BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF035B01

Length=690
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009766648.1|  PREDICTED: polyol transporter 5-like               198   3e-56   Nicotiana sylvestris
ref|XP_009596634.1|  PREDICTED: polyol transporter 5-like               197   7e-56   Nicotiana tomentosiformis
ref|XP_011092774.1|  PREDICTED: polyol transporter 5-like               187   3e-52   Sesamum indicum [beniseed]
ref|XP_006361759.1|  PREDICTED: polyol transporter 5-like               184   2e-51   Solanum tuberosum [potatoes]
ref|XP_011088358.1|  PREDICTED: polyol transporter 5-like               186   2e-51   Sesamum indicum [beniseed]
ref|XP_009611551.1|  PREDICTED: polyol transporter 5-like               184   6e-51   Nicotiana tomentosiformis
ref|XP_009800568.1|  PREDICTED: polyol transporter 5-like               182   2e-50   Nicotiana sylvestris
gb|EYU42629.1|  hypothetical protein MIMGU_mgv1a0059092mg               175   8e-50   Erythranthe guttata [common monkey flower]
gb|EPS69995.1|  sugar transport protein                                 178   1e-48   Genlisea aurea
ref|XP_009785575.1|  PREDICTED: polyol transporter 5-like isoform X2    172   6e-48   Nicotiana sylvestris
ref|NP_001281033.1|  polyol transporter 5-like                          175   1e-47   Malus domestica [apple tree]
ref|XP_011088761.1|  PREDICTED: putative polyol transporter 1           171   2e-47   
gb|KDP46229.1|  hypothetical protein JCGZ_10069                         174   3e-47   Jatropha curcas
ref|XP_009344431.1|  PREDICTED: putative polyol transporter 1           174   4e-47   Pyrus x bretschneideri [bai li]
emb|CDO97075.1|  unnamed protein product                                173   7e-47   Coffea canephora [robusta coffee]
ref|XP_008387369.1|  PREDICTED: putative polyol transporter 1 iso...    173   7e-47   
ref|XP_009375627.1|  PREDICTED: putative polyol transporter 1           172   1e-46   Pyrus x bretschneideri [bai li]
gb|AGG19155.1|  sorbitol transporter                                    172   2e-46   Pyrus pyrifolia [sha li]
gb|AFI61955.1|  polyol transporter                                      172   2e-46   Camellia sinensis [black tea]
gb|ABK29439.1|  sugar transport protein                                 171   3e-46   Coffea canephora [robusta coffee]
ref|XP_010096202.1|  Polyol transporter 5                               172   3e-46   Morus notabilis
ref|XP_009785574.1|  PREDICTED: polyol transporter 5-like isoform X1    168   3e-46   Nicotiana sylvestris
gb|ACB56939.1|  mannitol transporter                                    171   3e-46   Artemisia annua [sweet Annie]
ref|XP_004299107.1|  PREDICTED: polyol transporter 5-like               171   4e-46   Fragaria vesca subsp. vesca
ref|XP_011078884.1|  PREDICTED: polyol transporter 5-like isoform X2    171   4e-46   Sesamum indicum [beniseed]
ref|XP_011078883.1|  PREDICTED: polyol transporter 5-like isoform X1    171   4e-46   Sesamum indicum [beniseed]
ref|XP_009602627.1|  PREDICTED: polyol transporter 5-like               171   4e-46   Nicotiana tomentosiformis
ref|XP_009345071.1|  PREDICTED: putative polyol transporter 1           170   7e-46   Pyrus x bretschneideri [bai li]
ref|NP_001289249.1|  polyol transporter 5-like                          170   1e-45   Pyrus x bretschneideri [bai li]
ref|XP_002519083.1|  sugar transporter, putative                        169   2e-45   Ricinus communis
ref|XP_002313809.1|  putative sorbitol transporter family protein       169   2e-45   Populus trichocarpa [western balsam poplar]
ref|NP_001280902.1|  putative polyol transporter 1                      169   3e-45   Malus domestica [apple tree]
ref|XP_009375628.1|  PREDICTED: putative polyol transporter 1           168   5e-45   Pyrus x bretschneideri [bai li]
gb|EYU37769.1|  hypothetical protein MIMGU_mgv1a005015mg                168   5e-45   Erythranthe guttata [common monkey flower]
gb|AAZ80876.1|  putative sorbitol transporter                           164   6e-45   Nicotiana langsdorffii x Nicotiana sanderae
ref|NP_001281038.1|  polyol transporter 5-like                          167   6e-45   Malus domestica [apple tree]
ref|XP_009344435.1|  PREDICTED: putative polyol transporter 1           168   6e-45   Pyrus x bretschneideri [bai li]
ref|XP_009344433.1|  PREDICTED: putative polyol transporter 1           168   6e-45   Pyrus x bretschneideri [bai li]
ref|XP_011048787.1|  PREDICTED: polyol transporter 5-like               167   7e-45   Populus euphratica
