BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF035B20

Length=718
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004241917.1|  PREDICTED: 60S ribosomal protein L15               312   4e-104   Solanum lycopersicum
ref|XP_004242022.1|  PREDICTED: 60S ribosomal protein L15               311   6e-104   Solanum lycopersicum
ref|XP_004236901.1|  PREDICTED: 60S ribosomal protein L15-like          310   2e-103   Solanum lycopersicum
ref|XP_009606590.1|  PREDICTED: 60S ribosomal protein L15               310   4e-103   Nicotiana tomentosiformis
ref|XP_009796395.1|  PREDICTED: 60S ribosomal protein L15-like          309   4e-103   Nicotiana sylvestris
gb|EPS66678.1|  hypothetical protein M569_08101                         307   4e-102   Genlisea aurea
ref|XP_011069801.1|  PREDICTED: 60S ribosomal protein L15               306   6e-102   Sesamum indicum [beniseed]
emb|CDP10996.1|  unnamed protein product                                306   6e-102   Coffea canephora [robusta coffee]
ref|XP_010686789.1|  PREDICTED: 60S ribosomal protein L15               306   1e-101   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011076388.1|  PREDICTED: 60S ribosomal protein L15-like          306   1e-101   Sesamum indicum [beniseed]
ref|XP_006477158.1|  PREDICTED: 60S ribosomal protein L15-like          305   4e-101   Citrus sinensis [apfelsine]
gb|EYU24942.1|  hypothetical protein MIMGU_mgv1a013374mg                305   4e-101   Erythranthe guttata [common monkey flower]
gb|EYU43197.1|  hypothetical protein MIMGU_mgv1a012815mg                305   5e-101   Erythranthe guttata [common monkey flower]
sp|O82528.1|RL15_PETHY  RecName: Full=60S ribosomal protein L15         303   9e-101   Petunia x hybrida [garden petunia]
ref|XP_010667037.1|  PREDICTED: 60S ribosomal protein L15-1             303   9e-101   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006490145.1|  PREDICTED: 60S ribosomal protein L15-like          303   1e-100   Citrus sinensis [apfelsine]
ref|XP_006440278.1|  hypothetical protein CICLE_v10024403mg             304   1e-100   
gb|EPS59253.1|  hypothetical protein M569_15555                         303   1e-100   Genlisea aurea
ref|XP_002301250.1|  60S ribosomal protein L15                          303   2e-100   Populus trichocarpa [western balsam poplar]
ref|XP_007209614.1|  hypothetical protein PRUPE_ppa011603mg             303   2e-100   Prunus persica
ref|XP_011076387.1|  PREDICTED: 60S ribosomal protein L15-like          302   2e-100   Sesamum indicum [beniseed]
ref|XP_011080625.1|  PREDICTED: 60S ribosomal protein L15-like          302   2e-100   Sesamum indicum [beniseed]
ref|XP_009607935.1|  PREDICTED: 60S ribosomal protein L15-like          302   2e-100   Nicotiana tomentosiformis
ref|XP_006421625.1|  hypothetical protein CICLE_v10005611mg             305   4e-100   
ref|XP_011031909.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    302   4e-100   Populus euphratica
emb|CDP11952.1|  unnamed protein product                                301   4e-100   Coffea canephora [robusta coffee]
ref|XP_009764605.1|  PREDICTED: 60S ribosomal protein L15-like          302   4e-100   Nicotiana sylvestris
ref|XP_002304285.2|  60S ribosomal protein L15                          302   4e-100   Populus trichocarpa [western balsam poplar]
ref|XP_009768655.1|  PREDICTED: 60S ribosomal protein L15-like          302   4e-100   Nicotiana sylvestris
ref|XP_006369001.1|  60S ribosomal protein L15                          301   1e-99    Populus trichocarpa [western balsam poplar]
ref|XP_011017435.1|  PREDICTED: 60S ribosomal protein L15-like          301   1e-99    Populus euphratica
ref|XP_009618098.1|  PREDICTED: 60S ribosomal protein L15-like          300   1e-99    Nicotiana tomentosiformis
ref|XP_010933636.1|  PREDICTED: 60S ribosomal protein L15-1             300   2e-99    Elaeis guineensis
ref|XP_002510977.1|  ribosomal protein L15, putative                    300   3e-99    Ricinus communis
ref|XP_008369443.1|  PREDICTED: 60S ribosomal protein L15-1             301   3e-99    
ref|XP_007157273.1|  hypothetical protein PHAVU_002G057000g             300   3e-99    Phaseolus vulgaris [French bean]
gb|KDP39891.1|  hypothetical protein JCGZ_03422                         299   4e-99    Jatropha curcas
ref|XP_009334550.1|  PREDICTED: 60S ribosomal protein L15-1             300   4e-99    Pyrus x bretschneideri [bai li]
gb|KHG00889.1|  60S ribosomal L15                                       299   6e-99    Gossypium arboreum [tree cotton]
gb|KHG22797.1|  60S ribosomal L15-1 -like protein                       298   8e-99    Gossypium arboreum [tree cotton]
ref|XP_010919627.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    298   9e-99    Elaeis guineensis
ref|XP_008798983.1|  PREDICTED: 60S ribosomal protein L15-like          298   1e-98    Phoenix dactylifera
ref|XP_007038342.1|  Ribosomal protein L23/L15e family protein          298   2e-98    
ref|XP_009352987.1|  PREDICTED: 60S ribosomal protein L15-like          298   2e-98    Pyrus x bretschneideri [bai li]
ref|XP_008775187.1|  PREDICTED: 60S ribosomal protein L15               298   2e-98    Phoenix dactylifera
ref|XP_011001078.1|  PREDICTED: 60S ribosomal protein L15-like          298   2e-98    Populus euphratica
ref|XP_010933963.1|  PREDICTED: 60S ribosomal protein L15-like          297   2e-98    Elaeis guineensis
gb|KDP22442.1|  hypothetical protein JCGZ_26273                         297   2e-98    Jatropha curcas
gb|KDO49939.1|  hypothetical protein CISIN_1g028757mg                   296   2e-98    Citrus sinensis [apfelsine]
ref|XP_004146916.1|  PREDICTED: 60S ribosomal protein L15-like is...    297   3e-98    Cucumis sativus [cucumbers]
ref|XP_010934657.1|  PREDICTED: 60S ribosomal protein L15-1-like        296   4e-98    Elaeis guineensis
ref|XP_011031911.1|  PREDICTED: 60S ribosomal protein L15 isoform X3    296   4e-98    Populus euphratica
ref|XP_002530661.1|  ribosomal protein L15, putative                    296   4e-98    Ricinus communis
ref|XP_008437057.1|  PREDICTED: 60S ribosomal protein L15-2 isofo...    296   5e-98    Cucumis melo [Oriental melon]
ref|XP_008437056.1|  PREDICTED: 60S ribosomal protein L15-2 isofo...    297   6e-98    
ref|XP_010264371.1|  PREDICTED: 60S ribosomal protein L15-like          296   7e-98    Nelumbo nucifera [Indian lotus]
ref|XP_010107162.1|  60S ribosomal protein L15                          296   7e-98    Morus notabilis
ref|XP_002277836.1|  PREDICTED: 60S ribosomal protein L15-1             296   1e-97    Vitis vinifera
ref|XP_008796124.1|  PREDICTED: 60S ribosomal protein L15-2             295   1e-97    Phoenix dactylifera
pdb|3J61|N  Chain N, Localization Of The Large Subunit Ribosomal ...    295   2e-97    Triticum aestivum [Canadian hard winter wheat]
ref|NP_001050612.1|  Os03g0598800                                       295   2e-97    
emb|CBI16601.3|  unnamed protein product                                295   2e-97    Vitis vinifera
ref|XP_006650289.1|  PREDICTED: 60S ribosomal protein L15-like          295   2e-97    Oryza brachyantha
emb|CAN68893.1|  hypothetical protein VITISV_004609                     295   2e-97    Vitis vinifera
ref|XP_004152395.1|  PREDICTED: 60S ribosomal protein L15-like is...    295   2e-97    
ref|XP_007155679.1|  hypothetical protein PHAVU_003G222000g             295   3e-97    Phaseolus vulgaris [French bean]
ref|XP_006655163.1|  PREDICTED: 60S ribosomal protein L15-like          295   3e-97    
ref|XP_010529971.1|  PREDICTED: 60S ribosomal protein L15-1             295   3e-97    Tarenaya hassleriana [spider flower]
gb|AGL08210.1|  60S ribosomal protein L15                               294   4e-97    Arachis hypogaea [goober]
ref|XP_010258850.1|  PREDICTED: 60S ribosomal protein L15               294   4e-97    Nelumbo nucifera [Indian lotus]
ref|XP_008452210.1|  PREDICTED: 60S ribosomal protein L15-2-like        294   4e-97    Cucumis melo [Oriental melon]
ref|XP_010053499.1|  PREDICTED: 60S ribosomal protein L15-2             294   5e-97    Eucalyptus grandis [rose gum]
ref|XP_009406701.1|  PREDICTED: 60S ribosomal protein L15-1-like        294   5e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002268465.1|  PREDICTED: 60S ribosomal protein L15-1-like        294   6e-97    Vitis vinifera
ref|XP_003635402.1|  PREDICTED: 60S ribosomal protein L15-1             294   6e-97    Vitis vinifera
gb|ACV50439.1|  ribosomal protein L15                                   293   7e-97    Jatropha curcas
ref|XP_008241281.1|  PREDICTED: 60S ribosomal protein L15-like          293   7e-97    Prunus mume [ume]
ref|XP_009399011.1|  PREDICTED: 60S ribosomal protein L15-1-like        293   9e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006838929.1|  hypothetical protein AMTR_s00002p00270230          293   1e-96    Amborella trichopoda
ref|XP_010104882.1|  60S ribosomal protein L15                          294   1e-96    
ref|XP_010062398.1|  PREDICTED: 60S ribosomal protein L15-1             293   1e-96    Eucalyptus grandis [rose gum]
ref|XP_009418976.1|  PREDICTED: 60S ribosomal protein L15-1             293   2e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006837338.1|  hypothetical protein AMTR_s00111p00086580          293   2e-96    Amborella trichopoda
ref|XP_010919628.1|  PREDICTED: 60S ribosomal protein L15 isoform X2    292   2e-96    
ref|NP_001150716.1|  60S ribosomal protein L15                          292   3e-96    Zea mays [maize]
ref|NP_001235890.1|  uncharacterized protein LOC100305473               292   3e-96    Glycine max [soybeans]
gb|ACF88005.1|  unknown                                                 292   3e-96    Zea mays [maize]
ref|XP_009398340.1|  PREDICTED: 60S ribosomal protein L15-1-like        292   3e-96    Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE63068.1|  hypothetical protein OsJ_17876                          298   4e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002460708.1|  hypothetical protein SORBIDRAFT_02g033530          291   4e-96    Sorghum bicolor [broomcorn]
ref|XP_007202591.1|  hypothetical protein PRUPE_ppa011597mg             291   4e-96    Prunus persica
gb|KHG16565.1|  60S ribosomal L15-1 -like protein                       291   4e-96    Gossypium arboreum [tree cotton]
ref|XP_010539199.1|  PREDICTED: 60S ribosomal protein L15-1-like        291   5e-96    Tarenaya hassleriana [spider flower]
ref|NP_001148602.1|  60S ribosomal protein L15                          291   6e-96    Zea mays [maize]
gb|KHN44085.1|  60S ribosomal protein L15                               291   7e-96    Glycine soja [wild soybean]
gb|KJB51842.1|  hypothetical protein B456_008G234000                    291   7e-96    Gossypium raimondii
ref|XP_009408522.1|  PREDICTED: 60S ribosomal protein L15-1-like        291   7e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010539086.1|  PREDICTED: 60S ribosomal protein L15-1-like        291   7e-96    Tarenaya hassleriana [spider flower]
gb|EEC78893.1|  hypothetical protein OsI_19264                          297   8e-96    Oryza sativa Indica Group [Indian rice]
ref|XP_010538411.1|  PREDICTED: 60S ribosomal protein L15-1-like        291   8e-96    Tarenaya hassleriana [spider flower]
gb|ACU24496.1|  unknown                                                 291   8e-96    Glycine max [soybeans]
ref|NP_001148378.1|  60S ribosomal protein L15                          291   1e-95    Zea mays [maize]
ref|XP_008360544.1|  PREDICTED: 60S ribosomal protein L15               291   1e-95    
ref|XP_006837287.1|  hypothetical protein AMTR_s00111p00023340          291   1e-95    
gb|KHG20796.1|  60S ribosomal L15-1 -like protein                       290   1e-95    Gossypium arboreum [tree cotton]
ref|XP_003549922.1|  PREDICTED: 60S ribosomal protein L15-1-like        290   1e-95    
ref|XP_010540825.1|  PREDICTED: 60S ribosomal protein L15-1-like        290   1e-95    Tarenaya hassleriana [spider flower]
gb|ACF87670.1|  unknown                                                 290   2e-95    Zea mays [maize]
ref|XP_002461521.1|  hypothetical protein SORBIDRAFT_02g004020          290   2e-95    Sorghum bicolor [broomcorn]
ref|NP_001150386.1|  60S ribosomal protein L15                          290   2e-95    Zea mays [maize]
gb|AAT85124.1|  putative 60s ribosomal protein L15                      289   3e-95    Oryza sativa Japonica Group [Japonica rice]
gb|ADA67930.1|  putative 60S ribosomal protein L15                      290   3e-95    Wolffia arrhiza
ref|XP_004152396.1|  PREDICTED: 60S ribosomal protein L15-like is...    289   3e-95    
ref|XP_007039791.1|  Ribosomal protein L23/L15e family protein is...    290   3e-95    
ref|XP_004491939.1|  PREDICTED: 60S ribosomal protein L15-1-like ...    289   3e-95    Cicer arietinum [garbanzo]
gb|AFK49215.1|  unknown                                                 289   3e-95    Medicago truncatula
ref|XP_007039793.1|  Ribosomal protein L23/L15e family protein is...    289   4e-95    Theobroma cacao [chocolate]
gb|ACJ84067.1|  unknown                                                 289   4e-95    Medicago truncatula
ref|NP_001236804.1|  uncharacterized protein LOC100306052               289   4e-95    
ref|XP_004491938.1|  PREDICTED: 60S ribosomal protein L15-1-like ...    289   5e-95    
ref|XP_003593619.1|  Ribosomal protein L15                              290   6e-95    Medicago truncatula
sp|O65050.1|RL15A_PICMA  RecName: Full=60S ribosomal protein L15-1      288   1e-94    Picea mariana [black spruce]
emb|CBI38664.3|  unnamed protein product                                287   1e-94    Vitis vinifera
emb|CBI25842.3|  unnamed protein product                                287   1e-94    Vitis vinifera
sp|O65082.1|RL15B_PICMA  RecName: Full=60S ribosomal protein L15-2      288   1e-94    Picea mariana [black spruce]
tpg|DAA62721.1|  TPA: hypothetical protein ZEAMMB73_667917              286   4e-94    
dbj|BAJ95856.1|  predicted protein                                      286   5e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003573847.1|  PREDICTED: 60S ribosomal protein L15-2             286   5e-94    Brachypodium distachyon [annual false brome]
ref|XP_004299420.1|  PREDICTED: 60S ribosomal protein L15-1             286   9e-94    Fragaria vesca subsp. vesca
ref|XP_004955579.1|  PREDICTED: 60S ribosomal protein L15-1-like ...    285   1e-93    Setaria italica
dbj|BAD22764.1|  ribosomal protein                                      285   1e-93    Bromus inermis [awnless brome grass]
gb|KJB39740.1|  hypothetical protein B456_007G028600                    285   2e-93    Gossypium raimondii
gb|AFK46983.1|  unknown                                                 285   2e-93    Lotus japonicus
ref|XP_004957717.1|  PREDICTED: 60S ribosomal protein L15-1-like        284   3e-93    Setaria italica
gb|AAK67641.1|  ribosomal protein L15                                   284   5e-93    Homo sapiens [man]
ref|XP_004512167.1|  PREDICTED: 60S ribosomal protein L15-1-like        283   8e-93    Cicer arietinum [garbanzo]
ref|XP_001764493.1|  predicted protein                                  283   1e-92    
emb|CAB10520.1|  ribosomal protein                                      283   2e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009108318.1|  PREDICTED: 60S ribosomal protein L15-1-like        282   3e-92    Brassica rapa
ref|XP_003563105.1|  PREDICTED: 60S ribosomal protein L15-2             282   3e-92    Brachypodium distachyon [annual false brome]
ref|XP_009136839.1|  PREDICTED: 60S ribosomal protein L15-1             281   4e-92    Brassica rapa
emb|CDX90499.1|  BnaA03g42820D                                          284   4e-92    
ref|XP_009145572.1|  PREDICTED: 60S ribosomal protein L15-1             281   5e-92    Brassica rapa
ref|XP_006282719.1|  hypothetical protein CARUB_v10005752mg             281   5e-92    Capsella rubella
ref|NP_193470.1|  60S ribosomal protein L15-2                           281   5e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002868106.1|  60S ribosomal protein L15                          281   6e-92    
ref|NP_193405.1|  60S ribosomal protein L15-1                           281   6e-92    Arabidopsis thaliana [mouse-ear cress]
gb|KFK32179.1|  hypothetical protein AALP_AA6G207900                    281   6e-92    Arabis alpina [alpine rockcress]
ref|XP_010434676.1|  PREDICTED: 60S ribosomal protein L15-1-like        281   6e-92    Camelina sativa [gold-of-pleasure]
emb|CDY54747.1|  BnaAnng13420D                                          282   7e-92    Brassica napus [oilseed rape]
emb|CDY53647.1|  BnaA08g30370D                                          282   7e-92    Brassica napus [oilseed rape]
ref|XP_001753036.1|  predicted protein                                  281   7e-92    
emb|CDY60707.1|  BnaC07g50070D                                          283   9e-92    Brassica napus [oilseed rape]
ref|XP_001771165.1|  predicted protein                                  280   1e-91    
gb|AFK37409.1|  unknown                                                 280   1e-91    Lotus japonicus
ref|XP_009136806.1|  PREDICTED: 60S ribosomal protein L15-1-like        280   1e-91    Brassica rapa
emb|CDY50842.1|  BnaC08g47880D                                          281   3e-91    Brassica napus [oilseed rape]
emb|CDY40505.1|  BnaC01g20070D                                          283   4e-91    Brassica napus [oilseed rape]
ref|XP_002879569.1|  60S ribosomal protein L15                          278   7e-91    Arabidopsis lyrata subsp. lyrata
gb|AFK40278.1|  unknown                                                 278   1e-90    Lotus japonicus
ref|XP_001757563.1|  predicted protein                                  278   1e-90    
emb|CDX76573.1|  BnaA08g08270D                                          276   3e-90    
emb|CDY59531.1|  BnaCnng35130D                                          275   6e-90    Brassica napus [oilseed rape]
emb|CDY09632.1|  BnaC07g34290D                                          275   6e-90    Brassica napus [oilseed rape]
gb|KDO49937.1|  hypothetical protein CISIN_1g028757mg                   275   6e-90    Citrus sinensis [apfelsine]
gb|EMS52882.1|  60S ribosomal protein L15                               276   4e-89    Triticum urartu
ref|XP_002961462.1|  hypothetical protein SELMODRAFT_270259             272   2e-88    Selaginella moellendorffii
ref|XP_002971348.1|  hypothetical protein SELMODRAFT_270900             270   9e-88    Selaginella moellendorffii
ref|XP_008234416.1|  PREDICTED: 60S ribosomal protein L15-like          270   1e-87    Prunus mume [ume]
ref|XP_004955578.1|  PREDICTED: 60S ribosomal protein L15-1-like ...    267   7e-86    
ref|XP_002946380.1|  component of cytosolic 80S ribosome and 60S ...    261   4e-84    Volvox carteri f. nagariensis
ref|XP_010516773.1|  PREDICTED: 60S ribosomal protein L15-2-like        260   1e-83    
gb|EMT29287.1|  60S ribosomal protein L15                               261   2e-83    
ref|XP_005646118.1|  ribosomal protein L15e                             259   2e-83    Coccomyxa subellipsoidea C-169
ref|XP_005845356.1|  hypothetical protein CHLNCDRAFT_32281              259   3e-83    Chlorella variabilis
ref|XP_001701780.1|  ribosomal protein L15, component of cytosoli...    258   6e-83    Chlamydomonas reinhardtii
ref|XP_011401241.1|  60S ribosomal protein L15                          260   1e-80    Auxenochlorella protothecoides
gb|AAF67144.1|AF230646_1  large subunit ribosomal protein L15           246   3e-78    Syntrichia ruralis
emb|CEG01197.1|  Ribosomal protein L15e, conserved site                 246   5e-78    Ostreococcus tauri
ref|XP_003056552.1|  predicted protein                                  245   8e-78    Micromonas pusilla CCMP1545
gb|EMT18644.1|  60S ribosomal protein L15                               243   4e-77    
gb|KCW90850.1|  hypothetical protein EUGRSUZ_A02903                     242   5e-77    Eucalyptus grandis [rose gum]
ref|XP_001416062.1|  Ribosomal protein L15, component of cytosoli...    242   1e-76    Ostreococcus lucimarinus CCE9901
gb|KDD73446.1|  ribosomal L15                                           239   2e-75    Helicosporidium sp. ATCC 50920
ref|XP_004348091.1|  ribosomal protein L15                              236   3e-74    Capsaspora owczarzaki ATCC 30864
gb|EPE06282.1|  60s ribosomal protein l15                               234   9e-74    Ophiostoma piceae UAMH 11346
ref|XP_503229.1|  60S ribosomal protein L15                             234   1e-73    Yarrowia lipolytica CLIB122
ref|XP_005717822.1|  60S ribosomal protein L15                          234   2e-73    Chondrus crispus [carageen]
gb|ERS96332.1|  60S ribosomal protein L15                               234   2e-73    Sporothrix schenckii ATCC 58251
ref|XP_006690758.1|  ribosomal protein L15-like protein                 233   3e-73    Chaetomium thermophilum var. thermophilum DSM 1495
gb|ACU45020.1|  60s ribosomal protein L15                               233   7e-73    Pfiesteria piscicida
gb|EFX04788.1|  60S ribosomal protein l15                               232   8e-73    Grosmannia clavigera kw1407
gb|KJB51845.1|  hypothetical protein B456_008G234000                    229   1e-72    Gossypium raimondii
gb|KCW90852.1|  hypothetical protein EUGRSUZ_A02903                     229   3e-72    Eucalyptus grandis [rose gum]
tpg|DAA40843.1|  TPA: hypothetical protein ZEAMMB73_797426              229   5e-72    
tpg|DAA40844.1|  TPA: hypothetical protein ZEAMMB73_797426              228   5e-72    
gb|KIV95599.1|  60S ribosomal protein L15                               230   5e-72    Exophiala mesophila
gb|KEF63356.1|  60S ribosomal protein L15                               230   6e-72    Exophiala aquamarina CBS 119918
gb|KIN02516.1|  hypothetical protein OIDMADRAFT_18358                   229   8e-72    Oidiodendron maius Zn
ref|XP_008713401.1|  60S ribosomal protein L15                          229   8e-72    Cyphellophora europaea CBS 101466
gb|KIX01331.1|  60S ribosomal protein L15                               229   1e-71    Rhinocladiella mackenziei CBS 650.93
emb|CEJ94099.1|  Putative Ribosomal protein L15                         229   1e-71    Torrubiella hemipterigena
gb|EQL00837.1|  Ribosomal protein L15e                                  228   2e-71    Ophiocordyceps sinensis CO18
gb|ESW97334.1|  60S ribosomal protein L15-B                             228   3e-71    Ogataea parapolymorpha DL-1
ref|XP_957199.1|  60S ribosomal protein L15                             228   3e-71    Neurospora crassa OR74A
ref|XP_009159952.1|  60S ribosomal protein L15                          228   3e-71    Exophiala dermatitidis NIH/UT8656
ref|XP_006822011.1|  PREDICTED: 60S ribosomal protein L15-like is...    228   3e-71    Saccoglossus kowalevskii
ref|XP_008725811.1|  60S ribosomal protein L15                          228   3e-71    Cladophialophora carrionii CBS 160.54
gb|KIE03942.1|  Ribosomal protein L15e                                  228   5e-71    Metarhizium majus ARSEF 297
gb|KIW07591.1|  60S ribosomal protein L15                               228   6e-71    Verruconis gallopava
ref|XP_001541513.1|  60S ribosomal protein L15                          228   6e-71    Histoplasma capsulatum NAm1
ref|XP_001624083.1|  predicted protein                                  228   6e-71    Nematostella vectensis
gb|KIY95038.1|  60S ribosomal protein L15-1                             227   6e-71    Monoraphidium neglectum
ref|XP_003657786.1|  60S ribosomal protein L15                          227   7e-71    Thielavia terrestris NRRL 8126
ref|XP_003666937.1|  hypothetical protein MYCTH_2312102                 227   7e-71    Thermothelomyces thermophila ATCC 42464
gb|KIW41910.1|  60S ribosomal protein L15                               229   1e-70    Exophiala oligosperma
gb|KEQ59346.1|  60S ribosomal protein L15                               227   1e-70    Aureobasidium melanogenum CBS 110374
ref|XP_007812013.1|  60S ribosomal protein L15                          227   1e-70    Metarhizium acridum CQMa 102
gb|KEQ99844.1|  hypothetical protein AUEXF2481DRAFT_25720               228   1e-70    Aureobasidium subglaciale EXF-2481
ref|XP_005703122.1|  60S ribosomal protein L15e isoform 2               226   1e-70    Galdieria sulphuraria
ref|XP_002545593.1|  60S ribosomal protein L15-B                        226   1e-70    Candida tropicalis MYA-3404
ref|XP_001545571.1|  60S ribosomal protein L15                          226   1e-70    
gb|KID77747.1|  Ribosomal protein L15e                                  226   1e-70    Metarhizium brunneum ARSEF 3297
ref|XP_007788991.1|  putative 60s ribosomal protein l15 protein         226   2e-70    
ref|XP_001909718.1|  hypothetical protein                               226   2e-70    Podospora anserina S mat+
gb|KIX93106.1|  60S ribosomal protein L15                               226   2e-70    Fonsecaea multimorphosa CBS 102226
ref|XP_007759046.1|  60S ribosomal protein L15                          226   2e-70    Cladophialophora yegresii CBS 114405
ref|XP_009226880.1|  60S ribosomal protein L15                          226   2e-70    Gaeumannomyces tritici R3-111a-1
