPS H
Sbjct  521  VELDFLYPSEGIHRRWDNGYRITSMAATWDQAALILSVPKRKPGDETQETLRTSAFPSAH  580

Query  293  VKEKWSKNLYIASICYGRTV  234
            VK+KW+KNLY+AS+CYGRTV
Sbjct  581  VKDKWAKNLYLASVCYGRTV  600



>gb|EYU39997.1| hypothetical protein MIMGU_mgv1a002328mg [Erythranthe guttata]
Length=687

 Score =   268 bits (685),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 137/142 (96%), Gaps = 1/142 (1%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWI+KKWKEGFHVTSMT+AGSRWGVVMSRN+GYSEQV
Sbjct  546  LVVMSKGTPYTQQSYKVSESFPFKWISKKWKEGFHVTSMTSAGSRWGVVMSRNSGYSEQV  605

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRK-MMDETQETLRTSAFPST  297
            VE+DF+YPSEGIHRRWESGYRITSMAAT DQ+AF+LSIPRRK MMDE QETLRTSAFPS+
Sbjct  606  VEVDFVYPSEGIHRRWESGYRITSMAATTDQSAFVLSIPRRKLMMDEAQETLRTSAFPSS  665

Query  296  HVKEKWSKNLYIASICYGRTVC  231
            HVK KWS+NLYIAS+C+G TVC
Sbjct  666  HVKAKWSRNLYIASMCHGPTVC  687



>ref|XP_010472589.1| PREDICTED: uncharacterized protein LOC104752210 [Camelina sativa]
Length=257

 Score =   255 bits (651),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
             VVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM TAGS+WG+VMSR A +S+QV
Sbjct  117  FVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTSMATAGSKWGIVMSRGACFSDQV  176

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITS+AAT DQAAF+LS+PRRK+ DETQETLRTSAFPS H
Sbjct  177  VELDFLYPSEGIHRRWENGYRITSVAATWDQAAFVLSVPRRKLTDETQETLRTSAFPSNH  236

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLYIASICYGRTV
Sbjct  237  VKEKWGKNLYIASICYGRTV  256



>gb|AAC42254.1| unknown protein [Arabidopsis thaliana]
Length=282

 Score =   255 bits (652),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
             VVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM TAGS+WG+VMSR A +S+QV
Sbjct  142  FVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTSMATAGSKWGIVMSRGASFSDQV  201

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            +ELDFLYPSEGIHRRWE+GYRITS+AAT DQAAF+LS+PRRK+ DETQETLRTSAFPS H
Sbjct  202  IELDFLYPSEGIHRRWENGYRITSVAATWDQAAFVLSVPRRKLTDETQETLRTSAFPSNH  261

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLYIASICYGRTV
Sbjct  262  VKEKWGKNLYIASICYGRTV  281



>gb|KHN37292.1| Casein kinase I [Glycine soja]
Length=590

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYI+SIAG+ NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKW+EGFHVTSM TAGSRW
Sbjct  436  FYITSIAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWREGFHVTSMATAGSRW  495

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAG+S+QVVELDFLYPSEGIH+RW+ GYRIT+ AAT DQ+A ILSIPRRK+ DE
Sbjct  496  GVVMSRNAGFSKQVVELDFLYPSEGIHKRWDKGYRITATAATLDQSALILSIPRRKLSDE  555

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTS FPSTHVK+KWSKNLY+A +CYGRTVC
Sbjct  556  TQETLRTSQFPSTHVKDKWSKNLYLACLCYGRTVC  590



>tpg|DAA54811.1| TPA: hypothetical protein ZEAMMB73_098757 [Zea mays]
Length=186

 Score =   251 bits (641),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISS+AG+ NGSS+VVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVT+M T+G+RW
Sbjct  32   FYISSVAGSNNGSSIVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTAMATSGNRW  91

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
             +VMSR+AG+SEQVVELDFLYPSEGIHRRW++G+RIT+MAAT DQ+A ILS PRR+  DE
Sbjct  92   AIVMSRSAGFSEQVVELDFLYPSEGIHRRWDNGFRITAMAATMDQSALILSKPRRRPRDE  151

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRT+ FPS HVK+KW+KNLY+A ICYGRTV 
Sbjct  152  TQETLRTTQFPSQHVKDKWAKNLYLAGICYGRTVA  186



>gb|EMT21659.1| Casein kinase I-RAG8-like protein [Aegilops tauschii]
Length=640

 Score =   265 bits (676),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM TAG+RW
Sbjct  486  FYITAIAGALNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATAGNRW  545

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRN+GYS Q+VELDFLYPSEGIH RWE GYRITS AAT DQAAFILS P+RK +DE
Sbjct  546  GVVMSRNSGYSGQIVELDFLYPSEGIHWRWEHGYRITSSAATGDQAAFILSKPKRKPVDE  605

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFPS HVK+KW+KNLYIASICYGRTV
Sbjct  606  TQETLRTSAFPSNHVKDKWAKNLYIASICYGRTV  639



>ref|XP_006651899.1| PREDICTED: uncharacterized protein LOC102717146 [Oryza brachyantha]
Length=726

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YI++IAGA NGSSLVVMSK T YTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+RW
Sbjct  572  YYITAIAGANNGSSLVVMSKETSYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNRW  631

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRN GYS QVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFIL++P+RK +DE
Sbjct  632  GVVMSRNTGYSHQVVELDFLYPSEGIHRRWETGYRITSTAATPDQAAFILTMPKRKPVDE  691

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTS+FPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  692  TQETLRTSSFPSTHVKEKWSKNLYIASICYGRTVC  726



>ref|XP_010542444.1| PREDICTED: serine/threonine-protein kinase STE20-like [Tarenaya 
hassleriana]
Length=703

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT +TQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAGYSEQV
Sbjct  563  LVVMSKGTQFTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGYSEQV  622

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIH+RW+SG+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTH
Sbjct  623  VELDFLYPSEGIHKRWDSGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTH  682

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLY+AS+CYGRTV
Sbjct  683  VKEKWGKNLYLASLCYGRTV  702



>ref|XP_010534909.1| PREDICTED: serine/threonine-protein kinase STE20-like [Tarenaya 
hassleriana]
Length=703

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT +TQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAGYSEQV
Sbjct  563  LVVMSKGTQFTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGYSEQV  622

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTH
Sbjct  623  VELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTH  682

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLY+AS+CYGRTV
Sbjct  683  VKEKWGKNLYLASLCYGRTV  702



>ref|XP_003536792.1| PREDICTED: uncharacterized protein LOC100783819 [Glycine max]
Length=672

 Score =   265 bits (677),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYI+SIAG+ NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKW+EGFHVTSM TAGSRW
Sbjct  518  FYITSIAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWREGFHVTSMATAGSRW  577

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAG+S+QVVELDFLYPSEGIH+RW+ GYRIT+ AAT DQ+A ILSIPRRK+ DE
Sbjct  578  GVVMSRNAGFSKQVVELDFLYPSEGIHKRWDKGYRITATAATLDQSALILSIPRRKLSDE  637

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTS FPSTHVK+KWSKNLY+A +CYGRTVC
Sbjct  638  TQETLRTSQFPSTHVKDKWSKNLYLACLCYGRTVC  672



>gb|KHN27094.1| Casein kinase I [Glycine soja]
Length=657

 Score =   264 bits (675),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYI+SIAG+ NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKW+EGFHVTSM TAGSRW
Sbjct  503  FYITSIAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWREGFHVTSMATAGSRW  562

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAG+S+QVVELDFLYPSEGIH+RW+ GYRIT+ AAT DQ+A ILSIPRRK+ DE
Sbjct  563  GVVMSRNAGFSKQVVELDFLYPSEGIHKRWDKGYRITATAATLDQSALILSIPRRKLSDE  622

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTS FP THVKEKWSKNLY+A +CYGRTVC
Sbjct  623  TQETLRTSQFPGTHVKEKWSKNLYLACLCYGRTVC  657



>ref|XP_003556554.1| PREDICTED: uncharacterized protein LOC100807373 [Glycine max]
Length=669

 Score =   264 bits (675),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYI+SIAG+ NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKW+EGFHVTSM TAGSRW
Sbjct  515  FYITSIAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWREGFHVTSMATAGSRW  574

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAG+S+QVVELDFLYPSEGIH+RW+ GYRIT+ AAT DQ+A ILSIPRRK+ DE
Sbjct  575  GVVMSRNAGFSKQVVELDFLYPSEGIHKRWDKGYRITATAATLDQSALILSIPRRKLSDE  634

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTS FP THVKEKWSKNLY+A +CYGRTVC
Sbjct  635  TQETLRTSQFPGTHVKEKWSKNLYLACLCYGRTVC  669



>gb|KDP33655.1| hypothetical protein JCGZ_07226 [Jatropha curcas]
Length=664

 Score =   264 bits (675),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YI+S+AG ANGS+LVVMSKGTPYTQQSYKVS+ FPFKWINKKWKEGF VTSMTTAGS+W
Sbjct  510  YYITSVAGTANGSALVVMSKGTPYTQQSYKVSDVFPFKWINKKWKEGFSVTSMTTAGSKW  569

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            G+VMSRNAGY  QVVELDFLYPSEGIHRRWESGYRITS AATADQAAFILS P+RK  D 
Sbjct  570  GIVMSRNAGYPNQVVELDFLYPSEGIHRRWESGYRITSTAATADQAAFILSAPKRKSSDV  629

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             QETLRTSAFPSTHVK+KWSKNLYIASICYGRTV
Sbjct  630  AQETLRTSAFPSTHVKDKWSKNLYIASICYGRTV  663



>ref|XP_008797930.1| PREDICTED: uncharacterized protein LOC103712966 isoform X3 [Phoenix 
dactylifera]
Length=728

 Score =   265 bits (678),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T+GSRW
Sbjct  574  YYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATSGSRW  633

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            G+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITSMAAT DQAA ILS+P+R+  DE
Sbjct  634  GIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSMAATWDQAALILSVPKRRPGDE  693

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  694  TQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  727



>ref|XP_008797939.1| PREDICTED: uncharacterized protein LOC103712966 isoform X4 [Phoenix 
dactylifera]
Length=727

 Score =   265 bits (677),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T+GSRW
Sbjct  573  YYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATSGSRW  632

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            G+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITSMAAT DQAA ILS+P+R+  DE
Sbjct  633  GIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSMAATWDQAALILSVPKRRPGDE  692

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  693  TQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  726



>ref|XP_008797915.1| PREDICTED: uncharacterized protein LOC103712966 isoform X1 [Phoenix 
dactylifera]
Length=732

 Score =   265 bits (677),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T+GSRW
Sbjct  578  YYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATSGSRW  637

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            G+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITSMAAT DQAA ILS+P+R+  DE
Sbjct  638  GIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSMAATWDQAALILSVPKRRPGDE  697

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  698  TQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  731



>ref|XP_008797922.1| PREDICTED: uncharacterized protein LOC103712966 isoform X2 [Phoenix 
dactylifera]
Length=731

 Score =   265 bits (677),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T+GSRW
Sbjct  577  YYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATSGSRW  636