ref|XP_006365518.1|  PREDICTED: polyol transporter 5-like               168   8e-45   Solanum tuberosum [potatoes]
ref|XP_008361285.1|  PREDICTED: putative polyol transporter 1           167   1e-44   
ref|XP_006349557.1|  PREDICTED: polyol transporter 5-like               167   1e-44   Solanum tuberosum [potatoes]
emb|CAR82417.1|  polyol transporter                                     163   2e-44   Plantago major [cart-track plant]
ref|XP_008246181.1|  PREDICTED: polyol transporter 5-like               163   2e-44   Prunus mume [ume]
ref|XP_011088360.1|  PREDICTED: polyol transporter 5-like               166   4e-44   Sesamum indicum [beniseed]
ref|XP_008387370.1|  PREDICTED: putative polyol transporter 1           166   4e-44   Malus domestica [apple tree]
ref|XP_009375838.1|  PREDICTED: putative polyol transporter 1           166   4e-44   Pyrus x bretschneideri [bai li]
gb|AAO39267.1|AF482011_1  sorbitol transporter                          165   5e-44   Prunus cerasus [pie cherry]
emb|CDP10064.1|  unnamed protein product                                165   7e-44   Coffea canephora [robusta coffee]
ref|XP_009336961.1|  PREDICTED: putative polyol transporter 1           165   7e-44   Pyrus x bretschneideri [bai li]
ref|XP_008368693.1|  PREDICTED: polyol transporter 5-like               162   7e-44   
gb|EYU20732.1|  hypothetical protein MIMGU_mgv1a026176mg                164   9e-44   Erythranthe guttata [common monkey flower]
ref|XP_007199793.1|  hypothetical protein PRUPE_ppa004456mg             164   1e-43   Prunus persica
gb|AIU41385.1|  sorbitol transporter 1                                  164   1e-43   Prunus salicina [Japanese plum]
ref|XP_008236796.1|  PREDICTED: polyol transporter 5-like               164   1e-43   Prunus mume [ume]
ref|XP_008368694.1|  PREDICTED: polyol transporter 5-like               164   1e-43   
ref|XP_008345143.1|  PREDICTED: polyol transporter 5-like               164   1e-43   Malus domestica [apple tree]
ref|XP_009345072.1|  PREDICTED: putative polyol transporter 1           164   2e-43   
ref|XP_009378956.1|  PREDICTED: putative polyol transporter 1           164   2e-43   Pyrus x bretschneideri [bai li]
ref|XP_009375629.1|  PREDICTED: polyol transporter 5-like               163   2e-43   Pyrus x bretschneideri [bai li]
emb|CAD58710.1|  polyol transporter                                     164   2e-43   Plantago major [cart-track plant]
dbj|BAM66295.1|  sorbitol transporter                                   162   2e-43   Pyrus pyrifolia [sha li]
gb|AGG19156.1|  sorbitol transporter                                    163   2e-43   Pyrus pyrifolia [sha li]
emb|CAD58709.1|  polyol transporter                                     163   2e-43   Plantago major [cart-track plant]
ref|XP_009344434.1|  PREDICTED: polyol transporter 5-like               163   3e-43   Pyrus x bretschneideri [bai li]
ref|XP_007200667.1|  hypothetical protein PRUPE_ppa015294mg             163   3e-43   
ref|XP_009342010.1|  PREDICTED: putative polyol transporter 1           163   3e-43   Pyrus x bretschneideri [bai li]
ref|XP_009350912.1|  PREDICTED: putative polyol transporter 1           163   4e-43   Pyrus x bretschneideri [bai li]
ref|XP_009342008.1|  PREDICTED: putative polyol transporter 1           163   4e-43   Pyrus x bretschneideri [bai li]
ref|XP_008245305.1|  PREDICTED: polyol transporter 5-like               162   4e-43   Prunus mume [ume]
ref|XP_008236773.1|  PREDICTED: putative polyol transporter 1           163   4e-43   Prunus mume [ume]
ref|XP_006487182.1|  PREDICTED: polyol transporter 5-like               163   4e-43   Citrus sinensis [apfelsine]
ref|XP_007200254.1|  hypothetical protein PRUPE_ppa015090mg             163   4e-43   Prunus persica
ref|XP_007200033.1|  hypothetical protein PRUPE_ppa024323mg             163   5e-43   
ref|XP_007200117.1|  hypothetical protein PRUPE_ppa018884mg             162   5e-43   Prunus persica
ref|XP_006423215.1|  hypothetical protein CICLE_v10028170mg             162   5e-43   Citrus clementina [clementine]
dbj|BAM66296.1|  sorbitol transporter                                   161   6e-43   Pyrus pyrifolia [sha li]
ref|NP_001281036.1|  polyol transporter 5-like                          162   6e-43   Malus domestica [apple tree]
ref|XP_008236797.1|  PREDICTED: putative polyol transporter 2           162   6e-43   Prunus mume [ume]
ref|XP_008387373.1|  PREDICTED: putative polyol transporter 1           162   8e-43   