gb|EPQ66314.1|  Protein component of the large (60S) ribosomal su...    226   2e-70    Blumeria graminis f. sp. tritici 96224
ref|XP_007804051.1|  60S ribosomal protein L15                          226   2e-70    Endocarpon pusillum Z07020
ref|XP_008080630.1|  Ribosomal proteins S24e, L23 and L15e              226   2e-70    Glarea lozoyensis ATCC 20868
gb|KIW20891.1|  60S ribosomal protein L15                               226   2e-70    Exophiala spinifera
ref|XP_003233932.1|  60S ribosomal protein L15                          226   2e-70    Trichophyton rubrum CBS 118892
gb|EMS53506.1|  60S ribosomal protein L15                               224   2e-70    Triticum urartu
gb|EEQ87750.1|  60S ribosomal protein L15                               226   2e-70    
gb|KHN95867.1|  Ribosomal protein L15e                                  226   2e-70    Metarhizium album ARSEF 1941
ref|XP_002623870.1|  60S ribosomal protein L15                          226   2e-70    Blastomyces gilchristii SLH14081
ref|XP_003382517.1|  PREDICTED: 60S ribosomal protein L15-like          226   3e-70    Amphimedon queenslandica
ref|XP_007925894.1|  hypothetical protein MYCFIDRAFT_58365              226   3e-70    Pseudocercospora fijiensis CIRAD86
gb|ACR24948.1|  ribosomal protein L15                                   226   3e-70    Lepidochitona cinerea
ref|XP_003350788.1|  60S ribosomal protein L15                          226   3e-70    Sordaria macrospora k-hell
gb|ESZ93952.1|  60S ribosomal protein L15                               226   3e-70    Sclerotinia borealis F-4128
ref|XP_002797110.1|  60S ribosomal protein L15                          225   4e-70    Paracoccidioides lutzii Pb01
gb|ENH84342.1|  60s ribosomal protein l15                               225   4e-70    
gb|KGQ83010.1|  60S ribosomal protein L15-A                             225   4e-70    Candida albicans P37005
ref|XP_001225510.1|  60S ribosomal protein L15                          225   4e-70    Chaetomium globosum CBS 148.51
ref|XP_001525424.1|  60S ribosomal protein L15-B                        225   5e-70    Lodderomyces elongisporus NRRL YB-4239
gb|EMS24660.1|  60S ribosomal protein l15                               225   5e-70    Rhodotorula toruloides NP11
ref|XP_007373844.1|  hypothetical protein SPAPADRAFT_59682              225   5e-70    Spathaspora passalidarum NRRL Y-27907
ref|XP_007737355.1|  60S ribosomal protein L15                          225   5e-70    Capronia epimyces CBS 606.96
gb|KIW77490.1|  60S ribosomal protein L15                               225   5e-70    Fonsecaea pedrosoi CBS 271.37
ref|XP_006965992.1|  60s ribosomal protein L152/L15B                    225   6e-70    Trichoderma reesei QM6a
gb|KEY67005.1|  hypothetical protein S7711_05126                        225   6e-70    Stachybotrys chartarum IBT 7711
ref|XP_007671745.1|  hypothetical protein BAUCODRAFT_566278             225   6e-70    Baudoinia panamericana UAMH 10762
emb|CCF41498.1|  60S ribosomal protein L15                              224   7e-70    Colletotrichum higginsianum
ref|XP_007835687.1|  60S ribosomal protein L15                          224   8e-70    Pestalotiopsis fici W106-1
ref|XP_717445.1|  likely cytosolic ribosomal protein L15                224   9e-70    
emb|CDK25606.1|  unnamed protein product                                224   9e-70    Kuraishia capsulata CBS 1993
gb|EHK15888.1|  hypothetical protein TRIVIDRAFT_217112                  224   1e-69    Trichoderma virens Gv29-8
ref|XP_003869213.1|  Rpl15a ribosomal protein                           224   1e-69    Candida orthopsilosis Co 90-125
ref|XP_002162844.1|  PREDICTED: 60S ribosomal protein L15-like          224   1e-69    Hydra vulgaris
ref|XP_004339224.1|  ribosomal L15, putative                            224   1e-69    Acanthamoeba castellanii str. Neff
ref|XP_007741637.1|  60S ribosomal protein L15                          224   1e-69    Cladophialophora psammophila CBS 110553
ref|XP_007724541.1|  60S ribosomal protein L15                          224   1e-69    Capronia coronata CBS 617.96
ref|XP_008596519.1|  60S ribosomal protein L15                          224   1e-69    Beauveria bassiana ARSEF 2860
ref|XP_001212942.1|  60S ribosomal protein L15                          224   2e-69    Aspergillus terreus NIH2624
ref|XP_004198963.1|  Piso0_002360                                       224   2e-69    
ref|XP_001245521.1|  60S ribosomal protein L15                          223   2e-69    Coccidioides immitis RS
emb|CCE42581.1|  hypothetical protein CPAR2_202240                      223   2e-69    Candida parapsilosis
ref|XP_007595397.1|  ribosomal L15                                      223   2e-69    
ref|XP_003884098.1|  hypothetical protein NCLIV_045010                  223   2e-69    Neospora caninum Liverpool
emb|CCD34791.1|  hypothetical protein BofuT4_P098500.1                  226   2e-69    Botrytis cinerea T4
ref|XP_002583622.1|  60S ribosomal protein L15                          223   2e-69    Uncinocarpus reesii 1704
gb|KFA61144.1|  hypothetical protein S40285_02203                       223   2e-69    Stachybotrys chlorohalonata IBT 40285
ref|XP_003709740.1|  60S ribosomal protein L15                          223   2e-69    Magnaporthe oryzae 70-15
gb|KFY50714.1|  hypothetical protein V496_09238                         224   3e-69    Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|ELR05722.1|  60S ribosomal protein L15                               223   3e-69    Pseudogymnoascus destructans 20631-21
gb|EFQ32205.1|  ribosomal L15                                           223   3e-69    Colletotrichum graminicola M1.001
ref|XP_005534852.1|  60S ribosomal protein L15                          223   3e-69    Cyanidioschyzon merolae strain 10D
gb|KHJ35835.1|  putative 60s ribosomal protein l15                      223   3e-69    
emb|CCX31468.1|  Similar to 60S ribosomal protein L15; acc. no. Q...    223   3e-69    
ref|XP_762879.1|  60S ribosomal protein L15                             223   3e-69    
ref|XP_002366469.1|  ribosomal protein L15, putative                    223   3e-69    
ref|XP_003856171.1|  60S ribosomal protein L15                          223   3e-69    
gb|KFY89477.1|  hypothetical protein V500_05675                         223   4e-69    
emb|CDM26463.1|  60S ribosomal protein L15                              223   5e-69    
ref|XP_007915208.1|  putative 60s ribosomal protein l15 protein         223   5e-69    
ref|XP_009691154.1|  60S ribosomal protein L15                          222   6e-69    
gb|KIW51029.1|  60S ribosomal protein L15                               222   6e-69    
ref|XP_007589065.1|  putative 60s ribosomal protein l15 protein         222   6e-69    
ref|XP_007872719.1|  ribosomal L15                                      222   6e-69    
ref|XP_003837801.1|  hypothetical protein LEMA_P121210.1                224   7e-69    
gb|EKG10086.1|  Ribosomal protein L15e                                  222   7e-69    
gb|KIH94692.1|  large subunit ribosomal protein L15e                    222   7e-69    
ref|XP_001265199.1|  60S ribosomal protein L15                          222   7e-69    
gb|KIV77401.1|  60S ribosomal protein L15                               231   9e-69    
ref|XP_007511637.1|  60S ribosomal protein L15                          222   9e-69    
ref|XP_007296945.1|  60S ribosomal protein L15                          222   1e-68    
emb|CEP61029.1|  LALA0S02e05138g1_1                                     221   1e-68    
ref|XP_455872.1|  60S ribosomal protein L15                             221   1e-68    
gb|EME46361.1|  hypothetical protein DOTSEDRAFT_70383                   221   1e-68    
ref|XP_008020295.1|  hypothetical protein SETTUDRAFT_40911              221   1e-68    
gb|KEZ43818.1|  hypothetical protein SAPIO_CDS3973                      221   1e-68    
ref|XP_001388776.1|  60S ribosomal protein L15                          221   2e-68    
gb|EMF14509.1|  ribosomal protein L15e                                  221   2e-68    
ref|XP_006670037.1|  60S ribosomal protein L15                          221   2e-68    
dbj|GAM89956.1|  hypothetical protein ANO11243_079960                   221   2e-68    
ref|XP_002553867.1|  60S ribosomal protein L15                          221   2e-68    
ref|XP_658049.1|  RL15_ASPNG 60S RIBOSOMAL PROTEIN L15                  221   2e-68    
emb|CDO96181.1|  unnamed protein product                                221   2e-68    
gb|KFH46732.1|  60S ribosomal protein-like protein                      221   2e-68    
ref|XP_001644954.1|  hypothetical protein Kpol_1025p16                  221   2e-68    
gb|KIW64984.1|  60S ribosomal protein L15                               231   2e-68    
emb|CCQ18640.1|  60S ribosomal protein L15                              221   3e-68    
ref|XP_002616462.1|  conserved hypothetical protein                     220   3e-68    
ref|XP_011414691.1|  PREDICTED: 60S ribosomal protein L15-like          220   3e-68    
gb|EPS27962.1|  hypothetical protein PDE_02907                          220   4e-68    
gb|KEY77864.1|  60S ribosomal protein L15                               220   4e-68    
ref|XP_001386507.1|  60S ribosomal protein L15                          220   4e-68    
gb|EYE94488.1|  60S ribosomal protein L15                               220   4e-68    
ref|XP_461011.1|  60S ribosomal protein L15                             220   4e-68    
ref|XP_003686547.1|  60S ribosomal protein L15                          220   5e-68    
ref|XP_003296271.1|  60S ribosomal protein L15                          221   5e-68    
dbj|BAO40104.1|  60S ribosomal protein L15-B                            220   5e-68    
ref|XP_011123288.1|  hypothetical protein AOL_s00081g168                220   6e-68    
ref|XP_003647297.1|  hypothetical protein Ecym_6084                     219   7e-68    
ref|XP_002561234.1|  Pc16g09160                                         219   7e-68    
ref|XP_004377436.1|  PREDICTED: 60S ribosomal protein L15 isoform 1     219   7e-68    
ref|XP_003054429.1|  60S ribosomal protein L15                          219   9e-68    
ref|XP_001484435.1|  60S ribosomal protein L15-A                        219   9e-68    
ref|XP_001820015.1|  60S ribosomal protein L15                          219   1e-67    
gb|EMG48668.1|  Ribosomal protein L15                                   219   1e-67    
gb|KGK38943.1|  hypothetical protein JL09_g1954                         219   1e-67    
gb|EQL32630.1|  hypothetical protein BDFG_05175                         229   1e-67    
ref|XP_002598589.1|  hypothetical protein BRAFLDRAFT_113717             219   1e-67    
ref|XP_005029295.1|  PREDICTED: 60S ribosomal protein L15               219   1e-67    
ref|XP_006686733.1|  hypothetical protein CANTEDRAFT_114246             219   1e-67    
ref|XP_003415776.1|  PREDICTED: 60S ribosomal protein L15               219   2e-67    
gb|EOA94531.1|  60S ribosomal protein L15                               219   2e-67    
gb|KFY33682.1|  hypothetical protein V495_08272                         227   2e-67    
ref|XP_009263009.1|  hypothetical protein FPSE_11617                    219   2e-67    
ref|XP_004199814.1|  Piso0_002360                                       219   2e-67    
gb|KFY44566.1|  hypothetical protein V494_01413                         227   2e-67    
gb|KFX94172.1|  hypothetical protein O988_06437                         227   2e-67    
ref|XP_955444.1|  60S ribosomal protein l15                             218   2e-67    
gb|KFY08345.1|  hypothetical protein V492_06315                         226   2e-67    
gb|KDB17596.1|  60S ribosomal protein L15                               227   2e-67    
gb|KIL94800.1|  60s ribosomal protein l15                               218   2e-67    
ref|XP_004221219.1|  60S ribosomal protein L15-1                        218   2e-67    
ref|NP_985761.1|  60S ribosomal protein L15                             218   2e-67    
gb|EJT43462.1|  RPL15B-like protein                                     218   2e-67    
emb|CCE30070.1|  probable ribosomal protein L15.e.B, cytosolic          226   2e-67    
gb|KFZ12787.1|  hypothetical protein V502_06922                         226   3e-67    
ref|XP_002484013.1|  60S ribosomal protein L15                          218   3e-67    
emb|CCF76104.1|  unnamed protein product                                218   3e-67    
ref|XP_007421748.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    218   3e-67    
ref|XP_004991174.1|  ribosomal protein L15                              218   3e-67    
ref|XP_002150249.1|  60S ribosomal protein L15                          218   3e-67    
ref|XP_002836891.1|  60S ribosomal protein L15                          218   3e-67    
ref|XP_010986099.1|  PREDICTED: 60S ribosomal protein L15               218   3e-67    
ref|NP_001080766.1|  ribosomal protein L15                              218   3e-67    
gb|KFH71724.1|  60S ribosomal protein L15                               218   3e-67    
gb|EMT61608.1|  60S ribosomal protein L15                               218   3e-67    
ref|XP_009502210.1|  PREDICTED: 60S ribosomal protein L15               218   3e-67    
ref|XP_007505229.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    218   3e-67    
gb|EJT43834.1|  hypothetical protein SKUD_204406                        218   3e-67    
gb|AJS80338.1|  Rpl15bp                                                 218   4e-67    
gb|KFO70740.1|  60S ribosomal protein L15                               218   4e-67    
emb|CCK68268.1|  hypothetical protein KNAG_0A06060                      218   4e-67    
gb|AAS59857.1|  ribosomal protein L15                                   218   4e-67    
ref|XP_007068583.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    218   4e-67    
ref|NP_001292094.1|  60S ribosomal protein L15                          218   4e-67    
gb|AGH70163.1|  60S ribosomal protein L15                               218   5e-67    
ref|XP_007344080.1|  60S ribosomal protein L15                          217   6e-67    
tpg|DAA16199.1|  TPA: ribosomal protein L15-like                        217   6e-67    
ref|XP_004832605.1|  60S ribosomal protein L15, putative                217   6e-67    
emb|CEI91883.1|  Putative Ribosomal protein L15                         217   6e-67    
dbj|GAM38142.1|  60S ribosomal protein                                  217   6e-67    
ref|XP_001615040.1|  60S ribosomal protein L15-1                        217   6e-67    
gb|KIW22669.1|  60S ribosomal protein L15                               226   6e-67    
sp|Q7T2N4.3|RL15_SILME  RecName: Full=60S ribosomal protein L15         217   7e-67    
ref|XP_003678734.1|  60S ribosomal protein L15                          217   7e-67    
gb|EIE79210.1|  60S ribosomal protein L15                               217   7e-67    
ref|NP_001266930.1|  60S ribosomal protein L15                          217   8e-67    
sp|Q7T3N1.3|RL15_MYLPI  RecName: Full=60S ribosomal protein L15         217   8e-67    
ref|NP_001003447.1|  60S ribosomal protein L15                          217   8e-67    
ref|XP_002108683.1|  expressed hypothetical protein                     217   8e-67    
emb|CAH91644.1|  hypothetical protein                                   217   8e-67    
ref|XP_002808654.1|  60S ribosomal protein L15, putative                217   8e-67    
tpg|DAA32565.1|  TPA: ribosomal protein L15-like                        217   9e-67    
ref|XP_006986589.1|  PREDICTED: 60S ribosomal protein L15-like          217   9e-67    
ref|NP_079862.1|  60S ribosomal protein L15                             217   9e-67    
ref|XP_003226267.1|  PREDICTED: 60S ribosomal protein L15               217   9e-67    
ref|XP_002759698.1|  PREDICTED: 60S ribosomal protein L15               217   9e-67    
ref|XP_008816354.1|  ribosomal L15                                      217   9e-67    
emb|CAJ82575.1|  ribosomal protein L15                                  217   9e-67    
gb|EHN00844.1|  Rpl15bp                                                 217   9e-67    
ref|XP_003025216.1|  hypothetical protein TRV_00621                     217   9e-67    
gb|AAN52373.1|  ribosomal protein L15                                   217   1e-66    
gb|AAV38477.1|  ribosomal protein L15                                   217   1e-66    
ref|XP_009657767.1|  60S ribosomal protein L15-B                        216   1e-66    
ref|NP_013840.1|  ribosomal 60S subunit protein L15B                    216   1e-66    
dbj|GAA24916.1|  K7_Rpl15ap                                             216   1e-66    
gb|EXL86692.1|  60S ribosomal protein L15                               218   1e-66    
gb|EHN05368.1|  Rpl15bp                                                 216   1e-66    
gb|AJS78588.1|  Rpl15bp                                                 216   1e-66    
gb|EHN01315.1|  Rpl15bp                                                 216   1e-66    
ref|XP_011227834.1|  PREDICTED: 60S ribosomal protein L15               216   1e-66    
ref|XP_003957065.1|  hypothetical protein KAFR_0D02820                  216   1e-66    
gb|AJS62423.1|  Rpl15bp                                                 216   1e-66    
ref|XP_009937095.1|  PREDICTED: 60S ribosomal protein L15               216   1e-66    
ref|XP_008831372.1|  PREDICTED: 60S ribosomal protein L15               216   1e-66    
ref|XP_002258209.1|  ribosomal protein l15                              216   1e-66    
gb|ADO28804.1|  60S ribosomal protein l15                               216   1e-66    
gb|KFR14077.1|  60S ribosomal protein L15                               216   1e-66    
gb|EGU81126.1|  hypothetical protein FOXB_08400                         218   1e-66    
gb|ETE59074.1|  60S ribosomal protein L15                               216   1e-66    
gb|AAH30575.1|  Similar to RIKEN cDNA 2510008H07 gene                   217   2e-66    
gb|EGA57755.1|  Rpl15ap                                                 216   2e-66    
gb|EWG89405.1|  Rpl15bp                                                 216   2e-66    
ref|XP_002491583.1|  60S ribosomal protein L15                          216   2e-66    
gb|KIY71642.1|  ribosomal protein L15e                                  216   2e-66    
ref|XP_007762548.1|  ribosomal protein L15e                             216   2e-66    
gb|KFP76634.1|  60S ribosomal protein L15                               216   2e-66    
gb|EWZ51470.1|  60S ribosomal protein L15                               218   2e-66    
gb|EWG84044.1|  Rpl15bp                                                 216   2e-66    
gb|EGA77362.1|  Rpl15bp                                                 216   2e-66    
ref|XP_009887238.1|  PREDICTED: 60S ribosomal protein L15               216   2e-66    
ref|XP_001269695.1|  60S ribosomal protein L15                          216   2e-66    
ref|XP_005040971.1|  PREDICTED: 60S ribosomal protein L15               216   2e-66    
gb|KFO06064.1|  60S ribosomal protein L15                               216   2e-66    
gb|KFM13801.1|  60S ribosomal protein L15                               216   2e-66    
ref|XP_444915.1|  60S ribosomal protein L15                             216   2e-66    
ref|XP_010136517.1|  PREDICTED: 60S ribosomal protein L15               216   2e-66    
gb|EIF48674.1|  60s ribosomal protein l15-b                             216   2e-66    
sp|Q7T3N7.3|RL15_CYPCA  RecName: Full=60S ribosomal protein L15         216   2e-66    
gb|EXK95810.1|  60S ribosomal protein L15                               218   2e-66    
gb|KGL96424.1|  60S ribosomal protein L15                               216   2e-66    
ref|XP_008936743.1|  PREDICTED: 60S ribosomal protein L15               216   2e-66    
emb|CEP13977.1|  hypothetical protein                                   216   3e-66    
ref|NP_001187212.1|  60S ribosomal protein L15                          216   3e-66    
ref|XP_003936085.1|  PREDICTED: 60S ribosomal protein L15               216   3e-66    
ref|XP_006635829.1|  PREDICTED: 60S ribosomal protein L15-like          216   3e-66    
gb|AAG44837.1|  60S ribosomal protein L15                               216   3e-66    
gb|AAH14837.1|  Ribosomal protein L15                                   216   3e-66    
ref|XP_006021253.1|  PREDICTED: 60S ribosomal protein L15               216   3e-66    
dbj|BAE31437.1|  unnamed protein product                                216   3e-66    
gb|AAX36167.1|  ribosomal protein L15                                   215   3e-66    
ref|XP_004634243.1|  PREDICTED: 60S ribosomal protein L15               215   3e-66    
gb|ETW38445.1|  hypothetical protein PFTANZ_00876                       215   3e-66    
gb|AJS76851.1|  Rpl15bp                                                 215   3e-66    
ref|XP_011104444.1|  rpl15ap                                            215   3e-66    
emb|CEG70134.1|  Putative Ribosomal protein L15                         215   4e-66    
sp|Q7T3N4.3|RL15_MEGAM  RecName: Full=60S ribosomal protein L15         215   4e-66    
gb|KIM66174.1|  hypothetical protein SCLCIDRAFT_1211398                 215   4e-66    
gb|AJS94717.1|  Rpl15bp                                                 215   4e-66    
ref|XP_007378639.1|  60S ribosomal protein L15                          215   4e-66    
gb|ERE87094.1|  60S ribosomal protein L15-like protein                  215   4e-66    
ref|XP_011115334.1|  hypothetical protein H072_9785                     215   4e-66    
sp|Q7T3P0.3|RL15_HYPNO  RecName: Full=60S ribosomal protein L15         215   4e-66    
ref|XP_003281126.1|  PREDICTED: 60S ribosomal protein L15-like is...    215   4e-66    
ref|XP_007414800.1|  hypothetical protein MELLADRAFT_91790              215   4e-66    
ref|NP_013129.1|  ribosomal 60S subunit protein L15A                    215   5e-66    
gb|AAX43023.1|  ribosomal protein L15                                   215   5e-66    
dbj|BAB79461.1|  ribosomal protein L15                                  215   5e-66    
gb|EWM27504.1|  Ribosomal protein L15e                                  215   5e-66    
gb|AJS95152.1|  Rpl15bp                                                 214   6e-66    
pdb|1S1I|L  Chain L, Structure Of The Ribosomal 80s-Eef2-Sordarin...    214   6e-66    
ref|XP_003455275.1|  PREDICTED: 60S ribosomal protein L15-like is...    214   6e-66    
gb|AJS74671.1|  Rpl15bp                                                 214   7e-66    
gb|AAX08723.1|  ribosomal protein L15                                   214   7e-66    
emb|CAG00252.1|  unnamed protein product                                214   7e-66    
ref|XP_004179266.1|  hypothetical protein TBLA_0B09300                  214   8e-66    
gb|AFJ91723.1|  60S ribosomal protein L15                               214   8e-66    
ref|NP_001011478.1|  ribosomal protein L15                              214   8e-66    
gb|KIK28524.1|  hypothetical protein PISMIDRAFT_673552                  214   8e-66    
dbj|BAB27107.1|  unnamed protein product                                214   8e-66    
ref|XP_003969112.1|  PREDICTED: 60S ribosomal protein L15-like          214   8e-66    
sp|P61368.2|RL15_HYDVU  RecName: Full=60S ribosomal protein L15         214   1e-65    
sp|P61369.2|RL15_SILAS  RecName: Full=60S ribosomal protein L15         214   1e-65    
gb|AAN73345.1|  ribosomal protein L15                                   213   1e-65    
ref|XP_007695684.1|  hypothetical protein COCSADRAFT_133030             214   1e-65    
gb|EKV11308.1|  hypothetical protein PDIG_51450                         223   1e-65    
gb|EGA61325.1|  Rpl15ap                                                 214   1e-65    
gb|KIO08255.1|  hypothetical protein M404DRAFT_997181                   214   1e-65    
pdb|3JYW|L  Chain L, Structure Of The 60s Proteins For Eukaryotic...    213   1e-65    
gb|EPB90299.1|  60S ribosomal protein L15                               214   1e-65    
ref|XP_008630208.1|  PREDICTED: 60S ribosomal protein L15               214   1e-65    
ref|XP_007713002.1|  hypothetical protein COCCADRAFT_97949              214   1e-65    
ref|NP_001232361.1|  putative 60S ribosomal protein L10                 214   2e-65    
gb|EPB89957.1|  60S ribosomal protein L15                               214   2e-65    
dbj|GAD92792.1|  60S ribosomal protein L15                              223   2e-65    
sp|P61367.2|RL15_EPICO  RecName: Full=60S ribosomal protein L15         213   2e-65    
emb|CDR41295.1|  CYFA0S07e00386g1_1                                     213   2e-65    
emb|CDQ81142.1|  unnamed protein product                                213   2e-65    
gb|EDL26238.1|  mCG16398                                                213   2e-65    
ref|XP_007864396.1|  60S ribosomal protein L15                          213   3e-65    
ref|XP_006005298.1|  PREDICTED: 60S ribosomal protein L15               213   3e-65    
gb|EUD70551.1|  ribosomal L15                                           213   3e-65    
ref|XP_001828739.2|  60S ribosomal protein L15                          214   3e-65    