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            G+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITSMAAT DQAA ILS+P+R+  DE
Sbjct  637  GIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSMAATWDQAALILSVPKRRPGDE  696

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  697  TQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  730



>gb|ADE76410.1| unknown [Picea sitchensis]
Length=444

 Score =   258 bits (659),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVS+ FPFKWINKKWKEGF+VTSM+TA SRWGVVMSRNAG+S+QV
Sbjct  304  LVVMSKGTPYTQQSYKVSDFFPFKWINKKWKEGFYVTSMSTAASRWGVVMSRNAGFSDQV  363

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+ G+RIT+ AAT DQAAFILS+P+RK  DETQETLRTSAFPSTH
Sbjct  364  VELDFLYPSEGIHRRWDGGFRITATAATWDQAAFILSVPKRKPGDETQETLRTSAFPSTH  423

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLY+A++CYGRTV
Sbjct  424  VKEKWAKNLYLAAVCYGRTV  443



>ref|XP_009382978.1| PREDICTED: uncharacterized protein LOC103970784 [Musa acuminata 
subsp. malaccensis]
Length=721

 Score =   265 bits (676),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVSESFPFKWINKKWKEGFHVTSM TAGSRWG+VMSRNAG+S+QV
Sbjct  581  LVVMSKGTQYTQQSYKVSESFPFKWINKKWKEGFHVTSMATAGSRWGIVMSRNAGFSDQV  640

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+SGYRITSM AT DQAA ILS+P+RK  DETQETLRTSAFPS H
Sbjct  641  VELDFLYPSEGIHRRWDSGYRITSMGATWDQAALILSVPKRKPGDETQETLRTSAFPSAH  700

Query  293  VKEKWSKNLYIASICYGRTV  234
            VK+KW+KNLY+ASICYGRTV
Sbjct  701  VKDKWAKNLYLASICYGRTV  720


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 64/122 (52%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD-FLYPSEGIH  435
            Y V+++   + I +  ++G  ++ + +  + W ++M    G++ QV EL  F    E I 
Sbjct  501  YNVADARLAQHIERGNEDGLLISCVASCSNLWAIIMDAGTGFTSQVYELSPFFLHKEWIM  560

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y ITS+A + + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  561  EQWEKNYYITSLAGSNNGSSLVVM---SKGTQYTQQSYKVSESFPFKWINKKWKEGFHVT  617

Query  257  SI  252
            S+
Sbjct  618  SM  619



>ref|XP_001770883.1| predicted protein [Physcomitrella patens]
 gb|EDQ64213.1| predicted protein [Physcomitrella patens]
Length=603

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYIS+IAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGF+VTSM TAGSRW
Sbjct  449  FYISAIAGANNGSSLVVMSKGTSYTQQSYKVSDSFPFKWINKKWREGFYVTSMATAGSRW  508

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRRK  DE
Sbjct  509  GVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAAFVLSVPRRKPADE  568

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFPSTHVKEKWSKNLYIA++ YGRTV
Sbjct  569  TQETLRTSAFPSTHVKEKWSKNLYIAAVSYGRTV  602



>emb|CDP13154.1| unnamed protein product [Coffea canephora]
Length=601

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y QQSYKVS+SFPFKWINKKWKEGFHVTSM TAG+RW VVMSRN+G+S+QV
Sbjct  461  LVVMSKGTMYNQQSYKVSDSFPFKWINKKWKEGFHVTSMATAGTRWAVVMSRNSGFSDQV  520

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIH+RW+SGYRIT+ AAT DQAA ILS+PRRK++DETQETLRTS FPSTH
Sbjct  521  VELDFLYPSEGIHKRWDSGYRITATAATWDQAALILSVPRRKLLDETQETLRTSQFPSTH  580

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLY+AS+CYGRTVC
Sbjct  581  VKEKWAKNLYLASLCYGRTVC  601



>ref|XP_001764211.1| predicted protein [Physcomitrella patens]
 gb|EDQ71052.1| predicted protein [Physcomitrella patens]
Length=603

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYIS+IAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGF+VTSM TAGSRW
Sbjct  449  FYISAIAGANNGSSLVVMSKGTSYTQQSYKVSDSFPFKWINKKWREGFYVTSMATAGSRW  508

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRRK  DE
Sbjct  509  GVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAAFVLSVPRRKPADE  568

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFPSTHVKEKWSKNLYIA++ YGRTV
Sbjct  569  TQETLRTSAFPSTHVKEKWSKNLYIAAVSYGRTV  602



>ref|XP_008787870.1| PREDICTED: uncharacterized protein LOC103705792 [Phoenix dactylifera]
Length=730

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T+GSRWGVVMSRNAG+S+QV
Sbjct  590  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATSGSRWGVVMSRNAGFSDQV  649

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++GYRITS+AAT DQAA ILS+P+RK  DETQETLRTSAFPS H
Sbjct  650  VELDFLYPSEGIHRRWDNGYRITSVAATWDQAALILSVPKRKPGDETQETLRTSAFPSAH  709

Query  293  VKEKWSKNLYIASICYGRTV  234
            VK+KW+KNLY+A++CYGRTV
Sbjct  710  VKDKWAKNLYLAAVCYGRTV  729



>ref|XP_008367866.1| PREDICTED: casein kinase I [Malus domestica]
Length=540

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGFHVT+M TAGSRW +VMSR AG+S+QV
Sbjct  400  LVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFHVTAMATAGSRWAIVMSRGAGFSDQV  459

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++GYRITS AAT DQAAF+LS+PRRK+ DETQETLRTSAFPSTH
Sbjct  460  VELDFLYPSEGIHRRWDNGYRITSTAATWDQAAFVLSVPRRKLADETQETLRTSAFPSTH  519

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLYIASICYGRTV
Sbjct  520  VKEKWGKNLYIASICYGRTV  539



>emb|CDY23629.1| BnaC05g39650D [Brassica napus]
Length=525

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y+QQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQV
Sbjct  385  LVVMSKGTQYSQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQV  444

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEG+HRRW+ GYRITS AAT DQAA ILSIPRR++ DETQETLRTS FPSTH
Sbjct  445  VELDFLYPSEGVHRRWDGGYRITSTAATTDQAALILSIPRRRLADETQETLRTSQFPSTH  504

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLY+AS+ YGRTV
Sbjct  505  VKEKWGKNLYLASLSYGRTV  524



>ref|XP_010939947.1| PREDICTED: uncharacterized protein LOC105058653 isoform X2 [Elaeis 
guineensis]
Length=725

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T+GSRWGVVMSRNAG+S+QV
Sbjct  585  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATSGSRWGVVMSRNAGFSDQV  644

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++GYRITS+AAT DQAA ILS+P+RK  DETQETLRTSAFPS H
Sbjct  645  VELDFLYPSEGIHRRWDNGYRITSVAATWDQAALILSVPKRKPGDETQETLRTSAFPSAH  704

Query  293  VKEKWSKNLYIASICYGRTV  234
            VK+KW+KNLY+A++CYGRTV
Sbjct  705  VKDKWAKNLYLAAVCYGRTV  724



>ref|XP_010939945.1| PREDICTED: uncharacterized protein LOC105058653 isoform X1 [Elaeis 
guineensis]
 ref|XP_010939946.1| PREDICTED: uncharacterized protein LOC105058653 isoform X1 [Elaeis 
guineensis]
Length=729

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T+GSRWGVVMSRNAG+S+QV
Sbjct  589  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATSGSRWGVVMSRNAGFSDQV  648

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++GYRITS+AAT DQAA ILS+P+RK  DETQETLRTSAFPS H
Sbjct  649  VELDFLYPSEGIHRRWDNGYRITSVAATWDQAALILSVPKRKPGDETQETLRTSAFPSAH  708

Query  293  VKEKWSKNLYIASICYGRTV  234
            VK+KW+KNLY+A++CYGRTV
Sbjct  709  VKDKWAKNLYLAAVCYGRTV  728



>ref|XP_002967119.1| hypothetical protein SELMODRAFT_144765 [Selaginella moellendorffii]
 gb|EFJ31718.1| hypothetical protein SELMODRAFT_144765 [Selaginella moellendorffii]
Length=596

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYIS+IAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKW+EGF+VTSM TAG+RW
Sbjct  442  FYISAIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWREGFYVTSMATAGTRW  501

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAG+++QVVELDFLYPSEGIHRRW+ GYRIT+ AAT DQAAF+LS+PRRK  DE
Sbjct  502  GVVMSRNAGFTDQVVELDFLYPSEGIHRRWDCGYRITATAATWDQAAFVLSVPRRKPADE  561

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFPSTHVKEKWSKNLYIA++ YGRTV
Sbjct  562  TQETLRTSAFPSTHVKEKWSKNLYIAAVSYGRTV  595



>ref|XP_006445886.1| hypothetical protein CICLE_v10014444mg [Citrus clementina]
 ref|XP_006492686.1| PREDICTED: uncharacterized protein LOC102618306 [Citrus sinensis]
 gb|ESR59126.1| hypothetical protein CICLE_v10014444mg [Citrus clementina]
 gb|KDO62936.1| hypothetical protein CISIN_1g048600mg [Citrus sinensis]
Length=707

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+SEQV
Sbjct  567  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSEQV  626

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+ GYRITS AAT DQAA ILS+PRRK  DETQETLRTS FPSTH
Sbjct  627  VELDFLYPSEGIHRRWDGGYRITSTAATCDQAALILSVPRRKPGDETQETLRTSQFPSTH  686

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLY+A +CYGRTV
Sbjct  687  VKEKWAKNLYLACLCYGRTV  706



>ref|XP_002960894.1| hypothetical protein SELMODRAFT_139482 [Selaginella moellendorffii]
 gb|EFJ38433.1| hypothetical protein SELMODRAFT_139482 [Selaginella moellendorffii]
Length=596

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYIS+IAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKW+EGF+VTSM TAG+RW
Sbjct  442  FYISAIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWREGFYVTSMATAGTRW  501

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAG+++QVVELDFLYPSEGIHRRW+ GYRIT+ AAT DQAAF+LS+PRRK  DE
Sbjct  502  GVVMSRNAGFTDQVVELDFLYPSEGIHRRWDCGYRITATAATWDQAAFVLSVPRRKPADE  561

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFPSTHVKEKWSKNLYIA++ YGRTV
Sbjct  562  TQETLRTSAFPSTHVKEKWSKNLYIAAVSYGRTV  595



>emb|CBI28086.3| unnamed protein product [Vitis vinifera]
Length=629

 Score =   261 bits (668),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYI+S+AGA+NG++LVVMSKGTPY QQSYKVS+ FPFKWINKKWKEGF VTSMTTAGSRW
Sbjct  475  FYITSVAGASNGNALVVMSKGTPYNQQSYKVSDVFPFKWINKKWKEGFFVTSMTTAGSRW  534

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            G+VMSRNAG+S QVVELDFLYPSEGIHRRWESGYRITS AATADQAAFILS  +R+  D 
Sbjct  535  GIVMSRNAGFSNQVVELDFLYPSEGIHRRWESGYRITSTAATADQAAFILSTSKRRTQDV  594

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFP THVK+KWSKNLYIASICYGRTV
Sbjct  595  TQETLRTSAFPCTHVKDKWSKNLYIASICYGRTV  628