ref|XP_009345073.1|  PREDICTED: polyol transporter 5-like               161   8e-43   Pyrus x bretschneideri [bai li]
gb|AAN07021.1|  putative mannitol transporter                           162   9e-43   Phelipanche ramosa
gb|AGY96955.1|  polyol transporter 1                                    162   9e-43   Vitis vinifera
ref|XP_003631630.1|  PREDICTED: polyol transporter 5                    162   9e-43   Vitis vinifera
gb|AAO88964.1|  sorbitol transporter                                    161   1e-42   Malus domestica [apple tree]
ref|XP_008387375.1|  PREDICTED: polyol transporter 5-like               161   1e-42   
ref|XP_004300990.1|  PREDICTED: polyol transporter 5-like               161   2e-42   Fragaria vesca subsp. vesca
ref|XP_009342009.1|  PREDICTED: putative polyol transporter 1           161   2e-42   Pyrus x bretschneideri [bai li]
ref|XP_009350914.1|  PREDICTED: putative polyol transporter 1           161   2e-42   Pyrus x bretschneideri [bai li]
gb|AAT06053.2|  sorbitol transporter                                    160   3e-42   Malus domestica [apple tree]
ref|XP_008466959.1|  PREDICTED: polyol transporter 5-like               155   3e-42   Cucumis melo [Oriental melon]
ref|XP_008236860.1|  PREDICTED: putative polyol transporter 1           160   3e-42   Prunus mume [ume]
gb|KHG20989.1|  Polyol transporter 5 -like protein                      160   4e-42   Gossypium arboreum [tree cotton]
ref|XP_006349565.1|  PREDICTED: polyol transporter 5-like               160   4e-42   Solanum tuberosum [potatoes]
ref|XP_010254895.1|  PREDICTED: polyol transporter 5-like               160   4e-42   Nelumbo nucifera [Indian lotus]
gb|KJB32189.1|  hypothetical protein B456_005G228500                    160   5e-42   Gossypium raimondii
ref|XP_004507415.1|  PREDICTED: polyol transporter 5-like               160   5e-42   Cicer arietinum [garbanzo]
ref|XP_011037561.1|  PREDICTED: polyol transporter 5                    160   5e-42   Populus euphratica
ref|XP_007042744.1|  Polyol/monosaccharide transporter 5                159   7e-42   
ref|XP_008393068.1|  PREDICTED: putative polyol transporter 1           159   8e-42   Malus domestica [apple tree]
ref|XP_009407915.1|  PREDICTED: putative polyol transporter 1           159   8e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010065409.1|  PREDICTED: polyol transporter 5-like               159   8e-42   Eucalyptus grandis [rose gum]
ref|XP_007199207.1|  hypothetical protein PRUPE_ppa021762mg             159   9e-42   Prunus persica
gb|ACB86853.1|  mannitol transporter                                    158   2e-41   Citrus sinensis [apfelsine]
ref|XP_006423216.1|  hypothetical protein CICLE_v10028174mg             158   2e-41   Citrus clementina [clementine]
ref|XP_010065405.1|  PREDICTED: polyol transporter 5-like               158   2e-41   Eucalyptus grandis [rose gum]
gb|KEH30427.1|  polyol/monosaccharide transporter 1                     154   2e-41   Medicago truncatula
ref|XP_008387377.1|  PREDICTED: putative polyol transporter 1           158   3e-41   
ref|XP_008387376.1|  PREDICTED: putative polyol transporter 1           158   3e-41   
ref|XP_008245258.1|  PREDICTED: polyol transporter 5-like               157   5e-41   Prunus mume [ume]
ref|XP_009345075.1|  PREDICTED: putative polyol transporter 1           157   6e-41   Pyrus x bretschneideri [bai li]
gb|AAM44082.1|  putative sorbitol transporter                           157   7e-41   Prunus cerasus [pie cherry]
gb|AAY88181.2|  mannitol transporter 1                                  156   7e-41   Olea europaea
ref|XP_008359575.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    157   7e-41   
gb|KDP46230.1|  hypothetical protein JCGZ_10070                         156   9e-41   Jatropha curcas
ref|XP_008236795.1|  PREDICTED: polyol transporter 5-like               156   1e-40   Prunus mume [ume]
ref|XP_009375822.1|  PREDICTED: putative polyol transporter 1           155   2e-40   Pyrus x bretschneideri [bai li]
ref|XP_002305419.2|  hypothetical protein POPTR_0004s15960g             155   3e-40   Populus trichocarpa [western balsam poplar]
gb|KEH30425.1|  polyol/monosaccharide transporter 1                     154   4e-40   Medicago truncatula
gb|KEH30426.1|  polyol/monosaccharide transporter 1                     154   6e-40   Medicago truncatula
gb|AAL85876.2|AF480069_1  mannitol transporter                          153   1e-39   Apium graveolens Dulce Group [celery]
