BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF035D23

Length=653
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004134584.1|  PREDICTED: ferredoxin--NADP reductase, root ...    322   6e-106   Cucumis sativus [cucumbers]
gb|EYU19120.1|  hypothetical protein MIMGU_mgv1a008446mg                321   1e-105   Erythranthe guttata [common monkey flower]
ref|XP_008439552.1|  PREDICTED: ferredoxin--NADP reductase, root ...    321   1e-105   Cucumis melo [Oriental melon]
gb|ACJ83525.1|  unknown                                                 313   4e-105   Medicago truncatula
ref|XP_006448908.1|  hypothetical protein CICLE_v100156272mg            311   7e-105   
ref|XP_010051952.1|  PREDICTED: ferredoxin--NADP reductase, root ...    319   8e-105   Eucalyptus grandis [rose gum]
ref|XP_010098567.1|  Ferredoxin--NADP reductase, root isozyme           319   1e-104   
gb|AII16855.1|  ferredoxin-NADP(+) reductase                            318   2e-104   Ocimum basilicum [basil]
emb|CDP17310.1|  unnamed protein product                                320   4e-104   Coffea canephora [robusta coffee]
ref|NP_001239798.1|  uncharacterized protein LOC100807968               317   7e-104   Glycine max [soybeans]
ref|XP_006597058.1|  PREDICTED: uncharacterized protein LOC100807...    317   7e-104   Glycine max [soybeans]
gb|KHN14331.1|  Ferredoxin--NADP reductase, root isozyme, chlorop...    316   9e-104   Glycine soja [wild soybean]
gb|KDP34933.1|  hypothetical protein JCGZ_09221                         316   1e-103   Jatropha curcas
ref|XP_006468308.1|  PREDICTED: ferredoxin--NADP reductase, root ...    315   2e-103   Citrus sinensis [apfelsine]
ref|XP_003594526.1|  Ferredoxin-NADP reductase                          315   2e-103   Medicago truncatula
emb|CAA67796.1|  ferrodoxin NADP oxidoreductase                         315   3e-103   Pisum sativum [garden pea]
ref|XP_002523191.1|  ferredoxin--NADP reductase, putative               315   3e-103   Ricinus communis
sp|Q41014.2|FENR2_PEA  RecName: Full=Ferredoxin--NADP reductase, ...    315   3e-103   Pisum sativum [garden pea]
ref|NP_001058890.1|  Os07g0147900                                       315   3e-103   
ref|NP_001239859.1|  uncharacterized protein LOC100789291               315   3e-103   Glycine max [soybeans]
ref|XP_006586681.1|  PREDICTED: uncharacterized protein LOC100789...    315   3e-103   Glycine max [soybeans]
ref|XP_004231567.1|  PREDICTED: ferredoxin--NADP reductase, root-...    315   4e-103   Solanum lycopersicum
ref|XP_006363650.1|  PREDICTED: ferredoxin--NADP reductase, root-...    315   4e-103   Solanum tuberosum [potatoes]
ref|XP_010529363.1|  PREDICTED: ferredoxin--NADP reductase, root ...    315   4e-103   Tarenaya hassleriana [spider flower]
ref|XP_004293987.1|  PREDICTED: ferredoxin--NADP reductase, root ...    315   5e-103   Fragaria vesca subsp. vesca
gb|EAZ02773.1|  hypothetical protein OsI_24896                          315   5e-103   Oryza sativa Indica Group [Indian rice]
ref|XP_007147485.1|  hypothetical protein PHAVU_006G128400g             314   7e-103   Phaseolus vulgaris [French bean]
ref|XP_009397390.1|  PREDICTED: ferredoxin--NADP reductase, embry...    314   8e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009614066.1|  PREDICTED: ferredoxin--NADP reductase, root-...    314   9e-103   Nicotiana tomentosiformis
ref|XP_009761528.1|  PREDICTED: ferredoxin--NADP reductase, root-...    313   2e-102   Nicotiana sylvestris
ref|XP_004486455.1|  PREDICTED: ferredoxin--NADP reductase, root ...    312   6e-102   Cicer arietinum [garbanzo]
ref|XP_006344529.1|  PREDICTED: ferredoxin--NADP reductase, root-...    312   6e-102   Solanum tuberosum [potatoes]
emb|CDY39167.1|  BnaC09g21770D                                          311   2e-101   Brassica napus [oilseed rape]
ref|XP_011096684.1|  PREDICTED: ferredoxin--NADP reductase, root-...    311   2e-101   Sesamum indicum [beniseed]
sp|O04397.1|FENR2_TOBAC  RecName: Full=Ferredoxin--NADP reductase...    310   3e-101   Nicotiana tabacum [American tobacco]
ref|NP_001132762.1|  uncharacterized protein LOC100194249               310   4e-101   Zea mays [maize]
ref|XP_009344407.1|  PREDICTED: ferredoxin--NADP reductase, root ...    310   5e-101   Pyrus x bretschneideri [bai li]
ref|XP_009397718.1|  PREDICTED: ferredoxin--NADP reductase, root ...    310   5e-101   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACG35047.1|  ferredoxin--NADP reductase, embryo isozyme              310   5e-101   Zea mays [maize]
ref|XP_006658277.1|  PREDICTED: ferredoxin--NADP reductase, embry...    309   5e-101   
ref|XP_009114485.1|  PREDICTED: ferredoxin--NADP reductase, root ...    309   7e-101   Brassica rapa
ref|XP_010537869.1|  PREDICTED: ferredoxin--NADP reductase, root ...    309   8e-101   Tarenaya hassleriana [spider flower]
gb|AGT15976.1|  ferredoxin--NADP reductase                              309   8e-101   Saccharum hybrid cultivar R570
ref|XP_008383404.1|  PREDICTED: ferredoxin--NADP reductase, root ...    309   8e-101   Malus domestica [apple tree]
ref|XP_008650954.1|  PREDICTED: uncharacterized protein LOC100194...    310   8e-101   Zea mays [maize]
emb|CDY46362.1|  BnaA09g19760D                                          309   8e-101   Brassica napus [oilseed rape]
ref|XP_004955449.1|  PREDICTED: ferredoxin--NADP reductase, embry...    309   1e-100   Setaria italica
ref|XP_009362229.1|  PREDICTED: ferredoxin--NADP reductase, root ...    308   1e-100   Pyrus x bretschneideri [bai li]
ref|XP_006415462.1|  hypothetical protein EUTSA_v10007919mg             308   1e-100   Eutrema salsugineum [saltwater cress]
ref|XP_006415461.1|  hypothetical protein EUTSA_v10007919mg             308   1e-100   Eutrema salsugineum [saltwater cress]
emb|CDY02299.1|  BnaA09g26030D                                          308   1e-100   
emb|CDY09570.1|  BnaC05g23490D                                          308   2e-100   Brassica napus [oilseed rape]
ref|XP_010247806.1|  PREDICTED: ferredoxin--NADP reductase, root ...    308   2e-100   Nelumbo nucifera [Indian lotus]
gb|KFK32212.1|  hypothetical protein AALP_AA6G212100                    308   3e-100   Arabis alpina [alpine rockcress]
ref|XP_010907336.1|  PREDICTED: ferredoxin--NADP reductase, root ...    307   3e-100   Elaeis guineensis
dbj|BAA02248.1|  ferredoxin-NADP+ reductase enzyme                      305   3e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010907335.1|  PREDICTED: ferredoxin--NADP reductase, root ...    307   4e-100   Elaeis guineensis
ref|XP_002461452.1|  hypothetical protein SORBIDRAFT_02g002900          307   5e-100   Sorghum bicolor [broomcorn]
ref|NP_001051476.1|  Os03g0784700                                       307   5e-100   
ref|XP_006650686.1|  PREDICTED: ferredoxin--NADP reductase, root ...    306   6e-100   Oryza brachyantha
ref|XP_008346149.1|  PREDICTED: ferredoxin--NADP reductase, root ...    306   7e-100   Malus domestica [apple tree]
ref|XP_009115136.1|  PREDICTED: ferredoxin--NADP reductase, root ...    306   8e-100   Brassica rapa
ref|XP_002263658.2|  PREDICTED: ferredoxin--NADP reductase, root ...    306   9e-100   Vitis vinifera
gb|EMS52999.1|  Ferredoxin--NADP reductase, embryo isozyme, chlor...    310   1e-99    Triticum urartu
gb|EMT31879.1|  Ferredoxin--NADP reductase, embryo isozyme, chlor...    306   1e-99    
ref|XP_008796785.1|  PREDICTED: ferredoxin--NADP reductase, embry...    298   1e-99    Phoenix dactylifera
ref|XP_006396605.1|  hypothetical protein EUTSA_v10028734mg             305   2e-99    Eutrema salsugineum [saltwater cress]
gb|AAM64825.1|  ferredoxin--NADP+ reductase-like protein                305   3e-99    Arabidopsis thaliana [mouse-ear cress]
ref|NP_567293.1|  ferredoxin--NADP reductase, root isozyme 1            305   3e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874840.1|  ATRFNR1                                            304   3e-99    
emb|CAB81081.1|  ferredoxin--NADP+ reductase-like protein               304   3e-99    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190682.1|  ferredoxin--NADP reductase, root isozyme 1         304   4e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007211443.1|  hypothetical protein PRUPE_ppa007232mg             305   4e-99    Prunus persica
ref|XP_010691939.1|  PREDICTED: ferredoxin--NADP reductase, root ...    304   7e-99    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003558196.1|  PREDICTED: ferredoxin--NADP reductase, root ...    304   1e-98    Brachypodium distachyon [annual false brome]
gb|AAM96978.1|  ferredoxin--NADP+ reductase-like protein                303   2e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008225595.1|  PREDICTED: ferredoxin--NADP reductase, root ...    303   2e-98    Prunus mume [ume]
ref|NP_973942.1|  ferredoxin--NADP reductase, root isozyme 2            300   3e-98    Arabidopsis thaliana [mouse-ear cress]
ref|NP_564355.1|  ferredoxin--NADP reductase, root isozyme 2            303   3e-98    Arabidopsis thaliana [mouse-ear cress]
ref|NP_849734.1|  ferredoxin--NADP reductase, root isozyme 2            303   3e-98    Arabidopsis thaliana [mouse-ear cress]
gb|EYU43232.1|  hypothetical protein MIMGU_mgv1a008184mg                303   3e-98    Erythranthe guttata [common monkey flower]
gb|EMT16236.1|  Ferredoxin--NADP reductase, root isozyme, chlorop...    302   3e-98    
pdb|1JB9|A  Chain A, Crystal Structure Of The Ferredoxin:nadp+ Re...    300   3e-98    Zea mays [maize]
gb|EMS61290.1|  Ferredoxin--NADP reductase, root isozyme, chlorop...    304   3e-98    Triticum urartu
ref|XP_006287955.1|  hypothetical protein CARUB_v10001191mg             302   3e-98    Capsella rubella
ref|XP_006287956.1|  hypothetical protein CARUB_v10001191mg             302   4e-98    Capsella rubella
gb|AAB40034.1|  ferredoxin-NADP reductase precursor                     300   4e-98    Zea mays [maize]
ref|XP_010431473.1|  PREDICTED: ferredoxin--NADP reductase, root ...    302   4e-98    Camelina sativa [gold-of-pleasure]
pdb|3LVB|A  Chain A, Crystal Structure Of The Ferredoxin:nadp+ Re...    300   4e-98    Zea mays [maize]
gb|AAM65564.1|  ferrodoxin NADP oxidoreductase, putative                302   4e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305070.1|  hypothetical protein CARUB_v10009436mg             302   4e-98    Capsella rubella
ref|XP_010431466.1|  PREDICTED: ferredoxin--NADP reductase, root ...    302   5e-98    Camelina sativa [gold-of-pleasure]
dbj|BAJ93902.1|  predicted protein                                      302   5e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002463784.1|  hypothetical protein SORBIDRAFT_01g006100          302   5e-98    Sorghum bicolor [broomcorn]
ref|XP_002893629.1|  ATRFNR2                                            301   6e-98    
ref|XP_010478465.1|  PREDICTED: ferredoxin--NADP reductase, root ...    301   1e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010478464.1|  PREDICTED: ferredoxin--NADP reductase, root ...    301   2e-97    Camelina sativa [gold-of-pleasure]
ref|XP_008665551.1|  PREDICTED: ferredoxin--NADP reductase, root ...    301   2e-97    
gb|ACG39703.1|  ferredoxin--NADP reductase, root isozyme                300   2e-97    Zea mays [maize]
gb|KHG02797.1|  hypothetical protein F383_08810                         300   2e-97    Gossypium arboreum [tree cotton]
ref|XP_010422426.1|  PREDICTED: ferredoxin--NADP reductase, root ...    300   2e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010422427.1|  PREDICTED: ferredoxin--NADP reductase, root ...    300   2e-97    Camelina sativa [gold-of-pleasure]
pdb|3LO8|A  Chain A, Crystal Structure Of The Oxidized Form Of Fe...    297   4e-97    Zea mays [maize]
ref|XP_006844572.1|  hypothetical protein AMTR_s00016p00195680          298   1e-96    Amborella trichopoda
ref|XP_011085204.1|  PREDICTED: ferredoxin--NADP reductase, root-...    298   1e-96    Sesamum indicum [beniseed]
ref|XP_010460851.1|  PREDICTED: ferredoxin--NADP reductase, root ...    298   2e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010460850.1|  PREDICTED: ferredoxin--NADP reductase, root ...    298   2e-96    Camelina sativa [gold-of-pleasure]
gb|KFK44861.1|  hypothetical protein AALP_AA1G312100                    296   6e-96    Arabis alpina [alpine rockcress]
gb|KFK44862.1|  hypothetical protein AALP_AA1G312100                    296   6e-96    Arabis alpina [alpine rockcress]
ref|XP_011016596.1|  PREDICTED: ferredoxin--NADP reductase, root ...    295   1e-95    Populus euphratica
gb|KJB56289.1|  hypothetical protein B456_009G115100                    293   2e-95    Gossypium raimondii
gb|KJB56286.1|  hypothetical protein B456_009G115100                    294   4e-95    Gossypium raimondii
ref|XP_011038878.1|  PREDICTED: ferredoxin--NADP reductase, root ...    294   5e-95    Populus euphratica
ref|XP_001770917.1|  predicted protein                                  290   3e-93    
gb|ACY70395.1|  heterotrophic ferredoxin NADP+ oxidoreductase           289   5e-93    Populus tremula x Populus tremuloides
ref|XP_002982108.1|  hypothetical protein SELMODRAFT_179376             287   1e-92    
ref|XP_002992209.1|  hypothetical protein SELMODRAFT_134886             286   2e-92    
ref|XP_002298889.2|  ferredoxin-NADP reductase family protein           288   2e-92    Populus trichocarpa [western balsam poplar]
gb|EPS58368.1|  hypothetical protein M569_16446                         285   7e-92    Genlisea aurea
ref|XP_007022878.1|  Ferredoxin--NADP reductase, root-type isozym...    283   3e-91    
ref|XP_007022877.1|  Root FNR 1 isoform 1                               285   4e-91    
gb|AFK49031.1|  unknown                                                 273   3e-90    Lotus japonicus
ref|XP_001774270.1|  predicted protein                                  276   6e-89    
gb|KJB56288.1|  hypothetical protein B456_009G115100                    261   2e-82    Gossypium raimondii
gb|KJB56287.1|  hypothetical protein B456_009G115100                    253   3e-79    Gossypium raimondii
ref|XP_005644145.1|  ferredoxin-NADP+ reductase                         240   3e-74    Coccomyxa subellipsoidea C-169
gb|EJK72001.1|  hypothetical protein THAOC_06509                        237   3e-73    Thalassiosira oceanica
ref|XP_005853875.1|  ferredoxin--NADP+ reductase                        239   4e-73    Nannochloropsis gaditana CCMP526
gb|EWM23857.1|  Ferredoxin reductase-type FAD-binding domain protein    239   6e-73    Nannochloropsis gaditana
ref|XP_002184856.1|  predicted protein                                  233   1e-71    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002290014.1|  ferredoxin--NADP+ reductase                        232   4e-71    Thalassiosira pseudonana CCMP1335
gb|ABD51927.1|  chloroplast ferredoxin NADP oxidoreductase              230   4e-70    Guillardia theta
ref|XP_005835894.1|  hypothetical protein GUITHDRAFT_162347             230   5e-70    Guillardia theta CCMP2712
gb|KIZ06612.1|  ferredoxin--NADP+ reductase                             228   8e-70    Monoraphidium neglectum
ref|XP_005770769.1|  hypothetical protein EMIHUDRAFT_432385             228   9e-70    Emiliania huxleyi CCMP1516
gb|ABA55546.1|  chloroplast ferredoxin-dependent NADP oxireductase      229   1e-69    Karlodinium veneficum
ref|XP_005790923.1|  hypothetical protein EMIHUDRAFT_361737             229   1e-69    Emiliania huxleyi CCMP1516
ref|XP_003084170.1|  ferredoxin-NADP reductase (ISS)                    228   1e-69    Ostreococcus tauri
gb|ABF73016.1|  plastid ferredoxin NADPH reductase protein precursor    229   2e-69    Karenia brevis
ref|XP_002295321.1|  ferredoxin-nadp reductase                          227   2e-69    Thalassiosira pseudonana CCMP1335
ref|XP_002954986.1|  ferredoxin-NADP+ reductase                         227   3e-69    Volvox carteri f. nagariensis
emb|CAA55406.1|  ferredoxin NADP reductase                              223   9e-69    Chlamydomonas reinhardtii
ref|XP_001697352.1|  ferredoxin-nadp reductase                          225   2e-68    Chlamydomonas reinhardtii
ref|XP_007510909.1|  predicted protein                                  225   4e-68    Bathycoccus prasinos
ref|XP_002180511.1|  predicted protein                                  222   7e-68    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_001422240.1|  predicted protein                                  224   8e-68    Ostreococcus lucimarinus CCE9901
sp|P53991.1|FENR_CHLRE  RecName: Full=Ferredoxin--NADP reductase,...    223   1e-67    Chlamydomonas reinhardtii
ref|XP_002180502.1|  predicted protein                                  221   2e-67    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_010910721.1|  PREDICTED: ferredoxin--NADP reductase, root ...    216   6e-67    Elaeis guineensis
gb|AAP79145.1|  ferredoxin-NADP oxidoreductase                          221   1e-66    Bigelowiella natans
gb|AAW79315.1|  chloroplast ferredoxin NADP(+) reductase                219   4e-66    Isochrysis galbana
emb|CBJ31206.1|  hypothetical protein Esi_0238_0041                     220   6e-66    Ectocarpus siliculosus
ref|XP_003064407.1|  ferredoxin-NADP oxidoreductase                     218   2e-65    Micromonas pusilla CCMP1545
ref|XP_002500720.1|  ferredoxin-NADP oxidoreductase chloroplast p...    216   1e-64    Micromonas commoda
gb|KIY94893.1|  ferredoxin--NADP+ reductase                             209   2e-64    Monoraphidium neglectum
ref|XP_009040433.1|  hypothetical protein AURANDRAFT_31888              210   6e-63    Aureococcus anophagefferens
ref|XP_011400423.1|  Ferredoxin-NADP reductase, chloroplastic           209   7e-63    Auxenochlorella protothecoides
ref|XP_009035092.1|  hypothetical protein AURANDRAFT_23206              208   4e-62    Aureococcus anophagefferens
emb|CBN78345.1|  ferredoxin-NADP oxidoreductase                         207   6e-61    Ectocarpus siliculosus
ref|XP_002977684.1|  hypothetical protein SELMODRAFT_107413             203   2e-60    Selaginella moellendorffii
ref|XP_002979592.1|  hypothetical protein SELMODRAFT_419219             203   2e-60    Selaginella moellendorffii
ref|XP_002974410.1|  hypothetical protein SELMODRAFT_101002             202   5e-60    Selaginella moellendorffii
ref|XP_002985709.1|  hypothetical protein SELMODRAFT_122698             201   9e-60    Selaginella moellendorffii
ref|XP_005789289.1|  hypothetical protein EMIHUDRAFT_42969              195   4e-57    Emiliania huxleyi CCMP1516
ref|WP_025782058.1|  hypothetical protein                               187   7e-56    
ref|XP_010103488.1|  Ferredoxin--NADP reductase, embryo isozyme         190   1e-55    
ref|XP_005848997.1|  hypothetical protein CHLNCDRAFT_35035              190   7e-55    Chlorella variabilis
emb|CDY51794.1|  BnaC03g75370D                                          186   1e-54    Brassica napus [oilseed rape]
ref|WP_035831811.1|  ferredoxin-NADP reductase                          188   8e-54    
ref|WP_006170829.1|  ferredoxin--NADP reductase                         187   2e-53    Synechococcus sp. WH 5701
ref|WP_011825598.1|  ferredoxin--NADP reductase                         185   5e-53    
ref|WP_043326144.1|  ferredoxin-NADP reductase                          186   7e-53    Cyanobium gracile
gb|AFY27502.1|  Oxidoreductase NAD-binding domain/CpcD/allophycoc...    186   9e-53    Cyanobium gracile PCC 6307
ref|WP_036920327.1|  ferredoxin-NADP reductase                          183   1e-52    
ref|YP_002049405.1|  ferredoxin--NADP reductase (FNR)                   184   2e-52    Paulinella chromatophora
gb|ABO17805.1|  ferredoxin-NADP oxidoreductase (FNR)                    182   3e-52    Prochlorococcus marinus str. MIT 9301
ref|WP_036911108.1|  MULTISPECIES: ferredoxin-NADP reductase            183   3e-52    Prochlorococcus
ref|XP_002291633.1|  predicted protein                                  181   5e-52    Thalassiosira pseudonana CCMP1335
ref|WP_010317887.1|  ferredoxin--NADP reductase                         184   5e-52    Synechococcus sp. CB0205
ref|WP_025970824.1|  ferredoxin-NADP reductase                          177   5e-52    
ref|WP_025930500.1|  ferredoxin-NADP reductase                          183   6e-52    
ref|WP_011130473.1|  ferredoxin--NADP reductase                         182   6e-52    Prochlorococcus marinus
ref|WP_041484700.1|  ferredoxin-NADP reductase                          182   6e-52    Prochlorococcus marinus
gb|AFZ48005.1|  oxidoreductase FAD/NAD(P)-binding domain protein        180   7e-52    Cyanobacterium stanieri PCC 7202
ref|WP_011359557.1|  ferredoxin--NADP reductase                         183   8e-52    Synechococcus sp. CC9902
ref|WP_036896868.1|  ferredoxin-NADP reductase                          182   9e-52    
gb|KDD75893.1|  hypothetical protein H632_c449p0                        181   1e-51    Helicosporidium sp. ATCC 50920
ref|WP_002806441.1|  ferredoxin--NADP reductase                         182   2e-51    Prochlorococcus marinus
ref|WP_011132708.1|  ferredoxin--NADP reductase                         181   3e-51    Prochlorococcus marinus
ref|WP_032527499.1|  ferredoxin-NADP reductase                          181   3e-51    Prochlorococcus marinus
ref|WP_032524602.1|  ferredoxin-NADP reductase                          181   4e-51    Prochlorococcus marinus
ref|WP_009790228.1|  ferredoxin--NADP reductase                         181   4e-51    Synechococcus sp. BL107
ref|WP_025965632.1|  ferredoxin-NADP reductase                          181   5e-51    
ref|WP_012195665.1|  ferredoxin--NADP reductase                         180   6e-51    Prochlorococcus marinus
ref|XP_010536399.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    177   8e-51    Tarenaya hassleriana [spider flower]
gb|ABV50826.1|  ferredoxin-NADP oxidoreductase (FNR)                    180   8e-51    Prochlorococcus marinus str. MIT 9215
ref|WP_025972231.1|  ferredoxin-NADP reductase                          180   8e-51    
gb|EJK44714.1|  hypothetical protein THAOC_36724                        181   8e-51    Thalassiosira oceanica
ref|WP_025888618.1|  ferredoxin-NADP reductase                          180   9e-51    
ref|WP_025933682.1|  ferredoxin-NADP reductase                          180   9e-51    
ref|WP_011376636.1|  ferredoxin--NADP reductase                         180   9e-51    Prochlorococcus marinus
ref|XP_003547929.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    179   9e-51    Glycine max [soybeans]
gb|KHN01599.1|  Ferredoxin--NADP reductase, leaf isozyme, chlorop...    179   1e-50    Glycine soja [wild soybean]
ref|WP_032516697.1|  ferredoxin-NADP reductase                          180   1e-50    Prochlorococcus marinus
ref|WP_025934437.1|  ferredoxin-NADP reductase                          178   1e-50    
ref|WP_025932047.1|  ferredoxin-NADP reductase                          180   1e-50    
ref|WP_032515058.1|  ferredoxin-NADP reductase                          180   1e-50    Prochlorococcus marinus
ref|WP_006852296.1|  ferredoxin--NADP reductase                         180   1e-50    Synechococcus sp. WH 8016
ref|WP_036902640.1|  ferredoxin-NADP reductase                          179   1e-50    Prochlorococcus sp. MIT 0601
ref|WP_025914731.1|  ferredoxin-NADP reductase                          179   1e-50    
ref|WP_011820472.1|  ferredoxin--NADP reductase                         179   1e-50    Prochlorococcus marinus
ref|WP_032522615.1|  ferredoxin-NADP reductase                          180   2e-50    Prochlorococcus marinus
ref|WP_032514193.1|  ferredoxin-NADP reductase                          180   2e-50    Prochlorococcus marinus
ref|WP_025958422.1|  ferredoxin-NADP reductase                          179   2e-50    
ref|WP_017303294.1|  hypothetical protein                               179   2e-50    Spirulina subsalsa
ref|WP_025962971.1|  ferredoxin-NADP reductase                          179   2e-50    
gb|ABR26035.1|  ferredoxin-nadp reductase, leaf isozyme                 173   2e-50    Oryza sativa Indica Group [Indian rice]
ref|WP_032519107.1|  ferredoxin-NADP reductase                          179   2e-50    Prochlorococcus marinus
ref|WP_025881692.1|  ferredoxin-NADP reductase                          179   2e-50    
ref|WP_011935177.1|  ferredoxin--NADP reductase                         179   2e-50    Synechococcus sp. RCC307
ref|WP_041484386.1|  ferredoxin-NADP reductase                          179   2e-50    
ref|WP_025968699.1|  ferredoxin-NADP reductase                          179   2e-50    
ref|WP_025891782.1|  MULTISPECIES: ferredoxin-NADP reductase            179   2e-50    Prochlorococcus sp. HOT208_60m_810B23
ref|WP_025890941.1|  ferredoxin-NADP reductase                          179   2e-50    
ref|WP_025925380.1|  MULTISPECIES: ferredoxin-NADP reductase            179   2e-50    
ref|WP_025973953.1|  ferredoxin-NADP reductase                          179   2e-50    
ref|WP_025975443.1|  ferredoxin-NADP reductase                          179   2e-50    
ref|WP_011125275.1|  MULTISPECIES: ferredoxin--NADP reductase           179   2e-50    Prochlorococcus
ref|WP_025900667.1|  ferredoxin-NADP reductase                          179   2e-50    
ref|WP_025956780.1|  ferredoxin-NADP reductase                          179   2e-50    
ref|WP_025944110.1|  ferredoxin-NADP reductase                          179   2e-50    
ref|WP_025941824.1|  MULTISPECIES: ferredoxin-NADP reductase            179   2e-50    
ref|WP_025923346.1|  ferredoxin-NADP reductase                          178   3e-50    
ref|WP_025939411.1|  ferredoxin-NADP reductase                          178   3e-50    
gb|ABM70465.1|  ferredoxin-NADP oxidoreductase (FNR)                    177   4e-50    Prochlorococcus marinus str. AS9601
ref|WP_025893387.1|  ferredoxin-NADP reductase                          178   4e-50    
ref|WP_006632795.1|  ferredoxin--NADP reductase                         179   4e-50    Microcoleus vaginatus
gb|EMT15804.1|  Ferredoxin--NADP reductase, leaf isozyme, chlorop...    177   5e-50    
ref|WP_025974310.1|  ferredoxin-NADP reductase                          178   6e-50    
ref|WP_007098233.1|  ferredoxin--NADP reductase                         178   6e-50    Synechococcus sp. RS9916
ref|WP_012630377.1|  ferredoxin--NADP reductase                         178   6e-50    Cyanothece sp. PCC 7425
ref|WP_006041729.1|  ferredoxin--NADP reductase                         178   6e-50    Synechococcus sp. WH 7805
dbj|BAJ98295.1|  predicted protein                                      177   6e-50    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|WP_025906619.1|  MULTISPECIES: ferredoxin-NADP reductase            177   7e-50    
ref|WP_042850553.1|  ferredoxin-NADP reductase                          177   7e-50    Prochlorococcus sp. MIT 0604
ref|XP_002510546.1|  ferredoxin--NADP reductase, putative               177   7e-50    Ricinus communis
ref|WP_025955871.1|  MULTISPECIES: ferredoxin-NADP reductase            177   8e-50    
ref|WP_025922412.1|  ferredoxin-NADP reductase                          177   8e-50    
ref|WP_025939139.1|  ferredoxin-NADP reductase                          177   9e-50    
ref|WP_041484539.1|  ferredoxin-NADP reductase                          177   9e-50    Prochlorococcus marinus
ref|WP_025935188.1|  ferredoxin-NADP reductase                          177   9e-50    
ref|WP_025894678.1|  MULTISPECIES: ferredoxin-NADP reductase            177   9e-50    
ref|XP_010536398.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    177   9e-50    Tarenaya hassleriana [spider flower]
ref|WP_011618938.1|  ferredoxin--NADP reductase                         177   9e-50    Synechococcus sp. CC9311
ref|WP_007100218.1|  ferredoxin--NADP reductase                         177   1e-49    Synechococcus sp. RS9917
ref|WP_011364867.1|  ferredoxin--NADP reductase                         177   2e-49    Synechococcus sp. CC9605
pir||B42194  ferredoxin-NADP reductase (EC 1.18.1.2) - Synechococ...    177   2e-49    Synechococcus sp.
ref|WP_030007560.1|  ferredoxin-NADP reductase                          177   2e-49    Synechococcus sp. NKBG042902
ref|WP_025926660.1|  ferredoxin-NADP reductase                          176   2e-49    
ref|WP_012306481.1|  ferredoxin--NADP reductase                         177   2e-49    Synechococcus
ref|WP_028951585.1|  ferredoxin-NADP reductase                          177   2e-49    Synechococcus sp. CC9616
pdb|3VO2|A  Chain A, Crystal Structure Of Zea Mays Leaf Ferredoxi...    174   2e-49    Zea mays [maize]
ref|WP_007357258.1|  MULTISPECIES: ferredoxin--NADP reductase           177   2e-49    Kamptonema
ref|XP_002274366.2|  PREDICTED: ferredoxin--NADP reductase, leaf-...    176   2e-49    Vitis vinifera
ref|WP_024544655.1|  ferredoxin-NADP reductase                          177   2e-49    Synechococcus
ref|XP_006416443.1|  hypothetical protein EUTSA_v10007988mg             176   2e-49    Eutrema salsugineum [saltwater cress]
emb|CAD30024.2|  ferredoxin-NADP(H) oxidoreductase                      176   3e-49    Triticum aestivum [Canadian hard winter wheat]
ref|WP_015133505.1|  ferredoxin--NADP(+) reductase                      176   3e-49    Leptolyngbya sp. PCC 7376
ref|XP_006844481.1|  hypothetical protein AMTR_s00016p00108610          176   3e-49    Amborella trichopoda
ref|WP_038553815.1|  ferredoxin-NADP reductase                          176   3e-49    Synechococcus sp. KORDI-52
ref|WP_038543910.1|  ferredoxin-NADP reductase                          176   4e-49    Synechococcus sp. KORDI-100
ref|WP_017293489.1|  hypothetical protein                               176   4e-49    Geminocystis herdmanii
ref|WP_011933463.1|  ferredoxin--NADP reductase                         176   5e-49    Synechococcus sp. WH 7803
ref|XP_010113341.1|  Ferredoxin--NADP reductase, leaf isozyme           175   5e-49    
ref|WP_015125673.1|  oxidoreductase FAD-binding domain-containing...    176   6e-49    Synechococcus sp. PCC 6312
dbj|BAH56837.1|  AT1G20020                                              172   6e-49    Arabidopsis thaliana [mouse-ear cress]
gb|AHF64355.1|  ferredoxin--NADP reductase (FNR)                        176   6e-49    Synechococcus sp. WH 8109
gb|ACF85815.1|  unknown                                                 175   7e-49    Zea mays [maize]
ref|WP_012595818.1|  MULTISPECIES: ferredoxin--NADP reductase           176   7e-49    Cyanothece
ref|WP_015179262.1|  Ferredoxin--NADP(+) reductase                      176   7e-49    
ref|XP_003557263.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    174   8e-49    
gb|EMT12632.1|  Ferredoxin--NADP reductase, leaf isozyme, chlorop...    171   9e-49    
ref|WP_008191760.1|  FAD/NAD-binding oxidoreductase                     172   1e-48    
gb|AFZ54666.1|  Ferredoxin--NADP(+) reductase                           175   1e-48    
ref|WP_041922881.1|  ferredoxin-NADP reductase                          175   1e-48    
gb|KJB58054.1|  hypothetical protein B456_009G194200                    174   1e-48    
ref|WP_036533347.1|  ferredoxin-NADP reductase                          175   1e-48    
ref|WP_015229409.1|  FAD binding domain-containing protein              175   1e-48    
emb|CDY57601.1|  BnaAnng14750D                                          174   1e-48    
pdb|3W5U|A  Chain A, Cross-linked Complex Between Ferredoxin And ...    172   1e-48    
pdb|1GAQ|A  Chain A, Crystal Structure Of The Complex Between Fer...    172   1e-48    
ref|XP_009103366.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    174   2e-48    
ref|XP_010550469.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    174   2e-48    
ref|XP_007156158.1|  hypothetical protein PHAVU_003G263200g             173   2e-48    
ref|XP_006655693.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    173   2e-48    
gb|KDP36912.1|  hypothetical protein JCGZ_08203                         173   2e-48    
ref|XP_004952968.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    173   2e-48    
gb|EAY99350.1|  hypothetical protein OsI_21320                          173   2e-48    
ref|NP_001105568.1|  ferredoxin                                         173   2e-48    
ref|WP_015165197.1|  ferredoxin--NADP(+) reductase                      171   2e-48    
sp|Q00598.1|FENR_CYAPA  RecName: Full=Ferredoxin--NADP reductase,...    173   3e-48    
ref|XP_003520228.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    173   3e-48    
ref|WP_043369601.1|  ferredoxin-NADP reductase                          174   3e-48    
gb|EDY38180.1|  ferredoxin--NADP reductase                              174   3e-48    
ref|WP_010303595.1|  ferredoxin--NADP reductase                         173   4e-48    
ref|NP_001056570.1|  Os06g0107700                                       172   4e-48    
ref|NP_001077565.1|  ferredoxin--NADP reductase, leaf isozyme 2         172   5e-48    
pdb|3VO1|A  Chain A, Crystal Structure Of Zea Mays Leaf Ferredoxi...    171   5e-48    
ref|XP_010477227.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    172   6e-48    
ref|XP_010459681.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    172   6e-48    
ref|XP_002890363.1|  ATLFNR2                                            172   6e-48    
ref|XP_006285050.1|  hypothetical protein CARUB_v10006366mg             164   6e-48    
ref|XP_004233557.1|  PREDICTED: ferredoxin--NADP reductase, leaf-...    172   6e-48    
ref|NP_001077566.1|  ferredoxin--NADP reductase, leaf isozyme 2         172   7e-48    
ref|XP_006304543.1|  hypothetical protein CARUB_v10011511mg             172   7e-48    
ref|WP_036477079.1|  ferredoxin-NADP reductase                          173   7e-48    
ref|NP_173431.1|  ferredoxin--NADP reductase, leaf isozyme 2            172   7e-48    
gb|KCW56624.1|  hypothetical protein EUGRSUZ_I02340                     169   7e-48    
gb|AHB88104.1|  ferredoxin--NADP+ reductase PetH                        172   8e-48    
ref|WP_011057053.1|  ferredoxin--NADP reductase                         172   8e-48    
ref|WP_041429054.1|  ferredoxin-NADP reductase                          172   9e-48    
ref|WP_017715708.1|  ferredoxin--NADP reductase                         173   9e-48    
gb|KCW56625.1|  hypothetical protein EUGRSUZ_I02340                     169   1e-47    
ref|WP_015171443.1|  oxidoreductase FAD/NAD(P)-binding domain-con...    172   1e-47    
ref|XP_010498430.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    172   1e-47    
ref|WP_036917951.1|  MULTISPECIES: ferredoxin-NADP reductase            171   1e-47    
ref|XP_009390794.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    171   1e-47    
ref|WP_019504594.1|  hypothetical protein                               172   1e-47    
gb|ACG35645.1|  ferredoxin--NADP reductase, leaf isozyme                171   1e-47    
ref|WP_043691984.1|  ferredoxin-NADP reductase                          172   1e-47    
ref|XP_002183949.1|  predicted protein                                  169   2e-47    
ref|NP_001149023.1|  ferredoxin--NADP reductase, leaf isozyme           171   2e-47    
ref|XP_009382075.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    171   2e-47    
ref|XP_009382076.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    171   2e-47    
gb|KFK44126.1|  hypothetical protein AALP_AA1G219100                    171   2e-47    
ref|WP_002772196.1|  ferredoxin--NADP reductase                         172   2e-47    
ref|WP_044106149.1|  ferredoxin--NADP reductase                         169   2e-47    
ref|XP_009413066.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    171   2e-47    
ref|NP_001104851.1|  ferredoxin                                         171   2e-47    
gb|ACF83556.1|  unknown                                                 171   2e-47    
ref|XP_006361933.1|  PREDICTED: ferredoxin--NADP reductase, leaf-...    171   3e-47    
emb|CAD30025.1|  ferredoxin-NADP(H) oxidoreductase                      171   3e-47    
ref|WP_002762614.1|  ferredoxin--NADP reductase                         171   3e-47    
ref|XP_009110244.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    170   3e-47    
ref|XP_006425452.1|  hypothetical protein CICLE_v10027108mg             170   3e-47    
ref|XP_003575004.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    170   4e-47    
emb|CDP01892.1|  unnamed protein product                                170   4e-47    
ref|WP_038653537.1|  ferredoxin-NADP reductase                          171   4e-47    
ref|WP_011127616.1|  ferredoxin--NADP reductase                         171   4e-47    
ref|XP_009034033.1|  hypothetical protein AURANDRAFT_52453              171   5e-47    
ref|WP_002802650.1|  ferredoxin--NADP reductase                         171   5e-47    
ref|XP_008354645.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    167   5e-47    
ref|WP_002795570.1|  ferredoxin--NADP reductase                         171   5e-47    
ref|WP_002787377.1|  ferredoxin--NADP reductase                         171   6e-47    
ref|WP_015224643.1|  oxidoreductase FAD/NAD(P)-binding domain-con...    171   6e-47    
ref|XP_002459129.1|  hypothetical protein SORBIDRAFT_03g046340          170   6e-47    
ref|WP_002791386.1|  ferredoxin--NADP reductase                         170   6e-47    
ref|XP_008448551.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    169   7e-47    
ref|WP_002782614.1|  Ferredoxin--NADP reductase                         170   7e-47    
ref|WP_002734368.1|  ferredoxin--NADP reductase                         170   7e-47    
ref|XP_008448550.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    169   7e-47    
ref|WP_002776183.1|  ferredoxin--NADP reductase                         170   7e-47    
ref|WP_004158734.1|  ferredoxin--NADP reductase                         170   7e-47    
ref|XP_010029673.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    169   8e-47    
ref|WP_008202728.1|  ferredoxin--NADP reductase                         170   8e-47    
ref|WP_040937819.1|  ferredoxin-NADP reductase                          168   9e-47    
gb|ABK22336.1|  unknown                                                 169   9e-47    
ref|WP_017651922.1|  ferredoxin--NADP reductase                         171   1e-46    
ref|WP_040932423.1|  ferredoxin-NADP reductase                          167   1e-46    
ref|WP_015146553.1|  oxidoreductase FAD-binding domain-containing...    169   1e-46    
ref|WP_044304925.1|  ferredoxin-NADP reductase                          169   2e-46    
ref|XP_004170232.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    168   2e-46    
dbj|BAD07827.1|  putative ferredoxin-NADP(H) oxidoreductase             168   2e-46    
ref|WP_040944897.1|  ferredoxin-NADP reductase                          167   2e-46    
ref|XP_004146142.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    168   3e-46    
ref|WP_010474531.1|  ferredoxin--NADP reductase                         167   3e-46    
dbj|BAH20393.1|  AT5G66190                                              165   3e-46    
ref|XP_010268658.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    168   3e-46    
ref|XP_008394226.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    167   3e-46    
ref|XP_009379399.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    167   3e-46    
ref|NP_001078805.1|  ferredoxin-NADP(+)-oxidoreductase 1                165   4e-46    
emb|CCH68057.1|  Ferredoxin-NADP(+) reductase                           169   4e-46    
dbj|GAL95184.1|  ferredoxin-NADP(+) reductase                           168   5e-46    
ref|WP_036906601.1|  ferredoxin-NADP reductase                          167   5e-46    
gb|EAY84091.1|  hypothetical protein OsI_05475                          167   5e-46    
ref|XP_009363490.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    167   5e-46    
ref|WP_015185886.1|  sulfite reductase subunit alpha                    168   6e-46    
ref|WP_015203026.1|  ferredoxin--NADP(+) reductase                      168   6e-46    
ref|WP_006507842.1|  Oxidoreductase FAD-binding domain protein          167   6e-46    
ref|WP_002742462.1|  ferredoxin--NADP reductase                         167   6e-46    
gb|AAW79314.1|  chloroplast ferredoxin-NADP{+) reductase                168   6e-46    
ref|XP_003537636.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    167   7e-46    
ref|XP_002992727.1|  hypothetical protein SELMODRAFT_25109              165   8e-46    
ref|WP_022606197.1|  oxidoreductase NAD-binding domain/FAD bindin...    167   8e-46    
gb|KGN55659.1|  hypothetical protein Csa_3G002780                       168   8e-46    
ref|WP_015192030.1|  Ferredoxin--NADP(+) reductase                      168   8e-46    
ref|WP_028947747.1|  ferredoxin-NADP reductase                          167   1e-45    
ref|WP_009631217.1|  sulfite reductase, alpha subunit (flavoprotein)    168   1e-45    
gb|ELS32478.1|  Ferredoxin--NADP(+) reductase                           164   1e-45    
ref|XP_010444826.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    166   1e-45    
ref|XP_010484677.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    166   1e-45    
ref|XP_008361344.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    166   1e-45    
ref|WP_040688390.1|  ferredoxin-NADP reductase                          164   1e-45    
ref|XP_007046687.1|  Ferredoxin-NADP(+)-oxidoreductase 2                166   1e-45    
pdb|1SM4|A  Chain A, Crystal Structure Analysis Of The Ferredoxin...    164   1e-45    
ref|WP_012162552.1|  ferredoxin--NADP reductase                         166   1e-45    
ref|WP_015145548.1|  oxidoreductase NAD-binding domain-containing...    167   2e-45    
gb|ERT04099.1|  ferredoxin--NADP reductase                              164   2e-45    
ref|XP_008241828.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    166   2e-45    
ref|WP_011294764.1|  ferredoxin--NADP reductase                         166   2e-45    
ref|XP_010465822.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    166   2e-45    
gb|KDP46763.1|  hypothetical protein JCGZ_06551                         166   2e-45    
ref|XP_004287805.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    166   2e-45    
ref|NP_201420.1|  ferredoxin-NADP(+)-oxidoreductase 1                   166   2e-45    
ref|XP_002865083.1|  ferredoxin-NADP+ reductase                         166   2e-45    
ref|WP_015189196.1|  Ferredoxin--NADP(+) reductase                      167   2e-45    
dbj|BAE98556.1|  ferredoxin-NADP+ reductase                             166   2e-45    
ref|WP_016951277.1|  ferredoxin--NADP reductase                         167   2e-45    
ref|WP_015153058.1|  oxidoreductase FAD/NAD(P)-binding domain-con...    167   2e-45    
ref|WP_044205116.1|  hypothetical protein                               159   2e-45    
ref|WP_017804228.1|  ferredoxin--NADP reductase                         167   2e-45    
ref|XP_004232495.1|  PREDICTED: ferredoxin--NADP reductase, leaf-...    165   2e-45    
emb|CAB71293.1|  chloroplast ferredoxin-NADP+ oxidoreductase prec...    165   2e-45    
gb|EAW45548.1|  Oxidoreductase FAD/NAD(P)-binding                       167   2e-45    
ref|XP_009794242.1|  PREDICTED: ferredoxin--NADP reductase, leaf-...    165   2e-45    
ref|WP_009782586.1|  ferredoxin--NADP reductase                         166   3e-45    
ref|WP_011824088.1|  ferredoxin--NADP reductase                         166   3e-45    
ref|XP_007202096.1|  hypothetical protein PRUPE_ppa007547mg             165   3e-45    
ref|XP_009588213.1|  PREDICTED: ferredoxin--NADP reductase, leaf-...    165   3e-45    
ref|XP_002993724.1|  hypothetical protein SELMODRAFT_272335             165   3e-45    
dbj|BAG69182.1|  ferredoxin-NADP+ oxidoreductase                        166   3e-45    
ref|XP_006280674.1|  hypothetical protein CARUB_v10026639mg             165   3e-45    
sp|O04977.1|FENR1_TOBAC  RecName: Full=Ferredoxin--NADP reductase...    165   4e-45    
sp|P41343.1|FENR_MESCR  RecName: Full=Ferredoxin--NADP reductase,...    165   4e-45    
ref|XP_006340740.1|  PREDICTED: ferredoxin--NADP reductase, leaf-...    165   4e-45    
dbj|BAG69177.1|  ferredoxin-NADP+ oxidoreductase                        167   4e-45    
ref|XP_004951191.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    165   4e-45    
gb|ACJ05622.1|  ferredoxin:NADP+ oxidoreductase                         166   4e-45    
ref|WP_039713239.1|  ferredoxin-NADP reductase                          166   4e-45    
ref|WP_010873079.1|  ferredoxin--NADP reductase                         166   5e-45    
ref|XP_008788385.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    164   5e-45    
gb|KJB43314.1|  hypothetical protein B456_007G193800                    164   6e-45    
gb|ACJ05621.2|  ferredoxin:NADP+ oxidoreductase                         166   6e-45    
ref|WP_015160797.1|  Oxidoreductase FAD-binding domain/CpcD/allop...    165   6e-45    
pdb|1FNB|A  Chain A, Refined Crystal Structure Of Spinach Ferredo...    163   7e-45    
gb|KJB43315.1|  hypothetical protein B456_007G193800                    163   7e-45    
ref|XP_010920179.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    164   7e-45    
ref|WP_040484716.1|  ferredoxin-NADP reductase                          165   9e-45    
ref|WP_035158113.1|  ferredoxin-NADP reductase                          165   1e-44    
gb|AAA34029.1|  ferredoxin-NADP oxidoreductase                          164   1e-44    
ref|XP_007157909.1|  hypothetical protein PHAVU_002G108000g             163   1e-44    
ref|WP_026794586.1|  MULTISPECIES: ferredoxin-NADP reductase            164   2e-44    
dbj|BAG70314.1|  ferredoxin-NADP+ oxidoreductase                        165   2e-44    
ref|WP_027254306.1|  ferredoxin-NADP reductase                          164   2e-44    
dbj|BAD97809.1|  ferredoxin-NADP+ oxidoreductase                        165   2e-44    
dbj|BAG70317.1|  ferredoxin-NADP+ oxidoreductase                        164   2e-44    
gb|KIJ82541.1|  ferredoxin-NADP reductase                               164   2e-44    
ref|WP_015208880.1|  sulfite reductase, alpha subunit (flavoprotein)    165   2e-44    
ref|WP_018399210.1|  hypothetical protein                               164   2e-44    
ref|WP_041429853.1|  ferredoxin-NADP reductase                          161   2e-44    
gb|AFO59573.1|  ferredoxin-NADP reductase                               162   2e-44    
gb|AFY72940.1|  NAD-dependent oxidoreductase                            161   2e-44    
pdb|1FRN|A  Chain A, The Involvement Of Ser96 In The Catalytic Me...    161   3e-44    
ref|XP_006383096.1|  Chain A family protein                             162   3e-44    
ref|XP_011043184.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    162   3e-44    
ref|XP_011010543.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    162   3e-44    
ref|XP_010679926.1|  PREDICTED: ferredoxin--NADP reductase, chlor...    162   4e-44    
ref|WP_026788790.1|  MULTISPECIES: ferredoxin-NADP reductase            163   4e-44    
ref|WP_026797072.1|  MULTISPECIES: ferredoxin-NADP reductase            163   4e-44    
emb|CDX81408.1|  BnaC09g08190D                                          162   4e-44    
emb|CDY18592.1|  BnaA09g08030D                                          162   5e-44    
ref|XP_009112283.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    162   5e-44    
sp|P00455.1|FENR_SPIOL  RecName: Full=Ferredoxin--NADP reductase,...    162   5e-44    
gb|EYU30800.1|  hypothetical protein MIMGU_mgv1a008865mg                162   5e-44    
ref|XP_002437683.1|  hypothetical protein SORBIDRAFT_10g000720          162   5e-44    
ref|WP_044137750.1|  ferredoxin-NADP reductase                          162   6e-44    
ref|XP_006393807.1|  hypothetical protein EUTSA_v10004465mg             162   6e-44    
dbj|BAG48518.1|  ferredoxin-NADP+ oxidoreductase                        163   6e-44    
gb|ABG52720.1|  oxidoreductase FAD/NAD(P)-binding                       162   6e-44    
ref|XP_002265774.1|  PREDICTED: ferredoxin--NADP reductase, leaf-...    162   6e-44    
emb|CAN59785.1|  hypothetical protein VITISV_042164                     162   6e-44    
dbj|BAG69179.1|  ferredoxin-NADP+ oxidoreductase                        163   7e-44    
ref|XP_006380593.1|  Chain A family protein                             161   7e-44    
ref|XP_004512139.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    161   8e-44    
pdb|1BX1|A  Chain A, Ferredoxin:nadp+ Oxidoreductase (Ferredoxin ...    160   8e-44    
ref|WP_021831874.1|  Ferredoxin-NADP(+) reductase                       159   8e-44    
ref|WP_027838885.1|  ferredoxin-NADP reductase                          163   8e-44    
emb|CDY57760.1|  BnaC02g45020D                                          167   9e-44    
ref|WP_019493254.1|  ferredoxin--NADP reductase                         162   1e-43    
ref|WP_015111867.1|  ferredoxin--NADP(+) reductase                      162   1e-43    
ref|WP_012953929.1|  ferredoxin--NADP reductase                         159   1e-43    
ref|WP_015957129.1|  ferredoxin--NADP reductase                         161   2e-43    
ref|WP_036946982.1|  ferredoxin-NADP reductase                          159   2e-43    
emb|CAA63961.1|  ferredoxin-NADP oxidoreductase                         162   2e-43    
ref|XP_005719376.1|  Ferredoxin-NADP+ oxidoreductase                    160   2e-43    
pdb|1FRQ|A  Chain A, Ferredoxin:nadp+ Oxidoreductase (Ferredoxin ...    159   2e-43    
ref|WP_041041729.1|  ferredoxin-NADP reductase                          162   2e-43    
ref|WP_015118897.1|  FAD binding domaincontaining protein               161   2e-43    
gb|AFK41176.1|  unknown                                                 160   2e-43    
ref|XP_005706517.1|  ferredoxin--NADP+ reductase                        160   2e-43    