>ref|XP_006407187.1| hypothetical protein EUTSA_v10020172mg [Eutrema salsugineum]
 gb|ESQ48640.1| hypothetical protein EUTSA_v10020172mg [Eutrema salsugineum]
Length=703

 Score =   263 bits (672),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKWKEGFHVTSM TAGSRWGVVMSRN+GYSEQV
Sbjct  563  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWKEGFHVTSMATAGSRWGVVMSRNSGYSEQV  622

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTH
Sbjct  623  VELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTH  682

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLY+AS+ YGRTV
Sbjct  683  VKEKWGKNLYLASLSYGRTV  702



>ref|XP_007024284.1| Casein kinase I protein isoform 1 [Theobroma cacao]
 gb|EOY26906.1| Casein kinase I protein isoform 1 [Theobroma cacao]
Length=727

 Score =   263 bits (673),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMS+GT Y+QQSYKVSESFPFKWINKKWKEGFHVTSM T+GSRWGVVMSR AG+S+QV
Sbjct  587  LVVMSRGTQYSQQSYKVSESFPFKWINKKWKEGFHVTSMATSGSRWGVVMSRGAGFSDQV  646

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+ GYRIT+ AAT DQAAF+LS+PRRK MDETQETLRTSAFPSTH
Sbjct  647  VELDFLYPSEGIHRRWDCGYRITATAATWDQAAFVLSVPRRKPMDETQETLRTSAFPSTH  706

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLYIAS+CYGRTV
Sbjct  707  VKEKWAKNLYIASVCYGRTV  726



>ref|XP_006849555.1| hypothetical protein AMTR_s00024p00176520 [Amborella trichopoda]
 gb|ERN11136.1| hypothetical protein AMTR_s00024p00176520 [Amborella trichopoda]
Length=707

 Score =   263 bits (671),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS++FPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QV
Sbjct  567  LVVMSKGTQYTQQSYKVSDTFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQV  626

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+SGYRIT+ AAT DQAA ILS+P+RK  DETQETLRTSAFPS+H
Sbjct  627  VELDFLYPSEGIHRRWDSGYRITATAATFDQAALILSVPKRKPGDETQETLRTSAFPSSH  686

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKWSKNLY+ASICYGRTV
Sbjct  687  VKEKWSKNLYLASICYGRTV  706



>tpg|DAA54810.1| TPA: hypothetical protein ZEAMMB73_098757 [Zea mays]
Length=326

 Score =   252 bits (644),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISS+AG+ NGSS+VVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVT+M T+G+RW
Sbjct  172  FYISSVAGSNNGSSIVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTAMATSGNRW  231

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
             +VMSR+AG+SEQVVELDFLYPSEGIHRRW++G+RIT+MAAT DQ+A ILS PRR+  DE
Sbjct  232  AIVMSRSAGFSEQVVELDFLYPSEGIHRRWDNGFRITAMAATMDQSALILSKPRRRPRDE  291

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRT+ FPS HVK+KW+KNLY+A ICYGRTV 
Sbjct  292  TQETLRTTQFPSQHVKDKWAKNLYLAGICYGRTVA  326



>ref|XP_008351086.1| PREDICTED: uncharacterized protein LOC103414488 [Malus domestica]
Length=486

 Score =   257 bits (657),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QV
Sbjct  346  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQV  405

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++G+RITS AAT DQAA ILS+P+RK  DETQETLRTS FPSTH
Sbjct  406  VELDFLYPSEGIHRRWDNGFRITSTAATWDQAALILSVPKRKPGDETQETLRTSQFPSTH  465

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLY+A +CYGRTV
Sbjct  466  VKEKWAKNLYLACLCYGRTV  485



>ref|XP_003532324.1| PREDICTED: serine/threonine-protein kinase VRK1-like [Glycine 
max]
Length=672

 Score =   262 bits (669),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QV
Sbjct  532  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQV  591

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++GYRIT+ AAT DQ+A ILSIPRR+  DETQETLRTS FPSTH
Sbjct  592  VELDFLYPSEGIHRRWDNGYRITATAATWDQSALILSIPRRRPGDETQETLRTSQFPSTH  651

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKWSKNLY+A +CYGRTVC
Sbjct  652  VKEKWSKNLYLACLCYGRTVC  672



>gb|KHN24964.1| Casein kinase I isoform alpha [Glycine soja]
Length=708

 Score =   263 bits (671),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QV
Sbjct  568  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQV  627

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++GYRIT+ AAT DQ+A ILSIPRR+  DETQETLRTS FPSTH
Sbjct  628  VELDFLYPSEGIHRRWDNGYRITATAATWDQSALILSIPRRRPGDETQETLRTSQFPSTH  687

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKWSKNLY+A +CYGRTVC
Sbjct  688  VKEKWSKNLYLACLCYGRTVC  708



>ref|XP_009413490.1| PREDICTED: uncharacterized protein LOC103994778 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009413491.1| PREDICTED: uncharacterized protein LOC103994778 [Musa acuminata 
subsp. malaccensis]
Length=717

 Score =   263 bits (671),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVSESFPFKWINKKWKEGFHVTSM TAGSRWG+VMSRNAG+S+QV
Sbjct  577  LVVMSKGTQYTQQSYKVSESFPFKWINKKWKEGFHVTSMATAGSRWGIVMSRNAGFSDQV  636

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++GYRIT M AT DQAA ILS+P+RK  DETQETLRTSAFPS H
Sbjct  637  VELDFLYPSEGIHRRWDNGYRITCMGATWDQAALILSVPKRKPCDETQETLRTSAFPSAH  696

Query  293  VKEKWSKNLYIASICYGRTV  234
            VK+KW+KNLY+ASICYGRTV
Sbjct  697  VKDKWAKNLYLASICYGRTV  716


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/122 (24%), Positives = 66/122 (54%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD-FLYPSEGIH  435
            Y V+++   + I+K  ++G  ++ + ++ + W ++M    G++ Q+ EL  F    E + 
Sbjct  497  YNVADARLAQHIDKGNEDGLLISCVASSSNLWALIMDAGTGFTSQIYELSPFFLHKEWVM  556

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y ITS+A + + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  557  DQWEKNYYITSLAGSNNGSSLVVM---SKGTQYTQQSYKVSESFPFKWINKKWKEGFHVT  613

Query  257  SI  252
            S+
Sbjct  614  SM  615



>ref|XP_003552750.1| PREDICTED: serine/threonine-protein kinase VRK1-like [Glycine 
max]
 gb|KHN12581.1| Casein kinase I isoform alpha [Glycine soja]
Length=672

 Score =   262 bits (669),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QV
Sbjct  532  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQV  591

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++GYRIT+ AAT DQ+A ILSIPRR+  DETQETLRTS FPSTH
Sbjct  592  VELDFLYPSEGIHRRWDNGYRITATAATWDQSALILSIPRRRPGDETQETLRTSQFPSTH  651

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKWSKNLY+A +CYGRTVC
Sbjct  652  VKEKWSKNLYLACLCYGRTVC  672



>ref|XP_003621013.1| Casein kinase I isoform alpha [Medicago truncatula]
 gb|AES77231.1| casein kinase I-like protein [Medicago truncatula]
Length=599

 Score =   259 bits (663),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVSESFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QV
Sbjct  459  LVVMSKGTQYTQQSYKVSESFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQV  518

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++GYRIT+ AAT DQ+A ILS PRR+  DETQETLRTS FPSTH
Sbjct  519  VELDFLYPSEGIHRRWDNGYRITATAATWDQSALILSKPRRRPADETQETLRTSQFPSTH  578

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKWSKNLY+A +CYGRTVC
Sbjct  579  VKEKWSKNLYLACLCYGRTVC  599



>emb|CBI16476.3| unnamed protein product [Vitis vinifera]
Length=603

 Score =   260 bits (664),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRW
Sbjct  449  FYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRW  508

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQ+A ILS+P+RK  DE
Sbjct  509  GVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQSALILSVPKRKPGDE  568

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  569  TQETLRTSQFPSTHVKEKWAKNLYLACVCYGRTV  602



>ref|XP_009404157.1| PREDICTED: uncharacterized protein LOC103987553 [Musa acuminata 
subsp. malaccensis]
Length=725

 Score =   262 bits (670),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YI+S+AGA NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKWKEGFHVTSM TAG+RW
Sbjct  571  YYITSLAGANNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWKEGFHVTSMATAGTRW  630

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            G+VMSRNAG+S+QVVELDFLYPSEGIHRRW+ GYRITSMAAT DQAA ILS+P+RK  DE
Sbjct  631  GIVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGYRITSMAATWDQAALILSVPKRKPGDE  690

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTS+FPS HVK+KW+KNLY+ASICYGRTV
Sbjct  691  TQETLRTSSFPSAHVKDKWAKNLYLASICYGRTV  724



>emb|CDY55141.1| BnaC01g44810D [Brassica napus]
Length=632

 Score =   260 bits (665),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YISSIAGAANGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRW
Sbjct  478  YYISSIAGAANGSSLVVMSKGTAYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRW  537

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ G+RITS AAT DQAA ILSIPRR+++DE
Sbjct  538  GVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGFRITSTAATTDQAALILSIPRRRLVDE  597

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  598  TQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  631



>ref|XP_007139114.1| hypothetical protein PHAVU_008G002500g [Phaseolus vulgaris]
 gb|ESW11108.1| hypothetical protein PHAVU_008G002500g [Phaseolus vulgaris]
Length=675

 Score =   261 bits (667),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYI+SIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRW
Sbjct  521  FYITSIAGANNGSSLVVMSKGTHYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRW  580

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRN+GY++QV+ELDFLYPSEGIHRRW++GYRIT+ AAT DQ+A ILSIPRR+  DE
Sbjct  581  GVVMSRNSGYTDQVIELDFLYPSEGIHRRWDNGYRITATAATWDQSALILSIPRRRPGDE  640

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  641  TQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  675



>ref|XP_006297084.1| hypothetical protein CARUB_v10013087mg [Capsella rubella]
 gb|EOA29982.1| hypothetical protein CARUB_v10013087mg [Capsella rubella]
Length=704

 Score =   261 bits (668),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQV
Sbjct  564  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQV  623

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTH
Sbjct  624  VELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTH  683

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLY+AS+ YGRTV
Sbjct  684  VKEKWGKNLYLASLSYGRTV  703



>ref|XP_002882838.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59097.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=703

 Score =   261 bits (668),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQV
Sbjct  563  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQV  622

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTH
Sbjct  623  VELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTH  682

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLY+AS+ YGRTV
Sbjct  683  VKEKWGKNLYLASLSYGRTV  702



>ref|XP_010656334.1| PREDICTED: uncharacterized protein LOC100254414 [Vitis vinifera]
 ref|XP_010656335.1| PREDICTED: uncharacterized protein LOC100254414 [Vitis vinifera]
 ref|XP_010656336.1| PREDICTED: uncharacterized protein LOC100254414 [Vitis vinifera]
Length=700