ref|XP_010068107.1|  PREDICTED: polyol transporter 5-like               152   1e-39   Eucalyptus grandis [rose gum]
gb|KCW62858.1|  hypothetical protein EUGRSUZ_G00452                     153   2e-39   Eucalyptus grandis [rose gum]
gb|ACD68477.1|  plasma membrane mannitol transporter                    152   2e-39   Arachis hypogaea [goober]
ref|XP_006487181.1|  PREDICTED: polyol transporter 5-like               153   2e-39   Citrus sinensis [apfelsine]
ref|XP_008447049.1|  PREDICTED: polyol transporter 5                    152   2e-39   Cucumis melo [Oriental melon]
ref|NP_001287655.1|  polyol transporter 5-like                          152   3e-39   Solanum lycopersicum
gb|KJB12318.1|  hypothetical protein B456_002G011700                    152   4e-39   Gossypium raimondii
ref|XP_004148312.1|  PREDICTED: polyol transporter 5-like               150   9e-39   
gb|AAG43998.1|AF215837_1  mannitol transporter                          150   9e-39   Apium graveolens Dulce Group [celery]
ref|XP_003607077.1|  Sorbitol-like transporter                          150   9e-39   Medicago truncatula
gb|KHN14857.1|  Polyol transporter 5                                    141   1e-38   Glycine soja [wild soybean]
ref|XP_004171995.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    150   1e-38   
gb|KGN44323.1|  Sugar transporter                                       150   1e-38   Cucumis sativus [cucumbers]
ref|XP_003540961.2|  PREDICTED: polyol transporter 5-like               149   3e-38   Glycine max [soybeans]
ref|XP_007135989.1|  hypothetical protein PHAVU_009G008900g             149   3e-38   Phaseolus vulgaris [French bean]
ref|XP_004148857.1|  PREDICTED: polyol transporter 5-like               149   4e-38   Cucumis sativus [cucumbers]
gb|KHN25361.1|  Polyol transporter 5                                    149   5e-38   Glycine soja [wild soybean]
ref|XP_003541068.1|  PREDICTED: polyol transporter 5-like               149   5e-38   
ref|XP_007042751.1|  Polyol/monosaccharide transporter 5, putative      148   6e-38   
gb|KJB12317.1|  hypothetical protein B456_002G011600                    147   8e-38   Gossypium raimondii
ref|XP_004170410.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    147   2e-37   
gb|KHN25431.1|  Polyol transporter 5                                    147   2e-37   Glycine soja [wild soybean]
ref|XP_007131852.1|  hypothetical protein PHAVU_011G046800g             147   2e-37   Phaseolus vulgaris [French bean]
ref|XP_009395604.1|  PREDICTED: putative polyol transporter 1           147   2e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010909852.1|  PREDICTED: putative polyol transporter 1           147   2e-37   Elaeis guineensis
ref|XP_007131851.1|  hypothetical protein PHAVU_011G046700g             146   3e-37   Phaseolus vulgaris [French bean]
gb|KJB12316.1|  hypothetical protein B456_002G011500                    146   4e-37   Gossypium raimondii
ref|XP_002467638.1|  hypothetical protein SORBIDRAFT_01g031360          146   5e-37   Sorghum bicolor [broomcorn]
ref|NP_001049270.1|  Os03g0197200                                       142   5e-37   
gb|KJB12315.1|  hypothetical protein B456_002G011400                    146   5e-37   Gossypium raimondii
ref|XP_004985337.1|  PREDICTED: polyol transporter 5-like isoform X1    145   5e-37   Setaria italica
ref|XP_004985338.1|  PREDICTED: polyol transporter 5-like isoform X2    145   6e-37   
ref|XP_003603886.1|  Mannitol transporter                               145   6e-37   Medicago truncatula
ref|XP_004500821.1|  PREDICTED: polyol transporter 5-like               145   8e-37   Cicer arietinum [garbanzo]
ref|XP_009396401.1|  PREDICTED: polyol transporter 5-like               145   9e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY77363.1|  hypothetical protein OsI_05348                          144   9e-37   Oryza sativa Indica Group [Indian rice]
ref|XP_003562817.1|  PREDICTED: polyol transporter 5-like               145   1e-36   Brachypodium distachyon [annual false brome]
ref|XP_004983902.1|  PREDICTED: polyol transporter 5-like isoform X2    145   1e-36   
ref|XP_008795608.1|  PREDICTED: putative polyol transporter 1           145   1e-36   Phoenix dactylifera
ref|XP_004983901.1|  PREDICTED: polyol transporter 5-like isoform X1    145   1e-36   Setaria italica
ref|XP_006577924.1|  PREDICTED: polyol transporter 5-like               144   2e-36   Glycine max [soybeans]
tpg|DAA45950.1|  TPA: hypothetical protein ZEAMMB73_850316              144   2e-36   