>ref|XP_004134584.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004172626.1| PREDICTED: LOW QUALITY PROTEIN: ferredoxin--NADP reductase, root 
isozyme, chloroplastic-like [Cucumis sativus]
 gb|KGN49459.1| hypothetical protein Csa_6G525450 [Cucumis sativus]
Length=378

 Score =   322 bits (825),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKF GLAWLFLGVANTDSL
Sbjct  216  GKIMLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFGGLAWLFLGVANTDSL  275

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF+KYL+D+PDNFRYDR LSREQKN+NGGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  276  LYDDEFSKYLKDYPDNFRYDRALSREQKNRNGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  335

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG  WE KLSQLKKNKQWHVEVY
Sbjct  336  CGLKGMMPGIQDTLKKVAEQRGEKWEEKLSQLKKNKQWHVEVY  378



>gb|EYU19120.1| hypothetical protein MIMGU_mgv1a008446mg [Erythranthe guttata]
Length=373

 Score =   321 bits (823),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPEDNPNATHIMIATGTGVAPFRGYLRRMFME+VPTFKF GLAWLFLGVANTDSL
Sbjct  211  GKVMLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMEAVPTFKFGGLAWLFLGVANTDSL  270

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF+KYLQD+PDNFR+DR LSREQKN+NGGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  271  LYDEEFSKYLQDYPDNFRFDRALSREQKNRNGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  330

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  331  CGLKGMMPGIQDTLKKVAEQRGESWDEKLSQLKKNKQWHVEVY  373



>ref|XP_008439552.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Cucumis melo]
Length=379

 Score =   321 bits (823),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKF GLAWLFLGVANTDSL
Sbjct  217  GKIMLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFGGLAWLFLGVANTDSL  276

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF+KYL+D+PDNFRYDR LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  277  LYDDEFSKYLKDYPDNFRYDRALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  336

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG  WE KLSQLKKNKQWHVEVY
Sbjct  337  CGLKGMMPGIQDTLKKVAEQRGEKWEEKLSQLKKNKQWHVEVY  379



>gb|ACJ83525.1| unknown [Medicago truncatula]
Length=198

 Score =   313 bits (803),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAP+RGYLRRMFMESVPTFKF GLAWLFLGVAN+DSL
Sbjct  36   GKIMLLPEDDPNATHIMIATGTGVAPYRGYLRRMFMESVPTFKFGGLAWLFLGVANSDSL  95

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYL+D+P+NFRYDR LSRE+KN+NGGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  96   LYDDEFTKYLKDYPENFRYDRALSREEKNRNGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  155

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQ+TLKRVAE RG SWE KLSQLKKNKQWHVEVY
Sbjct  156  CGLKGMMPGIQETLKRVAENRGESWEEKLSQLKKNKQWHVEVY  198



>ref|XP_006448908.1| hypothetical protein CICLE_v100156272mg, partial [Citrus clementina]
 gb|ESR62148.1| hypothetical protein CICLE_v100156272mg, partial [Citrus clementina]
Length=165

 Score =   311 bits (798),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPEDNPNATHIMIATGTG+APFRGYLRRMFMESV T+KF GLAWLFLGVAN+DSL
Sbjct  3    GKIMLLPEDNPNATHIMIATGTGIAPFRGYLRRMFMESVHTYKFGGLAWLFLGVANSDSL  62

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYLQD+PDNFRYD+ LSREQKNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  63   LYDDEFTKYLQDYPDNFRYDKALSREQKNKKGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  122

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQ+TLKRVAE+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  123  CGLKGMMPGIQETLKRVAEQRGESWDQKLSQLKKNKQWHVEVY  165



>ref|XP_010051952.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Eucalyptus grandis]
 gb|KCW75780.1| hypothetical protein EUGRSUZ_D00177 [Eucalyptus grandis]
Length=377

 Score =   319 bits (818),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPEDNPNATHIMIATGTG+APFRGYLRRMFMESVPT+KF GLAWLFLGVAN+DSL
Sbjct  215  GKIMLLPEDNPNATHIMIATGTGIAPFRGYLRRMFMESVPTYKFGGLAWLFLGVANSDSL  274

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF+KYL+D+PDNFRYD  LSREQ NK GGKMYVQDKIEEYSDEIFKLLDEGAHIYF
Sbjct  275  LYDDEFSKYLRDYPDNFRYDTALSREQNNKKGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  334

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVA ERG SWE KLSQLKKNKQWHVEVY
Sbjct  335  CGLKGMMPGIQDTLKRVAVERGESWEEKLSQLKKNKQWHVEVY  377



>ref|XP_010098567.1| Ferredoxin--NADP reductase, root isozyme [Morus notabilis]
 gb|EXB75227.1| Ferredoxin--NADP reductase, root isozyme [Morus notabilis]
Length=393

 Score =   319 bits (818),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPEDNPNATHIMIATGTGVAP+RGYLRRMFMESVPTFKF GLAWLFLGVANTDSL
Sbjct  231  GKIMLLPEDNPNATHIMIATGTGVAPYRGYLRRMFMESVPTFKFGGLAWLFLGVANTDSL  290

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYL+D+PDNFRYDR LSREQKNK+GGKMYVQDKIEEYSDEIF+LLD+GAHIYF
Sbjct  291  LYDDEFTKYLKDYPDNFRYDRALSREQKNKSGGKMYVQDKIEEYSDEIFRLLDDGAHIYF  350

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQ+TLKRVA++RG SWE KL+QLKKNKQWHVEVY
Sbjct  351  CGLKGMMPGIQETLKRVADQRGESWEEKLAQLKKNKQWHVEVY  393



>gb|AII16855.1| ferredoxin-NADP(+) reductase, partial [Ocimum basilicum]
Length=372

 Score =   318 bits (815),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+P ATHIMIATGTGVAPFRGYLRRMFME VPTFKFNGLAWLFLGVAN DSL
Sbjct  210  GKIMLLPEDDPKATHIMIATGTGVAPFRGYLRRMFMEDVPTFKFNGLAWLFLGVANKDSL  269

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF+KYLQD+PDNFR+DR LSREQKN+NGGKMYVQDKIEEYSDE+FKLLD GAHIYF
Sbjct  270  LYDDEFSKYLQDYPDNFRFDRALSREQKNRNGGKMYVQDKIEEYSDEVFKLLDNGAHIYF  329

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG +WE KLSQLKKNKQWHVEVY
Sbjct  330  CGLKGMMPGIQDTLKKVAEQRGENWEEKLSQLKKNKQWHVEVY  372



>emb|CDP17310.1| unnamed protein product [Coffea canephora]
Length=442

 Score =   320 bits (819),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPEDNP ATHIMIATGTGVAP+R YLRRMFMESVPTFKF GLAWLFLGVANTDSL
Sbjct  280  GKIMLLPEDNPKATHIMIATGTGVAPYRAYLRRMFMESVPTFKFGGLAWLFLGVANTDSL  339

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF++YL+D+PDNFRYDR LSREQKNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  340  LYDDEFSQYLRDYPDNFRYDRALSREQKNKNGGKMYVQDKIEEYSDEIFKLLDTGAHIYF  399

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAE+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  400  CGLKGMMPGIQDTLKRVAEQRGESWDEKLSQLKKNKQWHVEVY  442



>ref|NP_001239798.1| uncharacterized protein LOC100807968 [Glycine max]
 gb|ACU22765.1| unknown [Glycine max]
Length=377

 Score =   317 bits (811),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAPFRGYLRRMFMESVP +KF GLAWLFLGVANTDSL
Sbjct  215  GKIMLLPEDDPNATHIMIATGTGVAPFRGYLRRMFMESVPAYKFGGLAWLFLGVANTDSL  274

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF+KYL+D+PDNFRY+R LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  275  LYDDEFSKYLKDYPDNFRYNRALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  334

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG SWE KLSQLKKNKQWHVEVY
Sbjct  335  CGLKGMMPGIQDTLKKVAEQRGESWEEKLSQLKKNKQWHVEVY  377



>ref|XP_006597058.1| PREDICTED: uncharacterized protein LOC100807968 isoform X1 [Glycine 
max]
Length=378

 Score =   317 bits (811),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAPFRGYLRRMFMESVP +KF GLAWLFLGVANTDSL
Sbjct  216  GKIMLLPEDDPNATHIMIATGTGVAPFRGYLRRMFMESVPAYKFGGLAWLFLGVANTDSL  275

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF+KYL+D+PDNFRY+R LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  276  LYDDEFSKYLKDYPDNFRYNRALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  335

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG SWE KLSQLKKNKQWHVEVY
Sbjct  336  CGLKGMMPGIQDTLKKVAEQRGESWEEKLSQLKKNKQWHVEVY  378



>gb|KHN14331.1| Ferredoxin--NADP reductase, root isozyme, chloroplastic [Glycine 
soja]
Length=369

 Score =   316 bits (810),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAPFRGYLRRMFMESVP +KF GLAWLFLGVANTDSL
Sbjct  207  GKIMLLPEDDPNATHIMIATGTGVAPFRGYLRRMFMESVPAYKFGGLAWLFLGVANTDSL  266

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF+KYL+D+PDNFRY+R LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  267  LYDDEFSKYLKDYPDNFRYNRALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  326

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG SWE KLSQLKKNKQWHVEVY
Sbjct  327  CGLKGMMPGIQDTLKKVAEQRGESWEEKLSQLKKNKQWHVEVY  369



>gb|KDP34933.1| hypothetical protein JCGZ_09221 [Jatropha curcas]
Length=379

 Score =   316 bits (810),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPEDNPNATHIMIATGTGVAPFRGYLRRMFME V  +KF GLAWLFLGVANTDSL
Sbjct  217  GKIMLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMEDVSKYKFGGLAWLFLGVANTDSL  276

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYLQD+PDNFRYD+ LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  277  LYDDEFTKYLQDYPDNFRYDKALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDCGAHIYF  336

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAE+RG SWE KLSQLKKNKQWHVEVY
Sbjct  337  CGLKGMMPGIQDTLKRVAEQRGESWEQKLSQLKKNKQWHVEVY  379



>ref|XP_006468308.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Citrus sinensis]
 gb|KDO75263.1| hypothetical protein CISIN_1g017070mg [Citrus sinensis]
Length=378

 Score =   315 bits (808),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPEDNPNATHIMIATGTG+APFRGYLRRMFMESVPT+KF GLAWLFLGVAN DSL
Sbjct  216  GKIMLLPEDNPNATHIMIATGTGIAPFRGYLRRMFMESVPTYKFGGLAWLFLGVANPDSL  275

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYLQD+PDNFRYD+ LSREQKNK GGKMYVQDKIEEYSDEIFK LD GAHIYF
Sbjct  276  LYDDEFTKYLQDYPDNFRYDKALSREQKNKKGGKMYVQDKIEEYSDEIFKRLDGGAHIYF  335

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQ+TLKRVAE+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  336  CGLKGMMPGIQETLKRVAEQRGESWDQKLSQLKKNKQWHVEVY  378



>ref|XP_003594526.1| Ferredoxin-NADP reductase [Medicago truncatula]
 gb|AES64777.1| ferredoxin reductase-like NAD(P) binding domain protein [Medicago 
truncatula]
 gb|AFK47886.1| unknown [Medicago truncatula]
Length=378

 Score =   315 bits (808),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAP+RGYLRRMFMESVPTFKF GLAWLFLGVAN+DSL
Sbjct  216  GKIMLLPEDDPNATHIMIATGTGVAPYRGYLRRMFMESVPTFKFGGLAWLFLGVANSDSL  275

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYL+D+P+NFRYDR LSRE+KN+NGGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  276  LYDDEFTKYLKDYPENFRYDRALSREEKNRNGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  335

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQ+TLKRVAE RG SWE KLSQLKKNKQWHVEVY
Sbjct  336  CGLKGMMPGIQETLKRVAENRGESWEEKLSQLKKNKQWHVEVY  378



>emb|CAA67796.1| ferrodoxin NADP oxidoreductase [Pisum sativum]
Length=378

 Score =   315 bits (808),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAP+RGYLRRMFMESVPTFKF GLAWLFLGVAN DSL
Sbjct  216  GKIMLLPEDDPNATHIMIATGTGVAPYRGYLRRMFMESVPTFKFGGLAWLFLGVANVDSL  275

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYL+D+PDNFRY+R LSRE+KNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  276  LYDDEFTKYLKDYPDNFRYNRALSREEKNKNGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  335