>ref|XP_004241917.1| PREDICTED: 60S ribosomal protein L15 [Solanum lycopersicum]
 ref|XP_006355022.1| PREDICTED: 60S ribosomal protein L15-like [Solanum tuberosum]
 ref|XP_006356521.1| PREDICTED: 60S ribosomal protein L15 [Solanum tuberosum]
Length=204

 Score =   312 bits (799),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 175/182 (96%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVRVTRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV
Sbjct  76   SKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN
Sbjct  136  DQAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_004242022.1| PREDICTED: 60S ribosomal protein L15 [Solanum lycopersicum]
 ref|XP_006363900.1| PREDICTED: 60S ribosomal protein L15-like [Solanum tuberosum]
Length=204

 Score =   311 bits (798),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 173/182 (95%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVRVTRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEVIL+
Sbjct  76   SKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEVILI  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D+AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN
Sbjct  136  DSAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_004236901.1| PREDICTED: 60S ribosomal protein L15-like [Solanum lycopersicum]
Length=204

 Score =   310 bits (795),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 174/182 (96%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVRVTRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV
Sbjct  76   SKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AHA IRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN
Sbjct  136  DQAHAGIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_009606590.1| PREDICTED: 60S ribosomal protein L15 [Nicotiana tomentosiformis]
 ref|XP_009601449.1| PREDICTED: 60S ribosomal protein L15 [Nicotiana tomentosiformis]
 ref|XP_009780055.1| PREDICTED: 60S ribosomal protein L15 [Nicotiana sylvestris]
Length=204

 Score =   310 bits (793),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 174/182 (96%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVRVTRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DQAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_009796395.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana sylvestris]
Length=204

 Score =   309 bits (792),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 174/182 (96%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVRVTRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DQAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>gb|EPS66678.1| hypothetical protein M569_08101, partial [Genlisea aurea]
Length=203

 Score =   307 bits (786),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF LR+RCWEYRQL ++VR+TRPTRPDKA RLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  15   SDVMRFVLRIRCWEYRQLPAVVRITRPTRPDKAHRLGYKAKQGYVIYRVRVRRGGRKRPV  74

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEVILV
Sbjct  75   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEVILV  134

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  135  DPAHAAIRNDPRINWVCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  194

Query  177  QT  172
            QT
Sbjct  195  QT  196



>ref|XP_011069801.1| PREDICTED: 60S ribosomal protein L15 [Sesamum indicum]
Length=204

 Score =   306 bits (785),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF LRVRCWEYRQL ++VRVT PTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLLRVRCWEYRQLPAVVRVTHPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVIL+
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILI  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AHA +RNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DPAHATVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>emb|CDP10996.1| unnamed protein product [Coffea canephora]
Length=186

 Score =   306 bits (783),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 174/179 (97%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -2

Query  708  MRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRF LRVRCWEYRQL SIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILVDPA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            HAAIRNDPRINWLC PVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT
Sbjct  121  HAAIRNDPRINWLCQPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  179



>ref|XP_010686789.1| PREDICTED: 60S ribosomal protein L15 [Beta vulgaris subsp. vulgaris]
Length=204

 Score =   306 bits (783),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 171/182 (94%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVRVT PTRPDKARRLGYKAKQG+V+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFTQRVRCWEYRQLPSIVRVTHPTRPDKARRLGYKAKQGFVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVMNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            DTAH AIRNDPR+NW+CNPVHKHRELRGLTSAGKKYRGLRGRGHL+HKARPSRRATWKRN
Sbjct  136  DTAHNAIRNDPRVNWICNPVHKHRELRGLTSAGKKYRGLRGRGHLNHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_011076388.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum]
 ref|XP_011076389.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum]
Length=204

 Score =   306 bits (783),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF LRVRCWEYRQL ++VRVT PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLLRVRCWEYRQLPAVVRVTHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVIL+
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILI  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AHA +RNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DPAHATVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_006477158.1| PREDICTED: 60S ribosomal protein L15-like [Citrus sinensis]
 gb|KDO61391.1| hypothetical protein CISIN_1g028730mg [Citrus sinensis]
Length=204

 Score =   305 bits (780),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 174/182 (96%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>gb|EYU24942.1| hypothetical protein MIMGU_mgv1a013374mg [Erythranthe guttata]
Length=222

 Score =   305 bits (781),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF LRVRCWEYRQL ++VRVT PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  34   SDVMRFLLRVRCWEYRQLPAVVRVTHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  93

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL GLRVLNSYWINEDSTYKYFEVIL+
Sbjct  94   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLAGLRVLNSYWINEDSTYKYFEVILI  153

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH  +RNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN
Sbjct  154  DPAHTTVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  213

Query  177  QT  172
            QT
Sbjct  214  QT  215



>gb|EYU43197.1| hypothetical protein MIMGU_mgv1a012815mg [Erythranthe guttata]
Length=239

 Score =   305 bits (782),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 171/182 (94%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF LRVRCWEYRQL ++VRVT PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  51   SDVMRFLLRVRCWEYRQLPAVVRVTHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  110

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL GLRVLNSYWINEDSTYKYFEVILV
Sbjct  111  PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLAGLRVLNSYWINEDSTYKYFEVILV  170

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH  +RNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN
Sbjct  171  DPAHTTVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  230

Query  177  QT  172
            QT
Sbjct  231  QT  232



>sp|O82528.1|RL15_PETHY RecName: Full=60S ribosomal protein L15 [Petunia x hybrida]
 gb|AAD13389.1| ribosomal protein L15 [Petunia x hybrida]
Length=204

 Score =   303 bits (777),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 172/182 (95%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVRVTRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQR+KRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRTKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHLH+KA PSRRA WKRN
Sbjct  136  DQAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHNKAPPSRRANWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_010667037.1| PREDICTED: 60S ribosomal protein L15-1 [Beta vulgaris subsp. 
vulgaris]
Length=204

 Score =   303 bits (777),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 171/182 (94%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF LRVRCWEYRQL SIVRVT PTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFVLRVRCWEYRQLPSIVRVTHPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWLNEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            DTAH A+RN+PRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHL+HK RPSRRATWKRN
Sbjct  136  DTAHNAVRNNPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLNHKNRPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_006490145.1| PREDICTED: 60S ribosomal protein L15-like [Citrus sinensis]
 gb|KDO49938.1| hypothetical protein CISIN_1g028757mg [Citrus sinensis]
Length=204

 Score =   303 bits (777),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 172/182 (95%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_006440278.1| hypothetical protein CICLE_v10024403mg [Citrus clementina]
 gb|ESR53518.1| hypothetical protein CICLE_v10024403mg [Citrus clementina]
Length=230

 Score =   304 bits (779),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 174/182 (96%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  42   SDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  101

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV
Sbjct  102  PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  161

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  162  DPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  221

Query  177  QT  172
             T
Sbjct  222  NT  223



>gb|EPS59253.1| hypothetical protein M569_15555, partial [Genlisea aurea]
Length=203

 Score =   303 bits (776),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF LR+RCWEYRQL ++VR+TRPTRPDKA RLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  15   SDVMRFVLRIRCWEYRQLPAVVRITRPTRPDKAHRLGYKAKQGYVIYRVRVRRGGRKRPV  74

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+EVIL+
Sbjct  75   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYYEVILI  134

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AHA +RNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  135  DPAHAVVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  194

Query  177  QT  172
            QT
Sbjct  195  QT  196



>ref|XP_002301250.1| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_006375250.1| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_011033124.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica]
 gb|EEE80523.1| 60S ribosomal protein L15 [Populus trichocarpa]
 gb|ERP53047.1| 60S ribosomal protein L15 [Populus trichocarpa]
Length=204

 Score =   303 bits (776),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 172/182 (95%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVT PTRPDKARRLGYKAKQGYVVYR+RVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVVYRIRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN
Sbjct  136  DAAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_007209614.1| hypothetical protein PRUPE_ppa011603mg [Prunus persica]
 ref|XP_008238447.1| PREDICTED: 60S ribosomal protein L15 [Prunus mume]
 gb|EMJ10813.1| hypothetical protein PRUPE_ppa011603mg [Prunus persica]
Length=204

 Score =   303 bits (775),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 173/182 (95%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG+GHL+HKARPSRRATWKRN
Sbjct  136  DVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKARPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  TT  197



>ref|XP_011076387.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum]
Length=204

 Score =   302 bits (774),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF LRVRCWEYRQL ++VRVT  TRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLLRVRCWEYRQLPAVVRVTHSTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AHA +RNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DPAHATVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_011080625.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum]
Length=204

 Score =   302 bits (774),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF LRVRCWEYRQL ++VRVT  TRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLLRVRCWEYRQLPAVVRVTHSTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVIL+
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILI  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH  IRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DPAHTTIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_009607935.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana tomentosiformis]
Length=204

 Score =   302 bits (774),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVRVTRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+EVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHL+HK RPSRR TWKRN
Sbjct  136  DAAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKNRPSRRGTWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_006421625.1| hypothetical protein CICLE_v10005611mg [Citrus clementina]
 gb|ESR34865.1| hypothetical protein CICLE_v10005611mg [Citrus clementina]
Length=273

 Score =   305 bits (780),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 172/182 (95%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  85   SDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  144

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEVILV
Sbjct  145  PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEVILV  204

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  205  DAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  264

Query  177  QT  172
            QT
Sbjct  265  QT  266



>ref|XP_011031909.1| PREDICTED: 60S ribosomal protein L15 isoform X1 [Populus euphratica]
Length=206

 Score =   302 bits (773),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 173/182 (95%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVT PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  18   SDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  77

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV
Sbjct  78   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  137

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRA WKRN
Sbjct  138  DVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRANWKRN  197

Query  177  QT  172
             T
Sbjct  198  NT  199



>emb|CDP11952.1| unnamed protein product [Coffea canephora]
Length=186

 Score =   301 bits (771),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -2

Query  708  MRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRF LRVRCWEYRQL SIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILVDPA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            HAAIRNDPRI+W+C PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRNQT
Sbjct  121  HAAIRNDPRIHWICEPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT  179



>ref|XP_009764605.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana sylvestris]
Length=204

 Score =   302 bits (773),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVRVTRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEVIL+
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEVILI  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AHAA+RNDPRINW+CNPVHKHRELRGLTSAGKK RGL+G+GHLHHK RPSRRATWKRN
Sbjct  136  DAAHAAVRNDPRINWICNPVHKHRELRGLTSAGKKNRGLQGKGHLHHKQRPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_002304285.2| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_006376227.1| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_011031910.1| PREDICTED: 60S ribosomal protein L15 isoform X2 [Populus euphratica]
 gb|ABK93503.1| unknown [Populus trichocarpa]
 gb|ERP54024.1| 60S ribosomal protein L15 [Populus trichocarpa]
 gb|EEE79264.2| 60S ribosomal protein L15 [Populus trichocarpa]
Length=204

 Score =   302 bits (773),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 173/182 (95%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVT PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRA WKRN
Sbjct  136  DVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRANWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_009768655.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana sylvestris]
Length=204

 Score =   302 bits (773),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVRVTRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL GL+VLNSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLAGLKVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHL+HK RPSRR TWKRN
Sbjct  136  DAAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKNRPSRRGTWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_006369001.1| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_011001458.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica]
 gb|ABK93954.1| unknown [Populus trichocarpa]
 gb|ERP65570.1| 60S ribosomal protein L15 [Populus trichocarpa]
Length=204

 Score =   301 bits (770),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 172/182 (95%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVT PTRPDKARRLGYKAKQGYVVYR+RVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVVYRIRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRA WKRN
Sbjct  136  DVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRANWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_011017435.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica]
Length=228

 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 171/182 (94%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVT PTRPDKARRLGYKAKQGYVVYR+RVRRGGRKRPV
Sbjct  40   SDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVVYRIRVRRGGRKRPV  99

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEVILV
Sbjct  100  PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEVILV  159

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN
Sbjct  160  DAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  219

Query  177  QT  172
            QT
Sbjct  220  QT  221



>ref|XP_009618098.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana tomentosiformis]
Length=204

 Score =   300 bits (769),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVRVTRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+EVIL+
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEVILI  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AHAA+RNDPRINW+CNPVHKHRELRGLTSAGKK RGL+G+GHLHHK RPSRRATWKRN
Sbjct  136  DAAHAAVRNDPRINWICNPVHKHRELRGLTSAGKKNRGLQGKGHLHHKQRPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_010933636.1| PREDICTED: 60S ribosomal protein L15-1 [Elaeis guineensis]
Length=204

 Score =   300 bits (768),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL +IVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPAIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+CN VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DAAHNAIRNDPRINWICNGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_002510977.1| ribosomal protein L15, putative [Ricinus communis]
 gb|EEF51579.1| ribosomal protein L15, putative [Ricinus communis]
Length=204

 Score =   300 bits (768),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVTRPTRPDKARR+GYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRMGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_008369443.1| PREDICTED: 60S ribosomal protein L15-1 [Malus domestica]
 ref|XP_008363794.1| PREDICTED: 60S ribosomal protein L15-1 [Malus domestica]
Length=236

 Score =   301 bits (771),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  48   SDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  107

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEVI+V
Sbjct  108  SKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWLNEDSTYKYFEVIMV  167

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG+GHL+HK RPSRRATWKRN
Sbjct  168  DVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKNRPSRRATWKRN  227

Query  177  QT  172
             T
Sbjct  228  TT  229



>ref|XP_007157273.1| hypothetical protein PHAVU_002G057000g [Phaseolus vulgaris]
 gb|ESW29267.1| hypothetical protein PHAVU_002G057000g [Phaseolus vulgaris]
Length=204

 Score =   300 bits (767),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEV+LV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEVVLV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AHAAIRNDPRINWLCNPVHKHRELRGLTSAGK  RGLRGRGHL+HKARPSRRATWKRN
Sbjct  136  DVAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHLYHKARPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>gb|KDP39891.1| hypothetical protein JCGZ_03422 [Jatropha curcas]
Length=204

 Score =   299 bits (766),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 171/182 (94%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVT PTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINWLC+PVHKHRELRGLTSAGKKYRGLRGRGHLHHK RPSRRATWKRN
Sbjct  136  DVAHNAIRNDPRINWLCDPVHKHRELRGLTSAGKKYRGLRGRGHLHHKNRPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_009334550.1| PREDICTED: 60S ribosomal protein L15-1 [Pyrus x bretschneideri]
 ref|XP_009334556.1| PREDICTED: 60S ribosomal protein L15-1 [Pyrus x bretschneideri]
Length=235

 Score =   300 bits (769),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  47   SDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  106

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEVI+V
Sbjct  107  SKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWLNEDSTYKYFEVIMV  166

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG+GHL+HK RPSRRATWKRN
Sbjct  167  DVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKNRPSRRATWKRN  226

Query  177  QT  172
             T
Sbjct  227  TT  228



>gb|KHG00889.1| 60S ribosomal L15 [Gossypium arboreum]
 gb|KJB40093.1| hypothetical protein B456_007G046500 [Gossypium raimondii]
Length=204

 Score =   299 bits (765),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            DTAH AIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRA WKRN
Sbjct  136  DTAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRANWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>gb|KHG22797.1| 60S ribosomal L15-1 -like protein [Gossypium arboreum]
 gb|KJB07871.1| hypothetical protein B456_001G049600 [Gossypium raimondii]
Length=204

 Score =   298 bits (764),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DPAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_010919627.1| PREDICTED: 60S ribosomal protein L15 isoform X1 [Elaeis guineensis]
Length=204

 Score =   298 bits (764),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DAAHNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_008798983.1| PREDICTED: 60S ribosomal protein L15-like [Phoenix dactylifera]
 ref|XP_008810110.1| PREDICTED: 60S ribosomal protein L15-like [Phoenix dactylifera]
Length=204

 Score =   298 bits (763),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DAAHNAVRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_007038342.1| Ribosomal protein L23/L15e family protein [Theobroma cacao]
 gb|EOY22843.1| Ribosomal protein L23/L15e family protein [Theobroma cacao]
Length=204

 Score =   298 bits (762),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRA WKRN
Sbjct  136  DPAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRANWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_009352987.1| PREDICTED: 60S ribosomal protein L15-like [Pyrus x bretschneideri]
Length=204

 Score =   298 bits (762),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SD+MRF  RVRCWEYRQ  SIVRVTRPTRPDKAR LGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDLMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARCLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGR+LGGLRVLNSYWINEDSTYKYFEVILV
Sbjct  76   SKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRRLGGLRVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG+GHL+HKARPSRRATWKRN
Sbjct  136  DVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKARPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  TT  197



>ref|XP_008775187.1| PREDICTED: 60S ribosomal protein L15 [Phoenix dactylifera]
Length=204

 Score =   298 bits (762),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+EVILV
Sbjct  76   PKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH+AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DAAHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_011001078.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica]
Length=204

 Score =   298 bits (762),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 171/182 (94%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVKHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINWLCNPV KHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRA WKRN
Sbjct  136  DVAHNAIRNDPRINWLCNPVQKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRANWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_010933963.1| PREDICTED: 60S ribosomal protein L15-like [Elaeis guineensis]
Length=204

 Score =   297 bits (761),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVRVTRPTRPDKARRLGYKAKQGYV+YR+RVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DAAHNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>gb|KDP22442.1| hypothetical protein JCGZ_26273 [Jatropha curcas]
Length=204

 Score =   297 bits (761),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVT PTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRA WKRN
Sbjct  136  DAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRANWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>gb|KDO49939.1| hypothetical protein CISIN_1g028757mg [Citrus sinensis]
Length=186

 Score =   296 bits (759),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -2

Query  708  MRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRF  RVRCWEYRQ  SIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEVILVDAA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRNQT
Sbjct  121  HNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT  179



>ref|XP_004146916.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis 
sativus]
 ref|XP_004146917.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis 
sativus]
 ref|XP_004167164.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis 
sativus]
 ref|XP_004167165.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis 
sativus]
 gb|KGN53150.1| hypothetical protein Csa_4G022860 [Cucumis sativus]
 gb|KGN56283.1| hypothetical protein Csa_3G112770 [Cucumis sativus]
 gb|KGN56284.1| hypothetical protein Csa_3G112780 [Cucumis sativus]
Length=204