 Score =   261 bits (668),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYI+S+AGA+NG++LVVMSKGTPY QQSYKVS+ FPFKWINKKWKEGF VTSMTTAGSRW
Sbjct  546  FYITSVAGASNGNALVVMSKGTPYNQQSYKVSDVFPFKWINKKWKEGFFVTSMTTAGSRW  605

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            G+VMSRNAG+S QVVELDFLYPSEGIHRRWESGYRITS AATADQAAFILS  +R+  D 
Sbjct  606  GIVMSRNAGFSNQVVELDFLYPSEGIHRRWESGYRITSTAATADQAAFILSTSKRRTQDV  665

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFP THVK+KWSKNLYIASICYGRTV
Sbjct  666  TQETLRTSAFPCTHVKDKWSKNLYIASICYGRTV  699



>tpg|DAA54809.1| TPA: hypothetical protein ZEAMMB73_098757 [Zea mays]
Length=346

 Score =   252 bits (643),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISS+AG+ NGSS+VVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVT+M T+G+RW
Sbjct  192  FYISSVAGSNNGSSIVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTAMATSGNRW  251

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
             +VMSR+AG+SEQVVELDFLYPSEGIHRRW++G+RIT+MAAT DQ+A ILS PRR+  DE
Sbjct  252  AIVMSRSAGFSEQVVELDFLYPSEGIHRRWDNGFRITAMAATMDQSALILSKPRRRPRDE  311

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRT+ FPS HVK+KW+KNLY+A ICYGRTV
Sbjct  312  TQETLRTTQFPSQHVKDKWAKNLYLAGICYGRTV  345



>gb|KFK38714.1| hypothetical protein AALP_AA3G150500 [Arabis alpina]
Length=700

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQV
Sbjct  560  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQV  619

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTH
Sbjct  620  VELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTH  679

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLY+AS+ YGRTV
Sbjct  680  VKEKWGKNLYLASLSYGRTV  699



>emb|CDY51730.1| BnaA01g37130D [Brassica napus]
Length=684

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQV
Sbjct  544  LVVMSKGTAYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQV  603

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEG+HRRW+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTH
Sbjct  604  VELDFLYPSEGVHRRWDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTH  663

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLY+AS+ YGRTV
Sbjct  664  VKEKWGKNLYLASLSYGRTV  683



>emb|CDX75726.1| BnaC03g38090D [Brassica napus]
Length=652

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAG+RWGVVMSRN+GYSEQV
Sbjct  512  LVVMSKGTAYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGTRWGVVMSRNSGYSEQV  571

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTH
Sbjct  572  VELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTH  631

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLY+AS+ YGRTV
Sbjct  632  VKEKWGKNLYLASLSYGRTV  651



>ref|XP_010500960.1| PREDICTED: uncharacterized protein LOC104778257 isoform X1 [Camelina 
sativa]
Length=711

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQV
Sbjct  571  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQV  630

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTH
Sbjct  631  VELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTH  690

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLY+AS+ YGRTV
Sbjct  691  VKEKWGKNLYLASLSYGRTV  710



>ref|XP_010465212.1| PREDICTED: uncharacterized protein LOC104745616 [Camelina sativa]
Length=714

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQV
Sbjct  574  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQV  633

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTH
Sbjct  634  VELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTH  693

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLY+AS+ YGRTV
Sbjct  694  VKEKWGKNLYLASLSYGRTV  713



>ref|XP_010487127.1| PREDICTED: serine/threonine-protein kinase STE20-like [Camelina 
sativa]
Length=717

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQV
Sbjct  577  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQV  636

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTH
Sbjct  637  VELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTH  696

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLY+AS+ YGRTV
Sbjct  697  VKEKWGKNLYLASLSYGRTV  716



>gb|KDP44321.1| hypothetical protein JCGZ_19188 [Jatropha curcas]
Length=710

 Score =   261 bits (667),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QV
Sbjct  570  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQV  629

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++G+RITS AAT DQAA ILS+PRRK  DETQETLRTS FPSTH
Sbjct  630  VELDFLYPSEGIHRRWDNGFRITSTAATLDQAALILSVPRRKPGDETQETLRTSQFPSTH  689

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLY+A +CYGRTV
Sbjct  690  VKEKWAKNLYLACLCYGRTV  709



>gb|KHN18151.1| Casein kinase I like 2 [Glycine soja]
Length=486

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M TAGSRW +VMSR AG+S+QV
Sbjct  346  LVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMATAGSRWAIVMSRGAGFSDQV  405

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++GYRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTH
Sbjct  406  VELDFLYPSEGIHRRWDNGYRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTH  465

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLYIASICYGRTV
Sbjct  466  VKEKWAKNLYIASICYGRTV  485



>emb|CDX97505.1| BnaA05g25740D [Brassica napus]
Length=653

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y+QQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQV
Sbjct  513  LVVMSKGTQYSQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQV  572

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEG+HRRW+ GYRITS AAT DQAA ILSIPRR++ DETQETLRTS FPSTH
Sbjct  573  VELDFLYPSEGVHRRWDGGYRITSTAATTDQAALILSIPRRRLADETQETLRTSQFPSTH  632

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLY+AS+ YGRTV
Sbjct  633  VKEKWGKNLYLASLSYGRTV  652



>ref|XP_009146466.1| PREDICTED: uncharacterized protein LOC103870106 [Brassica rapa]
Length=689

 Score =   260 bits (665),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y+QQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQV
Sbjct  549  LVVMSKGTQYSQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQV  608

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEG+HRRW+ GYRITS AAT DQAA ILSIPRR++ DETQETLRTS FPSTH
Sbjct  609  VELDFLYPSEGVHRRWDGGYRITSTAATTDQAALILSIPRRRLADETQETLRTSQFPSTH  668

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLY+AS+ YGRTV
Sbjct  669  VKEKWGKNLYLASLSYGRTV  688



>emb|CAN69523.1| hypothetical protein VITISV_040873 [Vitis vinifera]
Length=670

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRW
Sbjct  516  FYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRW  575

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQ+A ILS+P+RK  DE
Sbjct  576  GVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQSALILSVPKRKPGDE  635

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  636  TQETLRTSQFPSTHVKEKWAKNLYLACVCYGRTV  669



>ref|XP_008352012.1| PREDICTED: uncharacterized protein LOC103415457 [Malus domestica]
Length=677

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y QQSYKVSESFPFKWINKKW+EGFHVT+M TAGSRW +VMSR AG+SEQV
Sbjct  537  LVVMSKGTQYLQQSYKVSESFPFKWINKKWREGFHVTAMATAGSRWAIVMSRGAGFSEQV  596

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++GYRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTH
Sbjct  597  VELDFLYPSEGIHRRWDNGYRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTH  656

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLYIASICYGRTV
Sbjct  657  VKEKWGKNLYIASICYGRTV  676



>gb|KDO79864.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
Length=512

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M TAGSRW +VMSR AG+S+QV
Sbjct  372  LVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMATAGSRWAIVMSRGAGFSDQV  431

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTH
Sbjct  432  VELDFLYPSEGIHRRWDSGYRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTH  491

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLYIAS+CYGRTV
Sbjct  492  VKEKWAKNLYIASVCYGRTV  511


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/121 (21%), Positives = 63/121 (52%), Gaps = 3/121 (2%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD-FLYPSEGIH  435
            Y V+++   + I K  ++G  ++S+ +  + W ++M    G+S QV EL  +    E I 
Sbjct  292  YNVADARLSQHIEKGNEDGLFISSVASCSNLWALIMDAGTGFSAQVYELSPYFLHKEWIM  351

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIAS  255
             +WE  Y I+++A   + ++ ++     + + ++ +   + +FP   + +KW +  Y+ +
Sbjct  352  EQWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKV--SDSFPFKWINKKWREGFYVTA  409

Query  254  I  252
            +
Sbjct  410  M  410



>ref|NP_187977.1| protein kinase family protein [Arabidopsis thaliana]
 dbj|BAB01914.1| casein kinase-like protein [Arabidopsis thaliana]
 gb|AAL85021.1| putative casein kinase [Arabidopsis thaliana]
 gb|AAM51279.1| putative casein kinase [Arabidopsis thaliana]
 gb|AEE75390.1| protein kinase family protein [Arabidopsis thaliana]
Length=703

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAG+RWGVVMSRN+GYSEQV
Sbjct  563  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGNRWGVVMSRNSGYSEQV  622

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR+++DETQETLRTS FPSTH
Sbjct  623  VELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRRRLVDETQETLRTSQFPSTH  682

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLY+AS+ YGRTV
Sbjct  683  VKEKWGKNLYLASLSYGRTV  702



>ref|XP_004142151.1| PREDICTED: uncharacterized protein LOC101213194 [Cucumis sativus]
 ref|XP_008449783.1| PREDICTED: uncharacterized protein LOC103491568 [Cucumis melo]
 gb|KGN54092.1| hypothetical protein Csa_4G285680 [Cucumis sativus]
Length=694

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QV
Sbjct  554  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQV  613

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++GYRITS AAT DQAA ILS+PRRK  DETQETLRTS FPSTH
Sbjct  614  VELDFLYPSEGIHRRWDNGYRITSTAATWDQAALILSVPRRKPGDETQETLRTSQFPSTH  673

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLY+A +CYGRTV
Sbjct  674  VKEKWAKNLYLACLCYGRTV  693



>ref|XP_010257513.1| PREDICTED: uncharacterized protein LOC104597586 [Nelumbo nucifera]
 ref|XP_010257516.1| PREDICTED: uncharacterized protein LOC104597586 [Nelumbo nucifera]
 ref|XP_010257517.1| PREDICTED: uncharacterized protein LOC104597586 [Nelumbo nucifera]
Length=726

 Score =   261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWG+VMSRNAG+S+QV
Sbjct  586  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGIVMSRNAGFSDQV  645

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+SGYRITS AAT DQAA ILS+P+RK  DETQETLRTS FPSTH
Sbjct  646  VELDFLYPSEGIHRRWDSGYRITSTAATWDQAALILSVPKRKPGDETQETLRTSQFPSTH  705

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLY+AS+CYGRTV
Sbjct  706  VKEKWAKNLYLASLCYGRTV  725



>ref|XP_004162011.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101213194 
[Cucumis sativus]
Length=694

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QV
Sbjct  554  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQV  613

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++GYRITS AAT DQAA ILS+PRRK  DETQETLRTS FPSTH
Sbjct  614  VELDFLYPSEGIHRRWDNGYRITSTAATWDQAALILSVPRRKPGDETQETLRTSQFPSTH  673

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLY+A +CYGRTV
Sbjct  674  VKEKWAKNLYLACLCYGRTV  693



>ref|XP_008338530.1| PREDICTED: casein kinase I homolog 2-like [Malus domestica]
Length=538

 Score =   256 bits (655),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QV
Sbjct  398  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQV  457

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILS+P+RK  DETQETLRTS FPSTH
Sbjct  458  VELDFLYPSEGIHRRWDGGFRITSTAATWDQAALILSVPKRKPGDETQETLRTSQFPSTH  517

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLY+A +CYGRTV
Sbjct  518  VKEKWAKNLYLACLCYGRTV  537



>gb|KJB56821.1| hypothetical protein B456_009G137100 [Gossypium raimondii]
Length=719