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGL+GMMPGIQ+TLKRVAE+RG SWE KLSQLKKNKQWHVEVY
Sbjct  336  CGLRGMMPGIQETLKRVAEKRGESWEEKLSQLKKNKQWHVEVY  378



>ref|XP_002523191.1| ferredoxin--NADP reductase, putative [Ricinus communis]
 gb|EEF39222.1| ferredoxin--NADP reductase, putative [Ricinus communis]
Length=378

 Score =   315 bits (807),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE +PNATHIMIATGTGVAPFRGYLRRMFME VPTFKF GLAWLFLGVANTDSL
Sbjct  216  GKIMLLPESDPNATHIMIATGTGVAPFRGYLRRMFMEDVPTFKFGGLAWLFLGVANTDSL  275

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYL+D+PD+FRYD+ LSREQKNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  276  LYDDEFTKYLEDYPDHFRYDKALSREQKNKNGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  335

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  336  CGLKGMMPGIQDTLKKVAEQRGESWDQKLSQLKKNKQWHVEVY  378



>sp|Q41014.2|FENR2_PEA RecName: Full=Ferredoxin--NADP reductase, root isozyme, chloroplastic; 
Short=FNR; Flags: Precursor [Pisum sativum]
Length=377

 Score =   315 bits (807),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAP+RGYLRRMFMESVPTFKF GLAWLFLGVAN DSL
Sbjct  215  GKIMLLPEDDPNATHIMIATGTGVAPYRGYLRRMFMESVPTFKFGGLAWLFLGVANVDSL  274

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYL+D+PDNFRY+R LSRE+KNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  275  LYDDEFTKYLKDYPDNFRYNRALSREEKNKNGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  334

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGL+GMMPGIQ+TLKRVAE+RG SWE KLSQLKKNKQWHVEVY
Sbjct  335  CGLRGMMPGIQETLKRVAEKRGESWEEKLSQLKKNKQWHVEVY  377



>ref|NP_001058890.1| Os07g0147900 [Oryza sativa Japonica Group]
 sp|O23877.1|FENR3_ORYSJ RecName: Full=Ferredoxin--NADP reductase, embryo isozyme, chloroplastic; 
Short=FNR; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAA13417.1| precursor ferredoxin-NADP+ oxidoreductase [Oryza sativa (japonica 
cultivar-group)]
 dbj|BAC83340.1| Ferredoxin--NADP reductase, embryo isozyme, chloroplast precursor 
(FNR) [Oryza sativa Japonica Group]
 dbj|BAF20804.1| Os07g0147900 [Oryza sativa Japonica Group]
 gb|EAZ38695.1| hypothetical protein OsJ_23093 [Oryza sativa Japonica Group]
Length=378

 Score =   315 bits (807),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAP+RGYLRRMFME VP+FKF GLAWLFLGVANTDSL
Sbjct  216  GKIMLLPEDDPNATHIMIATGTGVAPYRGYLRRMFMEDVPSFKFGGLAWLFLGVANTDSL  275

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YLQ +PDNFRYD+ LSREQKNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  276  LYDEEFTNYLQQYPDNFRYDKALSREQKNKNGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  335

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAE+RG SWE KLSQLKKNKQWHVEVY
Sbjct  336  CGLKGMMPGIQDTLKRVAEQRGESWEQKLSQLKKNKQWHVEVY  378



>ref|NP_001239859.1| uncharacterized protein LOC100789291 [Glycine max]
 gb|ACU18286.1| unknown [Glycine max]
 gb|KHN23002.1| Ferredoxin--NADP reductase, root isozyme, chloroplastic [Glycine 
soja]
Length=377

 Score =   315 bits (807),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAPFRGYLRRMF+ESVPT+KF GLAWLFLGVANTDSL
Sbjct  215  GKIMLLPEDDPNATHIMIATGTGVAPFRGYLRRMFLESVPTYKFGGLAWLFLGVANTDSL  274

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF+KYL D+ DNFRYDR LSREQKNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  275  LYDEEFSKYLNDYSDNFRYDRALSREQKNKNGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  334

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG SWE KLSQLKKNKQWHVEVY
Sbjct  335  CGLKGMMPGIQDTLKKVAEQRGESWEEKLSQLKKNKQWHVEVY  377



>ref|XP_006586681.1| PREDICTED: uncharacterized protein LOC100789291 isoform X1 [Glycine 
max]
Length=378

 Score =   315 bits (807),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAPFRGYLRRMF+ESVPT+KF GLAWLFLGVANTDSL
Sbjct  216  GKIMLLPEDDPNATHIMIATGTGVAPFRGYLRRMFLESVPTYKFGGLAWLFLGVANTDSL  275

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF+KYL D+ DNFRYDR LSREQKNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  276  LYDEEFSKYLNDYSDNFRYDRALSREQKNKNGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  335

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG SWE KLSQLKKNKQWHVEVY
Sbjct  336  CGLKGMMPGIQDTLKKVAEQRGESWEEKLSQLKKNKQWHVEVY  378



>ref|XP_004231567.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic 
[Solanum lycopersicum]
Length=374

 Score =   315 bits (807),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 152/163 (93%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE+NPNATHIMI TGTGVAPFRGYLRRMFMESVP  KFNGLAWLFLGVANTDSL
Sbjct  213  GKIMLLPENNPNATHIMIGTGTGVAPFRGYLRRMFMESVP-MKFNGLAWLFLGVANTDSL  271

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYL D+P NFRYDR LSREQKN  GGKMYVQDKIEEYSDEIFKLLDEGAHIYF
Sbjct  272  LYDDEFTKYLNDYPGNFRYDRALSREQKNNKGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  331

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SWE KLSQLKKNKQWHVEVY
Sbjct  332  CGLKGMMPGIQDTLKRVAEERGESWEQKLSQLKKNKQWHVEVY  374



>ref|XP_006363650.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic-like 
[Solanum tuberosum]
Length=374

 Score =   315 bits (806),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 152/163 (93%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE+NPNATHIMI TGTGVAPFRGYLRRMFMESVP  KFNGLAWLFLGVANTDSL
Sbjct  213  GKIMLLPENNPNATHIMIGTGTGVAPFRGYLRRMFMESVP-MKFNGLAWLFLGVANTDSL  271

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYL D+P NFRYDR LSREQKN  GGKMYVQDKIEEYSDEIFKLLDEGAHIYF
Sbjct  272  LYDDEFTKYLNDYPGNFRYDRALSREQKNNKGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  331

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SWE KLSQLKKNKQWHVEVY
Sbjct  332  CGLKGMMPGIQDTLKRVAEERGESWEQKLSQLKKNKQWHVEVY  374



>ref|XP_010529363.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic 
[Tarenaya hassleriana]
Length=377

 Score =   315 bits (806),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPE+NPNATHIMIATGTGVAPFRGYLRRMFME+VP F+FNGLAWLFLGVAN+DSL
Sbjct  215  GKVMLLPEENPNATHIMIATGTGVAPFRGYLRRMFMENVPNFRFNGLAWLFLGVANSDSL  274

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YL D+PDNFRYD+ LSREQ+NK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  275  LYDEEFTNYLNDYPDNFRYDKALSREQQNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  334

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SWE KLSQLKKNKQWHVEVY
Sbjct  335  CGLKGMMPGIQDTLKRVAEERGESWEEKLSQLKKNKQWHVEVY  377



>ref|XP_004293987.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=380

 Score =   315 bits (806),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPEDNPNATHIMIATGTGVAP+RGYLRRMFME+VPTFKF GLAWLFLGVANTDSL
Sbjct  218  GKIMLLPEDNPNATHIMIATGTGVAPYRGYLRRMFMEAVPTFKFGGLAWLFLGVANTDSL  277

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF+KYL+D+PDNFRYD  LSRE KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  278  LYDEEFSKYLKDYPDNFRYDIALSREHKNKRGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  337

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQ+TLKRVAEERG SWE KLSQLKKNKQWHVEVY
Sbjct  338  CGLKGMMPGIQETLKRVAEERGESWEEKLSQLKKNKQWHVEVY  380



>gb|EAZ02773.1| hypothetical protein OsI_24896 [Oryza sativa Indica Group]
Length=379

 Score =   315 bits (806),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAP+RGYLRRMFME VP+FKF GLAWLFLGVANTDSL
Sbjct  217  GKIMLLPEDDPNATHIMIATGTGVAPYRGYLRRMFMEDVPSFKFGGLAWLFLGVANTDSL  276

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YLQ +PDNFRYD+ LSREQKNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  277  LYDEEFTNYLQQYPDNFRYDKALSREQKNKNGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  336

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAE+RG SWE KLSQLKKNKQWHVEVY
Sbjct  337  CGLKGMMPGIQDTLKRVAEQRGESWEQKLSQLKKNKQWHVEVY  379



>ref|XP_007147485.1| hypothetical protein PHAVU_006G128400g [Phaseolus vulgaris]
 gb|ESW19479.1| hypothetical protein PHAVU_006G128400g [Phaseolus vulgaris]
Length=377

 Score =   314 bits (805),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE++PNATHIMIATGTGVAPFRGYLRRMFMESVPT+KF GLAWLFLGVAN+DSL
Sbjct  215  GKIMLLPEEDPNATHIMIATGTGVAPFRGYLRRMFMESVPTYKFGGLAWLFLGVANSDSL  274

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF+KYL+D+P+NFR+DR LSREQKNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  275  LYDDEFSKYLKDYPNNFRFDRALSREQKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  334

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGL+GMMPGIQDTLKRVAE+RG SWE KLSQLKKNKQWHVEVY
Sbjct  335  CGLRGMMPGIQDTLKRVAEQRGESWEEKLSQLKKNKQWHVEVY  377



>ref|XP_009397390.1| PREDICTED: ferredoxin--NADP reductase, embryo isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=379

 Score =   314 bits (805),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE++PNATHIMIATGTGVAPFRGYLRRMFME+V T+KF GLAWLFLGVAN+DSL
Sbjct  217  GKIMLLPEEDPNATHIMIATGTGVAPFRGYLRRMFMEAVATYKFGGLAWLFLGVANSDSL  276

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF  YL+D+PDNFRYD+ LSREQKNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  277  LYDDEFTGYLKDYPDNFRYDKALSREQKNKNGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  336

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SW+TKLSQLKKNKQWHVEVY
Sbjct  337  CGLKGMMPGIQDTLKRVAEERGESWDTKLSQLKKNKQWHVEVY  379



>ref|XP_009614066.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic 
[Nicotiana tomentosiformis]
Length=375

 Score =   314 bits (804),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 152/163 (93%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE+NPNATHIMI TGTGVAPFRGYLRRMFMESVPT KFNGLAWLFLGVANTDSL
Sbjct  214  GKIMLLPEENPNATHIMIGTGTGVAPFRGYLRRMFMESVPT-KFNGLAWLFLGVANTDSL  272

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYL D+P NFRYDR LSREQKN  GGKMYVQDKIEEYSDEIFKLLDEGAHIYF
Sbjct  273  LYDDEFTKYLNDYPGNFRYDRALSREQKNNKGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  332

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAE RG SWE KLSQLKKNKQWHVEVY
Sbjct  333  CGLKGMMPGIQDTLKRVAERRGESWEQKLSQLKKNKQWHVEVY  375



>ref|XP_009761528.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic 
[Nicotiana sylvestris]
Length=375

 Score =   313 bits (802),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 151/163 (93%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPEDNPNA HIMI TGTGVAPFRGYLRRMFMESVPT KFNGLAWLFLGVANTDSL
Sbjct  214  GKIMLLPEDNPNAKHIMIGTGTGVAPFRGYLRRMFMESVPT-KFNGLAWLFLGVANTDSL  272

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYL D+P NFRYDR LSREQKN  GGKMYVQDKIEEYSDEIFKLLDEGAHIYF
Sbjct  273  LYDDEFTKYLNDYPGNFRYDRALSREQKNNKGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  332

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAE RG SWE KLSQLKKNKQWHVEVY
Sbjct  333  CGLKGMMPGIQDTLKRVAEARGESWEQKLSQLKKNKQWHVEVY  375



>ref|XP_004486455.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Cicer arietinum]
Length=377

 Score =   312 bits (799),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAP+RGYLRRMFMESVP FKF GLAWLFLGVAN+DSL
Sbjct  215  GKIMLLPEDDPNATHIMIATGTGVAPYRGYLRRMFMESVPKFKFGGLAWLFLGVANSDSL  274

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYL D+P+NFRYDR LSREQ+NKNGGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  275  LYDDEFTKYLNDYPNNFRYDRALSREQQNKNGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  334

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQ TLKRVAEERG SWE KLS LKKNKQWHVEVY
Sbjct  335  CGLKGMMPGIQGTLKRVAEERGESWEEKLSLLKKNKQWHVEVY  377



>ref|XP_006344529.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic-like 
[Solanum tuberosum]
Length=374

 Score =   312 bits (799),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 151/163 (93%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPEDN NATHIMI TGTGVAPFRGYLRRMFMESVP  KFNGLAWLFLGVANTDSL
Sbjct  213  GKIMLLPEDNLNATHIMIGTGTGVAPFRGYLRRMFMESVP-IKFNGLAWLFLGVANTDSL  271

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYL D+P NFRYDR LSREQKN  GGKMYVQDKIEEYSDEIFKLLDEGAHIYF
Sbjct  272  LYDDEFTKYLSDYPGNFRYDRALSREQKNNKGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  331

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SWE KLSQLKKNKQWHVEVY
Sbjct  332  CGLKGMMPGIQDTLKRVAEERGESWEQKLSQLKKNKQWHVEVY  374



>emb|CDY39167.1| BnaC09g21770D [Brassica napus]
Length=378

 Score =   311 bits (796),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPE++P ATHIMIATGTGVAPFRGYLRRMFME VPTFKF+GLAWLFLGVAN+DSL
Sbjct  216  GKVMLLPEEDPKATHIMIATGTGVAPFRGYLRRMFMEDVPTFKFDGLAWLFLGVANSDSL  275

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF+ YL+D+P+NFRYD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD+GAHIYF
Sbjct  276  LYDEEFSSYLKDYPENFRYDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDDGAHIYF  335

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SWE KLSQL+KNKQWHVEVY
Sbjct  336  CGLKGMMPGIQDTLKRVAEERGESWEQKLSQLRKNKQWHVEVY  378



>ref|XP_011096684.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic-like 
[Sesamum indicum]
Length=401

 Score =   311 bits (797),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKF GLAWLFLGVAN DSL
Sbjct  239  GKIMLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFGGLAWLFLGVANGDSL  298

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF+KYL++ PDNFRYDR LSREQKN++GGKMYVQDKIEEYSDEIF+LLD GAHIYF
Sbjct  299  LYDEEFSKYLRENPDNFRYDRALSREQKNRSGGKMYVQDKIEEYSDEIFRLLDGGAHIYF  358

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  359  CGLKGMMPGIQDTLKKVAEQRGESWDEKLSQLKKNKQWHVEVY  401



>sp|O04397.1|FENR2_TOBAC RecName: Full=Ferredoxin--NADP reductase, root-type isozyme, 
chloroplastic; Short=FNR; Flags: Precursor [Nicotiana tabacum]
 dbj|BAA20365.1| ferredoxin-NADP oxidoreductase [Nicotiana tabacum]
Length=375

 Score =   310 bits (794),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 151/163 (93%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE+ PNATHIMI TGTGVAPFRGYLRRMFMESVPT KFNGLAWLFLGVANTDSL
Sbjct  214  GKIMLLPEEIPNATHIMIGTGTGVAPFRGYLRRMFMESVPT-KFNGLAWLFLGVANTDSL  272

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYL D+P NFRYDR LSREQKN  GGKMYVQDKIEEYSDEIFKLLDEGAHIYF
Sbjct  273  LYDDEFTKYLNDYPGNFRYDRALSREQKNNKGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  332

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAE RG SWE KLSQLKKNKQWHVEVY
Sbjct  333  CGLKGMMPGIQDTLKRVAERRGESWEQKLSQLKKNKQWHVEVY  375



>ref|NP_001132762.1| uncharacterized protein LOC100194249 [Zea mays]
 gb|ACF81748.1| unknown [Zea mays]
 tpg|DAA59536.1| TPA: ferredoxin--NADP reductase [Zea mays]
Length=381

 Score =   310 bits (793),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAP+RGYLRRMFME VPTFKF GLAWLFLGVAN+DSL
Sbjct  219  GKIMLLPEDDPNATHIMIATGTGVAPYRGYLRRMFMEDVPTFKFGGLAWLFLGVANSDSL  278

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YLQ +PDNFRYD+ LSREQKNK+GGKMYVQDKIEEYSDEIF+LLD GAHIYF
Sbjct  279  LYDEEFTNYLQQYPDNFRYDKALSREQKNKSGGKMYVQDKIEEYSDEIFRLLDGGAHIYF  338

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  339  CGLKGMMPGIQDTLKKVAEQRGESWDQKLSQLKKNKQWHVEVY  381



>ref|XP_009344407.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Pyrus x bretschneideri]
Length=379

 Score =   310 bits (793),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPEDNPNATHIMIATGTG+AP+RGYLRRMFMESVP FKF GLAWLFLGVANTDSL
Sbjct  217  GKIMLLPEDNPNATHIMIATGTGIAPYRGYLRRMFMESVPKFKFGGLAWLFLGVANTDSL  276

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF KYL+D+PDNFRYD  LSREQKN+ GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  277  LYDEEFTKYLKDYPDNFRYDIALSREQKNQRGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  336

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQ+TLKRVA ERG SWE KLSQLKKNKQWHVEVY
Sbjct  337  CGLKGMMPGIQETLKRVAVERGESWEEKLSQLKKNKQWHVEVY  379



>ref|XP_009397718.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=379

 Score =   310 bits (793),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE +PNATHIMIATGTGVAPFRGYLRRMFME+V T+KF GLAWLFLGVANTDSL
Sbjct  217  GKIMLLPEGDPNATHIMIATGTGVAPFRGYLRRMFMEAVTTYKFGGLAWLFLGVANTDSL  276

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD EF+ YL+D+PDNFRYD+ LSREQKNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  277  LYDAEFSSYLKDYPDNFRYDKALSREQKNKNGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  336

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAE+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  337  CGLKGMMPGIQDTLKRVAEQRGESWDAKLSQLKKNKQWHVEVY  379



>gb|ACG35047.1| ferredoxin--NADP reductase, embryo isozyme [Zea mays]
Length=381

 Score =   310 bits (793),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAP+RGYLRRMFME VPTFKF GLAWLFLGVAN+DSL
Sbjct  219  GKIMLLPEDDPNATHIMIATGTGVAPYRGYLRRMFMEDVPTFKFGGLAWLFLGVANSDSL  278

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YLQ +PDNFRYD+ LSREQKNK+GGKMYVQDKIEEYSDEIF+LLD GAHIYF
Sbjct  279  LYDEEFTNYLQQYPDNFRYDKALSREQKNKSGGKMYVQDKIEEYSDEIFRLLDGGAHIYF  338

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  339  CGLKGMMPGIQDTLKKVAEQRGESWDQKLSQLKKNKQWHVEVY  381



>ref|XP_006658277.1| PREDICTED: ferredoxin--NADP reductase, embryo isozyme, chloroplastic-like 
[Oryza brachyantha]
Length=368

 Score =   309 bits (792),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAP+RGYLRRMFME VPTFKF GLAWLFLGVANTDSL
Sbjct  206  GKIMLLPEDDPNATHIMIATGTGVAPYRGYLRRMFMEDVPTFKFGGLAWLFLGVANTDSL  265

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YLQ +P+NFRYD+ LSREQ NKNGGKMYVQDKIEEYSDEIFKLLD  AHIYF
Sbjct  266  LYDEEFTNYLQQYPNNFRYDKALSREQNNKNGGKMYVQDKIEEYSDEIFKLLDGSAHIYF  325

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAE+RG SWE KLSQLKKNKQWHVEVY
Sbjct  326  CGLKGMMPGIQDTLKRVAEQRGESWEQKLSQLKKNKQWHVEVY  368



>ref|XP_009114485.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic 
[Brassica rapa]
Length=378

 Score =   309 bits (792),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPE++P ATHIMIATGTGVAPFRGYLRRMFME VPTFKF+GLAWLFLGVAN+DSL
Sbjct  216  GKVMLLPEEDPKATHIMIATGTGVAPFRGYLRRMFMEDVPTFKFDGLAWLFLGVANSDSL  275

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF+ YL+D+P+NFRYD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  276  LYDEEFSSYLKDYPENFRYDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  335

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SWE KL+QL+KNKQWHVEVY
Sbjct  336  CGLKGMMPGIQDTLKRVAEERGESWEQKLTQLRKNKQWHVEVY  378



>ref|XP_010537869.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic 
[Tarenaya hassleriana]
Length=378

 Score =   309 bits (791),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAP+RGYLRRMFME VP F+FNGLAWLFLGVAN+DSL
Sbjct  216  GKIMLLPEDDPNATHIMIATGTGVAPYRGYLRRMFMEDVPNFRFNGLAWLFLGVANSDSL  275

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  Y +++PDNFRYD+ LSREQ+NK GGKMYVQDKIEEYSDEIFKLLD+GAHIYF
Sbjct  276  LYDEEFTNYRKNYPDNFRYDKALSREQQNKKGGKMYVQDKIEEYSDEIFKLLDDGAHIYF  335

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SWE KLSQLKKNKQWHVEVY
Sbjct  336  CGLKGMMPGIQDTLKRVAEERGESWEQKLSQLKKNKQWHVEVY  378



>gb|AGT15976.1| ferredoxin--NADP reductase [Saccharum hybrid cultivar R570]
Length=377

 Score =   309 bits (791),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+P  THIMIATGTGVAP+RGYLRRMFME VPTFKF GLAWLFLGVAN+DSL
Sbjct  215  GKIMLLPEDDPKVTHIMIATGTGVAPYRGYLRRMFMEDVPTFKFGGLAWLFLGVANSDSL  274

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YLQ +PDNFRYD+ LSREQKNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  275  LYDEEFTNYLQQYPDNFRYDKALSREQKNKNGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  334

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAE+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  335  CGLKGMMPGIQDTLKRVAEQRGESWDQKLSQLKKNKQWHVEVY  377



>ref|XP_008383404.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Malus domestica]
Length=379

 Score =   309 bits (791),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPEDNPNATHIMIATGTGVAP+RGYLRRMFMESVP FKF GLAWLFLGVANTDSL
Sbjct  217  GKIMLLPEDNPNATHIMIATGTGVAPYRGYLRRMFMESVPKFKFGGLAWLFLGVANTDSL  276

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF KYL+D+PDNFRY+  LSREQKN+ GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  277  LYDEEFTKYLKDYPDNFRYNIALSREQKNQRGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  336

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQ+TLKRVA ERG SWE KLSQLKKNKQWHVEVY
Sbjct  337  CGLKGMMPGIQETLKRVAVERGESWEEKLSQLKKNKQWHVEVY  379



>ref|XP_008650954.1| PREDICTED: uncharacterized protein LOC100194249 isoform X1 [Zea 
mays]
Length=396

 Score =   310 bits (793),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAP+RGYLRRMFME VPTFKF GLAWLFLGVAN+DSL
Sbjct  234  GKIMLLPEDDPNATHIMIATGTGVAPYRGYLRRMFMEDVPTFKFGGLAWLFLGVANSDSL  293

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YLQ +PDNFRYD+ LSREQKNK+GGKMYVQDKIEEYSDEIF+LLD GAHIYF
Sbjct  294  LYDEEFTNYLQQYPDNFRYDKALSREQKNKSGGKMYVQDKIEEYSDEIFRLLDGGAHIYF  353

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  354  CGLKGMMPGIQDTLKKVAEQRGESWDQKLSQLKKNKQWHVEVY  396



>emb|CDY46362.1| BnaA09g19760D [Brassica napus]
Length=378

 Score =   309 bits (791),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPE++P ATHIMIATGTGVAPFRGYLRRMFME VPTFKF+GLAWLFLGVAN+DSL
Sbjct  216  GKVMLLPEEDPKATHIMIATGTGVAPFRGYLRRMFMEDVPTFKFDGLAWLFLGVANSDSL  275

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF+ YL+D+P+NFRYD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  276  LYDEEFSSYLKDYPENFRYDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  335

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SWE KL+QL+KNKQWHVEVY
Sbjct  336  CGLKGMMPGIQDTLKRVAEERGESWEQKLTQLRKNKQWHVEVY  378



>ref|XP_004955449.1| PREDICTED: ferredoxin--NADP reductase, embryo isozyme, chloroplastic-like 
[Setaria italica]
Length=380

 Score =   309 bits (791),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKILLLPED+PNATHIMIATGTGVAP+RGYLRRMFME VP +KF GLAWLFLGVAN+DSL
Sbjct  218  GKILLLPEDDPNATHIMIATGTGVAPYRGYLRRMFMEDVPAYKFGGLAWLFLGVANSDSL  277

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YLQ +PDNFRYD+ LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  278  LYDEEFTTYLQQYPDNFRYDKALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  337

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAE+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  338  CGLKGMMPGIQDTLKRVAEQRGESWDQKLSQLKKNKQWHVEVY  380



>ref|XP_009362229.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Pyrus x bretschneideri]
Length=377

 Score =   308 bits (790),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAP+RGYLRRMFMESVP FKF GLAWLFLGVANTDSL
Sbjct  215  GKIMLLPEDDPNATHIMIATGTGVAPYRGYLRRMFMESVPKFKFGGLAWLFLGVANTDSL  274

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF KYL+D+PDNFRYD  LSREQKN+ GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  275  LYDEEFTKYLKDYPDNFRYDIALSREQKNQRGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  334

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQ+TLKRVA ERG SWE KLSQLKKNKQWHVEVY
Sbjct  335  CGLKGMMPGIQETLKRVAVERGESWEEKLSQLKKNKQWHVEVY  377



>ref|XP_006415462.1| hypothetical protein EUTSA_v10007919mg [Eutrema salsugineum]
 gb|ESQ33815.1| hypothetical protein EUTSA_v10007919mg [Eutrema salsugineum]
Length=382

 Score =   308 bits (790),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPE++PNATHIMIATGTGVAP+RGYLRRMFME+VP FKF GLAWLFLGVANTDSL
Sbjct  220  GKVMLLPENDPNATHIMIATGTGVAPYRGYLRRMFMENVPNFKFGGLAWLFLGVANTDSL  279

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF+KYL+D P+NFR+D+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  280  LYDDEFSKYLKDHPENFRFDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  339

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SW+ KLSQL+KNKQWHVEVY
Sbjct  340  CGLKGMMPGIQDTLKRVAEERGESWDLKLSQLRKNKQWHVEVY  382



>ref|XP_006415461.1| hypothetical protein EUTSA_v10007919mg [Eutrema salsugineum]
 gb|ESQ33814.1| hypothetical protein EUTSA_v10007919mg [Eutrema salsugineum]
Length=381

 Score =   308 bits (790),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPE++PNATHIMIATGTGVAP+RGYLRRMFME+VP FKF GLAWLFLGVANTDSL
Sbjct  219  GKVMLLPENDPNATHIMIATGTGVAPYRGYLRRMFMENVPNFKFGGLAWLFLGVANTDSL  278

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF+KYL+D P+NFR+D+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  279  LYDDEFSKYLKDHPENFRFDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  338

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SW+ KLSQL+KNKQWHVEVY
Sbjct  339  CGLKGMMPGIQDTLKRVAEERGESWDLKLSQLRKNKQWHVEVY  381



>emb|CDY02299.1| BnaA09g26030D [Brassica napus]
Length=382

 Score =   308 bits (790),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPE++PNATHIMIATGTGVAP+RGYLRR+FME+VP +KF GLAWLFLGVANTDSL
Sbjct  220  GKVMLLPENDPNATHIMIATGTGVAPYRGYLRRLFMENVPNYKFGGLAWLFLGVANTDSL  279

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF+KYL+D PDNFR+D+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  280  LYDDEFSKYLKDHPDNFRFDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  339

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SW+ KLSQL+KNKQWHVEVY
Sbjct  340  CGLKGMMPGIQDTLKRVAEERGESWDAKLSQLRKNKQWHVEVY  382



>emb|CDY09570.1| BnaC05g23490D [Brassica napus]
Length=382

 Score =   308 bits (790),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPE++PNATHIMIATGTGVAP+RGYLRR+FME+VP +KF GLAWLFLGVANTDSL
Sbjct  220  GKVMLLPENDPNATHIMIATGTGVAPYRGYLRRLFMENVPNYKFGGLAWLFLGVANTDSL  279

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF+KYL+D PDNFR+D+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  280  LYDDEFSKYLKDHPDNFRFDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  339

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SW+ KLSQL+KNKQWHVEVY
Sbjct  340  CGLKGMMPGIQDTLKRVAEERGESWDAKLSQLRKNKQWHVEVY  382



>ref|XP_010247806.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Nelumbo nucifera]
Length=377

 Score =   308 bits (788),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAP+RGYLRRMFMES+P FKF GLAWLFLGVANTDSL
Sbjct  215  GKIMLLPEDDPNATHIMIATGTGVAPYRGYLRRMFMESIPNFKFGGLAWLFLGVANTDSL  274

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF  YLQD+PD+FRYD  LSREQKNK GGKMYVQDKIEEYSDEIFKLLD+GAHIYF
Sbjct  275  LYDDEFRMYLQDYPDHFRYDLALSREQKNKRGGKMYVQDKIEEYSDEIFKLLDKGAHIYF  334

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQ+TLKRVAEERG  WE KL QLKKNKQWHVEVY
Sbjct  335  CGLKGMMPGIQETLKRVAEERGEIWEEKLPQLKKNKQWHVEVY  377



>gb|KFK32212.1| hypothetical protein AALP_AA6G212100 [Arabis alpina]
Length=377

 Score =   308 bits (788),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED P ATHIMIATGTGVAPFRGYLRRMFME+VP FKF+GL+WLFLGVAN+DSL
Sbjct  215  GKIMLLPEDAPKATHIMIATGTGVAPFRGYLRRMFMENVPNFKFDGLSWLFLGVANSDSL  274

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EFA YL+D+PDNFRYD+ LSRE+KN+ GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  275  LYDEEFAGYLKDYPDNFRYDKALSREEKNQKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  334

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SWE KL+QL+KNKQWHVEVY
Sbjct  335  CGLKGMMPGIQDTLKRVAEERGESWEQKLTQLRKNKQWHVEVY  377



>ref|XP_010907336.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=360

 Score =   307 bits (786),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPED+PNATHIM+ATGTGVAPFR YLRRMFME VPT+KF GLAWLFLGVANTDSL
Sbjct  198  GKVMLLPEDDPNATHIMMATGTGVAPFRAYLRRMFMEDVPTYKFGGLAWLFLGVANTDSL  257

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEFA YL+D+PDNFRYD+ LSREQKNK GGKMYVQDKIEEYSDEIF+LLDEGAHIYF
Sbjct  258  LYDDEFAGYLRDYPDNFRYDKALSREQKNKRGGKMYVQDKIEEYSDEIFRLLDEGAHIYF  317

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAE+RG +W+ KLSQL+K KQWHVEVY
Sbjct  318  CGLKGMMPGIQDTLKRVAEQRGENWDEKLSQLRKKKQWHVEVY  360



>dbj|BAA02248.1| ferredoxin-NADP+ reductase enzyme [Oryza sativa Japonica Group]
Length=317

 Score =   305 bits (782),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE++PNATHIMIATGTGVAPFRGYLRRMFME VP ++F GLAWLFLGVANTDSL
Sbjct  155  GKIMLLPEEDPNATHIMIATGTGVAPFRGYLRRMFMEDVPKYRFGGLAWLFLGVANTDSL  214

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YL+ +PDNFRYD+ LSREQKNKN GKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  215  LYDEEFTSYLKQYPDNFRYDKALSREQKNKNAGKMYVQDKIEEYSDEIFKLLDGGAHIYF  274

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG SWE KLSQLKKNKQWHVEVY
Sbjct  275  CGLKGMMPGIQDTLKKVAEQRGESWEQKLSQLKKNKQWHVEVY  317