 Score =   297 bits (760),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKY+EVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DVAHNAVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_010934657.1| PREDICTED: 60S ribosomal protein L15-1-like [Elaeis guineensis]
Length=204

 Score =   296 bits (759),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  R+RCWEYRQL SIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRIRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGI+YGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+EVILV
Sbjct  76   PKGIIYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH+AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DAAHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_011031911.1| PREDICTED: 60S ribosomal protein L15 isoform X3 [Populus euphratica]
Length=186

 Score =   296 bits (758),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -2

Query  708  MRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRF  RVRCWEYRQ  SIVRVT PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDVA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRA WKRN T
Sbjct  121  HNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRANWKRNNT  179



>ref|XP_002530661.1| ribosomal protein L15, putative [Ricinus communis]
 gb|EEF31730.1| ribosomal protein L15, putative [Ricinus communis]
Length=204

 Score =   296 bits (759),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVTRPTRPDKARR+GYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRMGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINWLC PVHKHRELRGLTS+GKKYRGLRG+GHLHHK RPSRR TWKRN
Sbjct  136  DVAHNAIRNDPRINWLCKPVHKHRELRGLTSSGKKYRGLRGKGHLHHKNRPSRRGTWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_008437057.1| PREDICTED: 60S ribosomal protein L15-2 isoform X2 [Cucumis melo]
 ref|XP_008453903.1| PREDICTED: 60S ribosomal protein L15-2 [Cucumis melo]
Length=204

 Score =   296 bits (759),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRI W+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DVAHNAIRNDPRIKWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_008437056.1| PREDICTED: 60S ribosomal protein L15-2 isoform X1 [Cucumis melo]
Length=214

 Score =   297 bits (760),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  26   SDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  85

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVILV
Sbjct  86   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILV  145

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRI W+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  146  DVAHNAIRNDPRIKWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  205

Query  177  QT  172
             T
Sbjct  206  NT  207



>ref|XP_010264371.1| PREDICTED: 60S ribosomal protein L15-like [Nelumbo nucifera]
Length=204

 Score =   296 bits (758),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGI+YGKPTNQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+E+ILV
Sbjct  76   PKGIMYGKPTNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGL G+GHLHHKARPSRRATWKRN
Sbjct  136  DAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLHGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_010107162.1| 60S ribosomal protein L15 [Morus notabilis]
 gb|EXC13927.1| 60S ribosomal protein L15 [Morus notabilis]
Length=204

 Score =   296 bits (758),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SD+MRF  RVRCWEYRQ  SIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDLMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFE+ILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATWKRN
Sbjct  136  DPAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_002277836.1| PREDICTED: 60S ribosomal protein L15-1 [Vitis vinifera]
Length=204

 Score =   296 bits (757),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+E+ILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATWKRN
Sbjct  136  DAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHRHHKARPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_008796124.1| PREDICTED: 60S ribosomal protein L15-2 [Phoenix dactylifera]
Length=204

 Score =   295 bits (756),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL +IVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPAIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH  IRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DAAHNTIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>pdb|3J61|N Chain N, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
Length=200

 Score =   295 bits (755),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  +IVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILV
Sbjct  76   PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH+AIRNDPRINWLC PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATWKRN
Sbjct  136  DVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|NP_001050612.1| Os03g0598800 [Oryza sativa Japonica Group]
 ref|NP_001174316.1| Os05g0274700 [Oryza sativa Japonica Group]
 gb|AAN08216.1| ribosomal protein L15 [Oryza sativa Japonica Group]
 gb|AAO59978.1| ribosomal protein L15 [Oryza sativa Japonica Group]
 gb|ABF97468.1| 60S ribosomal protein L15, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12526.1| Os03g0598800 [Oryza sativa Japonica Group]
 gb|EAY90899.1| hypothetical protein OsI_12513 [Oryza sativa Indica Group]
 gb|EAZ27702.1| hypothetical protein OsJ_11650 [Oryza sativa Japonica Group]
 dbj|BAG87626.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96945.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00645.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH93044.1| Os05g0274700 [Oryza sativa Japonica Group]
Length=204

 Score =   295 bits (755),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  +IVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILV
Sbjct  76   PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH+AIRNDPRINWLC PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATWKRN
Sbjct  136  DVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>emb|CBI16601.3| unnamed protein product [Vitis vinifera]
Length=206

 Score =   295 bits (756),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  18   SDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  77

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+E+ILV
Sbjct  78   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEIILV  137

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATWKRN
Sbjct  138  DAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHRHHKARPSRRATWKRN  197

Query  177  QT  172
             T
Sbjct  198  NT  199



>ref|XP_006650289.1| PREDICTED: 60S ribosomal protein L15-like [Oryza brachyantha]
Length=204

 Score =   295 bits (755),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  +IVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILV
Sbjct  76   PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH+AIRNDPRINWLC PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATWKRN
Sbjct  136  DVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>emb|CAN68893.1| hypothetical protein VITISV_004609 [Vitis vinifera]
Length=204

 Score =   295 bits (755),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIV  TRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVXATRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRS+AEERAGRKLGGL+VLNSYWINEDSTYKY+EVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSIAEERAGRKLGGLKVLNSYWINEDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_004152395.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis 
sativus]
 ref|XP_004158132.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis 
sativus]
 gb|KGN50265.1| hypothetical protein Csa_5G162630 [Cucumis sativus]
Length=204

 Score =   295 bits (755),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINW+CNPVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DVAHNAVRNDPRINWICNPVHKRRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_007155679.1| hypothetical protein PHAVU_003G222000g [Phaseolus vulgaris]
 gb|ESW27673.1| hypothetical protein PHAVU_003G222000g [Phaseolus vulgaris]
Length=204

 Score =   295 bits (754),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSV+EERAGRKLGGLRVLNSYW+NEDSTYKYFEV+LV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVSEERAGRKLGGLRVLNSYWVNEDSTYKYFEVVLV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH+A+RNDPRINWLCNPVHKHRELRGLTSAGK  RGLRGRGHL+HK RPSRRATWKRN
Sbjct  136  DVAHSAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHLYHKNRPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_006655163.1| PREDICTED: 60S ribosomal protein L15-like [Oryza brachyantha]
Length=213

 Score =   295 bits (755),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  +IVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  25   SDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  84

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILV
Sbjct  85   PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILV  144

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH+AIRNDPRINWLC PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATWKRN
Sbjct  145  DVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRATWKRN  204

Query  177  QT  172
            QT
Sbjct  205  QT  206



>ref|XP_010529971.1| PREDICTED: 60S ribosomal protein L15-1 [Tarenaya hassleriana]
 ref|XP_010529975.1| PREDICTED: 60S ribosomal protein L15-1 [Tarenaya hassleriana]
Length=204

 Score =   295 bits (754),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            DTAH+AIRNDPR+NW+CNPVHKHRELRGLTS GKK RGLRG+GHL+HK RPSRRATWKRN
Sbjct  136  DTAHSAIRNDPRVNWICNPVHKHRELRGLTSEGKKNRGLRGKGHLYHKNRPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>gb|AGL08210.1| 60S ribosomal protein L15 [Arachis hypogaea]
 gb|AGL08221.1| 60S ribosomal protein L15 [Arachis hypogaea]
Length=204

 Score =   294 bits (753),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQQPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEE+AGRKLGGLRVLNSYW+NEDSTYKYFE+I+V
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEEKAGRKLGGLRVLNSYWVNEDSTYKYFEIIMV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINWLCNPVHKHRELRGLTSAGK  RGLRG+GHL+HK RPSRRATWKRN
Sbjct  136  DVAHTAIRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGKGHLYHKNRPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_010258850.1| PREDICTED: 60S ribosomal protein L15 [Nelumbo nucifera]
Length=204

 Score =   294 bits (753),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGI+YGKPTNQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+E+ILV
Sbjct  76   PKGIMYGKPTNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGL G+GHLHHKARPSRRA WKRN
Sbjct  136  DAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLHGKGHLHHKARPSRRANWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_008452210.1| PREDICTED: 60S ribosomal protein L15-2-like [Cucumis melo]
 ref|XP_008452211.1| PREDICTED: 60S ribosomal protein L15-2-like [Cucumis melo]
 ref|XP_008452213.1| PREDICTED: 60S ribosomal protein L15-2-like [Cucumis melo]
Length=204

 Score =   294 bits (753),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRI W+C PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DVAHNAIRNDPRIKWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_010053499.1| PREDICTED: 60S ribosomal protein L15-2 [Eucalyptus grandis]
 gb|KCW77807.1| hypothetical protein EUGRSUZ_D02096 [Eucalyptus grandis]
Length=204

 Score =   294 bits (753),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVT PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH  IR DPRI+WLCNPVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATWKRN
Sbjct  136  DVAHTTIRRDPRISWLCNPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRATWKRN  195

Query  177  QT  172
             +
Sbjct  196  NS  197



>ref|XP_009406701.1| PREDICTED: 60S ribosomal protein L15-1-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   294 bits (752),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVRVTRPTRPDKARRLGYKAKQG+V+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGFVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+E+IL+
Sbjct  76   PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYYEIILI  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH+AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DPAHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_002268465.1| PREDICTED: 60S ribosomal protein L15-1-like [Vitis vinifera]
Length=204

 Score =   294 bits (752),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIV  TRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVCATRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRS+AEERAGRKLGGL+VLNSYWINEDSTYKY+EVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSIAEERAGRKLGGLKVLNSYWINEDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_003635402.1| PREDICTED: 60S ribosomal protein L15-1 [Vitis vinifera]
Length=204

 Score =   294 bits (752),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+E+ILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH  IRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATWKRN
Sbjct  136  DAAHNTIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHRHHKARPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>gb|ACV50439.1| ribosomal protein L15 [Jatropha curcas]
Length=204

 Score =   293 bits (751),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVT PTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFE ILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEDILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            DTAH AIRNDPRINW+C PVHKHRELRGLT AGKKYRGLRGRGHLHHKARPSRRA WKRN
Sbjct  136  DTAHNAIRNDPRINWICKPVHKHRELRGLTFAGKKYRGLRGRGHLHHKARPSRRANWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_008241281.1| PREDICTED: 60S ribosomal protein L15-like [Prunus mume]
Length=204

 Score =   293 bits (751),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SD+MRF  RVRCWEYRQ  SIVRVTRPTRPDKARRLGYKAKQGYVVYR+RVRRGGRKRPV
Sbjct  16   SDLMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRIRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGR+LGGLRVLNSYWINEDSTYKYFEVILV
Sbjct  76   AKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRRLGGLRVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINWLCNPVHKHRELRGLTSAGKK RGL G+GHL+HKARPSRRATWKRN
Sbjct  136  DVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKCRGLGGKGHLYHKARPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_009399011.1| PREDICTED: 60S ribosomal protein L15-1-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   293 bits (751),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+EVIL+
Sbjct  76   PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYYEVILI  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DPAHNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_006838929.1| hypothetical protein AMTR_s00002p00270230 [Amborella trichopoda]
 gb|ERN01498.1| hypothetical protein AMTR_s00002p00270230 [Amborella trichopoda]
Length=204

 Score =   293 bits (750),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYWIN+DSTYKY+E+ILV
Sbjct  76   PKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYWINQDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+  PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DAAHNAIRNDPRINWITKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_010104882.1| 60S ribosomal protein L15 [Morus notabilis]
 gb|EXC02118.1| 60S ribosomal protein L15 [Morus notabilis]
Length=241

 Score =   294 bits (753),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVTRPTRPD+ARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  53   SDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDRARRLGYKAKQGYVIYRVRVRRGGRKRPV  112

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW NEDSTYKYFEVILV
Sbjct  113  PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWTNEDSTYKYFEVILV  172

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINWL  PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATWKRN
Sbjct  173  DVAHNAIRNDPRINWLSKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRATWKRN  232

Query  177  QT  172
             T
Sbjct  233  NT  234



>ref|XP_010062398.1| PREDICTED: 60S ribosomal protein L15-1 [Eucalyptus grandis]
 gb|KCW90851.1| hypothetical protein EUGRSUZ_A02903 [Eucalyptus grandis]
Length=204

 Score =   293 bits (749),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVT PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW+NEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWLNEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH  IR DPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATWKRN
Sbjct  136  DAAHNTIRKDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHSHHKARPSRRATWKRN  195

Query  177  QT  172
             +
Sbjct  196  NS  197



>ref|XP_009418976.1| PREDICTED: 60S ribosomal protein L15-1 [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   293 bits (749),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+IL+
Sbjct  76   PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVVNSYWVNEDSTYKYYEIILI  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH+AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DPAHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_006837338.1| hypothetical protein AMTR_s00111p00086580 [Amborella trichopoda]
 gb|ERN00192.1| hypothetical protein AMTR_s00111p00086580 [Amborella trichopoda]
Length=204

 Score =   293 bits (749),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVR TRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPSIVRCTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYWIN+DSTYKY+EVILV
Sbjct  76   PKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYWINQDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHL+HK RPSRRATWKRN
Sbjct  136  DAAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKNRPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_010919628.1| PREDICTED: 60S ribosomal protein L15 isoform X2 [Elaeis guineensis]
Length=186

 Score =   292 bits (747),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -2

Query  708  MRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRF  RVRCWEYRQL SIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVD A
Sbjct  61   IVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDAA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRNQT
Sbjct  121  HNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT  179



>ref|NP_001150716.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACF85905.1| unknown [Zea mays]
 gb|ACG40111.1| 60S ribosomal protein L15 [Zea mays]
 tpg|DAA62720.1| TPA: ribosomal protein L15 [Zea mays]
Length=204

 Score =   292 bits (748),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  +IVR+TRPTRPDKARRLG+KAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILV
Sbjct  76   PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATWKRN
Sbjct  136  DVAHTAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|NP_001235890.1| uncharacterized protein LOC100305473 [Glycine max]
 ref|XP_003538942.1| PREDICTED: 60S ribosomal protein L15-1-like [Glycine max]
 gb|ACU13151.1| unknown [Glycine max]
 gb|KHN34919.1| 60S ribosomal protein L15 [Glycine soja]
 gb|KHN42683.1| 60S ribosomal protein L15 [Glycine soja]
Length=204

 Score =   292 bits (748),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+TR TRPDKARRLG+KAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AHAAIRNDPRINWL NPVHKHRELRGLTSAGK  RGLRGRGHL+HKARPSRRATWKRN
Sbjct  136  DVAHAAIRNDPRINWLANPVHKHRELRGLTSAGKSNRGLRGRGHLYHKARPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>gb|ACF88005.1| unknown [Zea mays]
 tpg|DAA62722.1| TPA: ribosomal protein L15 [Zea mays]
Length=204

 Score =   292 bits (747),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  +IVR+TRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRKRPV
Sbjct  16   SDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILV
Sbjct  76   PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATWKRN
Sbjct  136  DVAHTAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_009398340.1| PREDICTED: 60S ribosomal protein L15-1-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   292 bits (747),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVRVTRPTRPDKARRLG+KAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGFKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+E+IL+
Sbjct  76   PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYYEIILI  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DPAHGAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>gb|EEE63068.1| hypothetical protein OsJ_17876 [Oryza sativa Japonica Group]
Length=377

 Score =   298 bits (762),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  +IVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  189  SDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  248

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILV
Sbjct  249  PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILV  308

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH+AIRNDPRINWLC PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATWKRN
Sbjct  309  DVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRATWKRN  368

Query  177  QT  172
            QT
Sbjct  369  QT  370



>ref|XP_002460708.1| hypothetical protein SORBIDRAFT_02g033530 [Sorghum bicolor]
 gb|ACG25131.1| 60S ribosomal protein L15 [Zea mays]
 gb|EER97229.1| hypothetical protein SORBIDRAFT_02g033530 [Sorghum bicolor]
 tpg|DAA40842.1| TPA: ribosomal protein L15 [Zea mays]
Length=204

 Score =   291 bits (746),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  +IVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILV
Sbjct  76   PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH  IRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATWKRN
Sbjct  136  DVAHTTIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_007202591.1| hypothetical protein PRUPE_ppa011597mg [Prunus persica]
 ref|XP_008244846.1| PREDICTED: 60S ribosomal protein L15-1-like [Prunus mume]
 gb|EMJ03790.1| hypothetical protein PRUPE_ppa011597mg [Prunus persica]
Length=204

 Score =   291 bits (746),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVTRPTRPDKAR LGYKAKQGYVVYRVRV+RGGRKRPV
Sbjct  16   SDVMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARLLGYKAKQGYVVYRVRVKRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKPTNQGVTQLKFQRS RSVAEERAGRKL GLRVLNSYWINEDSTYKYFEVILV
Sbjct  76   SKGIVYGKPTNQGVTQLKFQRSLRSVAEERAGRKLAGLRVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINWLCNPVHKHRELRGLTSAGKK RGLRG+GHL+HKARPSRRATWKRN
Sbjct  136  DVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKCRGLRGKGHLYHKARPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  TT  197



>gb|KHG16565.1| 60S ribosomal L15-1 -like protein [Gossypium arboreum]
Length=204

 Score =   291 bits (746),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHLHHK RPSRRATWKRN
Sbjct  136  DVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHLHHKNRPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_010539199.1| PREDICTED: 60S ribosomal protein L15-1-like [Tarenaya hassleriana]
Length=197

 Score =   291 bits (745),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQG VVYRVRVRRGGRKRPV
Sbjct  9    SDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGIVVYRVRVRRGGRKRPV  68

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL GLRVLNSYWINEDSTYKY+EVILV
Sbjct  69   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLAGLRVLNSYWINEDSTYKYYEVILV  128

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            DTAH+A+RNDPR+NW+CNPVHKHRELRGLTS GKK RGLRG+GHL+HK RPSRRATWKRN
Sbjct  129  DTAHSAVRNDPRMNWICNPVHKHRELRGLTSEGKKNRGLRGKGHLYHKNRPSRRATWKRN  188

Query  177  QT  172
             T
Sbjct  189  NT  190



>ref|NP_001148602.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACF83256.1| unknown [Zea mays]
 gb|ACG32179.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACG38194.1| 60S ribosomal protein L15 [Zea mays]
 tpg|DAA59713.1| TPA: ribosomal protein L15 [Zea mays]
Length=204

 Score =   291 bits (745),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRKRPV
Sbjct  16   SDVMRFVQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILV
Sbjct  76   PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AI+ DPRINWLCNPVHKHRELRGLTSAGKKYRGLRG+GH HHK RPSRRATWKRN
Sbjct  136  DVAHKAIKTDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHTHHKNRPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>gb|KHN44085.1| 60S ribosomal protein L15 [Glycine soja]
Length=204

 Score =   291 bits (745),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+TR TRPDKARRLG+KAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH+A+RNDPRINWLCNPVHKHRELRGLTSAGK  RGLRGRGHL+HK RPSRRATWKRN
Sbjct  136  DVAHSAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHLYHKNRPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>gb|KJB51842.1| hypothetical protein B456_008G234000 [Gossypium raimondii]
 gb|KJB51843.1| hypothetical protein B456_008G234000 [Gossypium raimondii]
 gb|KJB51844.1| hypothetical protein B456_008G234000 [Gossypium raimondii]
 gb|KJB51846.1| hypothetical protein B456_008G234000 [Gossypium raimondii]
Length=204

 Score =   291 bits (745),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SI+RV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIIRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHLHHK RPSRRATWKRN
Sbjct  136  DVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHLHHKNRPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_009408522.1| PREDICTED: 60S ribosomal protein L15-1-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   291 bits (745),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVRVTRPTRPD+ARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDRARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+E+IL+
Sbjct  76   PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYYEIILL  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D +H+AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DPSHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_010539086.1| PREDICTED: 60S ribosomal protein L15-1-like [Tarenaya hassleriana]
Length=204

 Score =   291 bits (745),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVTRPTRPDKARRLGYKAKQG+VVYR+RV+RGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQQPSIVRVTRPTRPDKARRLGYKAKQGFVVYRIRVKRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GHL HK RPSRRATWKRN
Sbjct  136  DPAHKAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHLFHKNRPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>gb|EEC78893.1| hypothetical protein OsI_19264 [Oryza sativa Indica Group]
Length=377

 Score =   297 bits (761),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  +IVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  189  SDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  248

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILV
Sbjct  249  PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILV  308

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH+AIRNDPRINWLC PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATWKRN
Sbjct  309  DVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRATWKRN  368

Query  177  QT  172
            QT
Sbjct  369  QT  370



>ref|XP_010538411.1| PREDICTED: 60S ribosomal protein L15-1-like [Tarenaya hassleriana]
Length=204

 Score =   291 bits (744),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVTRPTRPDKARRLGYKAKQG+VVYR+RV+RGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQQPSIVRVTRPTRPDKARRLGYKAKQGFVVYRIRVKRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPR+NW+CNPVHKHRELRGLTS GKK RGLRG+GHL+HK RPSRRATWKRN
Sbjct  136  DPAHKAVRNDPRMNWICNPVHKHRELRGLTSEGKKNRGLRGKGHLYHKNRPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>gb|ACU24496.1| unknown [Glycine max]
Length=204

 Score =   291 bits (744),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+TR TRPDKARRLG+KAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH+A+RNDPRINWLCNPVHKHRELRGLTSAGK  RGLRGRGHL+HK RPSRRATWKRN
Sbjct  136  DVAHSAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHLYHKNRPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|NP_001148378.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACG31200.1| 60S ribosomal protein L15 [Zea mays]
Length=204

 Score =   291 bits (744),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  R+RCWEYRQ  +IVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFVQRMRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILV
Sbjct  76   PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH  IRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATWKRN
Sbjct  136  DVAHTTIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_008360544.1| PREDICTED: 60S ribosomal protein L15 [Malus domestica]
Length=204

 Score =   291 bits (744),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SD+MRF  RVRCWEYRQ  SIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDLMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGR+LGGLRVLNSYWINEDSTY YFEVILV
Sbjct  76   SKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRRLGGLRVLNSYWINEDSTYXYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRND RIN LCNPVHKHRELRGLTSAGKKYRGLRG+GHL+HKARPSRRATWKRN
Sbjct  136  DVAHNAIRNDARINXLCNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKARPSRRATWKRN  195



>ref|XP_006837287.1| hypothetical protein AMTR_s00111p00023340 [Amborella trichopoda]
 gb|ERN00141.1| hypothetical protein AMTR_s00111p00023340 [Amborella trichopoda]
Length=233

 Score =   291 bits (746),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL SIVR TRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  45   SDVMRFLQRVRCWEYRQLPSIVRCTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  104

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYWIN+DSTYKY+EVILV
Sbjct  105  PKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYWINQDSTYKYYEVILV  164

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHL+HK RPSRRATWKRN
Sbjct  165  DAAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKNRPSRRATWKRN  224

Query  177  QT  172
             T
Sbjct  225  NT  226



>gb|KHG20796.1| 60S ribosomal L15-1 -like protein [Gossypium arboreum]
 gb|KJB39739.1| hypothetical protein B456_007G028600 [Gossypium raimondii]
Length=204