ref|NP_001147446.1|  sorbitol transporter                               144   2e-36   Zea mays [maize]
gb|EAZ04480.1|  hypothetical protein OsI_26629                          144   2e-36   Oryza sativa Indica Group [Indian rice]
dbj|BAC83310.1|  putative sorbitol transporter                          144   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060108.1|  Os07g0582400                                       144   2e-36   
emb|CDX95491.1|  BnaC01g33830D                                          143   4e-36   
dbj|BAJ85302.1|  predicted protein                                      143   5e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010527602.1|  PREDICTED: polyol transporter 5-like               135   6e-36   Tarenaya hassleriana [spider flower]
ref|NP_001045505.2|  Os01g0966900                                       142   6e-36   
ref|XP_006657888.1|  PREDICTED: polyol transporter 5-like               142   6e-36   Oryza brachyantha
gb|EMT15230.1|  Polyol transporter 5                                    142   7e-36   
emb|CAJ29291.1|  putative polyol transporter protein 4                  142   8e-36   Lotus japonicus
gb|EAY88906.1|  hypothetical protein OsI_10385                          142   1e-35   Oryza sativa Indica Group [Indian rice]
gb|EEE58504.1|  hypothetical protein OsJ_09775                          142   1e-35   Oryza sativa Japonica Group [Japonica rice]
gb|ABF94465.1|  Sugar transporter family protein, expressed             142   1e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007131748.1|  hypothetical protein PHAVU_011G038700g             142   1e-35   Phaseolus vulgaris [French bean]
ref|XP_010527590.1|  PREDICTED: polyol transporter 5-like               142   1e-35   Tarenaya hassleriana [spider flower]
ref|XP_002440825.1|  hypothetical protein SORBIDRAFT_09g007450          142   2e-35   Sorghum bicolor [broomcorn]
ref|XP_009112300.1|  PREDICTED: polyol transporter 5                    141   2e-35   Brassica rapa
ref|XP_008812826.1|  PREDICTED: polyol transporter 5-like               137   2e-35   Phoenix dactylifera
gb|AAL38359.1|  sugar transporter protein                               137   2e-35   Arabidopsis thaliana [mouse-ear cress]
emb|CAP58707.1|  putative polyol transported protein 2                  140   4e-35   Hevea brasiliensis [jebe]
ref|XP_010905472.1|  PREDICTED: polyol transporter 5-like               140   5e-35   
ref|XP_002460923.1|  hypothetical protein SORBIDRAFT_02g037570          140   5e-35   Sorghum bicolor [broomcorn]
gb|AEX55225.1|  sugar transporter                                       139   8e-35   Allium sativum
ref|NP_001236592.1|  sorbitol-like transporter                          139   1e-34   
gb|KHN39768.1|  Polyol transporter 5                                    139   1e-34   Glycine soja [wild soybean]
gb|ACF85526.1|  unknown                                                 132   2e-34   Zea mays [maize]
ref|XP_010446763.1|  PREDICTED: probable polyol transporter 6           138   2e-34   
ref|XP_009407903.1|  PREDICTED: polyol transporter 5-like               138   2e-34   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS55536.1|  Polyol transporter 5                                    138   2e-34   Triticum urartu
ref|XP_008653287.1|  PREDICTED: polyol transporter 5-like               138   3e-34   Zea mays [maize]
emb|CAP58706.1|  putative polyol transporter protein 1                  138   3e-34   Hevea brasiliensis [jebe]
ref|XP_002885281.1|  ATPLT5                                             138   3e-34   Arabidopsis lyrata subsp. lyrata
ref|NP_188513.1|  polyol transporter 5                                  137   4e-34   Arabidopsis thaliana [mouse-ear cress]
emb|CDP18000.1|  unnamed protein product                                137   5e-34   Coffea canephora [robusta coffee]
gb|ABX71752.1|  mannitol transporter                                    137   5e-34   Apium graveolens
ref|XP_008791366.1|  PREDICTED: polyol transporter 5-like               137   5e-34   
ref|XP_004958137.1|  PREDICTED: polyol transporter 5-like               137   6e-34   Setaria italica
ref|XP_009138439.1|  PREDICTED: probable polyol transporter 6           137   6e-34   Brassica rapa
emb|CDX75588.1|  BnaA01g01140D                                          136   1e-33   
ref|XP_006297395.1|  hypothetical protein CARUB_v10013420mg             136   1e-33   Capsella rubella
ref|XP_008775333.1|  PREDICTED: polyol transporter 5-like               136   1e-33   Phoenix dactylifera