>ref|XP_010907335.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=379

 Score =   307 bits (787),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPED+PNATHIM+ATGTGVAPFR YLRRMFME VPT+KF GLAWLFLGVANTDSL
Sbjct  217  GKVMLLPEDDPNATHIMMATGTGVAPFRAYLRRMFMEDVPTYKFGGLAWLFLGVANTDSL  276

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEFA YL+D+PDNFRYD+ LSREQKNK GGKMYVQDKIEEYSDEIF+LLDEGAHIYF
Sbjct  277  LYDDEFAGYLRDYPDNFRYDKALSREQKNKRGGKMYVQDKIEEYSDEIFRLLDEGAHIYF  336

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAE+RG +W+ KLSQL+K KQWHVEVY
Sbjct  337  CGLKGMMPGIQDTLKRVAEQRGENWDEKLSQLRKKKQWHVEVY  379



>ref|XP_002461452.1| hypothetical protein SORBIDRAFT_02g002900 [Sorghum bicolor]
 gb|EER97973.1| hypothetical protein SORBIDRAFT_02g002900 [Sorghum bicolor]
Length=381

 Score =   307 bits (787),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+P ATHIMIATGTGVAP+RGYLRRMFME VPTFKF GLAWLFLGVAN+DSL
Sbjct  219  GKIMLLPEDDPKATHIMIATGTGVAPYRGYLRRMFMEDVPTFKFGGLAWLFLGVANSDSL  278

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YLQ +P NFRYD+ LSREQKNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  279  LYDEEFTNYLQQYPYNFRYDKALSREQKNKNGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  338

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAE+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  339  CGLKGMMPGIQDTLKRVAEQRGESWDQKLSQLKKNKQWHVEVY  381



>ref|NP_001051476.1| Os03g0784700 [Oryza sativa Japonica Group]
 sp|P41345.1|FENR2_ORYSJ RecName: Full=Ferredoxin--NADP reductase, root isozyme, chloroplastic; 
Short=FNR; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAK72892.1|AC091123_11 ferredoxin-NADP+ reductase [Oryza sativa Japonica Group]
 dbj|BAA04232.1| ferredoxin-NADP+ reductase [Oryza sativa Japonica Group]
 dbj|BAA07479.1| root ferredoxin-NADP+ reductase [Oryza sativa Japonica Group]
 gb|ABF99220.1| Ferredoxin-NADP reductase, root isozyme, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13390.1| Os03g0784700 [Oryza sativa Japonica Group]
 gb|EAY92083.1| hypothetical protein OsI_13788 [Oryza sativa Indica Group]
 gb|EAZ28818.1| hypothetical protein OsJ_12850 [Oryza sativa Japonica Group]
 dbj|BAG96344.1| unnamed protein product [Oryza sativa Japonica Group]
 prf||2113196A ferredoxin-NADP oxidoreductase
Length=378

 Score =   307 bits (786),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE++PNATHIMIATGTGVAPFRGYLRRMFME VP ++F GLAWLFLGVANTDSL
Sbjct  216  GKIMLLPEEDPNATHIMIATGTGVAPFRGYLRRMFMEDVPKYRFGGLAWLFLGVANTDSL  275

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YL+ +PDNFRYD+ LSREQKNKN GKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  276  LYDEEFTSYLKQYPDNFRYDKALSREQKNKNAGKMYVQDKIEEYSDEIFKLLDGGAHIYF  335

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG SWE KLSQLKKNKQWHVEVY
Sbjct  336  CGLKGMMPGIQDTLKKVAEQRGESWEQKLSQLKKNKQWHVEVY  378



>ref|XP_006650686.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Oryza brachyantha]
Length=378

 Score =   306 bits (785),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE++PNATHIMIATGTGVAP+RGYLRRMFME VP +KF GLAWLFLGVANTDSL
Sbjct  216  GKIMLLPEEDPNATHIMIATGTGVAPYRGYLRRMFMEDVPKYKFGGLAWLFLGVANTDSL  275

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YL+ +PDNFRYD+ LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  276  LYDEEFTSYLKQYPDNFRYDKALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  335

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG SWE KLSQLKKNKQWHVEVY
Sbjct  336  CGLKGMMPGIQDTLKKVAEQRGESWEQKLSQLKKNKQWHVEVY  378



>ref|XP_008346149.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Malus domestica]
Length=377

 Score =   306 bits (785),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAP+RGYLRRMFMESVP FKF GLAWLFLGVAN DSL
Sbjct  215  GKIMLLPEDDPNATHIMIATGTGVAPYRGYLRRMFMESVPKFKFGGLAWLFLGVANIDSL  274

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF KYL+D+PDNFRYD  LSREQKN+ GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  275  LYDEEFTKYLKDYPDNFRYDIALSREQKNQRGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  334

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQ+TLKRVA ERG SWE KLSQLKKNKQWHVEVY
Sbjct  335  CGLKGMMPGIQETLKRVAVERGESWEEKLSQLKKNKQWHVEVY  377



>ref|XP_009115136.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 2, chloroplastic 
[Brassica rapa]
Length=382

 Score =   306 bits (785),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPE++PNATHIMIATGTGVAP+RGYLRR+FME+VP +KF GLAWLFLGVANTDSL
Sbjct  220  GKVMLLPENDPNATHIMIATGTGVAPYRGYLRRLFMENVPNYKFGGLAWLFLGVANTDSL  279

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF+KYL+D PD+FR+D+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  280  LYDDEFSKYLKDHPDHFRFDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  339

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SW+ KLSQL+KNKQWHVEVY
Sbjct  340  CGLKGMMPGIQDTLKRVAEERGESWDAKLSQLRKNKQWHVEVY  382



>ref|XP_002263658.2| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Vitis vinifera]
 emb|CBI31015.3| unnamed protein product [Vitis vinifera]
Length=377

 Score =   306 bits (784),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAP+RGYLRRMFME VP+F+F GLAWLFLGVANTDSL
Sbjct  215  GKIMLLPEDDPNATHIMIATGTGVAPYRGYLRRMFMEDVPSFRFGGLAWLFLGVANTDSL  274

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF KYL+D+PD FRYD+ LSREQKN+NGGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  275  LYDNEFTKYLKDYPDQFRYDKALSREQKNRNGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  334

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQ+TLKRVA++RG +WE KL+QLKKNKQWHVEVY
Sbjct  335  CGLKGMMPGIQETLKRVADQRGENWEEKLAQLKKNKQWHVEVY  377



>gb|EMS52999.1| Ferredoxin--NADP reductase, embryo isozyme, chloroplastic [Triticum 
urartu]
Length=488

 Score =   310 bits (793),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMI TGTGVAPFRGYLRRMFME VP+FKF GLAWLFLGVANTDSL
Sbjct  326  GKIMLLPEDDPNATHIMIGTGTGVAPFRGYLRRMFMEDVPSFKFGGLAWLFLGVANTDSL  385

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YLQ +P+NFRYD+ LSREQKNK+GGKMYVQD+IEEYSDEIFKLLD+GAHIYF
Sbjct  386  LYDEEFTNYLQQYPENFRYDKALSREQKNKSGGKMYVQDRIEEYSDEIFKLLDDGAHIYF  445

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAE+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  446  CGLKGMMPGIQDTLKRVAEQRGESWDQKLSQLKKNKQWHVEVY  488



>gb|EMT31879.1| Ferredoxin--NADP reductase, embryo isozyme, chloroplastic [Aegilops 
tauschii]
Length=378

 Score =   306 bits (783),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMI TGTGVAPFRGYLRRMFME V +FKF GLAWLFLGVANTDSL
Sbjct  216  GKIMLLPEDDPNATHIMIGTGTGVAPFRGYLRRMFMEDVSSFKFGGLAWLFLGVANTDSL  275

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YLQ +P+NFRYD+ LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD+GAHIYF
Sbjct  276  LYDEEFTNYLQQYPENFRYDKALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDDGAHIYF  335

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAE+RG SW  KLSQLKKNKQWHVEVY
Sbjct  336  CGLKGMMPGIQDTLKRVAEQRGESWHQKLSQLKKNKQWHVEVY  378



>ref|XP_008796785.1| PREDICTED: ferredoxin--NADP reductase, embryo isozyme, chloroplastic 
[Phoenix dactylifera]
Length=160

 Score =   298 bits (762),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -3

Query  642  LLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYD  463
            +LLPED+PNATHIMIATGTGVAP+RGYLRRMFME+VPT+KF GLAWLFLGVANTDSLLYD
Sbjct  1    MLLPEDDPNATHIMIATGTGVAPYRGYLRRMFMEAVPTYKFGGLAWLFLGVANTDSLLYD  60

Query  462  DEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGL  283
            DEF  YL D+PDNFRYD+ LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGL
Sbjct  61   DEFTGYLHDYPDNFRYDKALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDRGAHIYFCGL  120

Query  282  KGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            KGMMPGIQDTLKRVA +RG +W+ KLSQL+K KQWHVEVY
Sbjct  121  KGMMPGIQDTLKRVAVQRGENWDEKLSQLRKKKQWHVEVY  160



>ref|XP_006396605.1| hypothetical protein EUTSA_v10028734mg [Eutrema salsugineum]
 gb|ESQ38058.1| hypothetical protein EUTSA_v10028734mg [Eutrema salsugineum]
Length=377

 Score =   305 bits (781),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPED+P ATHIMIATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSL
Sbjct  215  GKVMLLPEDDPKATHIMIATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSL  274

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EFA YL+D P+NFRYD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  275  LYDEEFAGYLKDNPENFRYDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  334

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SWE KL+QL+KNKQWHVEVY
Sbjct  335  CGLKGMMPGIQDTLKRVAEERGESWEKKLTQLRKNKQWHVEVY  377



>gb|AAM64825.1| ferredoxin--NADP+ reductase-like protein [Arabidopsis thaliana]
Length=378

 Score =   305 bits (781),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPED+P ATHIMIATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSL
Sbjct  216  GKVMLLPEDDPKATHIMIATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSL  275

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EFA Y +D+P+NFRYD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  276  LYDEEFAGYRKDYPENFRYDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  335

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SWE KL+QL+KNKQWHVEVY
Sbjct  336  CGLKGMMPGIQDTLKRVAEERGESWEQKLTQLRKNKQWHVEVY  378



>ref|NP_567293.1| ferredoxin--NADP reductase, root isozyme 1 [Arabidopsis thaliana]
 sp|Q9M0V6.2|FNRR1_ARATH RecName: Full=Ferredoxin--NADP reductase, root isozyme 1, chloroplastic; 
AltName: Full=Root FNR 1; Short=AtRFNR1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL61946.1| ferredoxin-NADP+ reductase-like protein [Arabidopsis thaliana]
 gb|AAM47928.1| ferredoxin-NADP+ reductase-like protein [Arabidopsis thaliana]
 gb|AEE82512.1| ferredoxin--NADP reductase, root isozyme 1 [Arabidopsis thaliana]
Length=378

 Score =   305 bits (781),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPED+P ATHIMIATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSL
Sbjct  216  GKVMLLPEDDPKATHIMIATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSL  275

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EFA Y +D+P+NFRYD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  276  LYDEEFAGYRKDYPENFRYDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  335

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SWE KL+QL+KNKQWHVEVY
Sbjct  336  CGLKGMMPGIQDTLKRVAEERGESWEQKLTQLRKNKQWHVEVY  378



>ref|XP_002874840.1| ATRFNR1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51099.1| ATRFNR1 [Arabidopsis lyrata subsp. lyrata]
Length=355

 Score =   304 bits (778),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPED+P ATHIMIATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSL
Sbjct  193  GKVMLLPEDDPKATHIMIATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSL  252

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YL+D+P+NF+YD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  253  LYDEEFTGYLKDYPENFKYDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  312

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SWE KL+QL+KNKQWHVEVY
Sbjct  313  CGLKGMMPGIQDTLKRVAEERGESWEQKLTQLRKNKQWHVEVY  355



>emb|CAB81081.1| ferredoxin--NADP+ reductase-like protein [Arabidopsis thaliana]
Length=360

 Score =   304 bits (779),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPED+P ATHIMIATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSL
Sbjct  198  GKVMLLPEDDPKATHIMIATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSL  257

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EFA Y +D+P+NFRYD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  258  LYDEEFAGYRKDYPENFRYDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  317

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SWE KL+QL+KNKQWHVEVY
Sbjct  318  CGLKGMMPGIQDTLKRVAEERGESWEQKLTQLRKNKQWHVEVY  360



>ref|NP_001190682.1| ferredoxin--NADP reductase, root isozyme 1 [Arabidopsis thaliana]
 gb|AEE82513.1| ferredoxin--NADP reductase, root isozyme 1 [Arabidopsis thaliana]
Length=350

 Score =   304 bits (778),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPED+P ATHIMIATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSL
Sbjct  188  GKVMLLPEDDPKATHIMIATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSL  247

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EFA Y +D+P+NFRYD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  248  LYDEEFAGYRKDYPENFRYDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  307

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SWE KL+QL+KNKQWHVEVY
Sbjct  308  CGLKGMMPGIQDTLKRVAEERGESWEQKLTQLRKNKQWHVEVY  350



>ref|XP_007211443.1| hypothetical protein PRUPE_ppa007232mg [Prunus persica]
 gb|EMJ12642.1| hypothetical protein PRUPE_ppa007232mg [Prunus persica]
Length=377

 Score =   305 bits (780),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPEDNPNATHIMIATGTGVAP+RGYLRRMFMESVP FKF GLAWLFLGVANTDSL
Sbjct  215  GKIMLLPEDNPNATHIMIATGTGVAPYRGYLRRMFMESVPKFKFGGLAWLFLGVANTDSL  274

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF KYL+D+PDNFRYD  LSRE KN  GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  275  LYDEEFTKYLKDYPDNFRYDIALSREHKNNRGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  334

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGL+GMMPGIQ+TLKRVA+ RG +WE KLSQLKKNKQWHVEVY
Sbjct  335  CGLRGMMPGIQETLKRVADGRGENWEEKLSQLKKNKQWHVEVY  377



>ref|XP_010691939.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=376

 Score =   304 bits (778),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 152/163 (93%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPED PNATHIMIATGTGVAP+RGYLRRMFME VPT+KF GLAWLFLGVANTDSL
Sbjct  215  GKVMLLPED-PNATHIMIATGTGVAPYRGYLRRMFMEDVPTYKFKGLAWLFLGVANTDSL  273

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYL+++PDNFRYD  LSREQ+NK GGKMYVQDKIEEYSDEIFK+LD GAHIYF
Sbjct  274  LYDDEFTKYLKEYPDNFRYDTALSREQQNKKGGKMYVQDKIEEYSDEIFKMLDNGAHIYF  333

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG  W+ KLSQLKKNKQWHVEVY
Sbjct  334  CGLKGMMPGIQDTLKRVAEERGEKWDEKLSQLKKNKQWHVEVY  376



>ref|XP_003558196.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Brachypodium distachyon]
Length=380

 Score =   304 bits (778),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAP+RGYLRRMFME VP ++F GLAWLFLGVAN+DSL
Sbjct  218  GKIMLLPEDDPNATHIMIATGTGVAPYRGYLRRMFMEDVPNYRFGGLAWLFLGVANSDSL  277

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YL+ +PDNFR+D+ LSREQKNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  278  LYDEEFTSYLKQYPDNFRFDKALSREQKNKNGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  337

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQ+TLK+VAE+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  338  CGLKGMMPGIQETLKKVAEQRGESWDQKLSQLKKNKQWHVEVY  380



>gb|AAM96978.1| ferredoxin--NADP+ reductase-like protein [Arabidopsis thaliana]
Length=378

 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPED+P ATHIMIATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSL
Sbjct  216  GKVMLLPEDDPKATHIMIATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSL  275

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EFA Y +D+P+NFRYD+ LSRE+KNK GGKMYVQDKIEEYS+EIFKLLD GAHIYF
Sbjct  276  LYDEEFAGYRKDYPENFRYDKALSREEKNKKGGKMYVQDKIEEYSNEIFKLLDNGAHIYF  335

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SWE KL+QL+KNKQWHVEVY
Sbjct  336  CGLKGMMPGIQDTLKRVAEERGESWEQKLTQLRKNKQWHVEVY  378



>ref|XP_008225595.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Prunus mume]
Length=377

 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPEDNPNATHIMIATGTGVAP+RGYLRRMFMESVP FKF GLAWLFLGVANTDSL
Sbjct  215  GKIMLLPEDNPNATHIMIATGTGVAPYRGYLRRMFMESVPKFKFGGLAWLFLGVANTDSL  274

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF KYL+D+PDNFRY+  LSRE KN  GGKMYVQDKIEEYSDEIFKLLD+GAHIYF
Sbjct  275  LYDEEFTKYLKDYPDNFRYNIALSREHKNNRGGKMYVQDKIEEYSDEIFKLLDDGAHIYF  334

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGL+GMMPGIQ+TLKRVA+ RG +WE KLSQLKKNKQWHVEVY
Sbjct  335  CGLRGMMPGIQETLKRVADGRGENWEEKLSQLKKNKQWHVEVY  377



>ref|NP_973942.1| ferredoxin--NADP reductase, root isozyme 2 [Arabidopsis thaliana]
 gb|AEE31235.1| ferredoxin--NADP reductase, root isozyme 2 [Arabidopsis thaliana]
Length=317

 Score =   300 bits (769),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPE +PNATHIMIATGTGVAP+RGYLRRMFME+VP   F+GLAWLFLGVANTDSL
Sbjct  155  GKVMLLPESDPNATHIMIATGTGVAPYRGYLRRMFMENVPNKTFSGLAWLFLGVANTDSL  214

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF KYL+D PDNFR+D+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  215  LYDEEFTKYLKDHPDNFRFDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  274

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SW+ KLSQL+KNKQWHVEVY
Sbjct  275  CGLKGMMPGIQDTLKRVAEERGESWDLKLSQLRKNKQWHVEVY  317



>ref|NP_564355.1| ferredoxin--NADP reductase, root isozyme 2 [Arabidopsis thaliana]
 gb|AEE31236.1| ferredoxin--NADP reductase, root isozyme 2 [Arabidopsis thaliana]
Length=381

 Score =   303 bits (775),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPE +PNATHIMIATGTGVAP+RGYLRRMFME+VP   F+GLAWLFLGVANTDSL
Sbjct  219  GKVMLLPESDPNATHIMIATGTGVAPYRGYLRRMFMENVPNKTFSGLAWLFLGVANTDSL  278

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF KYL+D PDNFR+D+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  279  LYDEEFTKYLKDHPDNFRFDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  338

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SW+ KLSQL+KNKQWHVEVY
Sbjct  339  CGLKGMMPGIQDTLKRVAEERGESWDLKLSQLRKNKQWHVEVY  381



>ref|NP_849734.1| ferredoxin--NADP reductase, root isozyme 2 [Arabidopsis thaliana]
 sp|Q9S9P8.1|FNRR2_ARATH RecName: Full=Ferredoxin--NADP reductase, root isozyme 2, chloroplastic; 
AltName: Full=Root FNR 2; Short=AtRFNR2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF19753.1|AC009917_12 Strong similarity to gi|3913653 Ferredoxin-NADP Reductase, Embryo 
Isozyme Precurser from Oryza sativa, containing an Oxidoreductase 
FAD/NAD-binding PF|00175 domain. ESTs gb|N38303, 
gb|T21235, gb|AA721819, gb|T44416, gb|AI995147, gb|H76681, gb|N65405, 
gb|F14270 come from this gene [Arabidopsis thaliana]
 gb|AAL11588.1|AF424594_1 At1g30510/F26G16_5 [Arabidopsis thaliana]
 gb|AAM98159.1| ferrodoxin NADP oxidoreductase, putative [Arabidopsis thaliana]
 gb|AAP37827.1| At1g30510 [Arabidopsis thaliana]
 gb|AEE31237.1| ferredoxin--NADP reductase, root isozyme 2 [Arabidopsis thaliana]
Length=382

 Score =   303 bits (775),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPE +PNATHIMIATGTGVAP+RGYLRRMFME+VP   F+GLAWLFLGVANTDSL
Sbjct  220  GKVMLLPESDPNATHIMIATGTGVAPYRGYLRRMFMENVPNKTFSGLAWLFLGVANTDSL  279

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF KYL+D PDNFR+D+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  280  LYDEEFTKYLKDHPDNFRFDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  339

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SW+ KLSQL+KNKQWHVEVY
Sbjct  340  CGLKGMMPGIQDTLKRVAEERGESWDLKLSQLRKNKQWHVEVY  382



>gb|EYU43232.1| hypothetical protein MIMGU_mgv1a008184mg [Erythranthe guttata]
Length=382

 Score =   303 bits (775),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE+NPN THIMIATGTGVAP+RGYLRRMF E++PTFKFNGLAWLFLGVAN DSL
Sbjct  220  GKIMLLPEENPNGTHIMIATGTGVAPYRGYLRRMFTENIPTFKFNGLAWLFLGVANKDSL  279

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF++YL+++PDNFR+DR LSREQ+N+NGGKMYVQD+IEEYSDEIF+LLD GAHIYF
Sbjct  280  LYDEEFSEYLRNYPDNFRFDRALSREQRNRNGGKMYVQDRIEEYSDEIFELLDSGAHIYF  339

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRV+E RG  W+ KL+QLKKNKQWHVEVY
Sbjct  340  CGLKGMMPGIQDTLKRVSETRGEKWDEKLTQLKKNKQWHVEVY  382



>gb|EMT16236.1| Ferredoxin--NADP reductase, root isozyme, chloroplastic [Aegilops 
tauschii]
Length=372

 Score =   302 bits (774),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE +PNATHIMIATGTGVAP+RGYLRRMFME VP F+F GLAWLFLGVAN+DSL
Sbjct  210  GKIMLLPESDPNATHIMIATGTGVAPYRGYLRRMFMEDVPNFRFGGLAWLFLGVANSDSL  269

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YL+ +PDNFR+D+ LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  270  LYDEEFTSYLKQYPDNFRFDKALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  329

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  330  CGLKGMMPGIQDTLKKVAEQRGESWDQKLSQLKKNKQWHVEVY  372



>pdb|1JB9|A Chain A, Crystal Structure Of The Ferredoxin:nadp+ Reductase 
From Maize Root At 1.7 Angstroms
Length=316

 Score =   300 bits (768),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE++PNATHIMIATGTGVAPFRGYLRRMFME VP ++F GLAWLFLGVAN+DSL
Sbjct  154  GKIMLLPEEDPNATHIMIATGTGVAPFRGYLRRMFMEDVPNYRFGGLAWLFLGVANSDSL  213

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YL+ +PDNFRYD+ LSREQKN++GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  214  LYDEEFTSYLKQYPDNFRYDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  273

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE RG SW+ KL+QLKKNKQWHVEVY
Sbjct  274  CGLKGMMPGIQDTLKKVAERRGESWDQKLAQLKKNKQWHVEVY  316



>gb|EMS61290.1| Ferredoxin--NADP reductase, root isozyme, chloroplastic [Triticum 
urartu]
Length=419

 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE +PNATHIMIATGTGVAP+RGYLRRMFME VP F+F GLAWLFLGVAN+DSL
Sbjct  257  GKIMLLPESDPNATHIMIATGTGVAPYRGYLRRMFMEDVPNFRFGGLAWLFLGVANSDSL  316

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YL+ +PDNFR+D+ LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  317  LYDEEFTSYLKQYPDNFRFDKALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  376

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  377  CGLKGMMPGIQDTLKKVAEQRGESWDQKLSQLKKNKQWHVEVY  419



>ref|XP_006287955.1| hypothetical protein CARUB_v10001191mg [Capsella rubella]
 gb|EOA20853.1| hypothetical protein CARUB_v10001191mg [Capsella rubella]
Length=375

 Score =   302 bits (774),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPED+  ATHIMIATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSL
Sbjct  213  GKVMLLPEDDQKATHIMIATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSL  272

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF+ YL+D+P NFRYD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  273  LYDEEFSSYLKDYPKNFRYDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  332

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SWE KL+QL+KNKQWHVEVY
Sbjct  333  CGLKGMMPGIQDTLKRVAEERGESWEQKLTQLRKNKQWHVEVY  375



>ref|XP_006287956.1| hypothetical protein CARUB_v10001191mg [Capsella rubella]
 gb|EOA20854.1| hypothetical protein CARUB_v10001191mg [Capsella rubella]
Length=377

 Score =   302 bits (773),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPED+  ATHIMIATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSL
Sbjct  215  GKVMLLPEDDQKATHIMIATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSL  274

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF+ YL+D+P NFRYD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  275  LYDEEFSSYLKDYPKNFRYDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  334

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SWE KL+QL+KNKQWHVEVY
Sbjct  335  CGLKGMMPGIQDTLKRVAEERGESWEQKLTQLRKNKQWHVEVY  377



>gb|AAB40034.1| ferredoxin-NADP reductase precursor [Zea mays]
Length=327

 Score =   300 bits (769),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE++PNATHIMIATGTGVAPFRGYLRRMFME VP ++F GLAWLFLGVAN+DSL
Sbjct  165  GKIMLLPEEDPNATHIMIATGTGVAPFRGYLRRMFMEDVPNYRFGGLAWLFLGVANSDSL  224

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YL+ +PDNFRYD+ LSREQKN++GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  225  LYDEEFTSYLKQYPDNFRYDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  284

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE RG SW+ KL+QLKKNKQWHVEVY
Sbjct  285  CGLKGMMPGIQDTLKKVAERRGESWDQKLAQLKKNKQWHVEVY  327



>ref|XP_010431473.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic 
isoform X2 [Camelina sativa]
Length=375

 Score =   302 bits (773),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPED+  ATHIMIATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSL
Sbjct  213  GKVMLLPEDDQKATHIMIATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSL  272

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF+ YL+D+P NFRYD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  273  LYDEEFSGYLKDYPKNFRYDKALSREEKNKTGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  332

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SWE KL+QL+KNKQWHVEVY
Sbjct  333  CGLKGMMPGIQDTLKRVAEERGESWEQKLTQLRKNKQWHVEVY  375



>pdb|3LVB|A Chain A, Crystal Structure Of The Ferredoxin:nadp+ Reductase 
From Maize Root At 1.7 Angstroms - Test Set Withheld
Length=311

 Score =   300 bits (767),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE++PNATHIMIATGTGVAPFRGYLRRMFME VP ++F GLAWLFLGVAN+DSL
Sbjct  149  GKIMLLPEEDPNATHIMIATGTGVAPFRGYLRRMFMEDVPNYRFGGLAWLFLGVANSDSL  208

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YL+ +PDNFRYD+ LSREQKN++GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  209  LYDEEFTSYLKQYPDNFRYDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  268

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE RG SW+ KL+QLKKNKQWHVEVY
Sbjct  269  CGLKGMMPGIQDTLKKVAERRGESWDQKLAQLKKNKQWHVEVY  311



>gb|AAM65564.1| ferrodoxin NADP oxidoreductase, putative [Arabidopsis thaliana]
Length=381

 Score =   302 bits (773),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPE +PNATHIMIATGTGVAP+RGYLRRMFME+VP   F+GLAWLFLGVANTDSL
Sbjct  219  GKVMLLPESDPNATHIMIATGTGVAPYRGYLRRMFMENVPNKTFSGLAWLFLGVANTDSL  278

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF KYL+D PDNFR+D+ LSRE+KNK GGKMYVQDK+EEYSDEIFKLLD GAHIYF
Sbjct  279  LYDEEFTKYLKDHPDNFRFDKALSREEKNKKGGKMYVQDKVEEYSDEIFKLLDNGAHIYF  338

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SW+ KLSQL+KNKQWHVEVY
Sbjct  339  CGLKGMMPGIQDTLKRVAEERGESWDLKLSQLRKNKQWHVEVY  381



>ref|XP_006305070.1| hypothetical protein CARUB_v10009436mg [Capsella rubella]
 gb|EOA37968.1| hypothetical protein CARUB_v10009436mg [Capsella rubella]
Length=382

 Score =   302 bits (773),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPE +PNATHIMIATGTGVAP+RGYLRRMFME+VP   F GLAWLFLGVANTDSL
Sbjct  220  GKVMLLPEKDPNATHIMIATGTGVAPYRGYLRRMFMENVPNKTFGGLAWLFLGVANTDSL  279

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF KYL+D P+NFRYD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  280  LYDEEFTKYLKDHPENFRYDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  339

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SW+ KLSQL+KNKQWHVEVY
Sbjct  340  CGLKGMMPGIQDTLKRVAEERGESWDLKLSQLRKNKQWHVEVY  382



>ref|XP_010431466.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic 
isoform X1 [Camelina sativa]
Length=377

 Score =   302 bits (773),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPED+  ATHIMIATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSL
Sbjct  215  GKVMLLPEDDQKATHIMIATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSL  274

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF+ YL+D+P NFRYD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  275  LYDEEFSGYLKDYPKNFRYDKALSREEKNKTGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  334

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SWE KL+QL+KNKQWHVEVY
Sbjct  335  CGLKGMMPGIQDTLKRVAEERGESWEQKLTQLRKNKQWHVEVY  377



>dbj|BAJ93902.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=376

 Score =   302 bits (773),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE +PNATHIMIATGTGVAP+RGYLRRMFME VP ++F GLAWLFLGVAN+DSL
Sbjct  214  GKIMLLPESDPNATHIMIATGTGVAPYRGYLRRMFMEDVPNYRFGGLAWLFLGVANSDSL  273

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YL+ +PDNFR+D+ LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  274  LYDEEFTSYLKQYPDNFRFDKALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  333

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  334  CGLKGMMPGIQDTLKKVAEQRGESWDQKLSQLKKNKQWHVEVY  376



>ref|XP_002463784.1| hypothetical protein SORBIDRAFT_01g006100 [Sorghum bicolor]
 gb|EER90782.1| hypothetical protein SORBIDRAFT_01g006100 [Sorghum bicolor]
Length=380

 Score =   302 bits (773),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE++PNATHIMIATGTGVAPFRGYLRRMFME VP ++F GLAWLFLGVAN+DSL
Sbjct  218  GKIMLLPEEDPNATHIMIATGTGVAPFRGYLRRMFMEDVPNYRFGGLAWLFLGVANSDSL  277

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YL+ +PDNFRYD+ LSREQKN++GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  278  LYDEEFTSYLKQYPDNFRYDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  337

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  338  CGLKGMMPGIQDTLKKVAEQRGESWDQKLSQLKKNKQWHVEVY  380



>ref|XP_002893629.1| ATRFNR2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69888.1| ATRFNR2 [Arabidopsis lyrata subsp. lyrata]
Length=381

 Score =   301 bits (772),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPE +PNATHIMIATGTGVAP+RGYLRRMFME+VP   F+GLAWLFLGVANTDSL
Sbjct  219  GKVMLLPESDPNATHIMIATGTGVAPYRGYLRRMFMENVPNKTFSGLAWLFLGVANTDSL  278

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYL+D P+NFR+D+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  279  LYDDEFTKYLKDHPENFRFDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  338

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SW+ KLSQL+KNKQWHVEVY
Sbjct  339  CGLKGMMPGIQDTLKRVAEERGESWDLKLSQLRKNKQWHVEVY  381



>ref|XP_010478465.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 2, chloroplastic 
isoform X2 [Camelina sativa]
Length=382

 Score =   301 bits (770),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPE +P ATHIMIATGTGVAP+RGYLRRMFME+VP   F GLAWLFLGVANTDSL
Sbjct  220  GKVMLLPEKDPKATHIMIATGTGVAPYRGYLRRMFMENVPNRTFGGLAWLFLGVANTDSL  279

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYL+D P+NFRYD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  280  LYDDEFTKYLKDHPENFRYDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  339

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SW+ KLSQL+KNKQWHVEVY
Sbjct  340  CGLKGMMPGIQDTLKRVAEERGESWDLKLSQLRKNKQWHVEVY  382



>ref|XP_010478464.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 2, chloroplastic 
isoform X1 [Camelina sativa]
Length=383