 Score =   290 bits (743),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  +IVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPAIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHLHHK RPSRRATWKRN
Sbjct  136  DVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHLHHKNRPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_003549922.1| PREDICTED: 60S ribosomal protein L15-1-like [Glycine max]
 gb|KHN09835.1| 60S ribosomal protein L15 [Glycine soja]
Length=204

 Score =   290 bits (743),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+TR TRPDKARRLG+KAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINWLCNPVHKHRELRGLTSAGK  RGLRGRGHL+HK RPSRRATWKRN
Sbjct  136  DVAHTAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHLYHKNRPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_010540825.1| PREDICTED: 60S ribosomal protein L15-1-like [Tarenaya hassleriana]
 ref|XP_010542214.1| PREDICTED: 60S ribosomal protein L15-1 [Tarenaya hassleriana]
Length=204

 Score =   290 bits (743),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVTRPTRPDKARRLGYKAKQG+VVYR+RV+RGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQQPSIVRVTRPTRPDKARRLGYKAKQGFVVYRIRVKRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPR+NW+CNPVHKHRELRGLTS GKK RGLRG+GHL+HK RPSRRATWKRN
Sbjct  136  DVAHKAVRNDPRMNWICNPVHKHRELRGLTSEGKKNRGLRGKGHLYHKNRPSRRATWKRN  195

Query  177  QT  172
             +
Sbjct  196  NS  197



>gb|ACF87670.1| unknown [Zea mays]
Length=204

 Score =   290 bits (743),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  +IVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQL+FQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILV
Sbjct  76   PKGIVYGKPKHQGITQLRFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH  IRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATWKRN
Sbjct  136  DVAHTTIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_002461521.1| hypothetical protein SORBIDRAFT_02g004020 [Sorghum bicolor]
 gb|EER98042.1| hypothetical protein SORBIDRAFT_02g004020 [Sorghum bicolor]
Length=204

 Score =   290 bits (742),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  +IVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILV
Sbjct  76   PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AI+ DPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATWKRN
Sbjct  136  DVAHTAIKTDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|NP_001150386.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACG38875.1| 60S ribosomal protein L15 [Zea mays]
Length=204

 Score =   290 bits (742),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  +IVR+TRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRKRPV
Sbjct  16   SDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILV
Sbjct  76   PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIR DPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATWKRN
Sbjct  136  DVAHTAIRKDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>gb|AAT85124.1| putative 60s ribosomal protein L15 [Oryza sativa Japonica Group]
Length=186

 Score =   289 bits (739),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -2

Query  708  MRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRF  RVRCWEYRQ  +IVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILVD A
Sbjct  61   IVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILVDVA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H+AIRNDPRINWLC PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATWKRNQT
Sbjct  121  HSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRATWKRNQT  179



>gb|ADA67930.1| putative 60S ribosomal protein L15 [Wolffia arrhiza]
Length=204

 Score =   290 bits (741),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF LRVRCWEYRQ+ +IVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLLRVRCWEYRQMPAIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYW+NEDSTYKY+EVILV
Sbjct  76   PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYWVNEDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D A  AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  136  DGALNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_004152396.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis 
sativus]
 ref|XP_004158133.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis 
sativus]
Length=186

 Score =   289 bits (739),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -2

Query  708  MRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRF  RVRCWEYRQ  SIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILVDVA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H A+RNDPRINW+CNPVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN T
Sbjct  121  HNAVRNDPRINWICNPVHKRRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT  179



>ref|XP_007039791.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007039792.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24292.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24293.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma 
cacao]
Length=206

 Score =   290 bits (741),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  18   SDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  77

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEVILV
Sbjct  78   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFEVILV  137

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHL+HK RPSRRATWKRN
Sbjct  138  DVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHLYHKNRPSRRATWKRN  197

Query  177  QT  172
             T
Sbjct  198  NT  199



>ref|XP_004491939.1| PREDICTED: 60S ribosomal protein L15-1-like isoform X2 [Cicer 
arietinum]
Length=204

 Score =   289 bits (740),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDST+KYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTFKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINWL NPVHKHRELRGLTSAGK+ RGLRG+GH +HK RPSRRATWKRN
Sbjct  136  DVAHTAIRNDPRINWLVNPVHKHRELRGLTSAGKENRGLRGKGHRYHKNRPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>gb|AFK49215.1| unknown [Medicago truncatula]
 gb|KEH35101.1| 60S ribosomal protein L15-1 [Medicago truncatula]
Length=204

 Score =   289 bits (740),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDST+KYFEVILV
Sbjct  76   SKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTFKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH+AIRNDPRINWL NPVHKHRELRGLTSAGK+ RGL G+GH +HKARPSRRA WKRN
Sbjct  136  DVAHSAIRNDPRINWLTNPVHKHRELRGLTSAGKENRGLSGKGHRYHKARPSRRANWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_007039793.1| Ribosomal protein L23/L15e family protein isoform 3 [Theobroma 
cacao]
 gb|EOY24294.1| Ribosomal protein L23/L15e family protein isoform 3 [Theobroma 
cacao]
Length=204

 Score =   289 bits (740),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHL+HK RPSRRATWKRN
Sbjct  136  DVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHLYHKNRPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>gb|ACJ84067.1| unknown [Medicago truncatula]
Length=204

 Score =   289 bits (740),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDST+KYFEVILV
Sbjct  76   SKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTFKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH+AIRNDPRINWL NPVHKHRELRGLTSAGK+ RGL G+GH +HKARPSRRA WKRN
Sbjct  136  DVAHSAIRNDPRINWLTNPVHKHRELRGLTSAGKENRGLSGKGHRYHKARPSRRANWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|NP_001236804.1| uncharacterized protein LOC100306052 [Glycine max]
 gb|ACU14044.1| unknown [Glycine max]
Length=204

 Score =   289 bits (740),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 164/180 (91%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+TR TRPDKARRLG+KAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH+A+RNDPRINWLCNPVHKHRELRGLTSAGK  RGLRGRGHL+HK RPSRRATWKRN
Sbjct  136  DVAHSAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHLYHKNRPSRRATWKRN  195



>ref|XP_004491938.1| PREDICTED: 60S ribosomal protein L15-1-like isoform X1 [Cicer 
arietinum]
Length=216

 Score =   289 bits (740),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  28   SDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  87

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDST+KYFEVILV
Sbjct  88   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTFKYFEVILV  147

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINWL NPVHKHRELRGLTSAGK+ RGLRG+GH +HK RPSRRATWKRN
Sbjct  148  DVAHTAIRNDPRINWLVNPVHKHRELRGLTSAGKENRGLRGKGHRYHKNRPSRRATWKRN  207

Query  177  QT  172
             T
Sbjct  208  NT  209



>ref|XP_003593619.1| Ribosomal protein L15 [Medicago truncatula]
 gb|AES63870.1| 60S ribosomal protein L15-1 [Medicago truncatula]
Length=252

 Score =   290 bits (743),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  64   SDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  123

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDST+KYFEVILV
Sbjct  124  SKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTFKYFEVILV  183

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH+AIRNDPRINWL NPVHKHRELRGLTSAGK+ RGL G+GH +HKARPSRRA WKRN
Sbjct  184  DVAHSAIRNDPRINWLTNPVHKHRELRGLTSAGKENRGLSGKGHRYHKARPSRRANWKRN  243

Query  177  QT  172
             T
Sbjct  244  NT  245



>sp|O65050.1|RL15A_PICMA RecName: Full=60S ribosomal protein L15-1 [Picea mariana]
 gb|AAC32112.1| probable 60S ribosomal protein L15 [Picea mariana]
 gb|ABK22257.1| unknown [Picea sitchensis]
Length=204

 Score =   288 bits (737),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWE+RQL  IVRVTRP+RPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEFRQLPGIVRVTRPSRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP NQG+TQLKFQRS RSVAEERAGRKLGGLRVLNSYWIN+DSTYKY+E+ILV
Sbjct  76   PKGIVYGKPKNQGITQLKFQRSLRSVAEERAGRKLGGLRVLNSYWINQDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH+AIR DPRINW+CN VHKHRELRGLTSAGKKYRGLRGRGHL+HKARPS+RATWKRN
Sbjct  136  DQAHSAIRKDPRINWICNAVHKHRELRGLTSAGKKYRGLRGRGHLYHKARPSKRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>emb|CBI38664.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   287 bits (735),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -2

Query  708  MRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRF  RVRCWEYRQ  SIV  TRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVCATRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKPTNQGVTQLKFQRSKRS+AEERAGRKLGGL+VLNSYWINEDSTYKY+EVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSIAEERAGRKLGGLKVLNSYWINEDSTYKYYEVILVDAA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN T
Sbjct  121  HNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT  179



>emb|CBI25842.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   287 bits (735),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -2

Query  708  MRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRF  RVRCWEYRQ  SIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+E+ILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEIILVDAA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H  IRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATWKRN T
Sbjct  121  HNTIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHRHHKARPSRRATWKRNNT  179



>sp|O65082.1|RL15B_PICMA RecName: Full=60S ribosomal protein L15-2 [Picea mariana]
 gb|AAC32144.1| probable 60S ribosomal protein L15 [Picea mariana]
 gb|ABK25889.1| unknown [Picea sitchensis]
Length=204

 Score =   288 bits (736),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQL  IVR+T PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQLPGIVRITHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP NQG+TQLKFQRS RSVAEERAGRKLGGLRVLNSYWIN+DSTYKY+EV+LV
Sbjct  76   PKGIVYGKPKNQGITQLKFQRSLRSVAEERAGRKLGGLRVLNSYWINQDSTYKYYEVVLV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH  IRNDPRINW+CN VHKHRELRGLTSAGKKYRGLRGRGHL+HKARPS+RATWKRN
Sbjct  136  DQAHTVIRNDPRINWICNAVHKHRELRGLTSAGKKYRGLRGRGHLYHKARPSKRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>tpg|DAA62721.1| TPA: hypothetical protein ZEAMMB73_667917 [Zea mays]
Length=186

 Score =   286 bits (731),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -2

Query  708  MRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRF  RVRCWEYRQ  +IVR+TRPTRPDKARRLG+KAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILVD A
Sbjct  61   IVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILVDVA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H AIRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATWKRNQT
Sbjct  121  HTAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRATWKRNQT  179



>dbj|BAJ95856.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=204

 Score =   286 bits (733),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  +IVR+TRPTRPD+ARRLG+KAKQGYVVYR+RVRRGGRKRPV
Sbjct  16   SDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYVVYRIRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+NEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWVNEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH+A+RNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATWKRN
Sbjct  136  DVAHSAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHRHHKNRPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_003573847.1| PREDICTED: 60S ribosomal protein L15-2 [Brachypodium distachyon]
Length=204

 Score =   286 bits (733),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  +IVR+TRPTRPD+ARRLG+KAKQGYVVYR+RVRRGGRKRPV
Sbjct  16   SDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYVVYRIRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+NEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWVNEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG+G  HHK RPSRRATWKRN
Sbjct  136  DVAHNAVRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGQRHHKNRPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_004299420.1| PREDICTED: 60S ribosomal protein L15-1 [Fragaria vesca subsp. 
vesca]
Length=204

 Score =   286 bits (731),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVM F  RVRCW+YRQ  SIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMGFVQRVRCWDYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV
Sbjct  76   AKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH+ I+ DPRINW+ NPVHKHRELRGLTSAGKKYRGLRG+GH +HK RPSRRATWKRN
Sbjct  136  DVAHSVIKKDPRINWIVNPVHKHRELRGLTSAGKKYRGLRGKGHRYHKNRPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_004955579.1| PREDICTED: 60S ribosomal protein L15-1-like isoform X2 [Setaria 
italica]
Length=204

 Score =   285 bits (730),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  +IVR+TRPTRPDKARRLG+KAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QGVTQLKFQR+KRSVAEERAGRK+GGLRVLNSYW+NEDSTYKYFE+ILV
Sbjct  76   PKGIVYGKPKHQGVTQLKFQRNKRSVAEERAGRKIGGLRVLNSYWVNEDSTYKYFEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AHAAIRNDPRINWLC  VHKHRELRGLTSAGKKYRGLRG+G  HHK RPSRRATWKRN
Sbjct  136  DVAHAAIRNDPRINWLCKDVHKHRELRGLTSAGKKYRGLRGKGSSHHKNRPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>dbj|BAD22764.1| ribosomal protein [Bromus inermis]
Length=204

 Score =   285 bits (730),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  +IVR+TRPTRPD+ARRLG+KAKQGYVVYR+RVRRGGRKRPV
Sbjct  16   SDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYVVYRIRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+NEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWVNEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATWKRN
Sbjct  136  DVAHNAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHRHHKNRPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>gb|KJB39740.1| hypothetical protein B456_007G028600 [Gossypium raimondii]
Length=186

 Score =   285 bits (728),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  708  MRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRF  RVRCWEYRQ  +IVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPAIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFEVILVDVA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHLHHK RPSRRATWKRN T
Sbjct  121  HNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHLHHKNRPSRRATWKRNNT  179



>gb|AFK46983.1| unknown [Lotus japonicus]
Length=204

 Score =   285 bits (728),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+E+ILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINWLCNPVHKHREL G TSAGK  RGL G+GH HHKARPSRRATWK+N
Sbjct  136  DVAHTAIRNDPRINWLCNPVHKHRELTGKTSAGKHNRGLVGKGHRHHKARPSRRATWKKN  195

Query  177  QT  172
             +
Sbjct  196  NS  197



>ref|XP_004957717.1| PREDICTED: 60S ribosomal protein L15-1-like [Setaria italica]
Length=204

 Score =   284 bits (727),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  +IVR+TRPTRPDKARRLG+KAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRK+GGLRVLNSYW+NEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKIGGLRVLNSYWVNEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINWLC  VHKHRELRGLTSAGKKYRGLRG+G  HHK RPSRRATWKRN
Sbjct  136  DVAHTAIRNDPRINWLCKDVHKHRELRGLTSAGKKYRGLRGKGSAHHKNRPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>gb|AAK67641.1| ribosomal protein L15 [Homo sapiens]
Length=204

 Score =   284 bits (726),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  +IVR+TRPTRPD+ARRLG+KAKQGYV+YR+RVRRGGRKRPV
Sbjct  16   SDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYVIYRIRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+NED TYKYFEVILV
Sbjct  76   PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWVNEDFTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH+A+RNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATWKRN
Sbjct  136  DVAHSAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHRHHKNRPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_004512167.1| PREDICTED: 60S ribosomal protein L15-1-like [Cicer arietinum]
Length=204

 Score =   283 bits (725),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMR   R RCWEYRQ  SIVRVTRPTRPDKARRLG+KAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRCLQRWRCWEYRQQSSIVRVTRPTRPDKARRLGFKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+EVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWMNEDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPR+NW+CNPVHKHRELRGLTSAGK+ RGL+G+GH +HKARPSRRATWKRN
Sbjct  136  DVAHTAIRNDPRVNWVCNPVHKHRELRGLTSAGKQNRGLQGKGHRYHKARPSRRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_001764493.1| predicted protein [Physcomitrella patens]
 gb|EDQ70760.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   283 bits (723),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWEYRQL  IVRVTRP+RPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVLRFLLRVRCWEYRQLPGIVRVTRPSRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYWIN+DSTYKYFE+ILV
Sbjct  76   AKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYWINQDSTYKYFEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  HA IR DPRINW+ NPVHKHRELRGLTSAGKKYRGLRGRGHL+ KARPS RATWKRN
Sbjct  136  DPQHAVIRKDPRINWIVNPVHKHRELRGLTSAGKKYRGLRGRGHLYTKARPSIRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>emb|CAB10520.1| ribosomal protein [Arabidopsis thaliana]
 emb|CAB78742.1| ribosomal protein [Arabidopsis thaliana]
Length=216

 Score =   283 bits (723),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPV
Sbjct  28   SDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPV  87

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILV
Sbjct  88   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILV  147

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N
Sbjct  148  DPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWKKN  207

Query  177  QT  172
             +
Sbjct  208  NS  209



>ref|XP_009108318.1| PREDICTED: 60S ribosomal protein L15-1-like [Brassica rapa]
Length=204

 Score =   282 bits (721),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N
Sbjct  136  DPAHNAIRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWKKN  195

Query  177  QT  172
             +
Sbjct  196  NS  197



>ref|XP_003563105.1| PREDICTED: 60S ribosomal protein L15-2 [Brachypodium distachyon]
Length=204

 Score =   282 bits (721),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  +IVR+TRPTRPD+ARRLG+KAKQGYVVYR+RVRRGGRKRPV
Sbjct  16   SDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYVVYRIRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+NEDSTYKYFEVILV
Sbjct  76   PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWVNEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+G  HHK RPSRRATWKRN
Sbjct  136  DVAHNAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGTRHHKNRPSRRATWKRN  195

Query  177  QT  172
            QT
Sbjct  196  QT  197



>ref|XP_009136839.1| PREDICTED: 60S ribosomal protein L15-1 [Brassica rapa]
 gb|ABD65137.1| 60S ribosomal protein L15 [Brassica oleracea]
Length=204

 Score =   281 bits (720),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N
Sbjct  136  DPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHRNHKNRPSRRATWKKN  195

Query  177  QT  172
             +
Sbjct  196  NS  197



>emb|CDX90499.1| BnaA03g42820D [Brassica napus]
Length=275

 Score =   284 bits (726),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPV
Sbjct  87   SDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPV  146

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILV
Sbjct  147  PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILV  206

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N
Sbjct  207  DPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHRNHKNRPSRRATWKKN  266

Query  177  QT  172
             +
Sbjct  267  NS  268



>ref|XP_009145572.1| PREDICTED: 60S ribosomal protein L15-1 [Brassica rapa]
 ref|XP_009123031.1| PREDICTED: 60S ribosomal protein L15-1 [Brassica rapa]
Length=204

 Score =   281 bits (719),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N
Sbjct  136  DPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWKKN  195

Query  177  QT  172
             +
Sbjct  196  NS  197



>ref|XP_006282719.1| hypothetical protein CARUB_v10005752mg [Capsella rubella]
 gb|EOA15617.1| hypothetical protein CARUB_v10005752mg [Capsella rubella]
Length=204

 Score =   281 bits (719),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N
Sbjct  136  DPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWKKN  195

Query  177  QT  172
             +
Sbjct  196  NS  197



>ref|NP_193470.1| 60S ribosomal protein L15-2 [Arabidopsis thaliana]
 ref|XP_006282721.1| hypothetical protein CARUB_v10005754mg [Capsella rubella]
 sp|Q8VYF1.1|RL152_ARATH RecName: Full=60S ribosomal protein L15-2 [Arabidopsis thaliana]
 gb|AAL59940.1| putative 60S ribosomal protein L15-like protein [Arabidopsis 
thaliana]
 gb|AAM64649.1| 60S ribosomal protein L15 homolog [Arabidopsis thaliana]
 gb|AAM67498.1| putative 60S ribosomal protein L15-like protein [Arabidopsis 
thaliana]
 dbj|BAE98399.1| 60S ribosomal protein L15 homolog [Arabidopsis thaliana]
 gb|AEE83883.1| 60S ribosomal protein L15-2 [Arabidopsis thaliana]
 gb|EOA15619.1| hypothetical protein CARUB_v10005754mg [Capsella rubella]
Length=204

 Score =   281 bits (719),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N
Sbjct  136  DPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWKKN  195

Query  177  QT  172
             +
Sbjct  196  NS  197



>ref|XP_002868106.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_010434780.1| PREDICTED: 60S ribosomal protein L15-1-like [Camelina sativa]
 ref|XP_010440015.1| PREDICTED: 60S ribosomal protein L15-1-like [Camelina sativa]
 ref|XP_010449626.1| PREDICTED: 60S ribosomal protein L15-1-like [Camelina sativa]
 gb|EFH44365.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
Length=204

 Score =   281 bits (719),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N
Sbjct  136  DPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWKKN  195

Query  177  QT  172
             +
Sbjct  196  NS  197



>ref|NP_193405.1| 60S ribosomal protein L15-1 [Arabidopsis thaliana]
 ref|XP_002868071.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006391552.1| hypothetical protein EUTSA_v10019144mg [Eutrema salsugineum]
 ref|XP_006414312.1| hypothetical protein EUTSA_v10026269mg [Eutrema salsugineum]
 ref|XP_010440111.1| PREDICTED: 60S ribosomal protein L15-1 [Camelina sativa]
 ref|XP_010449726.1| PREDICTED: 60S ribosomal protein L15-1 [Camelina sativa]
 sp|O23515.1|RL151_ARATH RecName: Full=60S ribosomal protein L15-1 [Arabidopsis thaliana]
 gb|AAK44167.1|AF370352_1 putative ribosomal protein [Arabidopsis thaliana]
 emb|CAB10447.1| ribosomal protein [Arabidopsis thaliana]
 emb|CAB78714.1| ribosomal protein [Arabidopsis thaliana]
 gb|AAL24229.1| AT4g16720/dl4385c [Arabidopsis thaliana]
 gb|AAL91619.1| AT4g16720/dl4385c [Arabidopsis thaliana]
 gb|AAM64387.1| ribosomal protein [Arabidopsis thaliana]
 gb|AAM91731.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAN28757.1| At4g16720/dl4385c [Arabidopsis thaliana]
 gb|EFH44330.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
 gb|AEE83791.1| 60S ribosomal protein L15-1 [Arabidopsis thaliana]
 gb|ESQ28838.1| hypothetical protein EUTSA_v10019144mg [Eutrema salsugineum]
 gb|ESQ55765.1| hypothetical protein EUTSA_v10026269mg [Eutrema salsugineum]
 gb|KFK23089.1| hypothetical protein AALP_AAs51321U000100 [Arabis alpina]
Length=204

 Score =   281 bits (719),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N
Sbjct  136  DPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWKKN  195

Query  177  QT  172
             +
Sbjct  196  NS  197



>gb|KFK32179.1| hypothetical protein AALP_AA6G207900 [Arabis alpina]
Length=204

 Score =   281 bits (719),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N
Sbjct  136  DPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWKKN  195

Query  177  QT  172
             +
Sbjct  196  NS  197



>ref|XP_010434676.1| PREDICTED: 60S ribosomal protein L15-1-like [Camelina sativa]
Length=204

 Score =   281 bits (719),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N
Sbjct  136  DPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWKKN  195

Query  177  QT  172
             +
Sbjct  196  NS  197



>emb|CDY54747.1| BnaAnng13420D [Brassica napus]
Length=239

 Score =   282 bits (722),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPV
Sbjct  51   SDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPV  110

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILV
Sbjct  111  PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILV  170

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N
Sbjct  171  DPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWKKN  230

Query  177  QT  172
             +
Sbjct  231  NS  232



>emb|CDY53647.1| BnaA08g30370D [Brassica napus]
Length=237

 Score =   282 bits (722),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPV
Sbjct  49   SDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPV  108

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILV
Sbjct  109  PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILV  168

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N
Sbjct  169  DPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWKKN  228