 Score =   261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y QQSYKVSESFPFKWINKKW+EGFHVTSM T+GSRWGVVMSR AG+S+QV
Sbjct  579  LVVMSKGTSYLQQSYKVSESFPFKWINKKWREGFHVTSMATSGSRWGVVMSRGAGFSDQV  638

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRR+  DETQETLRTSAFPSTH
Sbjct  639  VELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRRRPADETQETLRTSAFPSTH  698

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLYIAS+CYGRTV
Sbjct  699  VKEKWAKNLYIASVCYGRTV  718



>ref|XP_007013209.1| Kinase family protein isoform 5 [Theobroma cacao]
 gb|EOY30828.1| Kinase family protein isoform 5 [Theobroma cacao]
Length=473

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYI+S+AGA NGS+LVVMSKGTPYTQQSYKVS+ FPFKWINKKWKEGF VTSMTTAGS+W
Sbjct  319  FYITSVAGAGNGSALVVMSKGTPYTQQSYKVSDVFPFKWINKKWKEGFSVTSMTTAGSKW  378

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            G+VMSRNAGY  QVVELDFLYPSEGIHRRWE GYRITS AAT DQAAFILS P+RK  D 
Sbjct  379  GIVMSRNAGYPSQVVELDFLYPSEGIHRRWEKGYRITSAAATQDQAAFILSAPKRKSQDI  438

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             QETLRT+AFPSTHVK+KW KNLYI+ ICYGRTV
Sbjct  439  MQETLRTTAFPSTHVKDKWLKNLYISCICYGRTV  472



>gb|EMS55588.1| Casein kinase I-like protein 2 [Triticum urartu]
Length=597

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISS+AGA  GSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSM T+GSRW
Sbjct  443  FYISSVAGANIGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMATSGSRW  502

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
             +VMSRNAG+++QVVELDFLYPSEG+HRRW++GYRIT+MAAT DQ+A ILS+PRR+  DE
Sbjct  503  AIVMSRNAGFTDQVVELDFLYPSEGVHRRWDNGYRITAMAATMDQSALILSMPRRRPRDE  562

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTS FPS HVK+KW+KNLY+A ICYGRTV 
Sbjct  563  TQETLRTSQFPSAHVKDKWAKNLYLAGICYGRTVA  597



>ref|XP_002283346.1| PREDICTED: uncharacterized protein LOC100263956 [Vitis vinifera]
Length=714

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRW
Sbjct  560  FYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRW  619

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQ+A ILS+P+RK  DE
Sbjct  620  GVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQSALILSVPKRKPGDE  679

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  680  TQETLRTSQFPSTHVKEKWAKNLYLACVCYGRTV  713



>ref|XP_010915404.1| PREDICTED: uncharacterized protein LOC105040538 [Elaeis guineensis]
Length=683

 Score =   259 bits (663),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YIS++AGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKWKEGF+VT+M TAGSRW
Sbjct  529  YYISALAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWKEGFYVTAMATAGSRW  588

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
             VVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRRK  DE
Sbjct  589  AVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRRKPADE  648

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFPS HVKEKWSKNLYIASICYGRTV
Sbjct  649  TQETLRTSAFPSQHVKEKWSKNLYIASICYGRTV  682


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 65/123 (53%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + I K  ++G  ++S+ +  + W ++M    GY+ QV EL   FL+  E I
Sbjct  463  YNVADARLAQHIEKGNEDGLFISSVASCTNLWALIMDAGTGYTAQVYELSPCFLH-KEWI  521

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+++A   + ++ ++     K     Q++ + S +FP   + +KW +  Y+
Sbjct  522  MEQWEKNYYISALAGANNGSSLVVM---SKGTQYAQQSYKVSDSFPFKWINKKWKEGFYV  578

Query  260  ASI  252
             ++
Sbjct  579  TAM  581



>ref|XP_008228435.1| PREDICTED: uncharacterized protein LOC103327845 [Prunus mume]
Length=706

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTP+TQQSYKVS++FPFKWINKKW+EGF+VT+M T+GSRW VVMSR AGYSEQV
Sbjct  566  LVVMSKGTPFTQQSYKVSDTFPFKWINKKWREGFYVTAMATSGSRWAVVMSRGAGYSEQV  625

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTH
Sbjct  626  VELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRRKPQDETQETLRTSAFPSTH  685

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLYIAS+CYGRTV
Sbjct  686  VKEKWAKNLYIASMCYGRTV  705



>dbj|BAJ99119.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=480

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISS+AGA  GSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGF+VTSM T+GSRW
Sbjct  326  FYISSVAGANTGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFYVTSMATSGSRW  385

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
             +VMSRNAG+++QVVELDFLYPSEG+HRRW++GYRIT+MAAT DQ+A ILS+PRR+  DE
Sbjct  386  AIVMSRNAGFTDQVVELDFLYPSEGVHRRWDNGYRITAMAATMDQSALILSMPRRRPRDE  445

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLR S FPS HVK+KW+KNLY+A ICYGRTV 
Sbjct  446  TQETLRASQFPSAHVKDKWAKNLYLAGICYGRTVA  480



>emb|CBI36074.3| unnamed protein product [Vitis vinifera]
Length=606

 Score =   258 bits (659),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T+GSRW
Sbjct  452  FYISAIAGATNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTSMATSGSRW  511

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSR AG+SEQVVELDFLYPSEGIHRRW++G+RIT+ AAT DQAAF+LS+PRRK +DE
Sbjct  512  GVVMSRGAGFSEQVVELDFLYPSEGIHRRWDNGFRITATAATWDQAAFVLSVPRRKPVDE  571

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  572  TQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  605



>ref|XP_009406168.1| PREDICTED: uncharacterized protein LOC103989128 [Musa acuminata 
subsp. malaccensis]
Length=685

 Score =   259 bits (663),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YI+++AGA N SSLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGF+VT+M TAG+RW
Sbjct  531  YYITALAGANNVSSLVVMSKGTQYVQQSYKVSESFPFKWINKKWREGFYVTAMATAGTRW  590

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRNAG+S+QVVELDFLYPSEGIHRRW+ GYRIT+ AAT DQAAF+LS+PRRK  DE
Sbjct  591  GVVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGYRITATAATMDQAAFVLSVPRRKPTDE  650

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFPS HVKEKW+KNLYIAS+CYGRTV
Sbjct  651  TQETLRTSAFPSQHVKEKWAKNLYIASVCYGRTV  684



>ref|XP_004491691.1| PREDICTED: serine/threonine-protein kinase VRK1-like [Cicer arietinum]
Length=667

 Score =   259 bits (662),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QV
Sbjct  527  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQV  586

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++GYRIT+ AAT DQ+A ILS PRR+  DETQETLRTS FPSTH
Sbjct  587  VELDFLYPSEGIHRRWDNGYRITATAATWDQSALILSKPRRRPADETQETLRTSQFPSTH  646

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKWSKNLY+A +CYGRTVC
Sbjct  647  VKEKWSKNLYLACLCYGRTVC  667



>ref|XP_007014775.1| Kinase family protein isoform 2 [Theobroma cacao]
 gb|EOY32394.1| Kinase family protein isoform 2 [Theobroma cacao]
Length=701

 Score =   260 bits (664),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGF+VTSM TAGSRWGVVMSRNAG+S+QV
Sbjct  561  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFYVTSMATAGSRWGVVMSRNAGFSDQV  620

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++GYRITS AAT+DQAA ILSIP+RK  DETQETLRTS FPSTH
Sbjct  621  VELDFLYPSEGIHRRWDNGYRITSTAATSDQAALILSIPKRKPGDETQETLRTSQFPSTH  680

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLY+A +CYGRTV
Sbjct  681  VKEKWAKNLYLACLCYGRTV  700



>ref|XP_008655737.1| PREDICTED: uncharacterized protein LOC103634938 [Zea mays]
 gb|AFW80326.1| hypothetical protein ZEAMMB73_054184 [Zea mays]
 gb|AFW80327.1| hypothetical protein ZEAMMB73_054184 [Zea mays]
Length=332

 Score =   250 bits (638),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYI+++AGA NGSSLV+MS+GT Y QQSYKVS++FPFKWINKKWKEGF+VT+M TAGSRW
Sbjct  178  FYITALAGANNGSSLVIMSRGTQYAQQSYKVSDTFPFKWINKKWKEGFYVTAMATAGSRW  237

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
             VVMSRNAG++ QVVELDFLYPSEGIH RW++GYRIT+ AAT DQAAFILSIPRRK  DE
Sbjct  238  AVVMSRNAGFTSQVVELDFLYPSEGIHMRWDNGYRITATAATWDQAAFILSIPRRKPSDE  297

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFPS HVK+KWSKNLY+ASICYGR+V
Sbjct  298  TQETLRTSAFPSQHVKDKWSKNLYLASICYGRSV  331



>gb|KJB21848.1| hypothetical protein B456_004G018000 [Gossypium raimondii]
Length=704

 Score =   260 bits (664),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGF+VTSMTTAGSRWGVVMSRNAG+S+QV
Sbjct  564  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFYVTSMTTAGSRWGVVMSRNAGFSDQV  623

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+SGYRITS AAT DQAA ILSIP+RK  DETQETLRTS FPS H
Sbjct  624  VELDFLYPSEGIHRRWDSGYRITSTAATLDQAALILSIPKRKPGDETQETLRTSQFPSIH  683

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLY+A +CYGRTV
Sbjct  684  VKEKWAKNLYLACLCYGRTV  703



>ref|XP_009117581.1| PREDICTED: uncharacterized protein LOC103842673 [Brassica rapa]
Length=683

 Score =   259 bits (662),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YISSIAGAANGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRW
Sbjct  529  YYISSIAGAANGSSLVVMSKGTAYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRW  588

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ G+RITS AAT DQAA ILSIPRR+++D+
Sbjct  589  GVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGFRITSTAATTDQAALILSIPRRRLVDK  648

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  649  TQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  682



>ref|XP_009395056.1| PREDICTED: uncharacterized protein LOC103980386 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=680

 Score =   259 bits (662),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPY QQSYKVSESFPFKWINKKW+EGF+VT+M TAG+RW VVMSRNAG+ EQV
Sbjct  540  LVVMSKGTPYAQQSYKVSESFPFKWINKKWREGFYVTAMATAGNRWAVVMSRNAGFLEQV  599

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRRK +DETQETLRTSAFPS H
Sbjct  600  VELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRRKPVDETQETLRTSAFPSQH  659

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLY+AS+CYGRTV
Sbjct  660  VKEKWAKNLYLASVCYGRTV  679



>ref|XP_002531638.1| casein kinase, putative [Ricinus communis]
 gb|EEF30734.1| casein kinase, putative [Ricinus communis]
Length=703

 Score =   259 bits (663),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QV
Sbjct  563  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQV  622

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++G+RITS AAT DQAA ILS+PRRK  DETQETLRTS FPSTH
Sbjct  623  VELDFLYPSEGIHRRWDNGFRITSTAATFDQAALILSVPRRKPGDETQETLRTSQFPSTH  682

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLY+A +CYGRTV
Sbjct  683  VKEKWAKNLYLACLCYGRTV  702