 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPE +P ATHIMIATGTGVAP+RGYLRRMFME+VP   F GLAWLFLGVANTDSL
Sbjct  221  GKVMLLPEKDPKATHIMIATGTGVAPYRGYLRRMFMENVPNRTFGGLAWLFLGVANTDSL  280

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYL+D P+NFRYD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  281  LYDDEFTKYLKDHPENFRYDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  340

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SW+ KLSQL+KNKQWHVEVY
Sbjct  341  CGLKGMMPGIQDTLKRVAEERGESWDLKLSQLRKNKQWHVEVY  383



>ref|XP_008665551.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Zea mays]
 gb|ACF87736.1| unknown [Zea mays]
 gb|ACN29024.1| unknown [Zea mays]
 gb|ACR35923.1| unknown [Zea mays]
 gb|ACR36711.1| unknown [Zea mays]
 tpg|DAA51768.1| TPA: ferredoxin-NADP reductase Precursor [Zea mays]
Length=381

 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE++PNATHIMIATGTGVAPFRGYLRRMFME VP ++F GLAWLFLGVAN+DSL
Sbjct  219  GKIMLLPEEDPNATHIMIATGTGVAPFRGYLRRMFMEDVPNYRFGGLAWLFLGVANSDSL  278

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YL+ +PDNFRYD+ LSREQKN++GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  279  LYDEEFTSYLKQYPDNFRYDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  338

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE RG SW+ KL+QLKKNKQWHVEVY
Sbjct  339  CGLKGMMPGIQDTLKKVAERRGESWDQKLAQLKKNKQWHVEVY  381



>gb|ACG39703.1| ferredoxin--NADP reductase, root isozyme [Zea mays]
Length=381

 Score =   300 bits (769),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE++PNATHIMIATGTGVAPFRGYLRRMFME VP ++F GLAWLFLGVAN+DSL
Sbjct  219  GKIMLLPEEDPNATHIMIATGTGVAPFRGYLRRMFMEDVPNYRFGGLAWLFLGVANSDSL  278

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YL+ +PDNFRYD+ LSREQKN++GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  279  LYDEEFTSYLKQYPDNFRYDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  338

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE RG SW+ KL+QLKKNKQWHVEVY
Sbjct  339  CGLKGMMPGIQDTLKKVAERRGESWDQKLAQLKKNKQWHVEVY  381



>gb|KHG02797.1| hypothetical protein F383_08810 [Gossypium arboreum]
Length=376

 Score =   300 bits (768),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 152/163 (93%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPEDNPNA HIMIATGTGVAPFRGYLRR+FME V TFKF GLAWLFLGVAN DSL
Sbjct  215  GKIMLLPEDNPNANHIMIATGTGVAPFRGYLRRIFMEDV-TFKFKGLAWLFLGVANKDSL  273

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYL+D+PD FRYD  LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD+GAHIYF
Sbjct  274  LYDDEFTKYLKDYPDQFRYDLALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDDGAHIYF  333

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGL+GMMPGIQ+TLKRVAE+RG +W+ KLSQLKKNKQWHVEVY
Sbjct  334  CGLRGMMPGIQETLKRVAEQRGENWDEKLSQLKKNKQWHVEVY  376



>ref|XP_010422426.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=377

 Score =   300 bits (768),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPED+  ATHIMIATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSL
Sbjct  215  GKVMLLPEDDQKATHIMIATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSL  274

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF+ YL+D+P NFRYD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  275  LYDEEFSGYLKDYPKNFRYDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDSGAHIYF  334

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SWE KL+QL+KNK+WHVEVY
Sbjct  335  CGLKGMMPGIQDTLKRVAEERGESWEQKLTQLRKNKRWHVEVY  377



>ref|XP_010422427.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=375

 Score =   300 bits (768),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPED+  ATHIMIATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSL
Sbjct  213  GKVMLLPEDDQKATHIMIATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSL  272

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF+ YL+D+P NFRYD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  273  LYDEEFSGYLKDYPKNFRYDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDSGAHIYF  332

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SWE KL+QL+KNK+WHVEVY
Sbjct  333  CGLKGMMPGIQDTLKRVAEERGESWEQKLTQLRKNKRWHVEVY  375



>pdb|3LO8|A Chain A, Crystal Structure Of The Oxidized Form Of Ferredoxin:nadp+ 
Reductase From Maize Root At 1.05 Angstroms
Length=311

 Score =   297 bits (761),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE++PNATHIMIATGTGVAPFRGYLRRMFME VP ++F GLAWLFLGVAN+DSL
Sbjct  149  GKIMLLPEEDPNATHIMIATGTGVAPFRGYLRRMFMEDVPNYRFGGLAWLFLGVANSDSL  208

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  YL+ +PDNFRYD+ LSREQKN++GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  209  LYDEEFTSYLKQYPDNFRYDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYF  268

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEV  166
            CGLKGMMPGIQDTLK+VAE RG SW+ KL+QLKKNKQWHVEV
Sbjct  269  CGLKGMMPGIQDTLKKVAERRGESWDQKLAQLKKNKQWHVEV  310



>ref|XP_006844572.1| hypothetical protein AMTR_s00016p00195680 [Amborella trichopoda]
 gb|ERN06247.1| hypothetical protein AMTR_s00016p00195680 [Amborella trichopoda]
Length=377

 Score =   298 bits (763),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPE++P+ATHIMIATGTG+APFRGYLRRMFMES+P+FKF GLAWLFLGVAN+DSL
Sbjct  215  GKVMLLPEEDPDATHIMIATGTGIAPFRGYLRRMFMESIPSFKFGGLAWLFLGVANSDSL  274

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EF  Y++++P+NFRYD  LSREQKNK GGK+YVQDKIEEYSDE+FKLLDEGAHIYF
Sbjct  275  LYDEEFNNYVKEYPENFRYDLALSREQKNKLGGKLYVQDKIEEYSDEVFKLLDEGAHIYF  334

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGL+GMMPGIQDTLKRVAE+RG +WE KLS+LKKNKQWHVEVY
Sbjct  335  CGLRGMMPGIQDTLKRVAEQRGENWEEKLSKLKKNKQWHVEVY  377



>ref|XP_011085204.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic-like 
[Sesamum indicum]
Length=393

 Score =   298 bits (764),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAPFRGYLRRMFME+VPTFKF GLAWLFLGVAN+DSL
Sbjct  231  GKIMLLPEDDPNATHIMIATGTGVAPFRGYLRRMFMENVPTFKFGGLAWLFLGVANSDSL  290

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF+KYL+D+PDNFRYDR LSREQKN+NGGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  291  LYDDEFSKYLRDYPDNFRYDRALSREQKNRNGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  350

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAE+RG SW+ KLSQLKK KQWHVEVY
Sbjct  351  CGLKGMMPGIQDTLKRVAEQRGESWDEKLSQLKKKKQWHVEVY  393



>ref|XP_010460851.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=382

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPE +P ATHIMIATGTGVAP+RGYLRRMFME VP   F GLAWLFLGVANTDSL
Sbjct  220  GKVMLLPEKDPKATHIMIATGTGVAPYRGYLRRMFMEDVPNRTFGGLAWLFLGVANTDSL  279

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYL+D P++FRYD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  280  LYDDEFTKYLKDHPEHFRYDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  339

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SW+ KLSQL+KNKQWHVEVY
Sbjct  340  CGLKGMMPGIQDTLKRVAEERGESWDLKLSQLRKNKQWHVEVY  382



>ref|XP_010460850.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=383

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPE +P ATHIMIATGTGVAP+RGYLRRMFME VP   F GLAWLFLGVANTDSL
Sbjct  221  GKVMLLPEKDPKATHIMIATGTGVAPYRGYLRRMFMEDVPNRTFGGLAWLFLGVANTDSL  280

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYL+D P++FRYD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYF
Sbjct  281  LYDDEFTKYLKDHPEHFRYDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYF  340

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SW+ KLSQL+KNKQWHVEVY
Sbjct  341  CGLKGMMPGIQDTLKRVAEERGESWDLKLSQLRKNKQWHVEVY  383



>gb|KFK44861.1| hypothetical protein AALP_AA1G312100 [Arabis alpina]
Length=384

 Score =   296 bits (759),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 153/164 (93%), Gaps = 2/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPE++PNATHIMIATGTGVAP+RGYLRRMFME+VP  KF GLAWLFLGVANTDSL
Sbjct  222  GKVMLLPENDPNATHIMIATGTGVAPYRGYLRRMFMENVPN-KFTGLAWLFLGVANTDSL  280

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSRE-QKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIY  295
            LYDDEF KYL+D P+NFR+D+ LSRE +KNK GGKMYVQDKIEEYSDEIFKLLD GAHIY
Sbjct  281  LYDDEFTKYLKDHPENFRFDKALSREGEKNKRGGKMYVQDKIEEYSDEIFKLLDNGAHIY  340

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            FCGLKGMMPGIQDTLKRVAEERG SWE KL+QL+KNKQWHVEVY
Sbjct  341  FCGLKGMMPGIQDTLKRVAEERGESWELKLTQLRKNKQWHVEVY  384



>gb|KFK44862.1| hypothetical protein AALP_AA1G312100 [Arabis alpina]
Length=383

 Score =   296 bits (759),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 153/164 (93%), Gaps = 2/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPE++PNATHIMIATGTGVAP+RGYLRRMFME+VP  KF GLAWLFLGVANTDSL
Sbjct  221  GKVMLLPENDPNATHIMIATGTGVAPYRGYLRRMFMENVPN-KFTGLAWLFLGVANTDSL  279

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSRE-QKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIY  295
            LYDDEF KYL+D P+NFR+D+ LSRE +KNK GGKMYVQDKIEEYSDEIFKLLD GAHIY
Sbjct  280  LYDDEFTKYLKDHPENFRFDKALSREGEKNKRGGKMYVQDKIEEYSDEIFKLLDNGAHIY  339

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            FCGLKGMMPGIQDTLKRVAEERG SWE KL+QL+KNKQWHVEVY
Sbjct  340  FCGLKGMMPGIQDTLKRVAEERGESWELKLTQLRKNKQWHVEVY  383



>ref|XP_011016596.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic-like 
[Populus euphratica]
Length=355

 Score =   295 bits (754),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAPFRGYLRRMFME+VPT+KF GLAWLFLGVANTDSL
Sbjct  193  GKIMLLPEDDPNATHIMIATGTGVAPFRGYLRRMFMEAVPTYKFGGLAWLFLGVANTDSL  252

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEFAKYLQD+PD+FRYD+ LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD+GAHIYF
Sbjct  253  LYDDEFAKYLQDYPDHFRYDKALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDDGAHIYF  312

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG  W+ KLSQLKK KQWHVEVY
Sbjct  313  CGLKGMMPGIQDTLKKVAEQRGEKWDEKLSQLKKKKQWHVEVY  355



>gb|KJB56289.1| hypothetical protein B456_009G115100 [Gossypium raimondii]
Length=316

 Score =   293 bits (750),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 149/163 (91%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE NP A HIMIATGTGVAPFR YLRRMFME V TFKF GLAWLFLGVAN DSL
Sbjct  155  GKIMLLPEGNPKANHIMIATGTGVAPFRSYLRRMFMEDV-TFKFKGLAWLFLGVANKDSL  213

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYL+D+PD FRYD  LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD+GAHIYF
Sbjct  214  LYDDEFTKYLEDYPDQFRYDLALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDDGAHIYF  273

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGL+GMMPGIQ+TLKRVAE+RG +W+ KLSQLKKNKQWHVEVY
Sbjct  274  CGLRGMMPGIQETLKRVAEQRGENWDEKLSQLKKNKQWHVEVY  316



>gb|KJB56286.1| hypothetical protein B456_009G115100 [Gossypium raimondii]
Length=376

 Score =   294 bits (753),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 149/163 (91%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE NP A HIMIATGTGVAPFR YLRRMFME V TFKF GLAWLFLGVAN DSL
Sbjct  215  GKIMLLPEGNPKANHIMIATGTGVAPFRSYLRRMFMEDV-TFKFKGLAWLFLGVANKDSL  273

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYL+D+PD FRYD  LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD+GAHIYF
Sbjct  274  LYDDEFTKYLEDYPDQFRYDLALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDDGAHIYF  333

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGL+GMMPGIQ+TLKRVAE+RG +W+ KLSQLKKNKQWHVEVY
Sbjct  334  CGLRGMMPGIQETLKRVAEQRGENWDEKLSQLKKNKQWHVEVY  376



>ref|XP_011038878.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Populus euphratica]
Length=378

 Score =   294 bits (753),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAPFRGYLRRMFME+VPT+KF GLAWLFLGVANTDSL
Sbjct  216  GKIMLLPEDDPNATHIMIATGTGVAPFRGYLRRMFMEAVPTYKFGGLAWLFLGVANTDSL  275

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EFAKYLQD+PD+FRYD+ LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD+GAHIYF
Sbjct  276  LYDEEFAKYLQDYPDHFRYDKALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDDGAHIYF  335

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG  W+ KLSQLKK KQWHVEVY
Sbjct  336  CGLKGMMPGIQDTLKKVAEQRGEKWDEKLSQLKKKKQWHVEVY  378



>ref|XP_001770917.1| predicted protein [Physcomitrella patens]
 ref|XP_001770962.1| predicted protein [Physcomitrella patens]
 gb|EDQ64247.1| predicted protein [Physcomitrella patens]
 gb|EDQ64292.1| predicted protein [Physcomitrella patens]
Length=378

 Score =   290 bits (741),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPE +PNATHIM+ATGTG+AP+RG+LRRMFME VPTFKF GLAWLFLGVAN+DSL
Sbjct  216  GKVMLLPESDPNATHIMVATGTGIAPYRGFLRRMFMEDVPTFKFGGLAWLFLGVANSDSL  275

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LY DEF KY + FP+NFRYD  LSRE+KN  GGKMYVQDKIEEYS+E+F LLD+GAHIYF
Sbjct  276  LYHDEFTKYKEAFPENFRYDTALSREEKNSKGGKMYVQDKIEEYSEELFNLLDKGAHIYF  335

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGL+GMMPGIQDTLKRVAE RG +WE KL++LKKNKQWHVEVY
Sbjct  336  CGLRGMMPGIQDTLKRVAEARGENWEEKLAKLKKNKQWHVEVY  378



>gb|ACY70395.1| heterotrophic ferredoxin NADP+ oxidoreductase [Populus tremula 
x Populus tremuloides]
Length=378

 Score =   289 bits (740),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAPFRGYLRRMFME VPT+KF GLAWLFLGVAN DSL
Sbjct  216  GKIMLLPEDDPNATHIMIATGTGVAPFRGYLRRMFMEDVPTYKFGGLAWLFLGVANNDSL  275

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EFAKYLQD PD+FRYD+ LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD+GAHIYF
Sbjct  276  LYDEEFAKYLQDNPDHFRYDKALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDDGAHIYF  335

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG  W+ KLSQLKK KQWHVEVY
Sbjct  336  CGLKGMMPGIQDTLKKVAEQRGEKWDEKLSQLKKKKQWHVEVY  378



>ref|XP_002982108.1| hypothetical protein SELMODRAFT_179376 [Selaginella moellendorffii]
 gb|EFJ16776.1| hypothetical protein SELMODRAFT_179376 [Selaginella moellendorffii]
Length=348

 Score =   287 bits (734),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE NP A HIMIATGTG+APFRGYLRRMFME V +FKF GLAWLFLGVAN DSL
Sbjct  187  GKIMLLPESNPKAAHIMIATGTGIAPFRGYLRRMFMEDV-SFKFGGLAWLFLGVANRDSL  245

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LY DEF  YL+++PDNFRYD  LSREQ NK GGKMYVQDKIEEYS+E+FKLLDEGAHIYF
Sbjct  246  LYHDEFEGYLKEYPDNFRYDIALSREQNNKRGGKMYVQDKIEEYSEEVFKLLDEGAHIYF  305

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SWE KLS LKK KQWHVEVY
Sbjct  306  CGLKGMMPGIQDTLKRVAEERGESWEEKLSMLKKKKQWHVEVY  348



>ref|XP_002992209.1| hypothetical protein SELMODRAFT_134886 [Selaginella moellendorffii]
 gb|EFJ06706.1| hypothetical protein SELMODRAFT_134886 [Selaginella moellendorffii]
Length=348

 Score =   286 bits (733),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE NP A HIMIATGTG+APFRGYLRRMFME V +FKF GLAWLFLGVAN DSL
Sbjct  187  GKIMLLPESNPKAAHIMIATGTGIAPFRGYLRRMFMEDV-SFKFGGLAWLFLGVANRDSL  245

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LY DEF  YL+++PDNFRYD  LSREQ NK GGKMYVQDKIEEYS+E+FKLLDEGAHIYF
Sbjct  246  LYHDEFEGYLKEYPDNFRYDIALSREQNNKRGGKMYVQDKIEEYSEEVFKLLDEGAHIYF  305

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLKRVAEERG SWE KLS LKK KQWHVEVY
Sbjct  306  CGLKGMMPGIQDTLKRVAEERGESWEEKLSMLKKKKQWHVEVY  348



>ref|XP_002298889.2| ferredoxin-NADP reductase family protein [Populus trichocarpa]
 gb|EEE83694.2| ferredoxin-NADP reductase family protein [Populus trichocarpa]
Length=378

 Score =   288 bits (736),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPED+PNATHIMIATGTGVAPFRGYLRRMFME+VPT+KF GLAWLFLGVAN DSL
Sbjct  216  GKIMLLPEDDPNATHIMIATGTGVAPFRGYLRRMFMEAVPTYKFGGLAWLFLGVANNDSL  275

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+EFAKYLQD PD+FRYD+ LSREQKNK+GGKMYVQDKIEEYSDEIFK LD+GAHIYF
Sbjct  276  LYDEEFAKYLQDNPDHFRYDKALSREQKNKSGGKMYVQDKIEEYSDEIFKRLDDGAHIYF  335

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQDTLK+VAE+RG  W+ KLSQLKK KQWHVEVY
Sbjct  336  CGLKGMMPGIQDTLKKVAEQRGEKWDEKLSQLKKKKQWHVEVY  378



>gb|EPS58368.1| hypothetical protein M569_16446, partial [Genlisea aurea]
Length=330

 Score =   285 bits (728),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 147/165 (89%), Gaps = 2/165 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESV--PTFKFNGLAWLFLGVANTD  478
            GKI+LLPEDNPN  HIMIATGTGVAPFR YLRRMFME+V   +FKF GLAWLFLGVAN D
Sbjct  166  GKIMLLPEDNPNGNHIMIATGTGVAPFRAYLRRMFMENVTASSFKFGGLAWLFLGVANGD  225

Query  477  SLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHI  298
            SLLYD+EF+KYL D P NFRYDR LSRE KNK GGKMYVQDK+EEYSDEI +LL++GAHI
Sbjct  226  SLLYDEEFSKYLVDHPANFRYDRALSREHKNKRGGKMYVQDKMEEYSDEILELLEQGAHI  285

Query  297  YFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            YFCGLKGMM GIQ+TLKRVAEERG SWE KLS+LKKNKQWHVEVY
Sbjct  286  YFCGLKGMMGGIQETLKRVAEERGESWEEKLSKLKKNKQWHVEVY  330



>ref|XP_007022878.1| Ferredoxin--NADP reductase, root-type isozyme, chloroplastic 
isoform 2 [Theobroma cacao]
 gb|EOY25500.1| Ferredoxin--NADP reductase, root-type isozyme, chloroplastic 
isoform 2 [Theobroma cacao]
Length=316

 Score =   283 bits (723),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 152/163 (93%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPEDNPNA HIMIATGTGVAPFRGYLRRMFME V TFKF GLAWLFLGVAN DSL
Sbjct  155  GKIMLLPEDNPNANHIMIATGTGVAPFRGYLRRMFMEDV-TFKFRGLAWLFLGVANADSL  213

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYLQDFPD+FRYD  LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD+GAHIYF
Sbjct  214  LYDDEFTKYLQDFPDHFRYDGALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDDGAHIYF  273

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQ+TLKRVAE+RG +W+ KLSQLKK KQWHVEVY
Sbjct  274  CGLKGMMPGIQETLKRVAEKRGENWDEKLSQLKKKKQWHVEVY  316



>ref|XP_007022877.1| Root FNR 1 isoform 1 [Theobroma cacao]
 gb|EOY25499.1| Root FNR 1 isoform 1 [Theobroma cacao]
Length=387

 Score =   285 bits (728),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 152/163 (93%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPEDNPNA HIMIATGTGVAPFRGYLRRMFME V TFKF GLAWLFLGVAN DSL
Sbjct  226  GKIMLLPEDNPNANHIMIATGTGVAPFRGYLRRMFMEDV-TFKFRGLAWLFLGVANADSL  284

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYLQDFPD+FRYD  LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD+GAHIYF
Sbjct  285  LYDDEFTKYLQDFPDHFRYDGALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDDGAHIYF  344

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQ+TLKRVAE+RG +W+ KLSQLKK KQWHVEVY
Sbjct  345  CGLKGMMPGIQETLKRVAEKRGENWDEKLSQLKKKKQWHVEVY  387



>gb|AFK49031.1| unknown [Lotus japonicus]
Length=147

 Score =   273 bits (699),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  603  MIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDN  424
            MI TGTGVAPFRGYLRRMFMESVPTFKF GLAWLFLGVANTDSLLY DEF KYL+D+P N
Sbjct  1    MIGTGTGVAPFRGYLRRMFMESVPTFKFGGLAWLFLGVANTDSLLYHDEFTKYLKDYPTN  60

Query  423  FRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKR  244
            FRYD  LSREQKNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYFCGL+GMMPGIQ+TLKR
Sbjct  61   FRYDIALSREQKNKNGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLRGMMPGIQETLKR  120

Query  243  VAEERGLSWETKLSQLKKNKQWHVEVY  163
            VA++RG +W+ KLSQLKKNKQWHVEVY
Sbjct  121  VADQRGENWDEKLSQLKKNKQWHVEVY  147



>ref|XP_001774270.1| predicted protein [Physcomitrella patens]
 gb|EDQ60906.1| predicted protein [Physcomitrella patens]
Length=291

 Score =   276 bits (705),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK+LLLPE++P+ATHIM+ATGTG+AP+RGYLRRMFME    FKFNGLAWLF+GVANTDSL
Sbjct  130  GKVLLLPEEDPSATHIMVATGTGIAPYRGYLRRMFMEDT-EFKFNGLAWLFMGVANTDSL  188

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LY DEF  YL+++PDNFRYD  LSREQKN  GGK+YVQDK+EEYS+E+F  LD+GAHIYF
Sbjct  189  LYHDEFNTYLKEYPDNFRYDIALSREQKNSRGGKLYVQDKMEEYSEELFDKLDKGAHIYF  248

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGL+GMMPGIQD LKRVAE RG SWETKL+ LKKNKQWHVEVY
Sbjct  249  CGLRGMMPGIQDMLKRVAESRGESWETKLAALKKNKQWHVEVY  291



>gb|KJB56288.1| hypothetical protein B456_009G115100 [Gossypium raimondii]
Length=364

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 133/146 (91%), Gaps = 1/146 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKI+LLPE NP A HIMIATGTGVAPFR YLRRMFME V TFKF GLAWLFLGVAN DSL
Sbjct  215  GKIMLLPEGNPKANHIMIATGTGVAPFRSYLRRMFMEDV-TFKFKGLAWLFLGVANKDSL  273

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF KYL+D+PD FRYD  LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD+GAHIYF
Sbjct  274  LYDDEFTKYLEDYPDQFRYDLALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDDGAHIYF  333

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWE  214
            CGL+GMMPGIQ+TLKRVAE+RG +W+
Sbjct  334  CGLRGMMPGIQETLKRVAEQRGENWD  359



>gb|KJB56287.1| hypothetical protein B456_009G115100 [Gossypium raimondii]
Length=349

 Score =   253 bits (645),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 128/140 (91%), Gaps = 1/140 (1%)
 Frame = -3

Query  582  VAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFRYDRVL  403
             APFR YLRRMFME V TFKF GLAWLFLGVAN DSLLYDDEF KYL+D+PD FRYD  L
Sbjct  211  TAPFRSYLRRMFMEDV-TFKFKGLAWLFLGVANKDSLLYDDEFTKYLEDYPDQFRYDLAL  269

Query  402  SREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVAEERGL  223
            SREQKNK+GGKMYVQDKIEEYSDEIFKLLD+GAHIYFCGL+GMMPGIQ+TLKRVAE+RG 
Sbjct  270  SREQKNKSGGKMYVQDKIEEYSDEIFKLLDDGAHIYFCGLRGMMPGIQETLKRVAEQRGE  329

Query  222  SWETKLSQLKKNKQWHVEVY  163
            +W+ KLSQLKKNKQWHVEVY
Sbjct  330  NWDEKLSQLKKNKQWHVEVY  349



>ref|XP_005644145.1| ferredoxin-NADP+ reductase [Coccomyxa subellipsoidea C-169]
 gb|EIE19601.1| ferredoxin-NADP+ reductase [Coccomyxa subellipsoidea C-169]
Length=349

 Score =   240 bits (612),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 130/163 (80%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKILLLPED  NA  IM+ATGTG+AP+R + RR F+E +  +K+ GLAWLF+GVAN+D+ 
Sbjct  188  GKILLLPEDK-NAAIIMVATGTGIAPYRAFWRRFFLEEIEGYKYTGLAWLFMGVANSDAK  246

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDE    L+  PD FR D  LSREQ NKNGGKMY+QDK+EEYSDE+F LLD GAHIYF
Sbjct  247  LYDDELQAILKAHPDQFRVDYALSREQTNKNGGKMYIQDKVEEYSDEVFDLLDNGAHIYF  306

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQ+ L+RVA E+G+ WE    +LKKN QWHVEVY
Sbjct  307  CGLKGMMPGIQEMLERVASEKGMVWEEFFQKLKKNNQWHVEVY  349



>gb|EJK72001.1| hypothetical protein THAOC_06509 [Thalassiosira oceanica]
Length=340

 Score =   237 bits (604),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 132/164 (80%), Gaps = 1/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDS  475
            GK++L+PE++PN  +IM+ATGTG+AP+RG++RR+F E  P    + G AWLFLGVAN+D+
Sbjct  177  GKVMLMPEEDPNTDYIMVATGTGIAPYRGFIRRLFFEDTPAADVYKGQAWLFLGVANSDA  236

Query  474  LLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIY  295
            LLYDDEF      +PDNFR D  LSREQ+NK GGKMY+QDK+EEY+DEIF  LD GAHIY
Sbjct  237  LLYDDEFQDAKARYPDNFRIDYALSREQENKKGGKMYIQDKVEEYADEIFNKLDSGAHIY  296

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            FCGLKGMMPGIQD LK V EE+G+S++  L  LK+ KQWHVEVY
Sbjct  297  FCGLKGMMPGIQDMLKAVCEEKGISYDEWLKGLKQAKQWHVEVY  340



>ref|XP_005853875.1| ferredoxin--NADP+ reductase [Nannochloropsis gaditana CCMP526]
 gb|EKU22482.1| ferredoxin--NADP+ reductase [Nannochloropsis gaditana CCMP526]
Length=411

 Score =   239 bits (609),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 134/164 (82%), Gaps = 1/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDS  475
            GK++L+PE  P A  IM+ATGTG+AP+R ++RR+F+E  P  K F GLAWLFLGVAN DS
Sbjct  248  GKVMLIPEKTPEADLIMVATGTGIAPYRTFVRRLFVEDTPARKAFKGLAWLFLGVANKDS  307

Query  474  LLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIY  295
            LLYDDE+ +  + +P+NFR D  LSREQ+NK GGKMY+QDK+EEY+DEIF  L +GAHIY
Sbjct  308  LLYDDEWQEVKKAYPNNFRVDYALSREQENKKGGKMYIQDKMEEYADEIFDRLSKGAHIY  367

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            FCGLKGMMPGIQDTL+RVA+E+G+ W+  L  LKKN QWHVEVY
Sbjct  368  FCGLKGMMPGIQDTLERVAQEKGIEWKDMLEGLKKNHQWHVEVY  411



>gb|EWM23857.1| Ferredoxin reductase-type FAD-binding domain protein [Nannochloropsis 
gaditana]
Length=437

 Score =   239 bits (610),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 134/164 (82%), Gaps = 1/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDS  475
            GK++L+PE  P A  IM+ATGTG+AP+R ++RR+F+E  P  K F GLAWLFLGVAN DS
Sbjct  274  GKVMLIPEKTPEADLIMVATGTGIAPYRTFVRRLFVEDTPARKAFKGLAWLFLGVANKDS  333

Query  474  LLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIY  295
            LLYDDE+ +  + +P+NFR D  LSREQ+NK GGKMY+QDK+EEY+DEIF  L +GAHIY
Sbjct  334  LLYDDEWQEVKKAYPNNFRVDYALSREQENKKGGKMYIQDKMEEYADEIFDRLSKGAHIY  393

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            FCGLKGMMPGIQDTL+RVA+E+G+ W+  L  LKKN QWHVEVY
Sbjct  394  FCGLKGMMPGIQDTLERVAQEKGIEWKDMLEGLKKNHQWHVEVY  437



>ref|XP_002184856.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC43592.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=340

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 133/164 (81%), Gaps = 1/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDS  475
            GK++LLPE+ P+  +IM+ATGTG+AP+RG++RR+F E  P  + + G AWLFLGVAN+D+
Sbjct  177  GKVMLLPEEEPDTDYIMVATGTGIAPYRGFVRRLFTEETPAGEAYKGQAWLFLGVANSDA  236

Query  474  LLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIY  295
            LLYDDE+   L+++P+NFR D  LSREQ+NKNGGKMY+QDK+EEY+DEIF  LD GAHIY
Sbjct  237  LLYDDEWQTVLKEYPENFRLDYALSREQENKNGGKMYIQDKVEEYADEIFAKLDSGAHIY  296

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            FCGLKGMMPGIQD LK V EE+ + ++  L  LK  KQWHVEVY
Sbjct  297  FCGLKGMMPGIQDMLKSVCEEKKVDYDEWLKGLKSKKQWHVEVY  340



>ref|XP_002290014.1| ferredoxin--NADP+ reductase [Thalassiosira pseudonana CCMP1335]
 gb|EED93551.1| ferredoxin--NADP+ reductase [Thalassiosira pseudonana CCMP1335]
Length=361

 Score =   232 bits (592),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 130/164 (79%), Gaps = 1/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDS  475
            GK++L+PE++P   +IM+ATGTG+APFRG++RR+F ES P  K + G AWLFLGVAN+D+
Sbjct  198  GKVMLMPEEDPKTDYIMVATGTGIAPFRGFVRRLFFESTPAAKAYQGQAWLFLGVANSDA  257

Query  474  LLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIY  295
            LLYDDEF +    FPDNFR D  LSREQ NK GGKMY+QDK+EEY+DE+F  L+ GAHIY
Sbjct  258  LLYDDEFQEAKSKFPDNFRLDYALSREQNNKKGGKMYIQDKVEEYADEVFNKLNNGAHIY  317

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            FCGLKGMMPGIQD L  V + +GL ++  + +LK  KQWHVEVY
Sbjct  318  FCGLKGMMPGIQDMLAEVCKSKGLDYDEWIKELKGKKQWHVEVY  361



>gb|ABD51927.1| chloroplast ferredoxin NADP oxidoreductase [Guillardia theta]
Length=366

 Score =   230 bits (586),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDS  475
            GK++L+PED+PN T+IM+ATGTG+APFR +LRR+F E  P  K F GLAWLFLGVAN DS
Sbjct  202  GKVMLMPEDDPNMTYIMVATGTGIAPFRSFLRRLFGEGNPAGKNFKGLAWLFLGVANKDS  261

Query  474  LLYDDEFAKYLQDFPDNFRYDRVLSREQK-NKNGGKMYVQDKIEEYSDEIFKLLDEGAHI  298
            LLYD+EF  YL+  PD  R D  LSRE   NK GGKMY+QDK+EEY+DE+F  LD+GAHI
Sbjct  262  LLYDEEFQVYLRQNPDKMRLDYALSREGPLNKKGGKMYIQDKVEEYADEVFDALDKGAHI  321