ref|XP_008800418.1|  PREDICTED: polyol transporter 5-like               136   2e-33   Phoenix dactylifera
ref|XP_010507195.1|  PREDICTED: polyol transporter 5                    136   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_008800420.1|  PREDICTED: polyol transporter 5-like               135   2e-33   Phoenix dactylifera
emb|CDX72594.1|  BnaC07g46160D                                          137   2e-33   
ref|XP_009109331.1|  PREDICTED: probable polyol transporter 6           135   2e-33   Brassica rapa
emb|CDY35469.1|  BnaC03g61910D                                          135   2e-33   Brassica napus [oilseed rape]
emb|CDY24775.1|  BnaA08g15350D                                          135   2e-33   Brassica napus [oilseed rape]
ref|XP_010527594.1|  PREDICTED: polyol transporter 5-like isoform X4    135   2e-33   Tarenaya hassleriana [spider flower]
ref|XP_006285274.1|  hypothetical protein CARUB_v10006648mg             135   2e-33   Capsella rubella
emb|CDY61985.1|  BnaC03g73840D                                          135   3e-33   Brassica napus [oilseed rape]
ref|XP_010465998.1|  PREDICTED: polyol transporter 5-like               135   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_008795662.1|  PREDICTED: probable polyol transporter 6           135   3e-33   
emb|CDY67098.1|  BnaCnng53530D                                          135   3e-33   Brassica napus [oilseed rape]
ref|XP_010487804.1|  PREDICTED: polyol transporter 5-like               135   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006406559.1|  hypothetical protein EUTSA_v10020495mg             135   4e-33   Eutrema salsugineum [saltwater cress]
ref|NP_001168177.1|  uncharacterized protein LOC100381931               135   4e-33   Zea mays [maize]
emb|CDP02097.1|  unnamed protein product                                135   4e-33   Coffea canephora [robusta coffee]
emb|CDY70259.1|  BnaCnng67460D                                          130   4e-33   Brassica napus [oilseed rape]
gb|KGN44326.1|  Mannitol transporter                                    135   4e-33   Cucumis sativus [cucumbers]
ref|XP_009142783.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    134   4e-33   Brassica rapa
gb|KJB40206.1|  hypothetical protein B456_007G051000                    134   5e-33   Gossypium raimondii
ref|XP_006384498.1|  hypothetical protein POPTR_0004s15900g             134   5e-33   
ref|XP_007131850.1|  hypothetical protein PHAVU_011G046600g             134   5e-33   Phaseolus vulgaris [French bean]
ref|XP_006411974.1|  hypothetical protein EUTSA_v10024974mg             134   5e-33   Eutrema salsugineum [saltwater cress]
ref|XP_009135601.1|  PREDICTED: polyol transporter 5                    134   5e-33   Brassica rapa
ref|XP_008447047.1|  PREDICTED: polyol transporter 5-like               134   6e-33   Cucumis melo [Oriental melon]
ref|XP_010432153.1|  PREDICTED: probable polyol transporter 6           134   8e-33   Camelina sativa [gold-of-pleasure]
ref|XP_008452333.1|  PREDICTED: polyol transporter 5-like isoform X2    134   1e-32   Cucumis melo [Oriental melon]
ref|XP_003558586.1|  PREDICTED: polyol transporter 5-like               133   1e-32   Brachypodium distachyon [annual false brome]
ref|XP_008452332.1|  PREDICTED: putative polyol transporter 2 iso...    133   1e-32   Cucumis melo [Oriental melon]
ref|XP_002460924.1|  hypothetical protein SORBIDRAFT_02g037580          133   2e-32   Sorghum bicolor [broomcorn]
ref|XP_004958139.1|  PREDICTED: putative polyol transporter 1-like      133   2e-32   Setaria italica
ref|XP_010527591.1|  PREDICTED: polyol transporter 5-like isoform X1    133   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_010095276.1|  putative polyol transporter 6                      133   2e-32   Morus notabilis
ref|XP_010527593.1|  PREDICTED: polyol transporter 5-like isoform X3    133   2e-32   Tarenaya hassleriana [spider flower]
ref|NP_001182999.1|  uncharacterized protein LOC100501319               132   2e-32   Zea mays [maize]
ref|XP_002866999.1|  hypothetical protein ARALYDRAFT_490969             132   2e-32   
ref|NP_195385.1|  putative polyol transporter 6                         132   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010527592.1|  PREDICTED: polyol transporter 5-like isoform X2    132   2e-32   Tarenaya hassleriana [spider flower]
dbj|BAJ86116.1|  predicted protein                                      132   3e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA63328.1|  TPA: hypothetical protein ZEAMMB73_585953              132   3e-32   