>ref|XP_009395055.1| PREDICTED: uncharacterized protein LOC103980386 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=684

 Score =   259 bits (662),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPY QQSYKVSESFPFKWINKKW+EGF+VT+M TAG+RW VVMSRNAG+ EQV
Sbjct  544  LVVMSKGTPYAQQSYKVSESFPFKWINKKWREGFYVTAMATAGNRWAVVMSRNAGFLEQV  603

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRRK +DETQETLRTSAFPS H
Sbjct  604  VELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRRKPVDETQETLRTSAFPSQH  663

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLY+AS+CYGRTV
Sbjct  664  VKEKWAKNLYLASVCYGRTV  683



>gb|KFK32550.1| hypothetical protein AALP_AA6G257400 [Arabis alpina]
Length=673

 Score =   259 bits (661),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
             VVMSKGTPY QQSYKVS+SFPFKWINKKWKEGF+VTSM TAGS+WG+VMSR AG+S+QV
Sbjct  533  FVVMSKGTPYLQQSYKVSDSFPFKWINKKWKEGFYVTSMATAGSKWGIVMSRGAGFSDQV  592

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++GYRITS+AAT DQAA +LS+PRRK  DETQETLRTSAFPSTH
Sbjct  593  VELDFLYPSEGIHRRWDNGYRITSVAATCDQAALVLSVPRRKPSDETQETLRTSAFPSTH  652

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLYI+S+CYGRTV
Sbjct  653  VKEKWAKNLYISSMCYGRTV  672



>gb|KHG14825.1| hypothetical protein F383_08945 [Gossypium arboreum]
Length=719

 Score =   260 bits (664),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y QQSYKVSESFPFKWINKKW+EGFHVTSM T+GSRWGVVMSR AG+S+QV
Sbjct  579  LVVMSKGTSYLQQSYKVSESFPFKWINKKWREGFHVTSMATSGSRWGVVMSRGAGFSDQV  638

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++GYRIT+ AAT DQAAF+LS+PRR+  DETQETLRTSAFPSTH
Sbjct  639  VELDFLYPSEGIHRRWDNGYRITATAATWDQAAFVLSVPRRRPTDETQETLRTSAFPSTH  698

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLYIAS+CYGRTV
Sbjct  699  VKEKWAKNLYIASVCYGRTV  718



>emb|CDX82524.1| BnaA03g32970D [Brassica napus]
Length=654

 Score =   258 bits (660),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAG+RWGVVMSRN+GYSEQV
Sbjct  514  LVVMSKGTAYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGTRWGVVMSRNSGYSEQV  573

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+ G+RITS AAT DQ A ILSIPRR+++DETQETLRTS FPSTH
Sbjct  574  VELDFLYPSEGIHRRWDGGFRITSTAATTDQTALILSIPRRRLVDETQETLRTSQFPSTH  633

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLY+AS+ YGRTV
Sbjct  634  VKEKWGKNLYLASLSYGRTV  653



>ref|XP_009135319.1| PREDICTED: uncharacterized protein LOC103859531 [Brassica rapa]
Length=676

 Score =   259 bits (661),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAG+RWGVVMSRN+GYSEQV
Sbjct  536  LVVMSKGTAYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGTRWGVVMSRNSGYSEQV  595

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+ G+RITS AAT DQ A ILSIPRR+++DETQETLRTS FPSTH
Sbjct  596  VELDFLYPSEGIHRRWDGGFRITSTAATTDQTALILSIPRRRLVDETQETLRTSQFPSTH  655

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLY+AS+ YGRTV
Sbjct  656  VKEKWGKNLYLASLSYGRTV  675



>ref|XP_007024285.1| Kinase family protein isoform 2 [Theobroma cacao]
 gb|EOY26907.1| Kinase family protein isoform 2 [Theobroma cacao]
Length=483

 Score =   254 bits (648),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 131/140 (94%), Gaps = 2/140 (1%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMS+GT Y+QQSYKVSESFPFKWINKKWKEGFHVTSM T+GSRWGVVMSR AG+S+QV
Sbjct  345  LVVMSRGTQYSQQSYKVSESFPFKWINKKWKEGFHVTSMATSGSRWGVVMSRGAGFSDQV  404

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+ GYRIT+ AAT DQAAF+LS+PRRK MDETQETLRTSAFPSTH
Sbjct  405  VELDFLYPSEGIHRRWDCGYRITATAATWDQAAFVLSVPRRKPMDETQETLRTSAFPSTH  464

Query  293  VKEKWSKNLYIASICYGRTV  234
            V  KW+KNLYIAS+CYGRTV
Sbjct  465  V--KWAKNLYIASVCYGRTV  482


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 60/122 (49%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++    + I K  ++G  ++S+ +  + W ++M    G+S QV EL   FL+  E I
Sbjct  265  YNVADGRLAQHIEKGNEDGLFISSVASCQNLWALIMDAGTGFSSQVYELSPHFLH-KEWI  323

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIA  258
              +WE  Y I+++A   +   F L +  R      Q    + +FP   + +KW +  ++ 
Sbjct  324  MEQWEKNYYISAIAGATN--GFSLVVMSRGTQYSQQSYKVSESFPFKWINKKWKEGFHVT  381

Query  257  SI  252
            S+
Sbjct  382  SM  383



>ref|XP_004963353.1| PREDICTED: probable casein kinase I homolog ECU11_1980-like isoform 
X2 [Setaria italica]
Length=599

 Score =   257 bits (656),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISS+AG+ NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSM T+GSRW
Sbjct  445  FYISSVAGSNNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMATSGSRW  504

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
             +VMSR+AG+SEQVVELDFLYPSEGIHRRW++GYRIT+MAAT DQ+A ILS PRR+  DE
Sbjct  505  AIVMSRSAGFSEQVVELDFLYPSEGIHRRWDNGYRITAMAATMDQSALILSKPRRRPRDE  564

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRT+ FPS HVKEKW+KNLY+A ICYGRTV
Sbjct  565  TQETLRTTQFPSQHVKEKWAKNLYLAGICYGRTV  598



>ref|XP_010249522.1| PREDICTED: uncharacterized protein LOC104592067 isoform X2 [Nelumbo 
nucifera]
Length=693

 Score =   259 bits (661),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM TAGSRWGVVMSR+AG+S+QV
Sbjct  553  LVVMSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTSMATAGSRWGVVMSRSAGFSDQV  612

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTH
Sbjct  613  VELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTH  672

Query  293  VKEKWSKNLYIASICYGRTV  234
            VK+KW+KNLYIAS+CYGRTV
Sbjct  673  VKDKWAKNLYIASVCYGRTV  692



>ref|XP_002283957.2| PREDICTED: uncharacterized protein LOC100253221 [Vitis vinifera]
Length=704

 Score =   259 bits (662),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T+GSRW
Sbjct  550  FYISAIAGATNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTSMATSGSRW  609

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSR AG+SEQVVELDFLYPSEGIHRRW++G+RIT+ AAT DQAAF+LS+PRRK +DE
Sbjct  610  GVVMSRGAGFSEQVVELDFLYPSEGIHRRWDNGFRITATAATWDQAAFVLSVPRRKPVDE  669

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  670  TQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  703



>ref|XP_010249521.1| PREDICTED: uncharacterized protein LOC104592067 isoform X1 [Nelumbo 
nucifera]
Length=697

 Score =   259 bits (661),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM TAGSRWGVVMSR+AG+S+QV
Sbjct  557  LVVMSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTSMATAGSRWGVVMSRSAGFSDQV  616

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTH
Sbjct  617  VELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTH  676

Query  293  VKEKWSKNLYIASICYGRTV  234
            VK+KW+KNLYIAS+CYGRTV
Sbjct  677  VKDKWAKNLYIASVCYGRTV  696



>emb|CAN77676.1| hypothetical protein VITISV_013722 [Vitis vinifera]
Length=710

 Score =   259 bits (662),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T+GSRW
Sbjct  556  FYISAIAGATNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTSMATSGSRW  615

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
            GVVMSR AG+SEQVVELDFLYPSEGIHRRW++G+RIT+ AAT DQAAF+LS+PRRK +DE
Sbjct  616  GVVMSRGAGFSEQVVELDFLYPSEGIHRRWDNGFRITATAATWDQAAFVLSVPRRKPVDE  675

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  676  TQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  709



>ref|XP_010526089.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526090.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526091.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526092.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526093.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526094.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526095.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
Length=601

 Score =   256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y QQSYKVSESFPFKWINKKW+EGF+VTSM TAGSRW +VMSR AG+S+QV
Sbjct  461  LVVMSKGTQYLQQSYKVSESFPFKWINKKWREGFYVTSMATAGSRWAIVMSRGAGFSDQV  520

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEG+HRRW++GYRITS+AAT+DQAA +LS+PRRK  DETQETLRTSAFPSTH
Sbjct  521  VELDFLYPSEGVHRRWDNGYRITSIAATSDQAALVLSVPRRKPADETQETLRTSAFPSTH  580

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLYIA ICYGRTV
Sbjct  581  VKEKWGKNLYIACICYGRTV  600


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/122 (24%), Positives = 64/122 (52%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++    + I+K  ++G  ++S+ +  + W ++M    GY+ QV +L   FL+  E I
Sbjct  381  YNVTDMRLAQHIDKGNEDGLFISSVASCSNLWALIMDAGTGYTAQVYQLSPCFLH-KEWI  439

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIA  258
               WE  Y IT++A   + ++ ++     + + ++ +   + +FP   + +KW +  Y+ 
Sbjct  440  MENWEKNYYITAIAGANNGSSLVVMSKGTQYLQQSYKV--SESFPFKWINKKWREGFYVT  497

Query  257  SI  252
            S+
Sbjct  498  SM  499



>ref|XP_008378069.1| PREDICTED: uncharacterized protein LOC103441148 [Malus domestica]
Length=683

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y QQSYKVSESFPFKWINKKW+EGFHVT+M TAGSRW +VMSR AG+S QV
Sbjct  543  LVVMSKGTQYLQQSYKVSESFPFKWINKKWREGFHVTAMATAGSRWAIVMSRGAGFSXQV  602

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++GYRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTH
Sbjct  603  VELDFLYPSEGIHRRWDNGYRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTH  662

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLYIASICYGRTV
Sbjct  663  VKEKWGKNLYIASICYGRTV  682



>ref|XP_010267169.1| PREDICTED: uncharacterized protein LOC104604501 isoform X2 [Nelumbo 
nucifera]
Length=693

 Score =   258 bits (660),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM TAGSRW
Sbjct  539  YYISAIAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTSMATAGSRW  598

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
             VVMSR+AG+S+QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRRK  DE
Sbjct  599  AVVMSRSAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRRKPADE  658

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  659  TQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  692



>gb|EEC78673.1| hypothetical protein OsI_18806 [Oryza sativa Indica Group]
Length=607

 Score =   256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYI+S+AGA NGSSLVVMS+GT Y QQSYKVS+SFPFKWINKKWKEGF+VT+M TAGSRW
Sbjct  453  FYITSLAGANNGSSLVVMSRGTQYAQQSYKVSDSFPFKWINKKWKEGFYVTAMATAGSRW  512