Query  297  YFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            YFCGLKGMMPGIQD L+ V E +GL++E  L  LKK  QWHVEVY
Sbjct  322  YFCGLKGMMPGIQDMLRGVCESKGLNFEEYLEGLKKKGQWHVEVY  366



>ref|XP_005835894.1| hypothetical protein GUITHDRAFT_162347 [Guillardia theta CCMP2712]
 gb|EKX48914.1| hypothetical protein GUITHDRAFT_162347 [Guillardia theta CCMP2712]
Length=391

 Score =   230 bits (587),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDS  475
            GK++L+PED+PN T+IM+ATGTG+APFR +LRR+F E  P  K F GLAWLFLGVAN DS
Sbjct  227  GKVMLMPEDDPNMTYIMVATGTGIAPFRSFLRRLFGEGNPAGKNFKGLAWLFLGVANKDS  286

Query  474  LLYDDEFAKYLQDFPDNFRYDRVLSREQK-NKNGGKMYVQDKIEEYSDEIFKLLDEGAHI  298
            LLYD+EF  YL+  PD  R D  LSRE   NK GGKMY+QDK+EEY+DE+F  LD+GAHI
Sbjct  287  LLYDEEFQVYLRQNPDKMRLDYALSREGPLNKKGGKMYIQDKVEEYADEVFDALDKGAHI  346

Query  297  YFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            YFCGLKGMMPGIQD L+ V E +GL++E  L  LKK  QWHVEVY
Sbjct  347  YFCGLKGMMPGIQDMLRGVCESKGLNFEEYLEGLKKKGQWHVEVY  391



>gb|KIZ06612.1| ferredoxin--NADP+ reductase [Monoraphidium neglectum]
Length=341

 Score =   228 bits (582),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 130/163 (80%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK+LLLPE +P +  I +ATGTG+APFR + RR F E+VP +KF+GL WLF+GVAN+DSL
Sbjct  180  GKVLLLPE-SPKSVLICVATGTGIAPFRSFWRRCFFENVPGWKFDGLFWLFMGVANSDSL  238

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LY+DE       +PDNFR D  LSREQKNK+GGKMY+QDK+EEY+D IFKLLDEGAHIYF
Sbjct  239  LYEDEIQAIKATYPDNFRVDYALSREQKNKSGGKMYIQDKVEEYADIIFKLLDEGAHIYF  298

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGI   L+RVA+ +GL++E    +LK   QWHVEVY
Sbjct  299  CGLKGMMPGITSMLERVAKAKGLNFEEFAEKLKHKNQWHVEVY  341



>ref|XP_005770769.1| hypothetical protein EMIHUDRAFT_432385 [Emiliania huxleyi CCMP1516]
 gb|EOD18340.1| hypothetical protein EMIHUDRAFT_432385 [Emiliania huxleyi CCMP1516]
Length=352

 Score =   228 bits (582),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 132/167 (79%), Gaps = 4/167 (2%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVP----TFKFNGLAWLFLGVAN  484
            GK++L+PE +PN   IM+ATGTG+AP+R ++RR+F+E  P      K  G AWLFLGVAN
Sbjct  186  GKVMLIPEKDPNVDLIMVATGTGIAPYRSFIRRLFVEKTPFGEAYTKGTGQAWLFLGVAN  245

Query  483  TDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGA  304
            +D+LLYDDE+ + L+ +PDNFR D  LSREQKNK+GGKMY+QDK+ EYSDEIF  +D GA
Sbjct  246  SDALLYDDEWQEVLKKYPDNFRLDYALSREQKNKDGGKMYIQDKVAEYSDEIFSKMDNGA  305

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            H+YFCGLKGMMPGI + L+ V +++GL WE KLS+ KK  QWHVEVY
Sbjct  306  HMYFCGLKGMMPGITEMLEGVCKDKGLVWEDKLSEWKKAGQWHVEVY  352



>gb|ABA55546.1| chloroplast ferredoxin-dependent NADP oxireductase [Karlodinium 
veneficum]
Length=382

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 127/164 (77%), Gaps = 1/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDS  475
            GK++LLPED P    IM+ATGTG+AP R +++RMF+E  P  K F GLAWLFLGVANTD+
Sbjct  219  GKVMLLPEDKPETDIIMVATGTGIAPMRSFIQRMFVEQTPYAKDFKGLAWLFLGVANTDA  278

Query  474  LLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIY  295
            LLYDD++       PD FRYD  LSREQ NK+GGKMY+QDK+EEYSDEIF  L +GAHIY
Sbjct  279  LLYDDDWKAIQAASPDQFRYDVALSREQTNKDGGKMYIQDKVEEYSDEIFDRLTKGAHIY  338

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            FCGLKGMMPGIQD LK+VA  +GL ++     LKKN QWHVEVY
Sbjct  339  FCGLKGMMPGIQDMLKKVAAAKGLDYDEFTKGLKKNGQWHVEVY  382



>ref|XP_005790923.1| hypothetical protein EMIHUDRAFT_361737 [Emiliania huxleyi CCMP1516]
 gb|EOD38494.1| hypothetical protein EMIHUDRAFT_361737 [Emiliania huxleyi CCMP1516]
Length=382

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 131/167 (78%), Gaps = 4/167 (2%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVP----TFKFNGLAWLFLGVAN  484
            GK++L+PE +PN   IM+ATGTG+AP+R ++RR+F+E  P      K +GLAWLFLGVAN
Sbjct  216  GKVMLIPEKDPNVDLIMVATGTGIAPYRSFIRRLFVEETPFGEAYTKGSGLAWLFLGVAN  275

Query  483  TDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGA  304
            +D+LLYDDE+   L+  P NFR D  LSREQKNK+GGKMY+QDK+ EYSDEIF  +D GA
Sbjct  276  SDALLYDDEWQSVLKAHPKNFRLDYALSREQKNKDGGKMYIQDKVAEYSDEIFTRMDNGA  335

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            H+YFCGLKGMMPGI + L+ V +E+GL WE KL+Q KK  QWHVEVY
Sbjct  336  HMYFCGLKGMMPGITEMLEGVCKEKGLKWEDKLTQWKKAGQWHVEVY  382



>ref|XP_003084170.1| ferredoxin-NADP reductase (ISS) [Ostreococcus tauri]
 emb|CAL58586.1| Ferredoxin-NADP+ reductase [Ostreococcus tauri]
Length=364

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 131/163 (80%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            G+++LLP+D P    IM+ATGTG+AP R YLRR F+E +P+++F GLAWLF+GVAN+D+ 
Sbjct  203  GQVMLLPKD-PATPVIMVATGTGIAPMRSYLRRFFLEDIPSWEFKGLAWLFMGVANSDAK  261

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF + ++ FPD FR D  LSRE  NKNGGKMY+QDK+EEY D++F+LLD GAH+YF
Sbjct  262  LYDDEFQEMVKRFPDQFRIDYALSREDTNKNGGKMYIQDKVEEYKDQVFQLLDGGAHMYF  321

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGI   L+ V +E+G+S+E  L  LKKN QWHVEVY
Sbjct  322  CGLKGMMPGILSMLEGVCKEKGISYEEWLEGLKKNGQWHVEVY  364



>gb|ABF73016.1| plastid ferredoxin NADPH reductase protein precursor [Karenia 
brevis]
Length=398

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 132/164 (80%), Gaps = 1/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDS  475
            GK++LLPED P    IM+ATGTG+AP+R +L+RMF+E  P  K F GLAWLFLGVAN+D+
Sbjct  235  GKVMLLPEDKPETDIIMVATGTGIAPYRSFLKRMFIEKTPFAKDFKGLAWLFLGVANSDA  294

Query  474  LLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIY  295
            LLYD+++    ++ PDNFRYD  LSRE  NK+GGKMY+QDK+EEY DE+F  LD+GAHIY
Sbjct  295  LLYDEDWKAIEKENPDNFRYDVALSREMTNKDGGKMYIQDKVEEYGDEVFDRLDKGAHIY  354

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            FCGLKGMMPGIQ  L++VA  +GL++E  + +LKKN QWHVEVY
Sbjct  355  FCGLKGMMPGIQGMLEKVAGAKGLNYEEFIKKLKKNGQWHVEVY  398



>ref|XP_002295321.1| ferredoxin-nadp reductase [Thalassiosira pseudonana CCMP1335]
 gb|EED87387.1| ferredoxin-nadp reductase [Thalassiosira pseudonana CCMP1335]
Length=339

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 128/164 (78%), Gaps = 1/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDS  475
            GK++L+PE++P   +IM+ATGTG+APFR ++RR+F E  P    + G AWLFLGVAN+D+
Sbjct  176  GKVMLMPEEDPKTDYIMVATGTGIAPFRSFVRRLFFEDTPAAAAYKGEAWLFLGVANSDA  235

Query  474  LLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIY  295
            LLYDDEF      +P+NFR D  LSREQ+NKNGGKMY+QDK+EEY+DE+F  LD GAHIY
Sbjct  236  LLYDDEFQDAKARYPENFRLDYALSREQENKNGGKMYIQDKVEEYADEVFNKLDNGAHIY  295

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            FCGLKGMMPGIQD L  V + +GL +E  + +LK  KQWHVEVY
Sbjct  296  FCGLKGMMPGIQDMLAEVCKSKGLDYEEWIKELKGKKQWHVEVY  339



>ref|XP_002954986.1| ferredoxin-NADP+ reductase [Volvox carteri f. nagariensis]
 gb|AAB40978.1| ferredoxin-NADP+ reductase [Volvox carteri]
 gb|EFJ43974.1| ferredoxin-NADP+ reductase [Volvox carteri f. nagariensis]
Length=346

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 128/163 (79%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK+LLLP D  NA  I +ATGTG+APFR + RR FME+VP++KF GL WLF+GVAN+D+ 
Sbjct  185  GKVLLLPADA-NAPLICVATGTGIAPFRSFWRRCFMENVPSYKFTGLFWLFMGVANSDAK  243

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+E     + +P  FR D  LSREQKN+ GGKMY+QDK+EEYSDEIF LLD GAH+YF
Sbjct  244  LYDEELQALAKAYPSQFRLDYALSREQKNRKGGKMYIQDKVEEYSDEIFDLLDNGAHMYF  303

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQ+ L+RVA+ +GL++E  +  LK   QWHVEVY
Sbjct  304  CGLKGMMPGIQEMLERVAKSKGLNYEEWVEGLKHRNQWHVEVY  346



>emb|CAA55406.1| ferredoxin NADP reductase [Chlamydomonas reinhardtii]
Length=255

 Score =   223 bits (568),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 128/163 (79%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK+LLLP D  NA  I +ATGTG+APFR + RR F+E+VP++KF GL WLF+GVAN+D+ 
Sbjct  94   GKVLLLPADA-NAPLICVATGTGIAPFRSFWRRCFIENVPSYKFTGLFWLFMGVANSDAK  152

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+E     + +P  FR D  LSREQ N+ GGKMY+QDK+EEY+DEIF LLD GAH+YF
Sbjct  153  LYDEELQAIAKAYPGQFRLDYALSREQNNRKGGKMYIQDKVEEYADEIFDLLDNGAHMYF  212

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQD L+RVA+E+GL++E  +  LK   QWHVEVY
Sbjct  213  CGLKGMMPGIQDMLERVAKEKGLNYEEWVEGLKHKNQWHVEVY  255



>ref|XP_001697352.1| ferredoxin-nadp reductase [Chlamydomonas reinhardtii]
 gb|EDP00292.1| ferredoxin-nadp reductase [Chlamydomonas reinhardtii]
Length=346

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 128/163 (79%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK+LLLP D  NA  I +ATGTG+APFR + RR F+E+VP++KF GL WLF+GVAN+D+ 
Sbjct  185  GKVLLLPADA-NAPLICVATGTGIAPFRSFWRRCFIENVPSYKFTGLFWLFMGVANSDAK  243

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+E     + +P  FR D  LSREQ N+ GGKMY+QDK+EEY+DEIF LLD GAH+YF
Sbjct  244  LYDEELQAIAKAYPGQFRLDYALSREQNNRKGGKMYIQDKVEEYADEIFDLLDNGAHMYF  303

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQD L+RVA+E+GL++E  +  LK   QWHVEVY
Sbjct  304  CGLKGMMPGIQDMLERVAKEKGLNYEEWVEGLKHKNQWHVEVY  346



>ref|XP_007510909.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66469.1| predicted protein [Bathycoccus prasinos]
Length=369

 Score =   225 bits (573),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 128/163 (79%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            G+++LLP+D P+   IM+ATGTG+AP R Y+RR F+E VP++ F GLAWLF+GVAN+D+ 
Sbjct  208  GQVMLLPKD-PSTPVIMVATGTGIAPMRAYIRRFFVEDVPSWNFTGLAWLFMGVANSDAT  266

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF + ++ FP  FR D  LSREQ NK GGKMY+QDK+EEY D++F LLD GAH+YF
Sbjct  267  LYDDEFQECVKRFPGQFRIDYALSREQNNKKGGKMYIQDKVEEYKDQVFGLLDGGAHMYF  326

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGI   L+ V +E+G+ +E  L  LKKN QWHVEVY
Sbjct  327  CGLKGMMPGILSMLEGVCKEKGIDYEEWLEGLKKNGQWHVEVY  369



>ref|XP_002180511.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC47919.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=298

 Score =   222 bits (565),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 131/164 (80%), Gaps = 1/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDS  475
            GK++L+PE+NP+  +IM+ATGTG+AP+RG++RR+F E  P  + + G AWLFLGVAN+D+
Sbjct  135  GKVMLMPEENPDTDYIMVATGTGIAPYRGFVRRLFTEKTPAAEAYKGQAWLFLGVANSDA  194

Query  474  LLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIY  295
            LLYDDE+ +   + P+ FR D  LSREQ+NK GGKMY+QDK+EEY+DEIF+ LD GAHIY
Sbjct  195  LLYDDEWQEVKTNNPNQFRLDYALSREQENKKGGKMYIQDKVEEYADEIFQKLDAGAHIY  254

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            FCGLKGMMPGIQ+ L+ V  ++G+ ++  L  LK  KQWHVEVY
Sbjct  255  FCGLKGMMPGIQEMLQTVCTQKGVEYDEWLKGLKAKKQWHVEVY  298



>ref|XP_001422240.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00557.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=360

 Score =   224 bits (570),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 128/163 (79%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            G+++LLP+D P    IM+ATGTG+AP R Y+RR F+E VP ++F GLAWLF+GVAN+D+ 
Sbjct  199  GQVMLLPKD-PATPVIMVATGTGIAPMRSYIRRFFLEDVPNWEFKGLAWLFMGVANSDAK  257

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF +  + FPD FR D  LSRE  NKNGGKMY+QDK+EEY D++F+LLD GAH+YF
Sbjct  258  LYDDEFQECAKRFPDQFRIDYALSREDTNKNGGKMYIQDKVEEYKDQVFQLLDGGAHMYF  317

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGI   L+ V +E+G+S+E  L  LKK  QWHVEVY
Sbjct  318  CGLKGMMPGILSMLEGVCKEKGISYEEWLEGLKKKGQWHVEVY  360



>sp|P53991.1|FENR_CHLRE RecName: Full=Ferredoxin--NADP reductase, chloroplastic; Short=FNR; 
Flags: Precursor [Chlamydomonas reinhardtii]
 gb|AAA79131.1| ferredoxin-NADP+ reductase [Chlamydomonas reinhardtii]
Length=354

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 127/163 (78%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK+LLLP D  NA  I +ATGTG+APFR + RR F+E+VP++KF GL WLF+GV N+D+ 
Sbjct  193  GKVLLLPADA-NAPLICVATGTGIAPFRSFWRRCFIENVPSYKFTGLFWLFMGVGNSDAK  251

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+E     + +P  FR D  LSREQ N+ GGKMY+QDK+EEY+DEIF LLD GAH+YF
Sbjct  252  LYDEELQAIAKAYPGQFRLDYALSREQNNRKGGKMYIQDKVEEYADEIFDLLDNGAHMYF  311

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGIQD L+RVA+E+GL++E  +  LK   QWHVEVY
Sbjct  312  CGLKGMMPGIQDMLERVAKEKGLNYEEWVEGLKHKNQWHVEVY  354



>ref|XP_002180502.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC47910.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=320

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 131/164 (80%), Gaps = 1/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDS  475
            GK++L+PE+NP+  +IM+ATGTG+AP+RG++RR+F E  P  + + G AWLFLGVAN+D+
Sbjct  157  GKVMLMPEENPDTDYIMVATGTGIAPYRGFVRRLFTEKTPAAEAYKGQAWLFLGVANSDA  216

Query  474  LLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIY  295
            LLYDDE+ +   + P+ FR D  LSREQ+NK GGKMY+QDK+EEY+DEIF+ LD GAHIY
Sbjct  217  LLYDDEWQEVKTNNPNQFRLDYALSREQENKKGGKMYIQDKVEEYADEIFQKLDAGAHIY  276

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            FCGLKGMMPGIQ+ L+ V  ++G+ ++  L  LK  KQWHVEVY
Sbjct  277  FCGLKGMMPGIQEMLQTVCTQKGVEYDEWLKGLKAKKQWHVEVY  320



>ref|XP_010910721.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like, 
partial [Elaeis guineensis]
Length=182

 Score =   216 bits (549),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 127/160 (79%), Gaps = 3/160 (2%)
 Frame = -3

Query  642  LLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYD  463
            +LL ED+PNATHIMIATGT +A   GYLRRMFME+VP  KF GLAWLFLG+ + D+LLYD
Sbjct  1    MLLLEDDPNATHIMIATGTEIA---GYLRRMFMEAVPMNKFGGLAWLFLGLTSIDNLLYD  57

Query  462  DEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGL  283
            DEF  YL++ PD  +       EQ+NK+G KMYVQDKIEEYSD+IF+ LDEG  IYFC L
Sbjct  58   DEFTSYLRNHPDKHQVQEFPILEQRNKSGRKMYVQDKIEEYSDKIFRFLDEGVFIYFCRL  117

Query  282  KGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            KG+M GIQDT +RVA +RG +W+ KLSQL+KNKQW+VE Y
Sbjct  118  KGVMLGIQDTPERVAVQRGENWDEKLSQLRKNKQWYVEFY  157



>gb|AAP79145.1| ferredoxin-NADP oxidoreductase [Bigelowiella natans]
Length=367

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 131/164 (80%), Gaps = 1/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTF-KFNGLAWLFLGVANTDS  475
            GK++L+PE+ P    IM+ATGTG+AP+RG+LRR+F+E+     KF GLAWLFLGVAN+D+
Sbjct  204  GKVMLMPEEKPETPIIMLATGTGIAPYRGFLRRLFVENTEAAEKFKGLAWLFLGVANSDA  263

Query  474  LLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIY  295
            LLYD+++    + +P+ FRYD  LSREQKNK+GGKMY+QDK+EEY  E+F+L++ GAHIY
Sbjct  264  LLYDEDWKAMQEKYPEKFRYDVALSREQKNKSGGKMYIQDKVEEYGKEVFELMNLGAHIY  323

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            FCGLKGMMPG+   ++ VA+ +G++WE  L + KK  QWHVEVY
Sbjct  324  FCGLKGMMPGVLGAMESVAKSQGVNWEETLQKWKKAGQWHVEVY  367



>gb|AAW79315.1| chloroplast ferredoxin NADP(+) reductase, partial [Isochrysis 
galbana]
 gb|ABA55514.1| chloroplast ferredoxin dependent NADH oxireductase, partial [Isochrysis 
galbana]
Length=367

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 127/164 (77%), Gaps = 1/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDS  475
            GK++L+PE +  A  IM+ATGTG+AP+R ++RR+F+E  P  + + GLAWLFLGVAN D+
Sbjct  204  GKVMLIPEQDATADLIMVATGTGIAPYRSFIRRLFVEKTPYGEVYKGLAWLFLGVANKDA  263

Query  474  LLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIY  295
            LLYDDE+   L+ +P NFR D  LSREQ NK+GGKMY+QDK+ EYSDEIF  +D GAH+Y
Sbjct  264  LLYDDEWQSVLKSYPKNFRVDYALSREQTNKDGGKMYIQDKVAEYSDEIFTRMDNGAHMY  323

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            FCGLKGMMPGI + L+ V++ +G+ WE KL + K   QWHVEVY
Sbjct  324  FCGLKGMMPGITEMLEGVSKAKGIVWEDKLKEWKSKGQWHVEVY  367



>emb|CBJ31206.1| hypothetical protein Esi_0238_0041 [Ectocarpus siliculosus]
Length=398

 Score =   220 bits (560),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 128/164 (78%), Gaps = 4/164 (2%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDS  475
            GKI+LLPE+ P+A  IM+ TGTG+AP+RG+L+R+F E  P  + F G AWLFLGVA T+ 
Sbjct  238  GKIMLLPEETPDADVIMVGTGTGIAPYRGFLQRLFKEDTPAARAFTGTAWLFLGVATTEG  297

Query  474  LLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIY  295
            LLY D++ + L+ FP NFR +    RE+KN +GGKMY+QD++E+Y+DE+F+ LD GAHIY
Sbjct  298  LLYHDDWMEMLRKFPFNFRCE---GREEKNASGGKMYIQDRVEQYADEVFERLDGGAHIY  354

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            FCGLKGMMPGI D L RVA ERG+SW+ KL +LK   QWHVEVY
Sbjct  355  FCGLKGMMPGITDMLARVAGERGISWDAKLKELKSKGQWHVEVY  398



>ref|XP_003064407.1| ferredoxin-NADP oxidoreductase [Micromonas pusilla CCMP1545]
 gb|EEH51312.1| ferredoxin-NADP oxidoreductase [Micromonas pusilla CCMP1545]
Length=383

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 128/163 (79%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            G+++LLPED P    IM+ATGTG+AP R Y+RR F+E V  ++F GLAWLF+GVAN+D+ 
Sbjct  222  GQVMLLPED-PATPVIMVATGTGIAPMRSYIRRFFVEDVKNWEFKGLAWLFMGVANSDAK  280

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDEF++ ++ FP  FR D  LSRE +N+ GGKMY+QDK+EEY D++F+LLD GAH+YF
Sbjct  281  LYDDEFSECIKRFPGQFRVDYALSRESQNRKGGKMYIQDKVEEYKDQVFQLLDGGAHMYF  340

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGI + L+ V +E+G+ +E  L  LKK  QWHVEVY
Sbjct  341  CGLKGMMPGILEMLEGVCKEKGIDYEEWLEGLKKKGQWHVEVY  383



>ref|XP_002500720.1| ferredoxin-NADP oxidoreductase chloroplast precursor [Micromonas 
sp. RCC299]
 gb|ACO61978.1| ferredoxin-NADP oxidoreductase chloroplast precursor [Micromonas 
sp. RCC299]
Length=368

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 128/163 (79%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            G+++LLP+D P    IM+ATGTG+AP R Y RR F+E V +++F GLAWLF+GVAN+D+ 
Sbjct  207  GQVMLLPKD-PATPVIMVATGTGIAPMRSYYRRFFVEDVKSWEFKGLAWLFMGVANSDAK  265

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYDDE  + ++ FP  FR D  LSREQ NKNGGKMY+QDK+EEY D+IF+LLD GAH+YF
Sbjct  266  LYDDEIQECIKRFPGQFRCDYALSREQTNKNGGKMYIQDKVEEYKDQIFQLLDGGAHMYF  325

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGMMPGI + L+ V +E+G+++E  L  LK+  QWHVEVY
Sbjct  326  CGLKGMMPGILEMLEGVCKEKGINYEEWLEGLKEKGQWHVEVY  368



>gb|KIY94893.1| ferredoxin--NADP+ reductase [Monoraphidium neglectum]
Length=174

 Score =   209 bits (531),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 123/162 (76%), Gaps = 8/162 (5%)
 Frame = -3

Query  624  NPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKY  445
            +P +  I +ATGTG+APFR + RR F E VP +KF+GL WLF+GVAN+DSLLY+DE    
Sbjct  13   SPKSVLICVATGTGIAPFRSFWRRCFYEDVPGWKFDGLFWLFMGVANSDSLLYEDEIQAI  72

Query  444  LQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPG  265
               +PDNFR D  LSREQKNK+GGKMY+QDK+EEY+D IFKLLDEGAHIYFCGLKGMMPG
Sbjct  73   KATYPDNFRVDYALSREQKNKSGGKMYIQDKVEEYADIIFKLLDEGAHIYFCGLKGMMPG  132

Query  264  IQDTLKRVAEERGLSWETKLSQLKKNK--------QWHVEVY  163
            I   L+RV++ +GL++E    +LK ++        QWHVEVY
Sbjct  133  ITSMLERVSKAKGLNFEEFAEKLKHSERGLSGPENQWHVEVY  174



>ref|XP_009040433.1| hypothetical protein AURANDRAFT_31888 [Aureococcus anophagefferens]
 gb|EGB04876.1| hypothetical protein AURANDRAFT_31888 [Aureococcus anophagefferens]
Length=336

 Score =   210 bits (535),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 126/164 (77%), Gaps = 1/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDS  475
            GK++L+PE+  +  +IM+ATGTG+AP+R ++RR+F E+ P  + + G AWLFLGVAN+D+
Sbjct  173  GKVMLMPEEKADTDYIMVATGTGIAPYRSFIRRLFTETTPAGEAYKGTAWLFLGVANSDA  232

Query  474  LLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIY  295
            LLYD+E+   L  +PDNF+ D  LSREQ N  GGKMY+QDK+EEY+DEIF  L +GA +Y
Sbjct  233  LLYDEEWQATLAKYPDNFKLDYALSREQSNSKGGKMYIQDKVEEYADEIFDRLGKGAVMY  292

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            FCGLKGMMPGIQD LK V +++GL ++  +  LKK  QW VEVY
Sbjct  293  FCGLKGMMPGIQDMLKSVCDKKGLDYDEYIKDLKKKGQWRVEVY  336



>ref|XP_011400423.1| Ferredoxin-NADP reductase, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM27456.1| Ferredoxin-NADP reductase, chloroplastic [Auxenochlorella protothecoides]
Length=293

 Score =   209 bits (531),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 118/163 (72%), Gaps = 1/163 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GKILLLPED      IM+ATGTG+AP+R + RR F+E VP + F GLAWLF+G AN+D+ 
Sbjct  132  GKILLLPEDQKTPV-IMVATGTGIAPYRAFWRRFFIEDVPGYNFEGLAWLFMGAANSDAT  190

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LYD+E     +  PD FR D  LSREQKN  GGKMY+QDKIEEY+DE+F LL  GAHIYF
Sbjct  191  LYDEEIQALAKAHPDQFRVDYALSREQKNSKGGKMYIQDKIEEYADEVFDLLSSGAHIYF  250

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CGLKGM+PGI + L+RVA  +G+ W     +LK   Q H+EVY
Sbjct  251  CGLKGMLPGILEMLERVAGTKGIDWPDFQQKLKHAGQLHIEVY  293



>ref|XP_009035092.1| hypothetical protein AURANDRAFT_23206 [Aureococcus anophagefferens]
 gb|EGB10278.1| hypothetical protein AURANDRAFT_23206 [Aureococcus anophagefferens]
Length=342

 Score =   208 bits (530),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 126/164 (77%), Gaps = 1/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDS  475
            GK++L+PE+  +  +IM+ATGTG+AP+R ++RR+F E+ P  + + G AWLFLGVAN+D+
Sbjct  179  GKVMLMPEEKADTDYIMVATGTGIAPYRSFIRRLFTETTPAGEAYKGTAWLFLGVANSDA  238

Query  474  LLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIY  295
            LLYD+E+   L  +PDNF+ D  LSREQ N  GGKMY+QDK+EEY+DEIF  L +GA +Y
Sbjct  239  LLYDEEWQATLAKYPDNFKLDYALSREQTNTKGGKMYIQDKVEEYADEIFDRLGKGAVMY  298

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            FCGLKGMMPGIQD LK V +++GL ++  +  LKK  QW VEVY
Sbjct  299  FCGLKGMMPGIQDMLKGVCDKKGLDYDEYIKGLKKAGQWRVEVY  342



>emb|CBN78345.1| ferredoxin-NADP oxidoreductase [Ectocarpus siliculosus]
Length=414

 Score =   207 bits (528),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 122/148 (82%), Gaps = 1/148 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDS  475
            GK++L+PED P    IMIATGTG+AP+R ++RR+F E+ P  + + G AWLFLGVAN+D+
Sbjct  222  GKVMLMPEDKPETDLIMIATGTGIAPYRSFVRRLFAEATPAKEAYKGQAWLFLGVANSDA  281

Query  474  LLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIY  295
            LLYD E+ + L++FPDNFR D  LSREQ+NK+GGKMY+QDK+EEY DE+F+ L +GAHIY
Sbjct  282  LLYDAEWQQVLKEFPDNFRLDYALSREQENKSGGKMYIQDKVEEYGDEVFQKLSKGAHIY  341

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWET  211
            FCGLKGMMPGI + L++VA ++ ++WET
Sbjct  342  FCGLKGMMPGILNMLEKVATKKKMNWET  369



>ref|XP_002977684.1| hypothetical protein SELMODRAFT_107413 [Selaginella moellendorffii]
 gb|EFJ21022.1| hypothetical protein SELMODRAFT_107413 [Selaginella moellendorffii]
Length=303

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 122/163 (75%), Gaps = 4/163 (2%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            G  LLL E+NP    IM+ TGTGVAPFRG+LRRMF+E VP FKF+GLAWLFLGVA++ SL
Sbjct  145  GSSLLLNEENPRGAQIMVGTGTGVAPFRGFLRRMFVEEVP-FKFDGLAWLFLGVASSKSL  203

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LY DEF +  +DFP +FRYD  LSRE  +++GGK YVQ +I+E   E+ +LL+ G HIYF
Sbjct  204  LYHDEFERIARDFPSSFRYDLALSREMVDRSGGKFYVQHRIKERGKEVLELLESGGHIYF  263

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CG + MM GIQ+T +++    G SW  KLS  K+NKQWHV+VY
Sbjct  264  CGREEMMEGIQETFRKLC---GDSWHEKLSGWKRNKQWHVDVY  303



>ref|XP_002979592.1| hypothetical protein SELMODRAFT_419219 [Selaginella moellendorffii]
 gb|EFJ19481.1| hypothetical protein SELMODRAFT_419219 [Selaginella moellendorffii]
Length=303

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 122/163 (75%), Gaps = 4/163 (2%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            G  LLL E+NP    IM+ TGTGVAPFRG+LRRMF+E VP FKF+GLAWLFLGVA++ SL
Sbjct  145  GSSLLLNEENPRGAQIMVGTGTGVAPFRGFLRRMFVEEVP-FKFDGLAWLFLGVASSKSL  203

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LY DEF +  +DFP +FRYD  LSRE  +++GGK YVQ +I+E   E+ +LL+ G HIYF
Sbjct  204  LYHDEFERIARDFPSSFRYDLALSREMVDRSGGKFYVQHRIKERGKEVLELLESGGHIYF  263

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CG + MM GIQ+T +++    G SW  KLS  K+NKQWHV+VY
Sbjct  264  CGREEMMEGIQETFRKLC---GDSWHEKLSGWKRNKQWHVDVY  303



>ref|XP_002974410.1| hypothetical protein SELMODRAFT_101002 [Selaginella moellendorffii]
 gb|EFJ24632.1| hypothetical protein SELMODRAFT_101002 [Selaginella moellendorffii]
Length=304

 Score =   202 bits (513),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 121/163 (74%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LL E NP+ +HIM+ATGTGVAPFRG+L+R+  + + + KF G AWLF+G      L
Sbjct  142  GKLMLLNESNPSDSHIMVATGTGVAPFRGFLQRLLEDKMGSRKFEGSAWLFMGAPTAGRL  201

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LY++EF +Y +D P +FRYD  LSRE  NK GG+ YVQD++EE+ +EIFKLLD G+HIYF
Sbjct  202  LYNEEFERYARDRPLSFRYDTALSRESCNKRGGRFYVQDRMEEHGEEIFKLLDGGSHIYF  261