Query  177  QT  172
             +
Sbjct  229  NS  230



>ref|XP_001753036.1| predicted protein [Physcomitrella patens]
 ref|XP_001758957.1| predicted protein [Physcomitrella patens]
 ref|XP_001772614.1| predicted protein [Physcomitrella patens]
 gb|EDQ62656.1| predicted protein [Physcomitrella patens]
 gb|EDQ76463.1| predicted protein [Physcomitrella patens]
 gb|EDQ82077.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   281 bits (718),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWEYRQL  IVRVTRP+RPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVLRFLLRVRCWEYRQLPGIVRVTRPSRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYWIN+DSTYKYFE+ILV
Sbjct  76   AKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYWINQDSTYKYFEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H  IR DPRINW+ NPVHKHRELRGLTSAGKKYRGLRGRGHL+ KARPS RATWKRN
Sbjct  136  DPQHTVIRKDPRINWIVNPVHKHRELRGLTSAGKKYRGLRGRGHLYTKARPSIRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>emb|CDY60707.1| BnaC07g50070D [Brassica napus]
Length=274

 Score =   283 bits (724),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPV
Sbjct  86   SDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPV  145

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILV
Sbjct  146  PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILV  205

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N
Sbjct  206  DPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHRNHKNRPSRRATWKKN  265

Query  177  QT  172
             +
Sbjct  266  NS  267



>ref|XP_001771165.1| predicted protein [Physcomitrella patens]
 gb|EDQ64014.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   280 bits (717),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWEYRQL  IVRVTRP+RPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVLRFLLRVRCWEYRQLPGIVRVTRPSRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYWIN+DSTYKYFE+IL+
Sbjct  76   AKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYWINQDSTYKYFEIILI  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H  IR DPRINW+ NPVHKHRELRGLTSAGKKYRGLRGRGHL+ KARPS RATWKRN
Sbjct  136  DPQHTVIRKDPRINWIVNPVHKHRELRGLTSAGKKYRGLRGRGHLYTKARPSIRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>gb|AFK37409.1| unknown [Lotus japonicus]
Length=204

 Score =   280 bits (716),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILV
Sbjct  76   SKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
              AH AIRNDPRINWLC PVH HRELRG TSAGK  R LRGRGH +HKARPSRRATW+RN
Sbjct  136  GIAHTAIRNDPRINWLCKPVHNHRELRGNTSAGKSNRCLRGRGHRYHKARPSRRATWRRN  195

Query  177  QT  172
             +
Sbjct  196  NS  197



>ref|XP_009136806.1| PREDICTED: 60S ribosomal protein L15-1-like [Brassica rapa]
Length=204

 Score =   280 bits (716),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+ RPTRPD+ARRLGYKAKQG+VVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDRARRLGYKAKQGFVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N
Sbjct  136  DPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHRNHKNRPSRRATWKKN  195

Query  177  QT  172
             +
Sbjct  196  NS  197



>emb|CDY50842.1| BnaC08g47880D, partial [Brassica napus]
Length=260

 Score =   281 bits (720),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPV
Sbjct  72   SDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPV  131

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILV
Sbjct  132  PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILV  191

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N
Sbjct  192  DPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWKKN  251

Query  177  QT  172
             +
Sbjct  252  NS  253



>emb|CDY40505.1| BnaC01g20070D [Brassica napus]
Length=318

 Score =   283 bits (724),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPV
Sbjct  130  SDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPV  189

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILV
Sbjct  190  PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILV  249

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N
Sbjct  250  DPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWKKN  309

Query  177  QT  172
             +
Sbjct  310  NS  311



>ref|XP_002879569.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55828.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
Length=204

 Score =   278 bits (712),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMR   RVRCW+YRQ  SIVR+TRPTRPDKARRLG+KAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRHLQRVRCWDYRQQPSIVRLTRPTRPDKARRLGFKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL GLRV+NSYWINEDSTYKY+E+ILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLSGLRVVNSYWINEDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N
Sbjct  136  DPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWKKN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>gb|AFK40278.1| unknown [Lotus japonicus]
Length=222

 Score =   278 bits (712),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  10   SDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  69

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILV
Sbjct  70   SKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILV  129

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  187
            D AH AIRNDPRINWLC PVH HRELRG TSAGK  R LRGRGH +HKARPSRRATW
Sbjct  130  DIAHTAIRNDPRINWLCKPVHNHRELRGNTSAGKSNRCLRGRGHRYHKARPSRRATW  186



>ref|XP_001757563.1| predicted protein [Physcomitrella patens]
 gb|EDQ77620.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   278 bits (710),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWEYRQL  IVRVTRP+RPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVLRFLLRVRCWEYRQLPGIVRVTRPSRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYWIN+DSTYKYFE+ILV
Sbjct  76   AKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYWINQDSTYKYFEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H  IR D RINW+ NPVHKHRELRGLTSAGKKYRGLRGRGHL+ KARPS RATWKRN
Sbjct  136  DPQHTVIRKDSRINWIVNPVHKHRELRGLTSAGKKYRGLRGRGHLYTKARPSIRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>emb|CDX76573.1| BnaA08g08270D [Brassica napus]
Length=186

 Score =   276 bits (706),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  708  MRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRF  RVRCWEYRQ  SIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILVDPA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H AIRNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N +
Sbjct  121  HNAIRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWKKNNS  179



>emb|CDY59531.1| BnaCnng35130D [Brassica napus]
Length=186

 Score =   275 bits (704),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  708  MRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRF  RVRCWEYRQ  SIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILVDPA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N +
Sbjct  121  HNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWKKNNS  179



>emb|CDY09632.1| BnaC07g34290D [Brassica napus]
 emb|CDX90478.1| BnaA03g43030D [Brassica napus]
Length=186

 Score =   275 bits (704),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  708  MRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  529
            MRF  RVRCWEYRQ  SIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPVPKG  60

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILVDPA  120

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N +
Sbjct  121  HNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHRNHKNRPSRRATWKKNNS  179



>gb|KDO49937.1| hypothetical protein CISIN_1g028757mg [Citrus sinensis]
Length=195

 Score =   275 bits (704),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 166/182 (91%), Gaps = 9/182 (5%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+         DSTYKYFEVILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLK---------DSTYKYFEVILV  126

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN
Sbjct  127  DAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN  186

Query  177  QT  172
            QT
Sbjct  187  QT  188



>gb|EMS52882.1| 60S ribosomal protein L15 [Triticum urartu]
Length=268

 Score =   276 bits (706),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 159/199 (80%), Gaps = 17/199 (9%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrp-  541
            SDVMRF  RVRCWEYRQ  +IVR+TRPTRPD+ARRLG+KAKQ   +      +  R    
Sbjct  63   SDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQILFLCDSYTLKYVRIYAG  122

Query  540  ----------------vpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNS  409
                            VPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNS
Sbjct  123  YVVYRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNS  182

Query  408  YWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRG  229
            YW+NEDSTYKYFEVILVD AH+A+RNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+G
Sbjct  183  YWVNEDSTYKYFEVILVDVAHSAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKG  242

Query  228  HLHHKARPSRRATWKRNQT  172
            H HHK RPSRRATWKRNQT
Sbjct  243  HRHHKNRPSRRATWKRNQT  261



>ref|XP_002961462.1| hypothetical protein SELMODRAFT_270259 [Selaginella moellendorffii]
 gb|EFJ36722.1| hypothetical protein SELMODRAFT_270259 [Selaginella moellendorffii]
Length=204

 Score =   272 bits (696),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF +RVRCWEYRQL  IVR+ RPTRPDKARRLG+KAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLMRVRCWEYRQLPGIVRIQRPTRPDKARRLGFKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLG LRVLNSYWIN+DSTYKYFE+IL+
Sbjct  76   SKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGNLRVLNSYWINQDSTYKYFEIILI  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+C PVHKHRELRG+TSAG+K+RGLRG+GH +HK RPS RATWKRN
Sbjct  136  DPMHTAIRKDPRINWICQPVHKHRELRGITSAGRKHRGLRGKGHRNHKNRPSIRATWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_002971348.1| hypothetical protein SELMODRAFT_270900 [Selaginella moellendorffii]
 gb|EFJ27946.1| hypothetical protein SELMODRAFT_270900 [Selaginella moellendorffii]
Length=204

 Score =   270 bits (691),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF +RVRCWEYRQL  IVR+ RPTRPDKARRLG+KAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLMRVRCWEYRQLPGIVRIQRPTRPDKARRLGFKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLG LRVLNSYWIN+DSTYKYFE+IL+
Sbjct  76   SKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGNLRVLNSYWINQDSTYKYFEIILI  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+C PVHKHRELRG+TSAG+K+RGLRG+GH +HK RPS R TWKRN
Sbjct  136  DPMHTAIRKDPRINWICQPVHKHRELRGITSAGRKHRGLRGKGHRNHKNRPSIRGTWKRN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_008234416.1| PREDICTED: 60S ribosomal protein L15-like [Prunus mume]
Length=204

 Score =   270 bits (690),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMR   R+R +EYR   SIVRVT PT PDKA RLGYKAKQGYVVYRVRV+RGGRKRPV
Sbjct  16   SDVMRALQRLRAFEYRHQPSIVRVTHPTCPDKAHRLGYKAKQGYVVYRVRVKRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKPTNQGV+QLKFQRSKRSVAEERAGRKL GL+VLNSYW+NEDSTYKYFEVILV
Sbjct  76   AKGIVYGKPTNQGVSQLKFQRSKRSVAEERAGRKLAGLKVLNSYWVNEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHLHHKARPSRRA WK N
Sbjct  136  DAAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLCGKGHLHHKARPSRRANWKSN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_004955578.1| PREDICTED: 60S ribosomal protein L15-1-like isoform X1 [Setaria 
italica]
Length=238

 Score =   267 bits (682),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 171/216 (79%), Gaps = 34/216 (16%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  +IVR+TRPTRPDKARRLG+KAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINE------------  394
            PKGIVYGKP +QGVTQLKFQR+KRSVAEERAGRK+GGLRVLNSYW+NE            
Sbjct  76   PKGIVYGKPKHQGVTQLKFQRNKRSVAEERAGRKIGGLRVLNSYWVNEVCWILWRNFLLE  135

Query  393  ----------------------DSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHREL  280
                                  DSTYKYFE+ILVD AHAAIRNDPRINWLC  VHKHREL
Sbjct  136  GSYCSCPIYFVLMPATVHLSTQDSTYKYFEIILVDVAHAAIRNDPRINWLCKDVHKHREL  195

Query  279  RGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            RGLTSAGKKYRGLRG+G  HHK RPSRRATWKRNQT
Sbjct  196  RGLTSAGKKYRGLRGKGSSHHKNRPSRRATWKRNQT  231



>ref|XP_002946380.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ52307.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=204

 Score =   261 bits (667),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWEYRQL SIVR+TRP+RPDKARRLGYKAKQG+VVYRVRVRRG RKRPV
Sbjct  16   SDVLRFLLRVRCWEYRQLPSIVRLTRPSRPDKARRLGYKAKQGFVVYRVRVRRGNRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKP NQG+TQLK  R+ RSVAEER GRK GGLRVLNSYW+N+DS YKYFEVILV
Sbjct  76   HKGIVYGKPVNQGITQLKAARNLRSVAEERVGRKCGGLRVLNSYWVNQDSCYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH  IRND RINWLCNPVHKHRELRGLTSAGK YRGLR +GH   K RPS+RA+WKR 
Sbjct  136  DPAHTTIRNDARINWLCNPVHKHRELRGLTSAGKHYRGLRAKGHKASKTRPSKRASWKRR  195

Query  177  QT  172
             +
Sbjct  196  NS  197



>ref|XP_010516773.1| PREDICTED: 60S ribosomal protein L15-2-like [Camelina sativa]
Length=212

 Score =   260 bits (665),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 165/190 (87%), Gaps = 8/190 (4%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMR   RVRCW YRQ  SIVR+TRPTRPD+ARRLG+KAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRHLQRVRCWNYRQQPSIVRLTRPTRPDEARRLGFKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRS +EERAGRKLGGLR LNSYWINEDSTYKY+E+ILV
Sbjct  76   PKGIVYGKPTNQGVTQLKFQRSKRSGSEERAGRKLGGLRDLNSYWINEDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKH--------RELRGLTSAGKKYRGLRGRGHLHHKARPS  202
            D AH A+ NDPRINW+CNPVHKH        RELRGLTS GKK +GLRG+GH ++K RPS
Sbjct  136  DLAHNAVSNDPRINWICNPVHKHQLRSSSHNRELRGLTSEGKKNKGLRGKGHNNNKNRPS  195

Query  201  RRATWKRNQT  172
            RRATWK N T
Sbjct  196  RRATWKNNNT  205



>gb|EMT29287.1| 60S ribosomal protein L15 [Aegilops tauschii]
Length=261

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYR   +IVR+TRP RPD+ARRLG+KAKQGYVVYR+RVRRGGRKRPV
Sbjct  73   SDVMRFVQRVRCWEYRLQPAIVRITRPPRPDRARRLGFKAKQGYVVYRIRVRRGGRKRPV  132

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+NEDSTYKYFEVILV
Sbjct  133  PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWVNEDSTYKYFEVILV  192

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH+A+RNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATWKRN
Sbjct  193  DVAHSAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHRHHKNRPSRRATWKRN  252

Query  177  QT  172
            QT
Sbjct  253  QT  254



>ref|XP_005646118.1| ribosomal protein L15e [Coccomyxa subellipsoidea C-169]
 gb|EIE21574.1| ribosomal protein L15e [Coccomyxa subellipsoidea C-169]
Length=204

 Score =   259 bits (662),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWEYRQL  IVR+T P+RPDKARRLGYKAKQG+VVYRVRVRRGGRK+PV
Sbjct  16   SDVLRFLLRVRCWEYRQLPGIVRLTGPSRPDKARRLGYKAKQGFVVYRVRVRRGGRKKPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKP NQG+TQLK  R+ RSVAEERAGRKLGGLRVLNSYW+N+DSTYKYFE+ILV
Sbjct  76   HKGIVYGKPVNQGITQLKPTRNLRSVAEERAGRKLGGLRVLNSYWVNQDSTYKYFEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH  +R DPR+NW+ +PVHKHRELRGLTSAGKK+RGLR +GH  +K RPSRRATWKRN
Sbjct  136  DIAHKVVREDPRVNWIVDPVHKHRELRGLTSAGKKFRGLRHKGHATNKLRPSRRATWKRN  195



>ref|XP_005845356.1| hypothetical protein CHLNCDRAFT_32281 [Chlorella variabilis]
 gb|EFN53254.1| hypothetical protein CHLNCDRAFT_32281 [Chlorella variabilis]
Length=204

 Score =   259 bits (662),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE+RQL  IVR+TRP+RPDKARR+G+KAKQGYVVYRVRVRRGGRK+PV
Sbjct  16   SDVLRFLLRVRCWEFRQLPGIVRLTRPSRPDKARRMGFKAKQGYVVYRVRVRRGGRKKPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKP +QGVTQLK  R+ +++AEER GRK GGLRVLNSYW+N+D+ YKYFEVILV
Sbjct  76   SKGIVYGKPVHQGVTQLKPTRNLQNIAEERVGRKCGGLRVLNSYWVNQDAVYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIR D R+NW+CNPVHKHRE RGLTSAGKKYRGL G+GHLHHKARPSRRA W++N
Sbjct  136  DPAHKAIRKDARVNWICNPVHKHREQRGLTSAGKKYRGLVGKGHLHHKARPSRRAVWRKN  195

Query  177  QT  172
             +
Sbjct  196  NS  197



>ref|XP_001701780.1| ribosomal protein L15, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP06755.1| ribosomal protein L15 [Chlamydomonas reinhardtii]
Length=204

 Score =   258 bits (659),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWEYRQ+ S VR+TRP+RPDKARRLGYKAKQGYVVYRVRVRRG RKRPV
Sbjct  16   SDVLRFLLRVRCWEYRQMPSCVRLTRPSRPDKARRLGYKAKQGYVVYRVRVRRGNRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKP NQG+TQLK  R+ R+VAEERAGRK GGLRVLNSYW+N+DS YKYFEVI+V
Sbjct  76   HKGIVYGKPVNQGITQLKPARNLRNVAEERAGRKCGGLRVLNSYWVNQDSCYKYFEVIMV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH AIRND RINWLCNPVHKHRELRGLT+AGK YRGLR +GH   K RPS+RA+WKR 
Sbjct  136  DPAHNAIRNDARINWLCNPVHKHRELRGLTAAGKNYRGLRAKGHKASKTRPSKRASWKRR  195

Query  177  QT  172
             +
Sbjct  196  NS  197



>ref|XP_011401241.1| 60S ribosomal protein L15 [Auxenochlorella protothecoides]
 gb|KFM28228.1| 60S ribosomal protein L15 [Auxenochlorella protothecoides]
Length=437

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWEYRQL SIVR+T PTRPDKARR+GYKAKQGYVVYRVRVRRGGRK+PV
Sbjct  16   SDVLRFLLRVRCWEYRQLPSIVRLTGPTRPDKARRMGYKAKQGYVVYRVRVRRGGRKKPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP NQG+TQLK  R+  ++AEER GRK GGLRVLNSYW+N+D+ YKYFEVILV
Sbjct  76   PKGIVYGKPVNQGITQLKPTRNLANLAEERVGRKCGGLRVLNSYWVNQDAVYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIRND RINW+ NPVHKHRELRGLTSAGKKYRGL G+GHLH K RPSRRA WK+N
Sbjct  136  DPFHKAIRNDARINWIANPVHKHRELRGLTSAGKKYRGLTGKGHLHTKNRPSRRAVWKKN  195



>gb|AAF67144.1|AF230646_1 large subunit ribosomal protein L15 [Syntrichia ruralis]
Length=203

 Score =   246 bits (628),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 141/182 (77%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE+RQL  IVRVT    PDKARRLGY+  +              +   
Sbjct  16   SDVLRFLLRVRCWEFRQLPGIVRVT-AQPPDKARRLGYRPSRVTWCTVCVCAVEAGRGRW  74

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            P+ +   KP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYWIN+DSTYKYFE+ILV
Sbjct  75   PRVLCMEKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYWINQDSTYKYFEIILV  134

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H  IR DPRINW+ NPVHKHR++RGLTSAGKKYRGLRGRGHL+ KARPS RATWKRN
Sbjct  135  DPQHKVIRKDPRINWIVNPVHKHRDVRGLTSAGKKYRGLRGRGHLYTKARPSIRATWKRN  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>emb|CEG01197.1| Ribosomal protein L15e, conserved site [Ostreococcus tauri]
Length=204

 Score =   246 bits (627),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  R+R WEYRQL SI RVTRPTRPDKARRLGYKAKQG+V+YR RVRRGGRKRPV
Sbjct  16   SDVMRFLQRIRVWEYRQLPSICRVTRPTRPDKARRLGYKAKQGFVIYRARVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG VYGKP + G+T+LKF R+ RSVAEERA R+ G LRVLNSYW+N+DS YKY+EVI+V
Sbjct  76   PKGQVYGKPVHCGITKLKFARNLRSVAEERAARRCGALRVLNSYWLNQDSVYKYYEVIMV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H  IRNDPRINW+CNP HKHRE+RGLTSAG+KYRGLRG+GH + K+RPS+RATW+ N
Sbjct  136  DPMHKCIRNDPRINWICNPTHKHREMRGLTSAGRKYRGLRGKGHNYTKSRPSKRATWRNN  195



>ref|XP_003056552.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59928.1| predicted protein [Micromonas pusilla CCMP1545]
Length=204

 Score =   245 bits (625),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF  RVR WEYRQL S+ RVTRPTRPDKARRLGYKAKQG+ VYR RVRRGGRKRPV
Sbjct  16   SDVLRFLQRVRVWEYRQLPSVCRVTRPTRPDKARRLGYKAKQGFCVYRARVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGI YGKP +QGV +LKF R+ RSVAEER  R+ G LRVLNSYW+NEDS YKY+EVI+V
Sbjct  76   SKGIRYGKPVHQGVKKLKFARNLRSVAEERTARRCGALRVLNSYWLNEDSVYKYYEVIMV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H  IR DPRINW+C PVHKHRELRGLTSAG+KYRGL+G+GH ++K+RPS+R TWKRN
Sbjct  136  DPMHKVIRGDPRINWICAPVHKHRELRGLTSAGRKYRGLQGKGHNYNKSRPSKRGTWKRN  195

Query  177  Q  175
            Q
Sbjct  196  Q  196



>gb|EMT18644.1| 60S ribosomal protein L15 [Aegilops tauschii]
Length=183

 Score =   243 bits (619),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 143/182 (79%), Gaps = 21/182 (12%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  +I  V    R    RR G K                  RPV
Sbjct  16   SDVMRFVQRVRCWEYRQQPAIGYVVYRIR---VRRGGRK------------------RPV  54

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+NEDSTYKYFEVILV
Sbjct  55   PKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWVNEDSTYKYFEVILV  114

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH+A+RNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATWKRN
Sbjct  115  DVAHSAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHRHHKNRPSRRATWKRN  174

Query  177  QT  172
            QT
Sbjct  175  QT  176



>gb|KCW90850.1| hypothetical protein EUGRSUZ_A02903 [Eucalyptus grandis]
Length=183

 Score =   242 bits (618),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 142/182 (78%), Gaps = 21/182 (12%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ  SI  V    R  +                      GRKRPV
Sbjct  16   SDVMRFLQRVRCWEYRQHPSIGYVVYRVRVRRG---------------------GRKRPV  54

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW+NEDSTYKYFEVILV
Sbjct  55   PKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWLNEDSTYKYFEVILV  114

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH  IR DPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATWKRN
Sbjct  115  DAAHNTIRKDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHSHHKARPSRRATWKRN  174

Query  177  QT  172
             +
Sbjct  175  NS  176



>ref|XP_001416062.1| Ribosomal protein L15, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO94354.1| Ribosomal protein L15, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=204

 Score =   242 bits (618),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  R+R WEYRQL SI RVTRPTRPDKARRLGYKAKQG+ +YR RVRRGGRKRPV
Sbjct  16   SDVMRFLQRIRVWEYRQLPSICRVTRPTRPDKARRLGYKAKQGFCIYRARVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KG VYGKP + G+T+LKF R+ RSVAEERA R+ G LRVLNSYW+N+DS YKY+EVI+V
Sbjct  76   AKGQVYGKPVHCGITKLKFARNLRSVAEERAARRCGALRVLNSYWLNQDSVYKYYEVIMV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H  +RNDPRINW+CNP HKHRE+RGLTSAG+KYRGL G+GH   K+RPS+RATW+ N
Sbjct  136  DPMHKCVRNDPRINWICNPTHKHREMRGLTSAGRKYRGLHGKGHNFTKSRPSKRATWRNN  195



>gb|KDD73446.1| ribosomal L15, partial [Helicosporidium sp. ATCC 50920]
Length=200

 Score =   239 bits (610),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE+RQL  IVR+T P+RPDKARR+GYKAKQGYV+YRVRVRRGGRK+PV
Sbjct  16   SDVLRFLLRVRCWEFRQLPRIVRLTGPSRPDKARRMGYKAKQGYVIYRVRVRRGGRKKPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKP NQG+TQLK +R+ ++++E R GR   GLRVLNSYW+N+D+++KY+EVI+V
Sbjct  76   AKGIVYGKPVNQGITQLKPRRNLQAISEGRVGRACRGLRVLNSYWVNQDASHKYYEVIMV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D AH  IRNDP INW+CNPVHKHRE  GLTSAGKK+RGL G+GH H  ARPSRRATW+RN
Sbjct  136  DPAHTVIRNDPHINWICNPVHKHREGHGLTSAGKKHRGLGGKGHGHVHARPSRRATWRRN  195