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
             VVMSRNAG+++QVVELDFLYPSEGIHRRW++G+RIT+ AAT DQAAFILSIPRRK  DE
Sbjct  513  AVVMSRNAGFTDQVVELDFLYPSEGIHRRWDNGFRITATAATWDQAAFILSIPRRKPADE  572

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFPS HVKEKWSKNLY+ASICYGRTV
Sbjct  573  TQETLRTSAFPSQHVKEKWSKNLYLASICYGRTV  606



>gb|ACO87665.1| protein kinase [Brachypodium sylvaticum]
Length=648

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISS+AG+ NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGF+VTSM T+GSRW
Sbjct  494  FYISSVAGSNNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFYVTSMATSGSRW  553

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
             +VMSRNAG+++QVVELDFLYPSEGIH+RW++GYRIT+MAAT DQ+A ILS+PRR+  DE
Sbjct  554  AIVMSRNAGFTDQVVELDFLYPSEGIHKRWDNGYRITAMAATMDQSALILSMPRRRPRDE  613

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTS FPS HVK+KW+KNLY+A ICYGRTV 
Sbjct  614  TQETLRTSQFPSAHVKDKWAKNLYLAGICYGRTVA  648



>dbj|BAG92829.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62667.1| hypothetical protein OsJ_17470 [Oryza sativa Japonica Group]
Length=607

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYI+S+AGA NGSSLVVMS+GT Y QQSYKVS+SFPFKWINKKWKEGF+VT+M TAGSRW
Sbjct  453  FYITSLAGANNGSSLVVMSRGTQYAQQSYKVSDSFPFKWINKKWKEGFYVTAMATAGSRW  512

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
             VVMSRNAG+++QVVELDFLYPSEGIHRRW++G+RIT+ AAT DQAAFILSIPRRK  DE
Sbjct  513  AVVMSRNAGFTDQVVELDFLYPSEGIHRRWDNGFRITATAATWDQAAFILSIPRRKPADE  572

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFPS HVKEKWSKNLY+ASICYGRTV
Sbjct  573  TQETLRTSAFPSQHVKEKWSKNLYLASICYGRTV  606



>ref|XP_002516524.1| casein kinase, putative [Ricinus communis]
 gb|EEF45865.1| casein kinase, putative [Ricinus communis]
Length=671

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M TAGSRW
Sbjct  517  FYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMATAGSRW  576

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
             +VMSR AG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRRK  DE
Sbjct  577  AIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAAFVLSVPRRKPADE  636

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  637  TQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  670



>ref|XP_010033842.1| PREDICTED: uncharacterized protein LOC104423081 [Eucalyptus grandis]
 ref|XP_010033843.1| PREDICTED: uncharacterized protein LOC104423081 [Eucalyptus grandis]
 gb|KCW53681.1| hypothetical protein EUGRSUZ_J02945 [Eucalyptus grandis]
Length=709

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y QQSYKVS+SFPFKWINKKWKEGF+VTSM TAGSRW +VMSR AG+SEQV
Sbjct  569  LVVMSKGTQYLQQSYKVSDSFPFKWINKKWKEGFYVTSMGTAGSRWAIVMSRGAGFSEQV  628

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LSIPRRK  DETQETLRTSAFPSTH
Sbjct  629  VELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSIPRRKPTDETQETLRTSAFPSTH  688

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLY+ASICYGRTV
Sbjct  689  VKEKWAKNLYLASICYGRTV  708



>gb|AAT44311.1| putative casein kinase [Oryza sativa Japonica Group]
 gb|AAV59374.1| putative casein kinase [Oryza sativa Japonica Group]
Length=608

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYI+S+AGA NGSSLVVMS+GT Y QQSYKVS+SFPFKWINKKWKEGF+VT+M TAGSRW
Sbjct  454  FYITSLAGANNGSSLVVMSRGTQYAQQSYKVSDSFPFKWINKKWKEGFYVTAMATAGSRW  513

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
             VVMSRNAG+++QVVELDFLYPSEGIHRRW++G+RIT+ AAT DQAAFILSIPRRK  DE
Sbjct  514  AVVMSRNAGFTDQVVELDFLYPSEGIHRRWDNGFRITATAATWDQAAFILSIPRRKPADE  573

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFPS HVKEKWSKNLY+ASICYGRTV
Sbjct  574  TQETLRTSAFPSQHVKEKWSKNLYLASICYGRTV  607



>ref|XP_010267167.1| PREDICTED: uncharacterized protein LOC104604501 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267168.1| PREDICTED: uncharacterized protein LOC104604501 isoform X1 [Nelumbo 
nucifera]
Length=697

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            +YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM TAGSRW
Sbjct  543  YYISAIAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTSMATAGSRW  602

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
             VVMSR+AG+S+QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRRK  DE
Sbjct  603  AVVMSRSAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRRKPADE  662

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  663  TQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  696



>ref|XP_006853659.1| hypothetical protein AMTR_s00056p00104010 [Amborella trichopoda]
 gb|ERN15126.1| hypothetical protein AMTR_s00056p00104010 [Amborella trichopoda]
Length=703

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y QQSYKVS++FPFKWINKKW+EGF VTSM TAGSRWGVVMSRNAG+++QV
Sbjct  563  LVVMSKGTQYAQQSYKVSDTFPFKWINKKWREGFFVTSMATAGSRWGVVMSRNAGFTDQV  622

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PR+K  DETQETLRTSAFPSTH
Sbjct  623  VELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRKKPADETQETLRTSAFPSTH  682

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLYIAS+CYGRTV
Sbjct  683  VKEKWAKNLYIASVCYGRTV  702



>ref|XP_010047289.1| PREDICTED: uncharacterized protein LOC104436263 [Eucalyptus grandis]
 gb|KCW79164.1| hypothetical protein EUGRSUZ_C00608 [Eucalyptus grandis]
Length=605

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPY QQSYKVS+SFPFKWINKKW+EGF+VTSM TAG+RW V+MSR AG+++QV
Sbjct  465  LVVMSKGTPYLQQSYKVSDSFPFKWINKKWREGFYVTSMATAGTRWAVIMSRGAGFTDQV  524

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+ GYRITS AAT DQ+A ILSIPRRK  DETQETLRTSAFPSTH
Sbjct  525  VELDFLYPSEGIHRRWDCGYRITSTAATLDQSALILSIPRRKPTDETQETLRTSAFPSTH  584

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLYIAS+CYGRTV
Sbjct  585  VKEKWAKNLYIASVCYGRTV  604


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++    + I+K  ++G  ++S+ +  + W ++M    G+S+QV EL   FL+  E I
Sbjct  385  YNVADIRLSQHIDKGNEDGLFISSVASCSNLWALIMDAGTGFSDQVYELSSYFLH-KEWI  443

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y IT++A  ++ ++ ++     K     Q++ + S +FP   + +KW +  Y+
Sbjct  444  MEQWEKNYYITAVAGASNGSSLVV---MSKGTPYLQQSYKVSDSFPFKWINKKWREGFYV  500

Query  260  ASI  252
             S+
Sbjct  501  TSM  503



>ref|XP_007208054.1| hypothetical protein PRUPE_ppa002206mg [Prunus persica]
 gb|EMJ09253.1| hypothetical protein PRUPE_ppa002206mg [Prunus persica]
Length=701

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QV
Sbjct  561  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQV  620

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++G+RITS AAT DQAA ILS+P+RK  DETQETLRTS FPSTH
Sbjct  621  VELDFLYPSEGIHRRWDNGFRITSTAATWDQAALILSVPKRKPGDETQETLRTSQFPSTH  680

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLY+A +CYGRTV
Sbjct  681  VKEKWAKNLYLACLCYGRTV  700



>emb|CDY21505.1| BnaC03g26920D [Brassica napus]
Length=615

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
             VVMSKGTPY QQSYKVS+SFPFKWINKKW+EGF+VTSM TAGS+WG+VMSR A +S+QV
Sbjct  475  FVVMSKGTPYLQQSYKVSDSFPFKWINKKWREGFYVTSMATAGSKWGIVMSRGAAFSDQV  534

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++GYRITS+AAT DQAAF+LS+PRRK  DETQETLRTSAFPS H
Sbjct  535  VELDFLYPSEGIHRRWDNGYRITSIAATWDQAAFVLSVPRRKPTDETQETLRTSAFPSNH  594

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKWSKNLYI+SICYGRTV
Sbjct  595  VKEKWSKNLYISSICYGRTV  614



>ref|XP_010546534.1| PREDICTED: uncharacterized protein LOC104818596 [Tarenaya hassleriana]
Length=701

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y QQSYKVSESFPFKWINKKW+EGF+VTSM TAGSRW +VMSR AG+S+QV
Sbjct  561  LVVMSKGTQYLQQSYKVSESFPFKWINKKWREGFYVTSMATAGSRWAIVMSRGAGFSDQV  620

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+SGYRITS+AAT DQAA ILS+PRRK  DETQETLRTSAFPSTH
Sbjct  621  VELDFLYPSEGIHRRWDSGYRITSLAATLDQAALILSVPRRKPADETQETLRTSAFPSTH  680

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLYIA ICYGRTV
Sbjct  681  VKEKWGKNLYIAYICYGRTV  700


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 67/122 (55%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++    + I+K  ++G  ++S+ +  + W ++M    GY+ QV +L   FL+  E I
Sbjct  481  YNVADIRLAQHIDKGNEDGLFISSVASCSNLWALIMDAGTGYTAQVYQLSPCFLH-KEWI  539

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIA  258
              +WE+ Y IT++A T + ++ ++     + + ++ +   + +FP   + +KW +  Y+ 
Sbjct  540  MEQWENNYYITAIAGTNNGSSLVVMSKGTQYLQQSYKV--SESFPFKWINKKWREGFYVT  597

Query  257  SI  252
            S+
Sbjct  598  SM  599



>gb|KJB07481.1| hypothetical protein B456_001G026300 [Gossypium raimondii]
Length=485

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M TAGSRW +VMSR A +S+QV
Sbjct  345  LVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMATAGSRWAIVMSRGAPFSDQV  404

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTH
Sbjct  405  VELDFLYPSEGIHRRWDSGYRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTH  464

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLYIAS+CYGRTV
Sbjct  465  VKEKWAKNLYIASVCYGRTV  484



>ref|XP_008791563.1| PREDICTED: uncharacterized protein LOC103708420 [Phoenix dactylifera]
Length=683

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYIS++AGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKWKEGF+VT+M TAG+RW
Sbjct  529  FYISALAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWKEGFYVTAMATAGTRW  588

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
             VVMSRNAG+S+QVVELDFLYPSEGIHRRW+ GYRIT+ AAT DQAAF+LS+PRRK  DE
Sbjct  589  AVVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGYRITATAATWDQAAFVLSVPRRKPADE  648

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            TQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  649  TQETLRTSAFPSQHVKEKWAKNLYIASICYGRTV  682



>gb|KJB21850.1| hypothetical protein B456_004G018100 [Gossypium raimondii]
Length=690

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGF+VTSM T GSRWGVVMSRNAG+S+QV
Sbjct  550  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFYVTSMATTGSRWGVVMSRNAGFSDQV  609