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CG K M+ G++   + VA   G  W  KL++LKKN+QWHVEVY
Sbjct  262  CGRKDMLVGVEAVFEEVARRMGEDWRGKLAKLKKNRQWHVEVY  304



>ref|XP_002985709.1| hypothetical protein SELMODRAFT_122698 [Selaginella moellendorffii]
 gb|EFJ13287.1| hypothetical protein SELMODRAFT_122698 [Selaginella moellendorffii]
Length=304

 Score =   201 bits (511),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 120/163 (74%), Gaps = 0/163 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LL E NP+ +HIM+ATGTGVAPFRG+L+R+  + +   KF G AWLF+G      L
Sbjct  142  GKLMLLNESNPSDSHIMVATGTGVAPFRGFLQRLLEDKMRPRKFEGSAWLFMGAPTAGRL  201

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYF  292
            LY++EF +Y +D P +FRYD  LSRE  NK GG+ YVQD++EE+ +EIFKLLD G+HIYF
Sbjct  202  LYNEEFERYARDLPWSFRYDTALSRESCNKRGGRFYVQDRMEEHGEEIFKLLDGGSHIYF  261

Query  291  CGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            CG K M+ G++   + VA   G  W  KL++LKKN+QWHVEVY
Sbjct  262  CGRKDMLVGVEAVFEEVARRMGEDWRGKLAKLKKNRQWHVEVY  304



>ref|XP_005789289.1| hypothetical protein EMIHUDRAFT_42969, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD36860.1| hypothetical protein EMIHUDRAFT_42969, partial [Emiliania huxleyi 
CCMP1516]
Length=320

 Score =   195 bits (495),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 118/170 (69%), Gaps = 7/170 (4%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTF-KFNGLAWLFLGVANTDS  475
            GK++L+PE  P    IM+ATGTG+AP+RG+LRR+F+E  P    F GLAWLFLGVAN D+
Sbjct  151  GKVMLMPEHEPATDLIMLATGTGIAPYRGFLRRLFLEPTPAADAFRGLAWLFLGVANRDA  210

Query  474  LLYDDEFAKYLQD------FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLD  313
            LLYDDE+   LQ            R D    R      GGKMY+QDK+ +++DE+F+ +D
Sbjct  211  LLYDDEWQAILQRETARGRSAAQGREDGARRRSATRPVGGKMYIQDKVAQHADEVFERMD  270

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
             GAH+YFCGLKGMMPGI + L+ V +E+GL WE KLS+ KK  QWHVEVY
Sbjct  271  NGAHMYFCGLKGMMPGITEMLEGVCKEKGLVWEDKLSEWKKAGQWHVEVY  320



>ref|WP_025782058.1| hypothetical protein, partial [Candidatus Synechococcus spongiarum]
Length=175

 Score =   187 bits (474),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 113/168 (67%), Gaps = 6/168 (4%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMF----MESVPTFKFNGLAWLFLGVAN  484
            GK +LLP D   A  IM+ATGTG+AP R YLRRMF        P + F G AWLF+GV  
Sbjct  9    GKEMLLPADE-EANVIMLATGTGIAPMRAYLRRMFDPGERAKNPDYAFRGKAWLFMGVPT  67

Query  483  TDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLD-EG  307
            T +LLY+DEF  YL  +P+NFRY + +SREQKN  GG+MY+Q ++ EY+DEIF L++ + 
Sbjct  68   TPNLLYEDEFQSYLNAYPENFRYTKAISREQKNSEGGRMYIQHRVAEYADEIFNLINLDA  127

Query  306  AHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
             H+Y CGL+GM PGI + +   A  RGL W+    QLKK  +WHVE Y
Sbjct  128  THLYMCGLRGMEPGIDEAMTAAASARGLDWKNLRPQLKKAGRWHVETY  175



>ref|XP_010103488.1| Ferredoxin--NADP reductase, embryo isozyme [Morus notabilis]
 gb|EXC46730.1| Ferredoxin--NADP reductase, embryo isozyme [Morus notabilis]
Length=295

 Score =   190 bits (483),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 118/162 (73%), Gaps = 5/162 (3%)
 Frame = -3

Query  648  KILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLL  469
            + +LL + +PNATHI +ATGTGVAPFR +LRR F E +PTF+F+GLAWLF GV N+DS L
Sbjct  139  EAMLLGDFSPNATHIFVATGTGVAPFRAHLRRFFKEDIPTFRFSGLAWLFHGVVNSDSQL  198

Query  468  YDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFC  289
            Y +EF +YL+D P+NFRYD   SR Q+ K     YVQD + + +DE+F LL  GA+IY  
Sbjct  199  YGEEFEQYLKDNPENFRYDVAFSRVQQKK-----YVQDAVADKADEVFDLLLNGAYIYLA  253

Query  288  GLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            GL+GM+  I++ LK VAE++ L WE  L+ LK N QW VEVY
Sbjct  254  GLQGMVSPIEEALKIVAEKKQLDWEAVLAALKANNQWRVEVY  295



>ref|XP_005848997.1| hypothetical protein CHLNCDRAFT_35035 [Chlorella variabilis]
 gb|EFN56895.1| hypothetical protein CHLNCDRAFT_35035 [Chlorella variabilis]
Length=358

 Score =   190 bits (483),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 116/169 (69%), Gaps = 7/169 (4%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWL-----FLGV-  490
            GK+LLLPED PNA  I +ATGTG+APFR + RRMFME++P +KF G   L     F  + 
Sbjct  191  GKVLLLPED-PNAVVICVATGTGIAPFRTFWRRMFMENIPGYKFTGAGPLARRRGFRALR  249

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDE  310
                  LYD+E A     +PD FR D  LSREQ+N  GGKMY+QDK+EEYSDE+F LL+ 
Sbjct  250  GGGGPRLYDEEMAACAAAYPDQFRLDYALSREQQNVRGGKMYIQDKVEEYSDEVFDLLNN  309

Query  309  GAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            GAHIYFCGLKGMMPGI + L+RVA  +GL++      LK   Q HVEVY
Sbjct  310  GAHIYFCGLKGMMPGILEMLERVATGKGLNYAEWFEGLKHKNQVHVEVY  358



>emb|CDY51794.1| BnaC03g75370D [Brassica napus]
Length=242

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK++LLPE++PN THIMIATGTGVAP+RGYLRRMFME++P +KF GL WLF+GVANTD L
Sbjct  130  GKVMLLPENDPNVTHIMIATGTGVAPYRGYLRRMFMENLPNYKFGGLDWLFVGVANTDIL  189

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYS  337
            LYDDEF KYL+D PDNFR+D+ LSREQKNK GGKMYVQDKIEEYS
Sbjct  190  LYDDEFNKYLKDHPDNFRFDKALSREQKNKKGGKMYVQDKIEEYS  234



>ref|WP_035831811.1| ferredoxin-NADP reductase [Cyanobium sp. CACIAM 14]
 gb|KEF41796.1| ferredoxin-NADP reductase [Cyanobium sp. CACIAM 14]
Length=391

 Score =   188 bits (478),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 117/168 (70%), Gaps = 6/168 (4%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMF----MESVPTFKFNGLAWLFLGVAN  484
            GK +LLP +  +A  IM+ATGTG+AP R YLRRMF     E  P ++F G AWLF+GV  
Sbjct  225  GKEMLLPPEE-DANIIMLATGTGIAPMRAYLRRMFEPAEREKNPEYQFRGKAWLFMGVPK  283

Query  483  TDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEG  307
            T +LLY+D+F +YL  +PD+FRY + +SREQ+N +GG+MY+QD++ E++DEIF L+ D  
Sbjct  284  TANLLYEDDFQRYLSKYPDHFRYTKAISREQQNPSGGRMYIQDRVTEHADEIFSLIEDPK  343

Query  306  AHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
             H+Y CGL+GM PGI + +   A  +GL W     QLKK  +WHVE Y
Sbjct  344  THVYMCGLRGMEPGIDEAMTTAAAAKGLDWSELRPQLKKADRWHVETY  391



>ref|WP_006170829.1| ferredoxin--NADP reductase [Synechococcus sp. WH 5701]
 gb|EAQ74003.1| ferredoxin--NADP reductase (FNR) [Synechococcus sp. WH 5701]
Length=385

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 116/168 (69%), Gaps = 6/168 (4%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMF----MESVPTFKFNGLAWLFLGVAN  484
            GK +LLP D  +A  IM+ATGTG+AP R YLRRMF        P ++F G AWL +GV  
Sbjct  219  GKEMLLPPDE-DANVIMLATGTGIAPMRAYLRRMFDPGERAKNPGYQFRGKAWLIMGVPT  277

Query  483  TDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEG  307
            T +LLY+++   YL +FPDNFRY + +SREQ+N +GG+MY+QD++ E+ DEIF ++ D  
Sbjct  278  TPNLLYEEDLQGYLAEFPDNFRYTKAISREQQNPSGGRMYIQDRVAEHGDEIFTMIEDSK  337

Query  306  AHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
             H+Y CGL+GM PGI + + + AE +GL+W     QLKK  +WHVE Y
Sbjct  338  THVYMCGLRGMEPGIDEAMSKAAESKGLNWSELRPQLKKADRWHVETY  385



>ref|WP_011825598.1| ferredoxin--NADP reductase [Prochlorococcus marinus]
 gb|ABM77692.1| ferredoxin-NADP oxidoreductase (FNR) [Prochlorococcus marinus 
str. MIT 9303]
Length=366

 Score =   185 bits (470),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 116/167 (69%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFM---ESVPTFKFNGLAWLFLGVANT  481
            GK +LLP+D   A  IM+ATGTG+AP R YLRRMF     S   +KF G AWLF+G   T
Sbjct  201  GKEMLLPDDE-EANVIMLATGTGIAPMRAYLRRMFEPTERSKNGWKFRGKAWLFMGAPYT  259

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEG-A  304
             +LLYDD+F +YL++FPDNF Y + +SREQ+N  GG+MY+QD++ EYSD+IFK+++    
Sbjct  260  ANLLYDDDFERYLREFPDNFIYTKAISREQQNSKGGRMYIQDRVMEYSDQIFKMIENPKT  319

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            H+Y CGLKGM PGI + +   A  +G+ W     QLKK  +WHVE Y
Sbjct  320  HVYMCGLKGMEPGIDEAMTAAATAKGIDWSELRPQLKKAHRWHVETY  366



>ref|WP_043326144.1| ferredoxin-NADP reductase [Cyanobium gracile]
Length=390

 Score =   186 bits (471),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 117/168 (70%), Gaps = 6/168 (4%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESV----PTFKFNGLAWLFLGVAN  484
            GK +LLP D  +A  IM+ATGTG+AP R YLRRMF  S     P ++F G AWL +GV  
Sbjct  224  GKEMLLPPDE-DANIIMLATGTGIAPMRAYLRRMFEPSERAKNPEYQFRGKAWLIMGVPK  282

Query  483  TDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEG  307
            T +LLY+D+F +YL ++P+NFRY + +SREQ+N +GG+MY+QD++ E++DEIF L+ D  
Sbjct  283  TPNLLYEDDFQRYLTEYPENFRYTKAISREQQNPSGGRMYIQDRVTEHADEIFSLIEDPK  342

Query  306  AHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
             H+Y CGL+GM PGI + +   A  +GL W     QLKK  +WHVE Y
Sbjct  343  THVYMCGLRGMEPGIDEAMTAAAAAKGLDWSELRPQLKKADRWHVETY  390



>gb|AFY27502.1| Oxidoreductase NAD-binding domain/CpcD/allophycocyanin linker 
domain protein [Cyanobium gracile PCC 6307]
Length=401

 Score =   186 bits (471),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 117/168 (70%), Gaps = 6/168 (4%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESV----PTFKFNGLAWLFLGVAN  484
            GK +LLP D  +A  IM+ATGTG+AP R YLRRMF  S     P ++F G AWL +GV  
Sbjct  235  GKEMLLPPDE-DANIIMLATGTGIAPMRAYLRRMFEPSERAKNPEYQFRGKAWLIMGVPK  293

Query  483  TDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEG  307
            T +LLY+D+F +YL ++P+NFRY + +SREQ+N +GG+MY+QD++ E++DEIF L+ D  
Sbjct  294  TPNLLYEDDFQRYLTEYPENFRYTKAISREQQNPSGGRMYIQDRVTEHADEIFSLIEDPK  353

Query  306  AHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
             H+Y CGL+GM PGI + +   A  +GL W     QLKK  +WHVE Y
Sbjct  354  THVYMCGLRGMEPGIDEAMTAAAAAKGLDWSELRPQLKKADRWHVETY  401



>ref|WP_036920327.1| ferredoxin-NADP reductase [Prochlorococcus marinus]
Length=333

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 119/167 (71%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMES---VPTFKFNGLAWLFLGVANT  481
            GK +LLPED  +A  +M+ATGTG+AP R YLRRMF  S      + F G AWLF+G   +
Sbjct  168  GKEMLLPEDE-DANIVMLATGTGIAPMRAYLRRMFEPSEREKNNWNFKGKAWLFMGAPKS  226

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGA  304
             +LLY+++  +YLQ++PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  
Sbjct  227  ANLLYEEDLQRYLQNYPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKT  286

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            HIY CGLKGM PGI + + + AEE+GL+W     QL+K  +WHVE Y
Sbjct  287  HIYLCGLKGMEPGIDEAMTKAAEEKGLNWAELRPQLRKAGRWHVETY  333



>ref|YP_002049405.1| ferredoxin--NADP reductase (FNR) [Paulinella chromatophora]
 gb|ACB43195.1| ferredoxin--NADP reductase (FNR) [Paulinella chromatophora]
Length=381

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 115/168 (68%), Gaps = 6/168 (4%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMF----MESVPTFKFNGLAWLFLGVAN  484
            GK +LLP D   A  IM+ATGTG+AP R YLRRMF        P ++F G AWLF+G   
Sbjct  215  GKEMLLPADE-MANVIMLATGTGIAPMRTYLRRMFEPGERSKNPEYQFRGKAWLFMGAPT  273

Query  483  TDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEG  307
            T +LLYDD+F +Y  +FP+NFRY + +SREQ+N +GG+MY+QD++ E++DEIF ++ D  
Sbjct  274  TANLLYDDDFNRYQSEFPENFRYTKAISREQQNTSGGRMYIQDRVTEHADEIFGMIEDSR  333

Query  306  AHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
             H+Y CGL+GM PGI   +   A+ +G +W     QLKK ++WHVE Y
Sbjct  334  THVYMCGLRGMEPGIDQAMTAAAQAKGFNWAELRPQLKKAERWHVETY  381



>gb|ABO17805.1| ferredoxin-NADP oxidoreductase (FNR) [Prochlorococcus marinus 
str. MIT 9301]
Length=321

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 119/170 (70%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLPE+  +A  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  156  GKEMLLPEEE-DANIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  211

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D+PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  212  PKSANLLYEEDLQRYLSDYPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  271

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  272  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  321



>ref|WP_036911108.1| MULTISPECIES: ferredoxin-NADP reductase [Prochlorococcus]
 gb|KGG28948.1| Ferredoxin-NADP(+) reductase [Prochlorococcus sp. MIT 0701]
 gb|KGG30621.1| Ferredoxin-NADP(+) reductase [Prochlorococcus sp. MIT 0702]
 gb|KGG36658.1| Ferredoxin-NADP(+) reductase [Prochlorococcus sp. MIT 0703]
Length=366

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 117/167 (70%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFM---ESVPTFKFNGLAWLFLGVANT  481
            GK +LLP+D  +A  IM+ATGTG+AP R YLRRMF     S   +KF G AWLF+G   T
Sbjct  201  GKEMLLPDDE-DANVIMLATGTGIAPMRAYLRRMFEPAERSKNGWKFRGKAWLFMGAPYT  259

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEG-A  304
             +LLYD++  +Y ++FPDNFRY + +SREQ+N  GG+MY+QD++ E+SDEIFK+++    
Sbjct  260  ANLLYDEDLNRYEREFPDNFRYTKAISREQQNSKGGRMYIQDRVMEHSDEIFKMIESPKT  319

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            H+Y CGLKGM PGI + +   A  +G++W     QLKK  +WHVE Y
Sbjct  320  HVYMCGLKGMEPGIDEAMTAAASAKGINWSELRPQLKKAHRWHVETY  366



>ref|XP_002291633.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED91740.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=294

 Score =   181 bits (459),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 117/166 (70%), Gaps = 4/166 (2%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFME-SVPTFKFNGLAWLFLGVANTDS  475
            GK +LLPED P    IM+ATGTG+APFRG++ R+FME ++    F G AWL LGV  +  
Sbjct  130  GKTMLLPED-PTKDVIMVATGTGIAPFRGFMHRLFMENTLARHMFGGSAWLVLGVPVSGG  188

Query  474  LLYDDEFAKYLQDF-PDNFRYDRVLSREQKNK-NGGKMYVQDKIEEYSDEIFKLLDEGAH  301
            LLY +EF   L++  P+  R D  +SRE  N  +GGK+YVQ  I +   E+F  LD GAH
Sbjct  189  LLYKEEFDCMLRNASPNQLRIDYAISREMTNTIDGGKLYVQHVIAQNGKELFNRLDNGAH  248

Query  300  IYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            IYFCGLKGM+PGI ++L+ VA+E+G+ W  KLS+LKKN QWHVEVY
Sbjct  249  IYFCGLKGMLPGILESLEGVAKEQGVDWTAKLSELKKNNQWHVEVY  294



>ref|WP_010317887.1| ferredoxin--NADP reductase [Synechococcus sp. CB0205]
Length=391

 Score =   184 bits (466),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 115/167 (69%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPT---FKFNGLAWLFLGVANT  481
            GK +LLPED   A  IM+ATGTG+AP R YLRRMF  +      + F G AWLF+G   T
Sbjct  226  GKEMLLPEDE-EANIIMLATGTGIAPMRTYLRRMFEPAEREKNGWNFRGKAWLFMGAPTT  284

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGA  304
             +LLYDD+F +Y ++FP+NFRY + +SREQKN NGG+MY+QD++ E +DEIF ++ D   
Sbjct  285  ANLLYDDDFNRYEREFPENFRYTKAISREQKNANGGRMYIQDRVSENADEIFAMIEDPKT  344

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            H+Y CGL+GM PGI + +   A  +GL W     +LKK ++WHVE Y
Sbjct  345  HVYMCGLRGMEPGIDEAMTTAAAAKGLDWSELRPKLKKAERWHVETY  391



>ref|WP_025970824.1| ferredoxin-NADP reductase, partial [Prochlorococcus sp. scB245a_521M10]
Length=187

 Score =   177 bits (450),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 118/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLPE+  ++  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  22   GKEMLLPEEE-DSNIVMLATGTGIAPMRAYLRRMF---EPTEKEKNKWNFKGKAWLFMGA  77

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  78   PKSANLLYEEDLQRYLVDNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  137

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  138  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  187



>ref|WP_025930500.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB241_528O2]
Length=375

 Score =   183 bits (464),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 118/167 (71%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVP---TFKFNGLAWLFLGVANT  481
            GK +LLP D  ++  +M+ATGTG+AP R YLRRMF  +      + F G AWLF+G   +
Sbjct  210  GKEMLLP-DEEDSNIVMLATGTGIAPMRAYLRRMFESTEKEKNNWNFKGKAWLFMGAPKS  268

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGA  304
             +LLY+++  +YL D+PDNF+Y + +SREQ+N NGG+MY+QD++ E ++E+F ++ DE  
Sbjct  269  ANLLYEEDLQRYLNDYPDNFKYTKAISREQQNTNGGRMYIQDRVLESANELFNMIEDEKT  328

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  329  HIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_011130473.1| ferredoxin--NADP reductase [Prochlorococcus marinus]
 emb|CAE21276.1| ferredoxin-NADP oxidoreductase [Prochlorococcus marinus str. 
MIT 9313]
Length=366

 Score =   182 bits (463),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 116/167 (69%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFM---ESVPTFKFNGLAWLFLGVANT  481
            GK +LLP+D   A  IM+ATGTG+AP R YLRRMF     S   +KF G AWLF+G   T
Sbjct  201  GKEMLLPDDE-EANVIMLATGTGIAPMRAYLRRMFEPTERSKNGWKFRGKAWLFMGAPYT  259

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEG-A  304
             +LLYD++F +YL++FPDNF Y + +SREQ+N  GG+MY+QD++ EY+D+IFK+++    
Sbjct  260  ANLLYDEDFERYLREFPDNFIYTKAISREQQNPKGGRMYIQDRVMEYADQIFKMIENPKT  319

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            H+Y CGLKGM PGI + +   A  +G+ W     QLKK  +WHVE Y
Sbjct  320  HVYMCGLKGMEPGIDEAMTAAATAKGIDWSELRPQLKKAHRWHVETY  366



>ref|WP_041484700.1| ferredoxin-NADP reductase [Prochlorococcus marinus]
Length=370

 Score =   182 bits (463),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 119/170 (70%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLPE+  +A  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  205  GKEMLLPEEE-DANIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  260

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D+PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  261  PKSANLLYEEDLQRYLSDYPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  320

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  321  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>gb|AFZ48005.1| oxidoreductase FAD/NAD(P)-binding domain protein [Cyanobacterium 
stanieri PCC 7202]
Length=287

 Score =   180 bits (457),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 118/166 (71%), Gaps = 4/166 (2%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESV--PTFKFNGLAWLFLGVANTD  478
            GK +LLP+D  +AT +M+ATGTG+APFR +L RMF E    P ++F GLAWL  G+  T 
Sbjct  123  GKEMLLPDDE-DATIVMLATGTGIAPFRAFLWRMFKERELNPDYQFKGLAWLVFGIPYTQ  181

Query  477  SLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDE-GAH  301
            ++LY +E  K  Q++PDNFR    +SREQK ++GGKMYVQ ++ EY+DE+F+L+ +   H
Sbjct  182  NILYKEELEKMAQEYPDNFRLTYAISREQKTEDGGKMYVQSRVSEYADELFELIQKPNTH  241

Query  300  IYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            +Y CGLKGM P I +T    AE+RG++W+    Q+KK  +WHVEVY
Sbjct  242  VYMCGLKGMEPPISETFTAEAEKRGMNWDEMRKQMKKEDRWHVEVY  287



>ref|WP_011359557.1| ferredoxin--NADP reductase [Synechococcus sp. CC9902]
 gb|ABB25717.1| ferredoxin--NADP reductase (FNR) [Synechococcus sp. CC9902]
Length=398

 Score =   183 bits (465),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 115/167 (69%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMES---VPTFKFNGLAWLFLGVANT  481
            GK +LLPED  +A  IM+ATGTG+AP R YLRRMF         + F G AWLF+G   T
Sbjct  233  GKEMLLPEDE-DANIIMLATGTGIAPMRTYLRRMFESKERKANGWSFKGKAWLFMGAPKT  291

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGA  304
             +LLYDD+F  YL+++PDNFRY + +SRE++N  GG+MY+QD++ E++DEIF ++ D   
Sbjct  292  ANLLYDDDFNNYLKEYPDNFRYTKAISREEQNSKGGRMYIQDRVSEHADEIFAMIEDPKT  351

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            H+Y CGL+GM PGI + +   A  +GL W+    QLKK  +WHVE Y
Sbjct  352  HVYMCGLRGMEPGIDEAMSAAAAAKGLDWKELRPQLKKADRWHVETY  398



>ref|WP_036896868.1| ferredoxin-NADP reductase [Prochlorococcus marinus]
Length=365

 Score =   182 bits (462),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 118/167 (71%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMES---VPTFKFNGLAWLFLGVANT  481
            GK +LLPED  +A  +M+ATGTG+AP R YLRRMF  S      + F G AWLF+G   +
Sbjct  200  GKEMLLPEDE-DANIVMLATGTGIAPMRAYLRRMFEPSEREKNNWNFKGKAWLFMGAPKS  258

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGA  304
             +LLY+++  +YL ++PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  
Sbjct  259  ANLLYEEDLQRYLANYPDNFKYTKAISREQQNAKGGRMYIQDRVTESANELFNMIEDEKT  318

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            HIY CGLKGM PGI + + + A+E+GL+W     QL+K  +WHVE Y
Sbjct  319  HIYLCGLKGMEPGIDEAMTKAAQEKGLNWAELRPQLRKAGRWHVETY  365



>gb|KDD75893.1| hypothetical protein H632_c449p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=327

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 119/164 (73%), Gaps = 2/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFN-GLAWLFLGVANTDS  475
            GK+LL+P D+P+A  I +ATGTG+APFR + RR F E+VP+ +   G  WLF+GVAN+D+
Sbjct  165  GKLLLMP-DDPHADVITVATGTGIAPFRAFWRRRFFEAVPSEQGGRGHMWLFMGVANSDA  223

Query  474  LLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIY  295
             LY  E     Q  P  FR D  LSREQ N +GGKMYVQD++E+++DE+F  L  GAHIY
Sbjct  224  KLYASEIEAVEQAHPTRFRVDYALSREQTNASGGKMYVQDRLEQHADEVFDRLSAGAHIY  283

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            FCGLKGM+PGI +TL+RVA E+G+ W   L  LKK  +WHVEVY
Sbjct  284  FCGLKGMLPGILETLERVAGEKGIDWPAFLEGLKKEHRWHVEVY  327



>ref|WP_002806441.1| ferredoxin--NADP reductase [Prochlorococcus marinus]
 gb|EEE40085.1| ferredoxin--NADP reductase [Prochlorococcus marinus str. MIT 
9202]
Length=394

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 118/167 (71%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVP---TFKFNGLAWLFLGVANT  481
            GK +LLPE+  +A  +M+ATGTG+AP R YLRRMF  +      + F G AWLF+G   +
Sbjct  229  GKEMLLPEEE-DANIVMLATGTGIAPMRAYLRRMFEATEKEKNNWNFKGKAWLFMGAPKS  287

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGA  304
             +LLY+++  +YL DFPDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  
Sbjct  288  ANLLYEEDLQRYLSDFPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKT  347

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            HIY CGLKGM PGI + + + A+E+GL+W     QLKK  +WHVE Y
Sbjct  348  HIYLCGLKGMEPGIDEAMTKAAQEKGLNWSDLRPQLKKAGRWHVETY  394



>ref|WP_011132708.1| ferredoxin--NADP reductase [Prochlorococcus marinus]
 emb|CAE19534.1| ferredoxin-NADP oxidoreductase (FNR) [Prochlorococcus marinus 
subsp. pastoris str. CCMP1986]
 gb|KGF88762.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. EQPAC1]
Length=370

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 117/167 (70%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVP---TFKFNGLAWLFLGVANT  481
            GK +LLP D  +A  +M+ATGTG+AP R YLRRMF  +      + F G AWLF+G   +
Sbjct  205  GKEMLLP-DEEDANIVMLATGTGIAPMRAYLRRMFEATEKEKNKWNFKGKAWLFMGAPKS  263

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGA  304
             +LLY+++  +YL+ +PDNF+Y + +SREQ+N  GG+MY+QD++ E ++EIF ++ DE  
Sbjct  264  ANLLYEEDLQRYLETYPDNFKYTKAISREQQNTKGGRMYIQDRVLESANEIFNMIEDEKT  323

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  324  HIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_032527499.1| ferredoxin-NADP reductase [Prochlorococcus marinus]
 gb|KGF96481.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. MIT 
9302]
Length=369

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 117/167 (70%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVP---TFKFNGLAWLFLGVANT  481
            GK +LLP D  +A  +M+ATGTG+AP R YLRRMF  +      + F G AWLF+G   +
Sbjct  204  GKEMLLP-DEEDANIVMLATGTGIAPMRAYLRRMFEATEKEKNKWNFKGKAWLFMGAPKS  262

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGA  304
             +LLY+++  +YL D+PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  
Sbjct  263  ANLLYEEDLQRYLTDYPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKT  322

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  323  HIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  369



>ref|WP_032524602.1| ferredoxin-NADP reductase [Prochlorococcus marinus]
 gb|KGF87384.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. GP2]
Length=380

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 117/167 (70%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVP---TFKFNGLAWLFLGVANT  481
            GK +LLP D  +A  +M+ATGTG+AP R YLRRMF  +      + F G AWLF+G   +
Sbjct  215  GKEMLLP-DEEDANIVMLATGTGIAPMRAYLRRMFEATEKEKNNWNFKGKAWLFMGAPKS  273

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGA  304
             +LLY+++  +YL D+PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  
Sbjct  274  ANLLYEEDLQRYLVDYPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKT  333

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  334  HIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  380



>ref|WP_009790228.1| ferredoxin--NADP reductase [Synechococcus sp. BL107]
 gb|EAU72189.1| ferredoxin--NADP reductase (FNR) [Synechococcus sp. BL107]
Length=398

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 116/167 (69%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFME---SVPTFKFNGLAWLFLGVANT  481
            GK +LLPED  +A  IM+ATGTG+AP R YLRRMF     +   + F G AWLF+G   T
Sbjct  233  GKEMLLPEDE-DANIIMLATGTGIAPMRTYLRRMFESKERNANGWSFKGKAWLFMGAPKT  291

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGA  304
             +LLYDD+F  YL+++PDNFRY + +SRE++N  GG+MY+QD++ E++DEIF ++ D   
Sbjct  292  ANLLYDDDFNHYLKEYPDNFRYTKAISREEQNSKGGRMYIQDRVSEHADEIFAMIEDPKT  351

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            H+Y CGL+GM PGI + +   A  +GL W+    QLKK  +WHVE Y
Sbjct  352  HVYMCGLRGMEPGIDEAMAAAAAAKGLDWKELRPQLKKADRWHVETY  398



>ref|WP_025965632.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB243_496M6]
Length=369

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 118/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLPE+  +A  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  204  GKEMLLPEEE-DANIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  259

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  260  PKSANLLYEEDLQRYLSDNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  319

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  320  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  369



>ref|WP_012195665.1| ferredoxin--NADP reductase [Prochlorococcus marinus]
 gb|ABX09044.1| ferredoxin-NADP oxidoreductase (FNR) [Prochlorococcus marinus 
str. MIT 9211]
Length=361

 Score =   180 bits (456),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 112/167 (67%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMF---MESVPTFKFNGLAWLFLGVANT  481
            GK +LLPED  NA  IM+ATGTG+AP R YLRRMF    +   ++ + G AWLF+G   T
Sbjct  196  GKEMLLPEDE-NANIIMLATGTGIAPMRAYLRRMFDPTEQEKNSWNYKGNAWLFMGAPKT  254

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEG-A  304
             +LLYD +F  Y   FP+N RY + +SREQKN  GG+MY+QD++ E++DEIF L++    
Sbjct  255  ANLLYDSDFEGYKSKFPNNLRYTKAISREQKNARGGRMYIQDRVLEHADEIFALIENPKT  314

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            HIY CGLKGM PGI + + + A  +GL W     QLKK  +WHVE Y
Sbjct  315  HIYLCGLKGMEPGIDEAMTQAAASKGLVWSELRPQLKKAGRWHVETY  361



>ref|XP_010536399.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=255

 Score =   177 bits (448),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 115/164 (70%), Gaps = 2/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK +L+P+D PNAT IM+ATGTG+APFR +L +MF E    ++FNGLAWLFLGV  T SL
Sbjct  93   GKEMLMPKD-PNATVIMLATGTGIAPFRSFLWKMFFEKHSDYEFNGLAWLFLGVPTTSSL  151

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIY  295
            LY +EF K     P+NFR D  +SREQ N+ G KMY+Q ++ EY+DE+++LL  +  +IY
Sbjct  152  LYQEEFDKMKAKAPENFRVDYAISREQTNEKGEKMYIQTRMAEYADELWELLKKDNTYIY  211

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
             CGLKGM  GI D +  +A   G+ W     Q+KK +QW+VEVY
Sbjct  212  MCGLKGMEKGIDDIMVSLAARDGIDWIEYKKQMKKAEQWNVEVY  255



>gb|ABV50826.1| ferredoxin-NADP oxidoreductase (FNR) [Prochlorococcus marinus 
str. MIT 9215]
Length=368