Query  177  Q  175
            Q
Sbjct  196  Q  196



>ref|XP_004348091.1| ribosomal protein L15 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE93479.1| ribosomal protein L15 [Capsaspora owczarzaki ATCC 30864]
Length=204

 Score =   236 bits (602),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 160/183 (87%), Gaps = 2/183 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF +R+RCW+YRQL +I R +RPTRPDKARRLGYKAKQGYV+YR+R+RRGGRKRPV
Sbjct  16   SDVLRFLVRLRCWQYRQLPAIHRASRPTRPDKARRLGYKAKQGYVIYRIRLRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGI+YGKP  QGVTQLK QRS R++AEER GR +GGLRVLNSYWI +DST+KY+EVI+V
Sbjct  76   FKGIIYGKPAAQGVTQLKNQRSHRAIAEERIGRAIGGLRVLNSYWICQDSTFKYYEVIMV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHK-ARPSRRATWKR  181
            DTAH AIR DPRINW+C  VHKHRELRGLT+AG+K+RG+ G+GHLH+K A  SRRA WKR
Sbjct  136  DTAHKAIRRDPRINWICENVHKHRELRGLTAAGRKHRGV-GKGHLHNKTAGSSRRANWKR  194

Query  180  NQT  172
              T
Sbjct  195  RNT  197



>gb|EPE06282.1| 60s ribosomal protein l15 [Ophiostoma piceae UAMH 11346]
Length=203

 Score =   234 bits (598),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 152/182 (84%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK+PV
Sbjct  16   SDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKKPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KG  YGKPTNQGV QLK+QRS +S AEER GR+ G LRVLNSYW+N+DSTYKYFEVILV
Sbjct  76   RKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCGNLRVLNSYWVNQDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  HAAIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH  +K R  RR TWKR+
Sbjct  136  DPQHAAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHKFNKTRAGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_503229.1| 60S ribosomal protein L15 [Yarrowia lipolytica]
 emb|CAG81430.1| YALI0D24387p [Yarrowia lipolytica CLIB122]
Length=203

 Score =   234 bits (597),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 148/182 (81%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V+YRVRVRRG RKRP 
Sbjct  16   SDVLRFLLRVRCWEYRQKTGIHRASRPSRPDKARRLGYKAKQGFVIYRVRVRRGNRKRPS  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KG  YGKPTNQG+ QLK QRS R+VAEER GR+ G LRVLNSYW+N+DSTYKYFEVILV
Sbjct  76   KKGATYGKPTNQGINQLKLQRSLRAVAEERVGRRAGNLRVLNSYWVNQDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D +H  IRNDPRINW+CNPVHKHRE RGLT+AGKK RG+  +GH +H     RR TWK  
Sbjct  136  DPSHVVIRNDPRINWICNPVHKHRESRGLTAAGKKNRGI-NKGHKYHNTSAGRRHTWKLQ  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_005717822.1| 60S ribosomal protein L15, partial [Chondrus crispus]
 emb|CDF37953.1| 60S ribosomal protein L15, partial [Chondrus crispus]
Length=216

 Score =   234 bits (597),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF LRVR WEYRQL SI R +RPTRP+KARRLGYK+KQG+VVYRVRVRRGGRKRPV
Sbjct  28   SDVMRFMLRVRAWEYRQLPSIHRASRPTRPEKARRLGYKSKQGFVVYRVRVRRGGRKRPV  87

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGI YGKP +QG+T+LKF+R+KR+VAEERAGR+ G LRVLNSYW+NED+ YKYFE+ILV
Sbjct  88   KKGIQYGKPKHQGITELKFKRNKRAVAEERAGRRCGNLRVLNSYWVNEDAAYKYFEIILV  147

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D +H AIRNDPR+NWL  PV KHRELRGLT+AG+K RGL  RGH  +  RPS RA WK++
Sbjct  148  DPSHNAIRNDPRLNWLARPVMKHRELRGLTAAGRKGRGLHVRGHRANSTRPSVRAVWKKH  207

Query  177  QT  172
             T
Sbjct  208  NT  209



>gb|ERS96332.1| 60S ribosomal protein L15 [Sporothrix schenckii ATCC 58251]
Length=203

 Score =   234 bits (596),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK+PV
Sbjct  16   SDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKKPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKYFEVILV
Sbjct  76   RKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  HAAIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH  +K R  RR TWKR+
Sbjct  136  DPQHAAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHKFNKTRAGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_006690758.1| ribosomal protein L15-like protein [Chaetomium thermophilum var. 
thermophilum DSM 1495]
 gb|EGS23516.1| ribosomal protein L15-like protein [Chaetomium thermophilum var. 
thermophilum DSM 1495]
Length=203

 Score =   233 bits (594),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 152/182 (84%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVVRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS R+ AEER GR+   LRVLNSYW+N+DSTYKY+EVILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLRATAEERVGRRCSNLRVLNSYWVNQDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+CNPVHKHRE RGLTS GKK RGL  +GH  +K R  RR TWKR+
Sbjct  136  DPNHKAIRRDPRINWICNPVHKHRECRGLTSTGKKSRGL-NKGHRFNKTRAGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>gb|ACU45020.1| 60s ribosomal protein L15 [Pfiesteria piscicida]
Length=204

 Score =   233 bits (593),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LR+RCWE R L  + R TRPTRPDKARRLGYKAKQGYV+YR RVRRGGRK+ V
Sbjct  16   SDVLRFLLRIRCWELRHLPRVHRATRPTRPDKARRLGYKAKQGYVIYRSRVRRGGRKKRV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KG   GKP +QGV  LKFQRSK SVAEER GR  G LRVLNSYW+N+DST+KY+EVI V
Sbjct  76   AKGNTDGKPKHQGVNHLKFQRSKASVAEERVGRVCGNLRVLNSYWVNQDSTFKYYEVICV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D +H AIRNDPRINW+  PVHKHRELRGLTSAGKK RGL GRG  + K RPSRRA WK+N
Sbjct  136  DPSHNAIRNDPRINWITKPVHKHRELRGLTSAGKKNRGLVGRGRRYQKNRPSRRAVWKKN  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>gb|EFX04788.1| 60S ribosomal protein l15 [Grosmannia clavigera kw1407]
Length=203

 Score =   232 bits (592),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV+YR RVRRGGRK+PV
Sbjct  16   SDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRARVRRGGRKKPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KG  +GKPTNQGV QLK+QRS +S AEER GR+ G LRVLNSYW+N+DSTYKY+EVILV
Sbjct  76   AKGATFGKPTNQGVNQLKYQRSLKSTAEERVGRRCGNLRVLNSYWVNQDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  HAAIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH  +K R  RR TWKR+
Sbjct  136  DPNHAAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHKFNKTRAGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>gb|KJB51845.1| hypothetical protein B456_008G234000 [Gossypium raimondii]
Length=146

 Score =   229 bits (585),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/119 (92%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = -2

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEVILVD A
Sbjct  21   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFEVILVDVA  80

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHLHHK RPSRRATWKRN T
Sbjct  81   HNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHLHHKNRPSRRATWKRNNT  139



>gb|KCW90852.1| hypothetical protein EUGRSUZ_A02903 [Eucalyptus grandis]
Length=165

 Score =   229 bits (585),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = -2

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW+NEDSTYKYFEVILVD A
Sbjct  40   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWLNEDSTYKYFEVILVDAA  99

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H  IR DPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATWKRN +
Sbjct  100  HNTIRKDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHSHHKARPSRRATWKRNNS  158



>tpg|DAA40843.1| TPA: hypothetical protein ZEAMMB73_797426, partial [Zea mays]
Length=176

 Score =   229 bits (584),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = -2

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILVD A
Sbjct  51   IVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILVDVA  110

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H  IRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATWKRNQT
Sbjct  111  HTTIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRATWKRNQT  169



>tpg|DAA40844.1| TPA: hypothetical protein ZEAMMB73_797426, partial [Zea mays]
Length=156

 Score =   228 bits (582),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = -2

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILVD A
Sbjct  31   IVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILVDVA  90

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H  IRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATWKRNQT
Sbjct  91   HTTIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRATWKRNQT  149



>gb|KIV95599.1| 60S ribosomal protein L15 [Exophiala mesophila]
Length=203

 Score =   230 bits (587),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYWIN+DSTYKYFEVILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRAANLRVLNSYWINQDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH ++K    RR TWKR+
Sbjct  136  DPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHGYNKTTAGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>gb|KEF63356.1| 60S ribosomal protein L15 [Exophiala aquamarina CBS 119918]
Length=203

 Score =   230 bits (586),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYWIN+DSTYKYFEVILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRASNLRVLNSYWINQDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH ++K    RR TWKR+
Sbjct  136  DPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHGYNKTTAGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>gb|KIN02516.1| hypothetical protein OIDMADRAFT_18358 [Oidiodendron maius Zn]
Length=203

 Score =   229 bits (585),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKYFE+ILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYFEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH ++K    RR TWKR+
Sbjct  136  DPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHSYNKTTAGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_008713401.1| 60S ribosomal protein L15 [Cyphellophora europaea CBS 101466]
 gb|ETN44328.1| 60S ribosomal protein L15 [Cyphellophora europaea CBS 101466]
Length=203

 Score =   229 bits (585),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF LRVRCWE RQL  I R TRP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRP 
Sbjct  16   SDVMRFLLRVRCWELRQLNVIHRATRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPA  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQG+ QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKYFEVILV
Sbjct  76   PKGATYGKPTNQGINQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH ++K    RR TWKR+
Sbjct  136  DPQHKAIRKDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHGYNKTSAGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>gb|KIX01331.1| 60S ribosomal protein L15 [Rhinocladiella mackenziei CBS 650.93]
Length=203

 Score =   229 bits (584),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYWIN+DSTYKY+EVILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRCANLRVLNSYWINQDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH+ +K    RR TWKR+
Sbjct  136  DPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHVFNKTTAGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>emb|CEJ94099.1| Putative Ribosomal protein L15 [Torrubiella hemipterigena]
Length=203

 Score =   229 bits (584),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 148/182 (81%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYVVYRVRVRRGGRK+P 
Sbjct  16   SDVMRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVVYRVRVRRGGRKKPA  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KG  YGKPTNQG+ QLK+QRS R+ AEER GR+   LRVLNSYWIN+DSTYKYFEVILV
Sbjct  76   RKGATYGKPTNQGINQLKYQRSLRATAEERVGRRCANLRVLNSYWINQDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLTS GK+ RGL  +GH ++K    RR TWKR+
Sbjct  136  DPQHKAIRIDPRINWIVNPVHKHREARGLTSTGKRSRGL-NKGHRYNKTTAGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>gb|EQL00837.1| Ribosomal protein L15e [Ophiocordyceps sinensis CO18]
Length=203

 Score =   228 bits (582),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYWIN+DSTYKY+E+ILV
Sbjct  76   RKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYWINQDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH ++K R  RR TWKR+
Sbjct  136  DPQHKAIRIDPRINWIVNPVHKHREARGLTATGKKSRGL-NKGHRYNKTRAGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>gb|ESW97334.1| 60S ribosomal protein L15-B [Ogataea parapolymorpha DL-1]
Length=204

 Score =   228 bits (582),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF LR+RCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V++R+RVRRGGRKRPV
Sbjct  16   SDVMRFLLRIRCWEYRQKTVIHRASRPSRPDKARRLGYKAKQGFVIFRIRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+Q++ RS AEER GRK   LRVLNSYW+NEDSTYKY+EVI V
Sbjct  76   PKGATYGKPTNQGVNQLKYQKALRSTAEERVGRKAANLRVLNSYWVNEDSTYKYYEVICV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPR NW+CNPVHKHRE RGLT+ GKK RG+  +GHL +K R  RR TWK++
Sbjct  136  DPQHKAIRRDPRYNWICNPVHKHREARGLTATGKKSRGI-AKGHLFNKTRKGRRHTWKQH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_957199.1| 60S ribosomal protein L15 [Neurospora crassa OR74A]
 ref|XP_009852151.1| hypothetical protein NEUTE1DRAFT_117386 [Neurospora tetrasperma 
FGSC 2508]
 sp|Q8X034.1|RL15_NEUCR RecName: Full=60S ribosomal protein L15 [Neurospora crassa OR74A]
 emb|CAD21192.1| probable ribosomal protein L15.e.B, cytosolic [Neurospora crassa]
 gb|EAA27963.1| 60S ribosomal protein L15 [Neurospora crassa OR74A]
 gb|EGO56565.1| hypothetical protein NEUTE1DRAFT_117386 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ70567.1| putative ribosomal protein L15.e.B, cytosolic [Neurospora tetrasperma 
FGSC 2509]
 gb|KHE83595.1| hypothetical protein GE21DRAFT_3246 [Neurospora crassa]
Length=203

 Score =   228 bits (582),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YR RVRRGGRK+PV
Sbjct  16   SDVVRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRARVRRGGRKKPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKYFEVILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLTS GK+ RGL  +GH ++K R  RR TWKR+
Sbjct  136  DPQHKAIRRDPRINWIVNPVHKHRESRGLTSTGKRSRGL-NKGHRYNKTRAGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_009159952.1| 60S ribosomal protein L15 [Exophiala dermatitidis NIH/UT8656]
 gb|EHY59491.1| 60S ribosomal protein L15 [Exophiala dermatitidis NIH/UT8656]
Length=203

 Score =   228 bits (582),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS R+ AEER GR+   LRVLNSYWIN+DSTYKYFEVILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLRATAEERVGRRCANLRVLNSYWINQDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH  +K    RR TWKR+
Sbjct  136  DPQHKAIRRDPRINWIVNPVHKHREARGLTATGKKSRGL-GKGHGFNKTTAGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_006822011.1| PREDICTED: 60S ribosomal protein L15-like isoform X1 [Saccoglossus 
kowalevskii]
 ref|XP_006822012.1| PREDICTED: 60S ribosomal protein L15-like isoform X2 [Saccoglossus 
kowalevskii]
Length=204

 Score =   228 bits (581),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 154/183 (84%), Gaps = 2/183 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SD MRF LRVRCW+YRQL +I R  RPTRPDKARRLGY+AKQGYV+YR+R+RRGGRKRPV
Sbjct  16   SDAMRFLLRVRCWQYRQLTAIHRAPRPTRPDKARRLGYRAKQGYVIYRIRLRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS +S+AEERAGR+ GGLRVLNSYW+ +DSTYK+FEVI+V
Sbjct  76   PKGATYGKPTNQGVNQLKWQRSLQSLAEERAGRRCGGLRVLNSYWVGQDSTYKFFEVIMV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKA-RPSRRATWKR  181
            D  H AIR +P   W+CNPVHKHRELRGLTSAGKK RG+ G+GHLH +    SRRA WKR
Sbjct  136  DPFHKAIRRNPDTQWICNPVHKHRELRGLTSAGKKNRGI-GKGHLHTQTIGGSRRAAWKR  194

Query  180  NQT  172
              T
Sbjct  195  RNT  197



>ref|XP_008725811.1| 60S ribosomal protein L15 [Cladophialophora carrionii CBS 160.54]
 gb|ETI26466.1| 60S ribosomal protein L15 [Cladophialophora carrionii CBS 160.54]
Length=203

 Score =   228 bits (581),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYWIN+DSTYKYFEVILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRCANLRVLNSYWINQDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH ++     RR TWKR 
Sbjct  136  DPNHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHGYNNTTAGRRKTWKRQ  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>gb|KIE03942.1| Ribosomal protein L15e, partial [Metarhizium majus ARSEF 297]
Length=203

 Score =   228 bits (580),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF LRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVMRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYWIN+DSTYKY+EVILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYWINQDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH ++K +  RR TW R+
Sbjct  136  DPQHKAIRIDPRINWIVNPVHKHREARGLTATGKKSRGL-NKGHRYNKTQAGRRKTWLRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>gb|KIW07591.1| 60S ribosomal protein L15 [Verruconis gallopava]
Length=203

 Score =   228 bits (580),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF LRVRCWEYRQ   I R +RP+RPDKARRLGYKAKQGYV+YR+RVRRGGRKRP 
Sbjct  16   SDVMRFLLRVRCWEYRQRHVIHRASRPSRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPA  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQG+ QLK+QRS R+ AEER GR+   LRVLNSYWIN+DSTYKY+EVILV
Sbjct  76   PKGATYGKPTNQGINQLKYQRSLRATAEERVGRRCANLRVLNSYWINQDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLTS GKK RGL  +GH ++K R  RR  WKR+
Sbjct  136  DPQHKAIRRDPRINWIVNPVHKHREARGLTSTGKKSRGL-NKGHRYNKTRGGRRKAWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_001541513.1| 60S ribosomal protein L15 [Histoplasma capsulatum NAm1]
 gb|EDN07080.1| 60S ribosomal protein L15 [Histoplasma capsulatum NAm1]
 gb|EEH11352.1| 60S ribosomal protein L15 [Histoplasma capsulatum G186AR]
 gb|EER43402.1| 60S ribosomal protein L15 [Histoplasma capsulatum H143]
 gb|EGC46336.1| 60S ribosomal protein [Histoplasma capsulatum H88]
Length=203

 Score =   228 bits (580),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 146/182 (80%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKR  
Sbjct  16   SDVIRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRQA  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTN GV QLK+QRS R  AEER GR+   LRVLNSYWINEDSTYKYFEVILV
Sbjct  76   PKGATYGKPTNHGVNQLKYQRSLRCTAEERVGRRCANLRVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+  PVHKHRE RGLT+AGKK RGL GRGH ++K    RR TWKR 
Sbjct  136  DPQHKAIRRDPRINWIVKPVHKHRESRGLTAAGKKSRGL-GRGHSYNKTSAGRRKTWKRL  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_001624083.1| predicted protein [Nematostella vectensis]
 gb|EDO31983.1| predicted protein [Nematostella vectensis]
Length=204

 Score =   228 bits (580),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 153/183 (84%), Gaps = 2/183 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SD++RF LRVRCW+YRQL +I R TRPTRPDKARRLGYKAKQG+V+YRVRVRRGGRKRPV
Sbjct  16   SDLLRFLLRVRCWQYRQLTAIHRATRPTRPDKARRLGYKAKQGFVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKP NQGV +LKFQRS RSVAEERAGR  GGLRVLNSYW+ +DS YKYFEVI+V
Sbjct  76   PKGATYGKPVNQGVNELKFQRSLRSVAEERAGRYCGGLRVLNSYWVGQDSIYKYFEVIMV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKA-RPSRRATWKR  181
            D  H AIR D RINW+C P HKHRELRGLT+AG K RG+R +GH ++K    SRRA WKR
Sbjct  136  DPFHKAIRRDARINWICKPTHKHRELRGLTAAGTKNRGMR-KGHNYNKVIGSSRRANWKR  194

Query  180  NQT  172
            + T
Sbjct  195  HNT  197



>gb|KIY95038.1| 60S ribosomal protein L15-1 [Monoraphidium neglectum]
Length=198

 Score =   227 bits (579),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 154/182 (85%), Gaps = 6/182 (3%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE+RQL  IVR+ RP+RPDKARR+G+KAKQGYVVYRVRVRRGGRKRPV
Sbjct  16   SDVLRFLLRVRCWEFRQLPGIVRLNRPSRPDKARRMGFKAKQGYVVYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KGIVYGKP NQG+TQLK  R+ R+VAEERAGR+LGGLRVLNSYW+NEDS YKYFEVILV
Sbjct  76   SKGIVYGKPVNQGITQLKASRNLRNVAEERAGRRLGGLRVLNSYWVNEDSAYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIRND RINW+       RELRGLTSAGKKYRGL G+G  ++K  PS+RATW ++
Sbjct  136  DPNHNAIRNDARINWI------RRELRGLTSAGKKYRGLHGKGSRYNKNAPSKRATWLKH  189

Query  177  QT  172
             +
Sbjct  190  NS  191



>ref|XP_003657786.1| 60S ribosomal protein L15 [Thielavia terrestris NRRL 8126]
 gb|AEO71450.1| hypothetical protein THITE_2083064 [Thielavia terrestris NRRL 
8126]
Length=203

 Score =   227 bits (579),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVVRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYWIN+DSTYKY+EVILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYWINQDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLTS GKK RGL  +GH ++K R  RR TWKR+
Sbjct  136  DPQHKAIRRDPRINWIVNPVHKHREARGLTSTGKKSRGL-NKGHRYNKTRAGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_003666937.1| hypothetical protein MYCTH_2312102 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO61692.1| hypothetical protein MYCTH_2312102 [Myceliophthora thermophila 
ATCC 42464]
Length=203

 Score =   227 bits (579),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRP 
Sbjct  16   SDVVRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPA  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQG+ QLK+QRS ++ AEER GR+   LRVLNSYWIN+DSTYKY+EVILV
Sbjct  76   PKGATYGKPTNQGINQLKYQRSLKATAEERVGRRCANLRVLNSYWINQDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLTS GKK RGL  +GH ++K R  RR TWKR+
Sbjct  136  DPQHKAIRRDPRINWIVNPVHKHREARGLTSTGKKSRGL-NKGHRYNKTRAGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>gb|KIW41910.1| 60S ribosomal protein L15 [Exophiala oligosperma]
Length=264

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  77   SDVLRFLLRVRCWELRQLKVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  136

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKYFEVILV
Sbjct  137  PKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYFEVILV  196

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH + K    RR TWKR+
Sbjct  197  DPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHGYSKTTAGRRKTWKRH  255

Query  177  QT  172
             T
Sbjct  256  NT  257



>gb|KEQ59346.1| 60S ribosomal protein L15 [Aureobasidium melanogenum CBS 110374]
 gb|KEQ71724.1| 60S ribosomal protein L15 [Aureobasidium pullulans var. namibiae 
CBS 147.97]
 gb|KEQ81902.1| 60S ribosomal protein L15 [Aureobasidium pullulans EXF-150]
Length=203

 Score =   227 bits (578),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 148/182 (81%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLKFQRS RSVAEER GR+   LRVLNSYWIN+DSTYKYFE+ILV
Sbjct  76   PKGATYGKPTNQGVNQLKFQRSLRSVAEERVGRRCANLRVLNSYWINQDSTYKYFEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR D RINW+ NPVHKHRELRGLTS GK  RG+  +GH ++     RR TWKR 
Sbjct  136  DPQHKAIRKDARINWIVNPVHKHRELRGLTSTGKHNRGI-NKGHRYNNTSAGRRKTWKRQ  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_007812013.1| 60S ribosomal protein L15 [Metarhizium acridum CQMa 102]
 ref|XP_007818066.1| Ribosomal protein L15e [Metarhizium robertsii ARSEF 23]
 gb|EFY88332.1| 60S ribosomal protein L15 [Metarhizium acridum CQMa 102]
 gb|EFZ02295.1| Ribosomal protein L15e [Metarhizium robertsii ARSEF 23]
 gb|EXV05475.1| ribosomal protein L15 [Metarhizium robertsii]
 gb|KFG82830.1| 60S ribosomal protein L15 [Metarhizium anisopliae]
 gb|KID67254.1| Ribosomal protein L15e, partial [Metarhizium anisopliae ARSEF 
549]
 gb|KID88474.1| Ribosomal protein L15e [Metarhizium guizhouense ARSEF 977]
Length=203