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++GYRITS AAT+DQAA ILSIP+RK  DETQETLRTS FPSTH
Sbjct  610  VELDFLYPSEGIHRRWDNGYRITSTAATSDQAALILSIPKRKPGDETQETLRTSQFPSTH  669

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLY+A +CYGRTV
Sbjct  670  VKEKWAKNLYLACLCYGRTV  689



>gb|EMT06030.1| Casein kinase I-2-like protein [Aegilops tauschii]
Length=597

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISS+AGA  GSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGF+VTSM T+GSRW
Sbjct  443  FYISSVAGANIGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFYVTSMATSGSRW  502

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
             +VMSRNAG+++QVVELDFLYPSEG+HRRW++GYRIT+MAAT DQ+A ILS+PRR+  DE
Sbjct  503  AIVMSRNAGFTDQVVELDFLYPSEGVHRRWDNGYRITAMAATMDQSALILSMPRRRPRDE  562

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRTS FPS HVK+KW+KNLY+A ICYGRTV 
Sbjct  563  TQETLRTSQFPSAHVKDKWAKNLYLAGICYGRTVA  597



>ref|XP_007217013.1| hypothetical protein PRUPE_ppa002136mg [Prunus persica]
 gb|EMJ18212.1| hypothetical protein PRUPE_ppa002136mg [Prunus persica]
Length=711

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTP+TQQSYKVS++FPFKWINKKW+EGF+VT+M T+GSRW VVMSR AGYSEQV
Sbjct  571  LVVMSKGTPFTQQSYKVSDTFPFKWINKKWREGFYVTAMATSGSRWAVVMSRGAGYSEQV  630

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRRK  DETQETLRTSAFPS H
Sbjct  631  VELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRRKPQDETQETLRTSAFPSPH  690

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLYIAS+CYGRTV
Sbjct  691  VKEKWAKNLYIASMCYGRTV  710



>ref|XP_008390151.1| PREDICTED: uncharacterized protein LOC103452441 [Malus domestica]
Length=697

 Score =   258 bits (658),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QV
Sbjct  557  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQV  616

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++G+RITS AAT DQAA ILS+P+RK  DETQETLRTS FPSTH
Sbjct  617  VELDFLYPSEGIHRRWDNGFRITSTAATWDQAALILSVPKRKPGDETQETLRTSQFPSTH  676

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLY+A +CYGRTV
Sbjct  677  VKEKWAKNLYLACLCYGRTV  696



>ref|XP_011019588.1| PREDICTED: uncharacterized protein LOC105122267 isoform X2 [Populus 
euphratica]
Length=483

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M TAGSRW +VMSR  G+S+QV
Sbjct  343  LVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTTMATAGSRWAIVMSRGTGFSDQV  402

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRRK +DETQETLRTSAFPSTH
Sbjct  403  VELDFLYPSEGIHRRWDSGYRITSTAATWDQAAFVLSVPRRKPVDETQETLRTSAFPSTH  462

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+ NLYIAS+CYGRTV
Sbjct  463  VKEKWATNLYIASVCYGRTV  482



>ref|XP_009375296.1| PREDICTED: uncharacterized protein LOC103964127 [Pyrus x bretschneideri]
Length=697

 Score =   258 bits (658),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QV
Sbjct  557  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQV  616

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++G+RITS AAT DQAA ILS+P+RK  DETQETLRTS FPSTH
Sbjct  617  VELDFLYPSEGIHRRWDNGFRITSTAATWDQAALILSVPKRKPGDETQETLRTSQFPSTH  676

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLY+A +CYGRTV
Sbjct  677  VKEKWAKNLYLACLCYGRTV  696



>ref|XP_008338507.1| PREDICTED: uncharacterized protein LOC103401567 isoform X2 [Malus 
domestica]
Length=699

 Score =   258 bits (658),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QV
Sbjct  559  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQV  618

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILS+P+RK  DETQETLRTS FPSTH
Sbjct  619  VELDFLYPSEGIHRRWDGGFRITSTAATWDQAALILSVPKRKPGDETQETLRTSQFPSTH  678

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLY+A +CYGRTV
Sbjct  679  VKEKWAKNLYLACLCYGRTV  698



>gb|KHN39248.1| Casein kinase I isoform delta-like, partial [Glycine soja]
Length=661

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T+GSRWGVVMSR AG+S+QV
Sbjct  521  LVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTSMATSGSRWGVVMSRGAGFSDQV  580

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIH+RW+ GYRIT+ AAT DQAAF+LS+PRRK +DETQETLRTSAFPSTH
Sbjct  581  VELDFLYPSEGIHKRWDCGYRITATAATWDQAAFVLSVPRRKPLDETQETLRTSAFPSTH  640

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLYIASICYGRTV
Sbjct  641  VKEKWAKNLYIASICYGRTV  660



>emb|CDY11509.1| BnaA09g40750D [Brassica napus]
Length=565

 Score =   254 bits (650),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
             VVMSKGTPY QQSYKVS+SFPFKWINKKW+EGF+VTSM TAGS+WG+VMSR A +S+QV
Sbjct  425  FVVMSKGTPYLQQSYKVSDSFPFKWINKKWREGFYVTSMATAGSKWGIVMSRGAAFSDQV  484

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITS+A T DQ+AF+LS+PRRK  DETQETLRTSAFPS H
Sbjct  485  VELDFLYPSEGIHRRWENGYRITSIAGTCDQSAFVLSVPRRKPSDETQETLRTSAFPSNH  544

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW KNLYI+SICYGRTV
Sbjct  545  VKEKWGKNLYISSICYGRTV  564



>ref|NP_001141429.1| uncharacterized protein LOC100273539 [Zea mays]
 gb|ACF86358.1| unknown [Zea mays]
Length=479

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -2

Query  695  FYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRW  516
            FYISS+AG+ NGSS+VVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVT+M T+G+RW
Sbjct  325  FYISSVAGSNNGSSIVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTAMATSGNRW  384

Query  515  GVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDE  336
             +VMSR+AG+SEQVVELDFLYPSEGIHRRW++G+RIT+MAAT DQ+A ILS PRR+  DE
Sbjct  385  AIVMSRSAGFSEQVVELDFLYPSEGIHRRWDNGFRITAMAATMDQSALILSKPRRRPRDE  444

Query  335  TQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            TQETLRT+ FPS HVK+KW+KNLY+A ICYGRTV 
Sbjct  445  TQETLRTTQFPSQHVKDKWAKNLYLAGICYGRTVA  479



>ref|XP_008338505.1| PREDICTED: uncharacterized protein LOC103401567 isoform X1 [Malus 
domestica]
Length=699

 Score =   257 bits (657),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QV
Sbjct  559  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQV  618

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILS+P+RK  DETQETLRTS FPSTH
Sbjct  619  VELDFLYPSEGIHRRWDGGFRITSTAATWDQAALILSVPKRKPGDETQETLRTSQFPSTH  678

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLY+A +CYGRTV
Sbjct  679  VKEKWAKNLYLACLCYGRTV  698



>ref|XP_009364099.1| PREDICTED: uncharacterized protein LOC103954016 [Pyrus x bretschneideri]
Length=699

 Score =   257 bits (657),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QV
Sbjct  559  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQV  618

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILS+P+RK  DETQETLRTS FPSTH
Sbjct  619  VELDFLYPSEGIHRRWDGGFRITSTAATWDQAALILSVPKRKPGDETQETLRTSQFPSTH  678

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLY+A +CYGRTV
Sbjct  679  VKEKWAKNLYLACLCYGRTV  698



>ref|XP_004294964.1| PREDICTED: uncharacterized protein LOC101294343 [Fragaria vesca 
subsp. vesca]
Length=731

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QV
Sbjct  591  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQV  650

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++G+RITS AAT DQAA ILS+P+RK  DETQETLRTS FPSTH
Sbjct  651  VELDFLYPSEGIHRRWDNGFRITSTAATWDQAALILSVPKRKPGDETQETLRTSQFPSTH  710

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLY+A +CYGRTV
Sbjct  711  VKEKWAKNLYLACLCYGRTV  730


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/122 (24%), Positives = 63/122 (52%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD-FLYPSEGIH  435
            Y V+++   + + +   +G  ++ +++  + W ++M    G+S QV EL  F    E I 
Sbjct  511  YNVADARLAQHVERGIADGLLISCVSSCSNLWALIMDAGTGFSNQVYELSPFFLHKEWIM  570

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  571  EQWEKNYYISSIAGANNGSSLVV---MSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVT  627

Query  257  SI  252
            S+
Sbjct  628  SM  629



>gb|KHN10182.1| Casein kinase I like 2 [Glycine soja]
Length=606

 Score =   255 bits (652),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M TAGSRW +VMSR AG+S+QV
Sbjct  466  LVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMATAGSRWAIVMSRGAGFSDQV  525

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRRK  DETQETLRTSAFP TH
Sbjct  526  VELDFLYPSEGIHRRWDSGYRITSTAATWDQAAFVLSVPRRKPADETQETLRTSAFPGTH  585

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLYIASICYGRTV
Sbjct  586  VKEKWAKNLYIASICYGRTV  605



>ref|XP_007014774.1| Casein kinase I protein isoform 1 [Theobroma cacao]
 gb|EOY32393.1| Casein kinase I protein isoform 1 [Theobroma cacao]
Length=891

 Score =   260 bits (665),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGF+VTSM TAGSRWGVVMSRNAG+S+QV
Sbjct  751  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFYVTSMATAGSRWGVVMSRNAGFSDQV  810

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++GYRITS AAT+DQAA ILSIP+RK  DETQETLRTS FPSTH
Sbjct  811  VELDFLYPSEGIHRRWDNGYRITSTAATSDQAALILSIPKRKPGDETQETLRTSQFPSTH  870

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLY+A +CYGRTV
Sbjct  871  VKEKWAKNLYLACLCYGRTV  890



>ref|XP_010243375.1| PREDICTED: uncharacterized protein LOC104587456 [Nelumbo nucifera]
 ref|XP_010243376.1| PREDICTED: uncharacterized protein LOC104587456 [Nelumbo nucifera]
 ref|XP_010243377.1| PREDICTED: uncharacterized protein LOC104587456 [Nelumbo nucifera]
Length=728

 Score =   258 bits (658),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSRWGVVMSRNAG+++QV
Sbjct  588  LVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNAGFNDQV  647

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW++GYRIT  AAT DQAA ILS+P+RK  DETQETLRTS FPSTH
Sbjct  648  VELDFLYPSEGIHRRWDNGYRITCAAATWDQAALILSVPKRKPSDETQETLRTSQFPSTH  707

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKWSKNLY+A +CYGRTV
Sbjct  708  VKEKWSKNLYLACVCYGRTV  727


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y VS++   + +++  ++G  ++ + +  + W ++M    GY+ QV EL   FL+  E I
Sbjct  508  YNVSDTRLRQHVDRGNEDGLLISCVASCSNLWALIMDAGTGYTSQVYELSPYFLH-KEWI  566

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A + + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  567  MEQWEKNYYISSIAGSTNGSSLVVM---SKGTQYTQQSYKVSDSFPFKWINKKWREGFHV  623

Query  260  ASI  252
             S+
Sbjct  624  TSM  626



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1179751321320