 Score =   180 bits (456),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 118/167 (71%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVP---TFKFNGLAWLFLGVANT  481
            GK +LLPE+  ++  +M+ATGTG+AP R YLRRMF  +      + F G AWLF+G   +
Sbjct  203  GKEMLLPEEE-DSNIVMLATGTGIAPMRAYLRRMFEATEKEKNKWNFKGKAWLFMGAPKS  261

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGA  304
             +LLY+++  +YL D+PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  
Sbjct  262  ANLLYEEDLQRYLSDYPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKT  321

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            HIY CGLKGM PGI + + + A+E+GL+W     QLKK  +WHVE Y
Sbjct  322  HIYLCGLKGMEPGIDEAMTKAAQEKGLNWSDLRPQLKKAGRWHVETY  368



>ref|WP_025972231.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB241_527L22]
Length=375

 Score =   180 bits (456),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 117/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLP D  +A  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  210  GKEMLLP-DEEDANIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  265

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  266  PKSANLLYEEDLQRYLADNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  325

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  326  EKTHIYLCGLKGMEPGIDEAMSKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>gb|EJK44714.1| hypothetical protein THAOC_36724 [Thalassiosira oceanica]
Length=395

 Score =   181 bits (458),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 113/165 (68%), Gaps = 3/165 (2%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFME-SVPTFKFNGLAWLFLGVANTDS  475
            GK +LLP+D+ N   IMIATGTG+APFRG++ R+FME ++    F G AWL LGV  T  
Sbjct  232  GKTMLLPKDS-NTDIIMIATGTGIAPFRGFMHRLFMENTLARHMFGGRAWLVLGVPVTGG  290

Query  474  LLYDDEFAKYLQDF-PDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHI  298
            LLY +EF    ++   D  R D  +SRE   K GGKMYVQ+ I E   E+F  LD GA I
Sbjct  291  LLYKEEFDCMQRNAGADQLRIDYAISREMTAKTGGKMYVQNVIAENGREVFDRLDNGAVI  350

Query  297  YFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            YFCGLKGMMPGI D+L+ VA  +G+ W  KL++LKKN QWHVEVY
Sbjct  351  YFCGLKGMMPGILDSLEEVAASQGIVWSEKLAELKKNHQWHVEVY  395



>ref|WP_025888618.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB241_526B17]
Length=370

 Score =   180 bits (456),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 119/170 (70%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLPE+  ++  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  205  GKEMLLPEEE-DSNIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  260

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  261  PKSANLLYEEDLQRYLVDNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  320

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK+ +WHVE Y
Sbjct  321  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKSGRWHVETY  370



>ref|WP_025933682.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB243_498A3]
Length=375

 Score =   180 bits (456),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 117/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLP D  +A  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  210  GKEMLLP-DEEDANIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  265

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  266  PKSANLLYEEDLQRYLADNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  325

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  326  EKTHIYLCGLKGMEPGIDEAMSKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_011376636.1| ferredoxin--NADP reductase [Prochlorococcus marinus]
 gb|ABB50145.1| ferredoxin-NADP oxidoreductase (FNR) [Prochlorococcus marinus 
str. MIT 9312]
 gb|KGG01997.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. MIT 
9311]
Length=370

 Score =   180 bits (456),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 116/167 (69%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVP---TFKFNGLAWLFLGVANT  481
            GK +LLP D  +A  +M+ATGTG+AP R YLRRMF  +      + F G AWLF+G   +
Sbjct  205  GKEMLLP-DEEDANIVMLATGTGIAPMRAYLRRMFEATEKEKNKWNFKGKAWLFMGAPKS  263

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGA  304
             +LLY+++  +YL D+PDNF Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  
Sbjct  264  ANLLYEEDLQRYLTDYPDNFTYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKT  323

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  324  HIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|XP_003547929.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme, chloroplastic 
isoform 1 [Glycine max]
Length=362

 Score =   179 bits (455),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 118/164 (72%), Gaps = 2/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK +L+P+D PNAT IM+ TGTG+APFR +L +MF E    +KFNGLAWLFLGV  + SL
Sbjct  200  GKEMLMPKD-PNATIIMLGTGTGIAPFRSFLWKMFFEKHEDYKFNGLAWLFLGVPTSSSL  258

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIY  295
            LY +EF K  + +PDNFR D  +SREQ N+NG KMY+Q ++ +Y++E+++LL  +   +Y
Sbjct  259  LYKEEFEKMQEKYPDNFRLDFAVSREQTNENGEKMYIQTRMAQYAEELWELLKKDNTFVY  318

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
             CGLKGM  GI D +  +A + G+ W     QLKK++QW+VEVY
Sbjct  319  MCGLKGMEKGIDDIMVSLAAKDGIDWTEYKRQLKKSEQWNVEVY  362



>gb|KHN01599.1| Ferredoxin--NADP reductase, leaf isozyme, chloroplastic [Glycine 
soja]
Length=362

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 118/164 (72%), Gaps = 2/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK +L+P+D PNAT IM+ TGTG+APFR +L +MF E    +KFNGLAWLFLGV  + SL
Sbjct  200  GKEMLMPKD-PNATIIMLGTGTGIAPFRSFLWKMFFEKHEDYKFNGLAWLFLGVPTSSSL  258

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIY  295
            LY +EF K  + +PDNFR D  +SREQ N+NG KMY+Q ++ +Y++E+++LL  +   +Y
Sbjct  259  LYKEEFEKMQEKYPDNFRLDFAVSREQTNENGEKMYIQTRMAQYAEELWELLKKDNTFVY  318

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
             CGLKGM  GI D +  +A + G+ W     QLKK++QW+VEVY
Sbjct  319  MCGLKGMEKGIDDIMVSLAAKDGIDWTEYKRQLKKSEQWNVEVY  362



>ref|WP_032516697.1| ferredoxin-NADP reductase [Prochlorococcus marinus]
 gb|KGG05909.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. MIT 
9322]
 gb|KGG05978.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. MIT 
9321]
 gb|KGG11008.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. MIT 
9401]
Length=390

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 117/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLP D  +A  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  225  GKEMLLP-DEEDANIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  280

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  281  PKSANLLYEEDLQRYLTDNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  340

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  341  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  390



>ref|WP_025934437.1| ferredoxin-NADP reductase, partial [Prochlorococcus sp. scB243_498J20]
Length=314

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 118/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLPE+  ++  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  149  GKEMLLPEEE-DSNIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  204

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  205  PKSANLLYEEDLQRYLVDNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  264

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  265  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  314



>ref|WP_025932047.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB241_528P14]
Length=375

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 117/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLP D  +A  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  210  GKEMLLP-DEEDANIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  265

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  266  PKSANLLYEEDLQRYLADNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  325

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  326  EKTHIYLCGLKGMEPGIDEAMSKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_032515058.1| ferredoxin-NADP reductase [Prochlorococcus marinus]
 gb|KGG03418.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. MIT 
9314]
Length=375

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 117/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLP D  +A  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  210  GKEMLLP-DEEDANIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  265

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  266  PKSANLLYEEDLQRYLADNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  325

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  326  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_006852296.1| ferredoxin--NADP reductase [Synechococcus sp. WH 8016]
 gb|EHA63116.1| Ferredoxin--NADP(+) reductase [Synechococcus sp. WH 8016]
Length=383

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 114/167 (68%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFM---ESVPTFKFNGLAWLFLGVANT  481
            GK +LLPED   A  IM+ATGTG+AP R YLRRMF     +   + F G AWLF+G   T
Sbjct  218  GKEMLLPEDE-EANVIMLATGTGIAPMRTYLRRMFEPKERAENGWNFRGKAWLFMGAPKT  276

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGA  304
             +LLYD++F  Y +++PDNFRY + +SREQ+N  GG+MY+QD++ E+++EIF ++ D   
Sbjct  277  ANLLYDEDFLHYEKEYPDNFRYTKAISREQQNPKGGRMYIQDRVSEHAEEIFAMIEDPKT  336

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            H+Y CGL+GM PGI + +   AE +GL W     +LKK  +WHVE Y
Sbjct  337  HVYMCGLRGMEPGIDEAMSAAAEAKGLDWSELRPKLKKAHRWHVETY  383



>ref|WP_036902640.1| ferredoxin-NADP reductase [Prochlorococcus sp. MIT 0601]
 gb|KGG12234.1| Ferredoxin-NADP(+) reductase [Prochlorococcus sp. MIT 0601]
Length=365

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 113/167 (68%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMES---VPTFKFNGLAWLFLGVANT  481
            GK +LLP DN +A  IM+ATGTG+AP R YLR+MF  S      + + G AWLF+G   T
Sbjct  200  GKEMLLP-DNEDANIIMLATGTGIAPMRAYLRKMFEPSERQKNNWNYKGNAWLFMGAPKT  258

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGA  304
            ++LLYD +F  Y   FP+N RY + +SREQKN  GG+MY+QD++ E+++EIF ++ D   
Sbjct  259  ENLLYDSDFEHYKSQFPNNLRYTKAISREQKNSKGGRMYIQDRVLEHAEEIFSMIEDPKT  318

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            HIY CGLKGM PGI + + + A  +GL W+    QLKK  +WHVE Y
Sbjct  319  HIYLCGLKGMEPGIDEAMNKAAASKGLKWDELRPQLKKQGRWHVETY  365



>ref|WP_025914731.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB245a_520K10]
Length=375

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 117/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLP D  +A  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  210  GKEMLLP-DEEDANIVMLATGTGIAPMRAYLRRMFE---PTEKEKNNWNFKGKAWLFMGA  265

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D+PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  266  PKSANLLYEEDLQRYLTDYPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  325

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
               HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  326  NKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_011820472.1| ferredoxin--NADP reductase [Prochlorococcus marinus]
 gb|ABM72372.1| ferredoxin-NADP oxidoreductase (FNR) [Prochlorococcus marinus 
str. MIT 9515]
Length=384

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 118/167 (71%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVP---TFKFNGLAWLFLGVANT  481
            GK +LLPE+  +A  +M+ATGTG+AP R YLRRMF  +      + F G AWLF+G   +
Sbjct  219  GKEMLLPEEE-DANIVMLATGTGIAPMRAYLRRMFEATEKEKNKWNFKGKAWLFMGAPKS  277

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGA  304
             +LLY+++  +YL+++PDNF+Y + +SREQ+N  GG+MY+QD++ E ++EIF ++ DE  
Sbjct  278  ANLLYEEDLQRYLENYPDNFKYTKAISREQQNTKGGRMYIQDRVLESANEIFNMIEDEKT  337

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            HIY CGLKGM PGI + + + A E+GL+W     QLKK  +WHVE Y
Sbjct  338  HIYLCGLKGMEPGIDEAMTKAAAEKGLNWSELRPQLKKAGRWHVETY  384



>ref|WP_032522615.1| ferredoxin-NADP reductase [Prochlorococcus marinus]
 gb|KGF95140.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. MIT 
9201]
Length=398

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 117/167 (70%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVP---TFKFNGLAWLFLGVANT  481
            GK +LLP D  +A  +M+ATGTG+AP R YLRRMF  +      + F G AWLF+G   +
Sbjct  233  GKEMLLP-DEEDANVVMLATGTGIAPMRAYLRRMFEATEKEKNKWNFKGKAWLFMGAPKS  291

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLD-EGA  304
             +LLY+++  +YL D+PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F +++ E  
Sbjct  292  ANLLYEEDLQRYLTDYPDNFKYTKAISREQQNAKGGRMYIQDRVLESANELFNMIENEKT  351

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  352  HIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  398



>ref|WP_032514193.1| ferredoxin-NADP reductase [Prochlorococcus marinus]
 gb|KGF90625.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. MIT 
9107]
 gb|KGF90788.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. MIT 
9116]
 gb|KGF93650.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. MIT 
9123]
Length=398

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 119/167 (71%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVP---TFKFNGLAWLFLGVANT  481
            GK +LLPE+  +A  +M+ATGTG+AP R YLRRMF  +     ++ F G AWLF+G   +
Sbjct  233  GKEMLLPEEE-DANIVMLATGTGIAPMRAYLRRMFEATEKEKNSWNFKGKAWLFMGAPKS  291

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGA  304
             +LLY+++  +YL D+P+NF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  
Sbjct  292  ANLLYEEDLQRYLTDYPENFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKT  351

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            HIY CGLKGM PGI + + + AEE+GL+W     +LKK  +WHVE Y
Sbjct  352  HIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPKLKKAGRWHVETY  398



>ref|WP_025958422.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB241_527L15]
Length=370

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 118/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLPE+  ++  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  205  GKEMLLPEEE-DSNIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  260

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  261  PKSANLLYEEDLQRYLVDNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  320

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  321  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_017303294.1| hypothetical protein [Spirulina subsalsa]
Length=393

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 114/164 (70%), Gaps = 2/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK +LLP+D  NAT IM+ATGTG+APFR +L RMF E+ P +KF GLAWL  G+  + ++
Sbjct  231  GKEMLLPDDE-NATIIMLATGTGIAPFRAFLWRMFKENNPEYKFKGLAWLIFGIPYSANI  289

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDE-GAHIY  295
            LY +E  +   +FP+NFR    +SREQ+N  GGKMYVQ ++ EY+DEIF++L     H+Y
Sbjct  290  LYQEELERLAAEFPENFRLTYAISREQQNAEGGKMYVQSRVSEYADEIFEMLRRPNTHLY  349

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
             CGLKGM P I  T    A +R ++W+    QLKK ++WHVEVY
Sbjct  350  MCGLKGMEPPISQTFTDEAGKRDMNWDEFRKQLKKEERWHVEVY  393



>ref|WP_025962971.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB245a_521O20]
Length=380

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 118/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLPE+  ++  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  215  GKEMLLPEEE-DSNIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  270

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  271  PKSANLLYEEDLQRYLVDNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  330

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  331  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  380



>gb|ABR26035.1| ferredoxin-nadp reductase, leaf isozyme [Oryza sativa Indica 
Group]
Length=188

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 113/164 (69%), Gaps = 2/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK +L+P+D PNA  IM+ATGTG+APFR +L +MF E    +KFNGLAWLFLGV  + SL
Sbjct  26   GKEMLMPKD-PNANIIMLATGTGIAPFRSFLWKMFFEKYDDYKFNGLAWLFLGVPTSSSL  84

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIY  295
            LY +EF K     P+NFR D  +SREQ N  G KMY+Q ++ EY +E+++LL  +  ++Y
Sbjct  85   LYKEEFDKMKAKAPENFRVDYAVSREQTNAQGEKMYIQTRMAEYKEELWELLKKDNTYVY  144

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
             CGLKGM  GI D +  +A + G+ W     QLKK +QW+VEVY
Sbjct  145  MCGLKGMEKGIDDIMVSLAAKDGIDWADYKKQLKKGEQWNVEVY  188



>ref|WP_032519107.1| ferredoxin-NADP reductase [Prochlorococcus marinus]
 gb|KGG09891.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. SB]
Length=370

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 117/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLP D  +A  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  205  GKEMLLP-DEEDANIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  260

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  261  PKSANLLYEEDLQRYLVDNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  320

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  321  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_025881692.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB241_527E14]
Length=370

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 118/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLPE+  ++  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  205  GKEMLLPEEE-DSNIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  260

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  261  PKSANLLYEEDLQRYLVDNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  320

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  321  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_011935177.1| ferredoxin--NADP reductase [Synechococcus sp. RCC307]
 emb|CAK27663.1| Ferredoxin-NADP oxidoreductase [Synechococcus sp. RCC307]
Length=388

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 114/167 (68%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFME---SVPTFKFNGLAWLFLGVANT  481
            GK +LLPED   A  IM+ATGTG+AP R YLRRMF +       +KF G AWLF+G   T
Sbjct  223  GKEMLLPEDE-EANVIMLATGTGIAPMRTYLRRMFEDKEREANGWKFRGKAWLFMGAPKT  281

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGA  304
             +LLYD++F +Y  ++ DNFRY + +SREQ+N  GG+MY+QD++ EY+DEIF ++ D   
Sbjct  282  ANLLYDEDFQRYESEYSDNFRYTKAISREQQNPKGGRMYIQDRVTEYADEIFAMIEDPKT  341

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            H+Y CGL+GM PGI + +   A  +G+ W     QLKK ++WHVE Y
Sbjct  342  HVYMCGLRGMEPGIDEAMTAAAAAKGMDWAELRPQLKKAERWHVETY  388



>ref|WP_041484386.1| ferredoxin-NADP reductase [Prochlorococcus marinus]
Length=394

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 118/167 (71%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVP---TFKFNGLAWLFLGVANT  481
            GK +LLPE+  ++  +M+ATGTG+AP R YLRRMF  +      + F G AWLF+G   +
Sbjct  229  GKEMLLPEEE-DSNIVMLATGTGIAPMRAYLRRMFEATEKEKNKWNFKGKAWLFMGAPKS  287

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGA  304
             +LLY+++  +YL D+PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  
Sbjct  288  ANLLYEEDLQRYLSDYPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKT  347

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            HIY CGLKGM PGI + + + A+E+GL+W     QLKK  +WHVE Y
Sbjct  348  HIYLCGLKGMEPGIDEAMTKAAQEKGLNWSDLRPQLKKAGRWHVETY  394



>ref|WP_025968699.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB245a_519D13]
Length=370

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 118/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLPE+  ++  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  205  GKEMLLPEEE-DSNIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  260

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  261  PKSANLLYEEDLQRYLVDNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  320

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  321  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_025891782.1| MULTISPECIES: ferredoxin-NADP reductase [Prochlorococcus]
Length=370

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 118/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLPE+  ++  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  205  GKEMLLPEEE-DSNIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  260

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  261  PKSANLLYEEDLQRYLVDNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  320

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  321  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_025890941.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB241_526N9]
Length=380

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 118/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLPE+  ++  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  215  GKEMLLPEEE-DSNIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  270

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  271  PKSANLLYEEDLQRYLVDNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  330

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  331  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  380



>ref|WP_025925380.1| MULTISPECIES: ferredoxin-NADP reductase [Prochlorococcus]
Length=375

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 118/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLPE+  ++  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  210  GKEMLLPEEE-DSNIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  265

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  266  PKSANLLYEEDLQRYLVDNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  325

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  326  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_025973953.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB241_529B19]
Length=370

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 118/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLPE+  ++  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  205  GKEMLLPEEE-DSNIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  260

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  261  PKSANLLYEEDLQRYLVDNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  320

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  321  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_025975443.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB243_495K23]
Length=370

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 118/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLPE+  ++  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  205  GKEMLLPEEE-DSNIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  260

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  261  PKSANLLYEEDLQRYLVDNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  320

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  321  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_011125275.1| MULTISPECIES: ferredoxin--NADP reductase [Prochlorococcus]
 ref|NP_875515.1| Ferredoxin-NADP oxidoreductase, PetH [Prochlorococcus marinus 
subsp. marinus str. CCMP1375]
 gb|AAQ00168.1| Ferredoxin-NADP oxidoreductase, PetH [Prochlorococcus marinus 
subsp. marinus str. CCMP1375]
 gb|KGG13966.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. LG]
 gb|KGG19099.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. SS2]
 gb|KGG23361.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. SS35]
 gb|KGG32403.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. SS51]
 gb|KGG35711.1| Ferredoxin-NADP(+) reductase [Prochlorococcus sp. SS52]
Length=364

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 113/167 (68%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMES---VPTFKFNGLAWLFLGVANT  481
            GK +LLP+D  +A  IM+ATGTG+AP R YLR+MF ++      + F G AWLF+G   T
Sbjct  199  GKEMLLPDDE-DANIIMLATGTGIAPMRAYLRKMFEKTEREKNNWYFKGKAWLFMGAPKT  257

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEG-A  304
             +LLYDD+F  Y   +P+N RY + +SREQKN  GG+MY+QD++ EY+DEIF L++    
Sbjct  258  ANLLYDDDFENYKAQYPENLRYTKAISREQKNTKGGRMYIQDRVLEYADEIFSLIENPKT  317

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            HIY CGLKGM PGI + +   A  +GL+W     QLKK  +WHVE Y
Sbjct  318  HIYLCGLKGMEPGIDEAMTTAASAKGLNWSELRPQLKKAGRWHVETY  364



>ref|WP_025900667.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB243_498N8]
Length=370

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 118/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLPE+  ++  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  205  GKEMLLPEEE-DSNIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  260

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  261  PKSANLLYEEDLQRYLVDNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  320

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  321  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_025956780.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB243_498L10]
Length=375

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 118/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLPE+  ++  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  210  GKEMLLPEEE-DSNIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  265

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  266  PKSANLLYEEDLQRYLVDNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  325

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  326  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_025944110.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB241_526B22]
Length=375

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 118/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLPE+  ++  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  210  GKEMLLPEEE-DSNIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  265

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  266  PKSANLLYEEDLQRYLVDNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  325

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  326  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_025941824.1| MULTISPECIES: ferredoxin-NADP reductase [Prochlorococcus]
Length=375

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 118/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLPE+  ++  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  210  GKEMLLPEEE-DSNIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  265

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  266  PKSANLLYEEDLQRYLVDNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  325

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  326  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_025923346.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB243_495D8]
Length=369

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 117/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLP D  +A  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  204  GKEMLLP-DEEDANIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  259

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +Y+ D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  260  PKSANLLYEEDLQRYIADNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  319

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  320  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  369



>ref|WP_025939411.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB245a_520B18]
Length=370

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 117/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLPE+  +   +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  205  GKEMLLPEEE-DCNIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  260

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  261  PKSANLLYEEDLQRYLVDNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  320

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  321  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>gb|ABM70465.1| ferredoxin-NADP oxidoreductase (FNR) [Prochlorococcus marinus 
str. AS9601]
Length=326

 Score =   177 bits (448),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 117/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLP D  +A  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  161  GKEMLLP-DEEDANIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  216

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +Y+ + PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  217  PKSANLLYEEDLQRYITENPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  276

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  277  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  326



>ref|WP_025893387.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB241_527N11]
Length=375

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 118/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLPE+  ++  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  210  GKEMLLPEEE-DSNIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  265

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  266  PKSANLLYEEDLQRYLFDNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  325

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  326  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_006632795.1| ferredoxin--NADP reductase [Microcoleus vaginatus]
 gb|EGK88014.1| Ferredoxin--NADP(+) reductase [Microcoleus vaginatus FGP-2]
Length=401

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 116/164 (71%), Gaps = 2/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK +LLP+D   AT IM+ATGTG+APFR YL RMF E+ P +KF GLAWLFLGVA T ++
Sbjct  239  GKEMLLPDDE-EATIIMMATGTGIAPFRAYLWRMFKENNPDYKFKGLAWLFLGVAYTPNI  297

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDE-GAHIY  295
            LY +E  +  ++FPDNFR    +SREQKN +GGKMY+Q++I+E +D++++L+ +   H Y
Sbjct  298  LYKEELEQLQREFPDNFRLTYAISREQKNADGGKMYIQNRIQENADQLWELVQKPNTHTY  357

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
             CGLKGM  GI + +   + + G+ W     QLKK  +WHVE Y
Sbjct  358  ICGLKGMEGGIDEGMSAASSKYGVEWAAYQKQLKKEHRWHVETY  401



>gb|EMT15804.1| Ferredoxin--NADP reductase, leaf isozyme, chloroplastic [Aegilops 
tauschii]
Length=361

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 115/164 (70%), Gaps = 2/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK +L+P+D PNAT IM+ATGTG+APFR +L +MF E    +KFNGLAWLFLGV  + SL
Sbjct  199  GKEMLMPKD-PNATIIMLATGTGIAPFRSFLWKMFFEKYEDYKFNGLAWLFLGVPTSSSL  257

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIY  295
            LY +EF K     PDNFR D  +SRE+ N  G KMY+Q ++ EY DE+++LL  +  ++Y
Sbjct  258  LYPEEFGKMKAKAPDNFRVDYAISREETNAAGEKMYIQTRMAEYKDELWELLKKDNTYVY  317

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
             CGLKGM  GI + +  +A + G+ W     QLKK++QW+VEVY
Sbjct  318  MCGLKGMEKGIDEIMIPLASKEGIDWIDYRKQLKKSEQWNVEVY  361



>ref|WP_025974310.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB241_529J11]
Length=375

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 118/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLPE+  ++  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  210  GKEMLLPEEE-DSNIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  265

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL D PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  266  PKSANLLYEEDLQRYLVDNPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  325

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AE++GL+W     QLKK  +WHVE Y
Sbjct  326  EKTHIYLCGLKGMEPGIDEAMTKAAEQKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_007098233.1| ferredoxin--NADP reductase [Synechococcus sp. RS9916]
 gb|EAU74127.1| ferredoxin--NADP reductase (FNR) [Synechococcus sp. RS9916]
Length=392

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 113/167 (68%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPT---FKFNGLAWLFLGVANT  481
            GK +LLP+D   A  IM ATGTG+AP R YLRRMF  S      + F G AWLF+G   T
Sbjct  227  GKEMLLPDDE-EANVIMFATGTGIAPMRTYLRRMFESSEREKNGWNFRGKAWLFMGAPKT  285

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGA  304
             +LLYDD+F +Y  ++P+NFRY + +SREQ+N  GG+MY+QD++ E++DEIF ++ D   
Sbjct  286  PNLLYDDDFNRYESEYPENFRYTKAISREQQNTKGGRMYIQDRVLEHADEIFAMIEDPKT  345

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            H+Y CGL+GM PGI + +   A  +GL W     QLKK ++WHVE Y
Sbjct  346  HVYMCGLRGMEPGIDEAMSAAAAAKGLDWSVLRPQLKKAERWHVETY  392



>ref|WP_012630377.1| ferredoxin--NADP reductase [Cyanothece sp. PCC 7425]
 gb|ACL47344.1| oxidoreductase FAD/NAD(P)-binding domain protein [Cyanothece 
sp. PCC 7425]
Length=400

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 114/164 (70%), Gaps = 2/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK +LLP+D P AT IM+ATGTG+APFR YL RMF E+ P +KF GLAWLF GVA T ++
Sbjct  238  GKEMLLPDD-PEATIIMMATGTGIAPFRAYLWRMFKENNPEYKFRGLAWLFFGVAYTPNI  296

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDE-GAHIY  295
            LY +E     Q +PDNFR    +SREQKN  GGKMY+Q +I+E +DE+++L+ +   H+Y
Sbjct  297  LYKEELETLQQQYPDNFRLTCAISREQKNAQGGKMYIQHRIQENADELWQLVQKPNTHVY  356

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
             CGLKGM  GI + +   A + G SW     ++KK ++WHVE Y
Sbjct  357  ICGLKGMEGGIDEGMSAAAAKFGASWAEFQRKMKKEERWHVETY  400



>ref|WP_006041729.1| ferredoxin--NADP reductase [Synechococcus sp. WH 7805]
 gb|EAR18038.1| ferredoxin--NADP reductase (FNR) [Synechococcus sp. WH 7805]
Length=386

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 114/167 (68%), Gaps = 5/167 (3%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPT---FKFNGLAWLFLGVANT  481
            GK +LLP+D   A  IM+ATGTG+AP R YLRRMF  S      + F G AWLF+G   T
Sbjct  221  GKEMLLPDDE-EANVIMLATGTGIAPMRTYLRRMFEPSEREKNGWTFRGKAWLFMGAPKT  279

Query  480  DSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDE-GA  304
             +LLYD++F  Y +++PDNFRY + +SREQ+N  GG+MY+QD++ EY+DEIF +++    
Sbjct  280  PNLLYDEDFEHYEREYPDNFRYTKAISREQQNSKGGRMYIQDRVLEYADEIFAMIENPKT  339

Query  303  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            H+Y CGL+GM PGI + +   A  +GL W     QLKK ++WHVE Y
Sbjct  340  HVYMCGLRGMEPGIDEAMSAAAAAKGLDWSELRPQLKKAERWHVETY  386



>dbj|BAJ98295.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99653.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=360

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 115/164 (70%), Gaps = 2/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK +L+P+D PNAT IM+ATGTG+APFR +L +MF E    +KFNGLAWLFLGV  + SL
Sbjct  198  GKEMLMPKD-PNATIIMLATGTGIAPFRSFLWKMFFEKYDDYKFNGLAWLFLGVPTSSSL  256

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIY  295
            LY +EF K     PDNFR D  +SRE+ N  G KMY+Q ++ EY DE+++LL  +  ++Y
Sbjct  257  LYPEEFGKMKAKAPDNFRVDYAISREETNAAGEKMYIQTRMAEYKDELWELLKKDNTYVY  316

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
             CGLKGM  GI + +  +A + G+ W     QLKK++QW+VEVY
Sbjct  317  MCGLKGMEKGIDEIMVPLAAKEGIDWIDYRKQLKKSEQWNVEVY  360



>ref|WP_025906619.1| MULTISPECIES: ferredoxin-NADP reductase [Prochlorococcus]
Length=370

 Score =   177 bits (450),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 117/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLP D  +A  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  205  GKEMLLP-DEEDANIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  260

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +Y+ + PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  261  PKSANLLYEEDLQRYITENPDNFKYTKAISREQQNSKGGRMYIQDRVLESANELFNMIED  320

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  321  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_042850553.1| ferredoxin-NADP reductase [Prochlorococcus sp. MIT 0604]
 gb|AIQ95228.1| Ferredoxin-NADP(+) reductase [Prochlorococcus sp. MIT 0604]
Length=375

 Score =   177 bits (450),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 116/170 (68%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLP D   A  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  210  GKEMLLP-DEEEANIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  265

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +YL + PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  266  PKSANLLYEEDLQRYLNENPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  325

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  326  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|XP_002510546.1| ferredoxin--NADP reductase, putative [Ricinus communis]
 gb|EEF52733.1| ferredoxin--NADP reductase, putative [Ricinus communis]
Length=362

 Score =   177 bits (449),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 116/164 (71%), Gaps = 2/164 (1%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSL  472
            GK +L+P+D PNAT IM+ATGTG+APFR +L +MF E    +KFNGLAWLFLGV  + SL
Sbjct  200  GKEMLMPKD-PNATIIMLATGTGIAPFRSFLWKMFFEKHEDYKFNGLAWLFLGVPTSSSL  258

Query  471  LYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIY  295
            LY DEF K  +  P+NFR D  +SREQ N  G KMY+Q ++ +Y++E+++LL  +  ++Y
Sbjct  259  LYPDEFQKMKEKAPENFRVDYAVSREQTNDKGDKMYIQTRMAQYAEELWELLKKDNTYVY  318

Query  294  FCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
             CGLKGM  GI D +  +A   G+ W     QLKK++QW+VEVY
Sbjct  319  MCGLKGMEKGIDDIMVNLAARDGIDWIEYKRQLKKSEQWNVEVY  362



>ref|WP_025955871.1| MULTISPECIES: ferredoxin-NADP reductase [Prochlorococcus]
Length=370

 Score =   177 bits (449),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 117/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLP D  +A  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  205  GKEMLLP-DEEDANIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  260

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +Y+ + PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  261  PKSANLLYEEDLQRYIAENPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  320

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  321  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_025922412.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB241_529D18]
Length=370

 Score =   177 bits (449),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 117/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLP D  +A  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  205  GKEMLLP-DEEDANIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  260

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +Y+ + PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  261  PKSANLLYEEDLQRYIAENPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  320

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  321  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_025939139.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB245a_518A6]
Length=375

 Score =   177 bits (449),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 117/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLP D  +A  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  210  GKEMLLP-DEEDANIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  265

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +Y+ + PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  266  PKSANLLYEEDLQRYIAENPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  325

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  326  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_041484539.1| ferredoxin-NADP reductase [Prochlorococcus marinus]
Length=375

 Score =   177 bits (449),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 117/170 (69%), Gaps = 11/170 (6%)
 Frame = -3

Query  651  GKILLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGV  490
            GK +LLP D  +A  +M+ATGTG+AP R YLRRMF    PT K      F G AWLF+G 
Sbjct  210  GKEMLLP-DEEDANIVMLATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGA  265

Query  489  ANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-D  313
              + +LLY+++  +Y+ + PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D
Sbjct  266  PKSANLLYEEDLQRYITENPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIED  325

Query  312  EGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  163
            E  HIY CGLKGM PGI + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  326  EKTHIYLCGLKGMEPGIDEAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  375



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1001432574250