 Score =   227 bits (578),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF LRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYWIN+DSTYKY+EVILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYWINQDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH ++K +  RR TW R+
Sbjct  136  DPQHKAIRIDPRINWIVNPVHKHREARGLTATGKKSRGL-NKGHRYNKTQAGRRKTWLRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>gb|KEQ99844.1| hypothetical protein AUEXF2481DRAFT_25720 [Aureobasidium subglaciale 
EXF-2481]
Length=253

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 148/182 (81%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  66   SDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  125

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLKFQRS RSVAEER GR+   LRVLNSYWIN+DSTYKYFE+ILV
Sbjct  126  PKGATYGKPTNQGVNQLKFQRSLRSVAEERVGRRCANLRVLNSYWINQDSTYKYFEIILV  185

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR D RINW+ NPVHKHRELRGLTS GK  RG+  +GH ++     RR TWKR 
Sbjct  186  DPQHKAIRKDARINWIVNPVHKHRELRGLTSTGKHNRGI-NKGHRYNNTSAGRRKTWKRQ  244

Query  177  QT  172
             T
Sbjct  245  NT  246



>ref|XP_005703122.1| 60S ribosomal protein L15e isoform 2 [Galdieria sulphuraria]
 ref|XP_005703123.1| 60S ribosomal protein L15e isoform 1 [Galdieria sulphuraria]
 gb|EME26602.1| 60S ribosomal protein L15e isoform 2 [Galdieria sulphuraria]
 gb|EME26603.1| 60S ribosomal protein L15e isoform 1 [Galdieria sulphuraria]
Length=204

 Score =   226 bits (577),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF LRVR WEYR L S+ R +RPTRPDKAR LGYKAKQG+V+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLLRVRAWEYRHLPSVHRASRPTRPDKARMLGYKAKQGFVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKGI YGKP NQG+TQLKF+R+KRSVAEERAGR+ G LRVLNSYWIN+D  YKYFEVILV
Sbjct  76   PKGIQYGKPKNQGITQLKFKRNKRSVAEERAGRRCGNLRVLNSYWINQDGIYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRI+W+C P  KHRE RGLTSAG+ +RGLR +G    K RPS RA WKR 
Sbjct  136  DPNHKAIRRDPRIHWICKPTMKHRERRGLTSAGRAHRGLRRKGLGVAKVRPSVRANWKRR  195

Query  177  QT  172
             T
Sbjct  196  NT  197



>ref|XP_002545593.1| 60S ribosomal protein L15-B [Candida tropicalis MYA-3404]
 gb|EER35635.1| 60S ribosomal protein L15-B [Candida tropicalis MYA-3404]
Length=204

 Score =   226 bits (577),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYW+N+DSTYKYFEVILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRASNLRVLNSYWVNQDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D +H AIR D R NW+ NPVHKHRE RGLTSAGKK RG+  +GHL +K +  RR TWK++
Sbjct  136  DPSHKAIRRDARYNWIANPVHKHRESRGLTSAGKKSRGI-NKGHLFNKTKAGRRHTWKKH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_001545571.1| 60S ribosomal protein L15 [Botrytis cinerea B05.10]
 ref|XP_001588964.1| 60S ribosomal protein L15 [Sclerotinia sclerotiorum 1980 UF-70]
 gb|EDN94638.1| hypothetical protein SS1G_10512 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=203

 Score =   226 bits (577),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  + R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVLRFLLRVRCWELRQLNVVHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKYFE+ILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYFEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH  +K    RR TWK++
Sbjct  136  DPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHGFNKTTAGRRKTWKKH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>gb|KID77747.1| Ribosomal protein L15e, partial [Metarhizium brunneum ARSEF 3297]
Length=203

 Score =   226 bits (577),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF LRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYWIN+DSTYKY+E+ILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYWINQDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH ++K +  RR TW R+
Sbjct  136  DPQHKAIRIDPRINWIVNPVHKHREARGLTATGKKSRGL-NKGHRYNKTQAGRRKTWLRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_007788991.1| putative 60s ribosomal protein l15 protein [Eutypa lata UCREL1]
 gb|EMR71923.1| putative 60s ribosomal protein l15 protein [Eutypa lata UCREL1]
Length=203

 Score =   226 bits (577),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYWIN+DSTYKY+EVILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYWINQDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH ++K R  RR TWKR+
Sbjct  136  DPQHKAIRLDPRINWIVNPVHKHREARGLTATGKKSRGL-NKGHRYNKTRAGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_001909718.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP70851.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP27445.1| Putative cytosolic 60S ribosomal protein Rpl15 [Podospora anserina 
S mat+]
Length=203

 Score =   226 bits (577),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK+PV
Sbjct  16   SDVVRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKKPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYWIN+DSTYKYFEVILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYWINQDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH ++K +  RR TWKR+
Sbjct  136  DPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHRYNKTKAGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>gb|KIX93106.1| 60S ribosomal protein L15 [Fonsecaea multimorphosa CBS 102226]
Length=203

 Score =   226 bits (577),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YR+RVRRGGRKRPV
Sbjct  16   SDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYWIN+DSTYKY+E+ILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRCANLRVLNSYWINQDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH + K    RR TWKR+
Sbjct  136  DPNHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHGYTKTTSGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_007759046.1| 60S ribosomal protein L15 [Cladophialophora yegresii CBS 114405]
 gb|EXJ56512.1| 60S ribosomal protein L15 [Cladophialophora yegresii CBS 114405]
Length=203

 Score =   226 bits (576),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYWIN+DSTYKYFEVILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRCANLRVLNSYWINQDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRI+W+ NPVHKHRE RGLT+ GKK RGL G+GH ++     RR TWKR 
Sbjct  136  DPNHKAIRRDPRISWIVNPVHKHRESRGLTATGKKSRGL-GKGHGYNNTTAGRRKTWKRQ  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_009226880.1| 60S ribosomal protein L15 [Gaeumannomyces graminis var. tritici 
R3-111a-1]
 gb|EJT71483.1| 60S ribosomal protein L15 [Gaeumannomyces graminis var. tritici 
R3-111a-1]
Length=203

 Score =   226 bits (576),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SD++RF LRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDILRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKY+EVILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRI+W+ NPVHKHRE RGLT+ GKK RGL  +GH ++K    RR TWKR+
Sbjct  136  DPQHKAIRRDPRISWIVNPVHKHRESRGLTATGKKSRGL-NKGHRYNKTTAGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>gb|EPQ66314.1| Protein component of the large (60S) ribosomal subunit [Blumeria 
graminis f. sp. tritici 96224]
 emb|CCU77282.1| 60S ribosomal protein L15 [Blumeria graminis f. sp. hordei DH14]
Length=203

 Score =   226 bits (576),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  + R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVLRFLLRVRCWELRQLNVVHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKY+EVILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GK+ RGL G+GH ++K    RR TWKR+
Sbjct  136  DPQHKAIRRDPRINWIVNPVHKHRECRGLTATGKRSRGL-GKGHGYNKTTAGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_007804051.1| 60S ribosomal protein L15 [Endocarpon pusillum Z07020]
 gb|ERF70289.1| 60S ribosomal protein L15 [Endocarpon pusillum Z07020]
Length=203

 Score =   226 bits (576),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKY+E+ILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH ++K    RR TWKR 
Sbjct  136  DPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHRYNKTTAGRRKTWKRL  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_008080630.1| Ribosomal proteins S24e, L23 and L15e [Glarea lozoyensis ATCC 
20868]
 gb|EHK96892.1| putative 60S ribosomal protein L15 [Glarea lozoyensis 74030]
 gb|EPE32618.1| Ribosomal proteins S24e, L23 and L15e [Glarea lozoyensis ATCC 
20868]
Length=203

 Score =   226 bits (576),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK+PV
Sbjct  16   SDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKKPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKYFE+ILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYFEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR D RINW+ NPVHKHRE RGLT+ GKK RGL G+GH ++K    RR TWKR+
Sbjct  136  DPQHKAIRRDARINWIVNPVHKHRESRGLTATGKKSRGL-GKGHGYNKTTAGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>gb|KIW20891.1| 60S ribosomal protein L15 [Exophiala spinifera]
Length=203

 Score =   226 bits (576),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVLRFLLRVRCWELRQLKVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYW+N+DSTYKY+EVILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWVNQDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH ++K    RR TWKR 
Sbjct  136  DPQHKAIRKDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHGYNKTTAGRRKTWKRL  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_003233932.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 118892]
 gb|EGD89563.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 118892]
 gb|EGD98634.1| 60S ribosomal protein L15 [Trichophyton tonsurans CBS 112818]
 gb|EGE06831.1| ribosomal protein L15 [Trichophyton equinum CBS 127.97]
 gb|EZF24323.1| 60S ribosomal protein L15 [Trichophyton rubrum MR850]
 gb|EZF35746.1| 60S ribosomal protein L15 [Trichophyton interdigitale H6]
 gb|EZF43284.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 100081]
 gb|EZF53926.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 288.86]
 gb|EZF64574.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 289.86]
 gb|EZF75156.1| 60S ribosomal protein L15 [Trichophyton soudanense CBS 452.61]
 gb|EZF85853.1| 60S ribosomal protein L15 [Trichophyton rubrum MR1448]
 gb|EZF96634.1| 60S ribosomal protein L15 [Trichophyton rubrum MR1459]
 gb|EZG07762.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 735.88]
 gb|EZG18074.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 202.88]
 gb|KDB26559.1| 60S ribosomal protein L15 [Trichophyton interdigitale MR816]
 gb|KDB35118.1| 60S ribosomal protein L15 [Trichophyton rubrum D6]
Length=203

 Score =   226 bits (576),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 146/182 (80%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YR+RVRRGGRKR  
Sbjct  16   SDVMRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRIRVRRGGRKRTA  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KG  YGKPTNQGV QLK+QRS RS AEER G++   LRVLNSYWIN+DSTYKY+E+ILV
Sbjct  76   RKGATYGKPTNQGVNQLKYQRSLRSTAEERVGKRCANLRVLNSYWINQDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH ++K    RR TWKR 
Sbjct  136  DPQHKAIRKDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHGYNKTTAGRRKTWKRL  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>gb|EMS53506.1| 60S ribosomal protein L15 [Triticum urartu]
Length=168

 Score =   224 bits (572),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = -2

Query  528  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  349
            IVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+NEDSTYKYFEVILVD A
Sbjct  43   IVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWVNEDSTYKYFEVILVDVA  102

Query  348  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  172
            H+A+RNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATWKRNQT
Sbjct  103  HSAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHRHHKNRPSRRATWKRNQT  161



>gb|EEQ87750.1| 60S ribosomal protein L15 [Blastomyces dermatitidis ER-3]
Length=203

 Score =   226 bits (576),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 145/182 (80%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKR  
Sbjct  16   SDVIRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRQA  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTN GV QLK+QRS R  AEER GR+   LRVLNSYWINEDSTYKYFEVILV
Sbjct  76   PKGTTYGKPTNHGVNQLKYQRSLRCTAEERVGRRCANLRVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+  PVHKHRE RGLT+AGKK RGL GRGH + K    RR TWKR 
Sbjct  136  DPQHKAIRRDPRINWIVKPVHKHRENRGLTAAGKKSRGL-GRGHSYTKTTAGRRKTWKRL  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>gb|KHN95867.1| Ribosomal protein L15e [Metarhizium album ARSEF 1941]
Length=203

 Score =   226 bits (576),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF LRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYWIN DSTYKY+EVILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYWINRDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH ++K +  RR TW R+
Sbjct  136  DPQHKAIRIDPRINWIVNPVHKHREARGLTATGKKSRGL-NKGHRYNKTQAGRRKTWLRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_002623870.1| 60S ribosomal protein L15 [Blastomyces dermatitidis SLH14081]
 gb|EEQ70385.1| 60S ribosomal protein L15 [Blastomyces dermatitidis SLH14081]
 gb|EGE77651.1| 60S ribosomal protein L15 [Blastomyces dermatitidis ATCC 18188]
Length=203

 Score =   226 bits (575),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 145/182 (80%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKR  
Sbjct  16   SDVIRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRQA  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTN GV QLK+QRS R  AEER GR+   LRVLNSYWINEDSTYKYFEVILV
Sbjct  76   PKGATYGKPTNHGVNQLKYQRSLRCTAEERVGRRCANLRVLNSYWINEDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+  PVHKHRE RGLT+AGKK RGL GRGH + K    RR TWKR 
Sbjct  136  DPQHKAIRRDPRINWIVKPVHKHRENRGLTAAGKKSRGL-GRGHSYTKTTAGRRKTWKRL  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_003382517.1| PREDICTED: 60S ribosomal protein L15-like [Amphimedon queenslandica]
Length=204

 Score =   226 bits (575),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 130/183 (71%), Positives = 149/183 (81%), Gaps = 2/183 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SD++RF LRVRCW+YRQL  + R  RPTRPDKARRLGYKAKQG+V+YR+RVRRGGRKR  
Sbjct  16   SDLLRFLLRVRCWQYRQLNVLHRAPRPTRPDKARRLGYKAKQGFVIYRIRVRRGGRKRKA  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KG  YGKPTNQGV +LKFQRS +SVAEER GR  GGLRVLNSYW+ +DST+K++EVILV
Sbjct  76   RKGATYGKPTNQGVNELKFQRSLQSVAEERVGRHCGGLRVLNSYWVGQDSTFKFYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKAR-PSRRATWKR  181
            D AH  IR DPR NW+C PVHKHRE+RGLTS G+K RGL G+GHL  K +  SRRA WKR
Sbjct  136  DPAHKVIRQDPRTNWICRPVHKHREMRGLTSCGRKNRGL-GKGHLRTKVQGGSRRANWKR  194

Query  180  NQT  172
              T
Sbjct  195  RNT  197



>ref|XP_007925894.1| hypothetical protein MYCFIDRAFT_58365 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME83067.1| hypothetical protein MYCFIDRAFT_58365 [Pseudocercospora fijiensis 
CIRAD86]
Length=203

 Score =   226 bits (575),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKY+E+ILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYYEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH ++  +  RR TWKR 
Sbjct  136  DPQHKAIRKDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHRYNNTKAGRRHTWKRQ  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>gb|ACR24948.1| ribosomal protein L15 [Lepidochitona cinerea]
Length=204

 Score =   226 bits (575),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 152/183 (83%), Gaps = 2/183 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LR+R W+YRQL S+ R +RPTRPDKARRLGY+AKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVLRFLLRIRSWQYRQLASVHRASRPTRPDKARRLGYRAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKP NQGV QLKFQRS +SVAEER GRK  GLRVL+SYW+ +DSTYK+FE+++V
Sbjct  76   PKGATYGKPVNQGVNQLKFQRSLQSVAEERVGRKCQGLRVLSSYWVAQDSTYKFFEIVMV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKA-RPSRRATWKR  181
            D  H AIR DP+INWLCNPVHKHRELRGLT+AGK  RGL  +GH  HK    SRRA WKR
Sbjct  136  DPFHKAIRRDPKINWLCNPVHKHRELRGLTTAGKSSRGLX-KGHKFHKTIGGSRRANWKR  194

Query  180  NQT  172
              T
Sbjct  195  QNT  197



>ref|XP_003350788.1| 60S ribosomal protein L15 [Sordaria macrospora k-hell]
 emb|CCC07453.1| unnamed protein product [Sordaria macrospora k-hell]
Length=203

 Score =   226 bits (575),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK+PV
Sbjct  16   SDVVRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKKPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKY+EVILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GK+ RGL  +GH ++K R  RR TWKR+
Sbjct  136  DPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKRSRGL-NKGHRYNKTRAGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>gb|ESZ93952.1| 60S ribosomal protein L15 [Sclerotinia borealis F-4157]
Length=203

 Score =   226 bits (575),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 148/182 (81%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  + R +RP+RPDKARRLGYKAKQGYV+YR RVRRGGRKRP 
Sbjct  16   SDVLRFLLRVRCWELRQLNVVHRASRPSRPDKARRLGYKAKQGYVIYRARVRRGGRKRPA  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQG+ QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKYFE+ILV
Sbjct  76   PKGATYGKPTNQGINQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYFEIILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RG+T+ GKK RGL G+GH  +K    RR TWK++
Sbjct  136  DPQHKAIRRDPRINWIVNPVHKHRESRGMTATGKKSRGL-GKGHGFNKTTAGRRKTWKKH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_002797110.1| 60S ribosomal protein L15 [Paracoccidioides sp. 'lutzii' Pb01]
 ref|XP_010759628.1| 60S ribosomal protein L15 [Paracoccidioides brasiliensis Pb18]
 gb|EEH18959.1| 60S ribosomal protein L15 [Paracoccidioides brasiliensis Pb03]
 gb|EEH38048.1| 60S ribosomal protein L15 [Paracoccidioides sp. 'lutzii' Pb01]
 gb|EEH47772.1| 60S ribosomal protein L15 [Paracoccidioides brasiliensis Pb18]
Length=203

 Score =   225 bits (574),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 148/182 (81%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YR+RVRRGGRKRP 
Sbjct  16   SDVIRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPA  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTN G+ QLK+QRS RS AEER GR+   LRVLNSYWIN+DSTYKY+EVILV
Sbjct  76   PKGATYGKPTNHGINQLKYQRSLRSTAEERVGRRCANLRVLNSYWINQDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL GRGH ++K    RR TWKR 
Sbjct  136  DPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GRGHKYNKTTAGRRKTWKRL  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>gb|ENH84342.1| 60s ribosomal protein l15 [Colletotrichum orbiculare MAFF 240422]
Length=203

 Score =   225 bits (574),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK+PV
Sbjct  16   SDVMRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKKPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KG  +GKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYW+N+DSTYKY+EVILV
Sbjct  76   AKGATFGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYWVNQDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH ++K +  RR TWKR+
Sbjct  136  DPQHKAIRIDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHRYNKTKAGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>gb|KGQ83010.1| 60S ribosomal protein L15-A [Candida albicans P37005]
 gb|KGT63650.1| 60S ribosomal protein L15-A [Candida albicans 12C]
 gb|KGU02265.1| 60S ribosomal protein L15-A [Candida albicans L26]
 gb|KGU02520.1| 60S ribosomal protein L15-A [Candida albicans 19F]
Length=204

 Score =   225 bits (574),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V+YR+RVRRGGRKRPV
Sbjct  16   SDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFVIYRIRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
             KG  YGKPTNQGV QLK+Q+S RS AEER GR+   LRVLNSYW+N+DSTYKYFEVILV
Sbjct  76   LKGATYGKPTNQGVNQLKYQKSLRSTAEERVGRRASNLRVLNSYWVNQDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D +H AIR D R NW+ NPVHKHRE RGLTSAGKK RG+  +GHL +K +  RR TWK++
Sbjct  136  DPSHKAIRRDARYNWIVNPVHKHREARGLTSAGKKSRGI-NKGHLFNKTKAGRRHTWKKH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_001225510.1| 60S ribosomal protein L15 [Chaetomium globosum CBS 148.51]
 gb|EAQ86601.1| 60S ribosomal protein L15 [Chaetomium globosum CBS 148.51]
Length=203

 Score =   225 bits (574),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+ F LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRP 
Sbjct  16   SDVVCFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPA  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQG+ QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKYFEVILV
Sbjct  76   PKGATYGKPTNQGINQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH ++K R  RR TWKR+
Sbjct  136  DPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHRYNKTRAGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_001525424.1| 60S ribosomal protein L15-B [Lodderomyces elongisporus NRRL YB-4239]
 gb|EDK45173.1| 60S ribosomal protein L15-B [Lodderomyces elongisporus NRRL YB-4239]
Length=204

 Score =   225 bits (574),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V+YRVRVRRGGRKRPV
Sbjct  16   SDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV  LK+Q+S RS AEER GR+   LRVLNSYW+N+DSTYKYFEVILV
Sbjct  76   PKGATYGKPTNQGVNHLKYQKSLRSTAEERVGRRAANLRVLNSYWVNQDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPR NW+ N VHKHRE RGLTSAGKK RG+  +GHL++K R  RR TWK++
Sbjct  136  DPQHKAIRRDPRYNWIANAVHKHREARGLTSAGKKSRGI-NKGHLYNKTRAGRRHTWKKH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>gb|EMS24660.1| 60S ribosomal protein l15 [Rhodosporidium toruloides NP11]
 emb|CDR35885.1| RHTO0S01e09384g1_1 [Rhodosporidium toruloides]
Length=201

 Score =   225 bits (573),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 150/182 (82%), Gaps = 3/182 (2%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQG+VVYRVRVRRG RKRPV
Sbjct  16   SDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGFVVYRVRVRRGNRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLKFQRS RS AEER  R+ G LRVLNSYWIN+D  YKY+EVILV
Sbjct  76   PKGATYGKPTNQGVNQLKFQRSLRSTAEERVARRCGNLRVLNSYWINQDGVYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D +H AIR D RINW+CNPVHK RE RGLTSAGK+ RGL G+GH + K+  +RRA WKR 
Sbjct  136  DPSHKAIRRDARINWICNPVHKRRESRGLTSAGKQNRGL-GKGHSYTKS--NRRAHWKRT  192

Query  177  QT  172
             T
Sbjct  193  NT  194



>ref|XP_007373844.1| hypothetical protein SPAPADRAFT_59682 [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW34260.1| hypothetical protein SPAPADRAFT_59682 [Spathaspora passalidarum 
NRRL Y-27907]
Length=204

 Score =   225 bits (574),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDVMRF  RVRCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V++RVRVRRGGRKRPV
Sbjct  16   SDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFVIFRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS RS AEER GR+ G LRVLNSYWIN+DSTYKYFEVILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRAGNLRVLNSYWINQDSTYKYFEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D +H AIR D R NW+  PVHKHRE RGLT+AGKK RG+  +GH + K +  RR TWK+N
Sbjct  136  DPSHKAIRRDARYNWITEPVHKHRESRGLTAAGKKSRGI-NKGHRYTKTKAGRRHTWKKN  194

Query  177  QT  172
             T
Sbjct  195  NT  196



>ref|XP_007737355.1| 60S ribosomal protein L15 [Capronia epimyces CBS 606.96]
 gb|EXJ77910.1| 60S ribosomal protein L15 [Capronia epimyces CBS 606.96]
Length=203

 Score =   225 bits (573),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  717  SDVMRFXLRVRCWEYRQLXSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpv  538
            SDV+RF LRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV
Sbjct  16   SDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV  75

Query  537  pkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  358
            PKG  YGKPTNQGV QLK+QRS R+ AEER GR+   LRVLNSYWIN+DSTYKY+EVILV
Sbjct  76   PKGATYGKPTNQGVNQLKYQRSLRATAEERVGRRAANLRVLNSYWINQDSTYKYYEVILV  135

Query  357  DTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  178
            D  H AIR DPRI+W+ NPVHKHRE RGLT+ GKK RGL G+GH  +K    RR TWKR+
Sbjct  136  DPQHKAIRRDPRISWIVNPVHKHREARGLTATGKKSRGL-GKGHGFNKTTAGRRKTWKRH  194

Query  177  QT  172
             T
Sbjct  195  NT  196



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410