ref|XP_006649564.1|  PREDICTED: polyol transporter 5-like               132   3e-32   Oryza brachyantha
ref|XP_010435020.1|  PREDICTED: putative polyol transporter 2           132   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_008651795.1|  PREDICTED: uncharacterized protein LOC100501...    132   3e-32   Zea mays [maize]
ref|XP_010442448.1|  PREDICTED: putative polyol transporter 2           132   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_004509296.1|  PREDICTED: probable polyol transporter 3-like      132   4e-32   Cicer arietinum [garbanzo]
ref|NP_001141158.1|  hypothetical protein                               132   4e-32   Zea mays [maize]
ref|XP_008447048.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    132   4e-32   Cucumis melo [Oriental melon]
emb|CDP17996.1|  unnamed protein product                                132   4e-32   Coffea canephora [robusta coffee]
ref|XP_010444944.1|  PREDICTED: probable polyol transporter 6           133   4e-32   
ref|XP_008667512.1|  PREDICTED: hypothetical protein isoform X1         132   4e-32   Zea mays [maize]
emb|CDY72601.1|  BnaAnng41630D                                          131   4e-32   Brassica napus [oilseed rape]
ref|XP_010484928.1|  PREDICTED: putative polyol transporter 1           132   4e-32   Camelina sativa [gold-of-pleasure]
ref|XP_007201628.1|  hypothetical protein PRUPE_ppa021469mg             131   5e-32   
emb|CDY46217.1|  BnaA07g03530D                                          131   5e-32   Brassica napus [oilseed rape]
ref|XP_006425707.1|  hypothetical protein CICLE_v10027247mg             131   7e-32   Citrus clementina [clementine]
ref|XP_010495901.1|  PREDICTED: putative polyol transporter 1           131   7e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010445995.1|  PREDICTED: putative polyol transporter 2           131   7e-32   Camelina sativa [gold-of-pleasure]
gb|KDP27565.1|  hypothetical protein JCGZ_20028                         131   8e-32   Jatropha curcas
ref|XP_010516958.1|  PREDICTED: putative polyol transporter 2           131   8e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010530516.1|  PREDICTED: putative polyol transporter 1           129   9e-32   Tarenaya hassleriana [spider flower]
ref|XP_010472919.1|  PREDICTED: putative polyol transporter 2           131   9e-32   Camelina sativa [gold-of-pleasure]
ref|XP_009121227.1|  PREDICTED: putative polyol transporter 1           131   9e-32   Brassica rapa
emb|CDY46218.1|  BnaA07g03520D                                          130   1e-31   Brassica napus [oilseed rape]
ref|XP_003629474.1|  hypothetical protein MTR_8g077890                  130   1e-31   Medicago truncatula
gb|AFK37582.1|  unknown                                                 130   1e-31   Medicago truncatula
gb|ACJ85829.1|  unknown                                                 130   1e-31   Medicago truncatula
ref|XP_010472942.1|  PREDICTED: putative polyol transporter 2           130   1e-31   Camelina sativa [gold-of-pleasure]
gb|KGN56185.1|  hypothetical protein Csa_3G095020                       130   1e-31   Cucumis sativus [cucumbers]
ref|XP_006299557.1|  hypothetical protein CARUB_v10015731mg             130   1e-31   Capsella rubella
gb|KFK30307.1|  hypothetical protein AALP_AA7G244900                    130   1e-31   Arabis alpina [alpine rockcress]
ref|XP_006409469.1|  hypothetical protein EUTSA_v10023129mg             130   1e-31   Eutrema salsugineum [saltwater cress]
ref|XP_002886203.1|  hypothetical protein ARALYDRAFT_343514             130   1e-31   Arabidopsis lyrata subsp. lyrata
dbj|BAJ93158.1|  predicted protein                                      130   1e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004149937.1|  PREDICTED: polyol transporter 5-like               130   1e-31   
ref|XP_002884156.1|  predicted protein                                  130   1e-31   
ref|XP_009121388.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    130   1e-31   
ref|XP_010468639.1|  PREDICTED: putative polyol transporter 2           130   1e-31   
ref|XP_009371568.1|  PREDICTED: probable polyol transporter 6           130   2e-31   
ref|XP_008670519.1|  PREDICTED: putative polyol transporter 1           130   2e-31   
ref|XP_010442571.1|  PREDICTED: putative polyol transporter 2           130   2e-31   
ref|NP_001132062.1|  proton myo-inositol cotransporter                  130   2e-31   
ref|NP_179209.1|  polyol/monosaccharide transporter 1                   130   2e-31   
gb|ACG35144.1|  proton myo-inositol cotransporter                       130   2e-31   
gb|ACN26310.1|  unknown                                                 130   2e-31   
gb|ACF86250.1|  unknown                                                 122   2e-31   
ref|XP_010548339.1|  PREDICTED: probable polyol transporter 6           129   3e-31   
ref|XP_002463086.1|  hypothetical protein SORBIDRAFT_02g037590          129   3e-31   
ref|XP_008338123.1|  PREDICTED: probable polyol transporter 6           129   4e-31   
ref|XP_010690917.1|  PREDICTED: polyol transporter 5 isoform X2         129   5e-31   
ref|NP_179210.1|  polyol/monosaccharide transporter 2                   129   5e-31   
ref|XP_006658740.1|  PREDICTED: polyol transporter 5-like               129   5e-31   
ref|XP_007156029.1|  hypothetical protein PHAVU_003G252500g             129   6e-31   
ref|XP_010690916.1|  PREDICTED: polyol transporter 5 isoform X1         129   6e-31   
ref|XP_010254894.1|  PREDICTED: polyol transporter 5-like               128   6e-31   
gb|EMT15229.1|  Putative polyol transporter 1                           127   7e-31   
ref|XP_008447302.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    128   7e-31   
ref|XP_008465477.1|  PREDICTED: polyol transporter 5-like               128   7e-31   
ref|XP_008338588.1|  PREDICTED: probable polyol transporter 6           128   8e-31   
ref|XP_009112494.1|  PREDICTED: probable polyol transporter 3           128   1e-30   
ref|XP_007046983.1|  Major facilitator superfamily protein              128   1e-30   
ref|XP_004148314.1|  PREDICTED: polyol transporter 5-like               127   1e-30   
gb|KFK30287.1|  hypothetical protein AALP_AA7G242000                    127   1e-30   
gb|KGN44327.1|  hypothetical protein Csa_7G253820                       127   1e-30   
gb|EMT29310.1|  Putative polyol transporter 6                           122   2e-30   
ref|XP_003616024.1|  hypothetical protein MTR_5g075300                  127   2e-30   
ref|XP_009356716.1|  PREDICTED: probable polyol transporter 6           127   2e-30   
ref|XP_010908358.1|  PREDICTED: probable polyol transporter 6           127   2e-30   
gb|KFK41272.1|  hypothetical protein AALP_AA2G108500                    126   2e-30   
gb|EMS55537.1|  Putative polyol transporter 1                           126   3e-30   
gb|KHN41994.1|  Putative polyol transporter 6                           126   3e-30   
ref|XP_006590682.1|  PREDICTED: probable polyol transporter 6-like      126   3e-30   
ref|XP_008795604.1|  PREDICTED: putative polyol transporter 1           126   3e-30   
ref|XP_010530847.1|  PREDICTED: putative polyol transporter 1           126   4e-30   
ref|XP_008795606.1|  PREDICTED: polyol transporter 5-like isoform X1    126   4e-30   
ref|XP_007156923.1|  hypothetical protein PHAVU_002G028600g             126   4e-30   
ref|XP_010531022.1|  PREDICTED: probable polyol transporter 6           126   4e-30   
ref|XP_003561393.1|  PREDICTED: probable polyol transporter 6           126   4e-30   
emb|CBI17542.3|  unnamed protein product                                125   4e-30   
gb|KFK40045.1|  hypothetical protein AALP_AA3G322700                    126   4e-30   
gb|AFK38433.1|  unknown                                                 121   4e-30   
ref|XP_008795607.1|  PREDICTED: polyol transporter 5-like isoform X2    126   4e-30   
ref|XP_010905473.1|  PREDICTED: putative polyol transporter 1           126   6e-30   
gb|KFK40217.1|  hypothetical protein AALP_AA3G345800                    125   6e-30   
ref|XP_008241649.1|  PREDICTED: probable polyol transporter 6           125   6e-30   
ref|XP_002267872.1|  PREDICTED: probable polyol transporter 6 iso...    125   7e-30   
emb|CDP17999.1|  unnamed protein product                                125   7e-30   
ref|XP_009411236.1|  PREDICTED: probable polyol transporter 6           125   8e-30   
ref|XP_004148313.1|  PREDICTED: polyol transporter 5-like               125   8e-30   
ref|XP_004166834.1|  PREDICTED: polyol transporter 5-like               125   9e-30   
ref|XP_011078372.1|  PREDICTED: polyol transporter 5-like               125   9e-30   
gb|KHN00554.1|  Putative polyol transporter 3                           125   1e-29   
dbj|BAK07233.1|  predicted protein                                      125   1e-29   
gb|KHN44499.1|  Putative polyol transporter 3                           124   1e-29   
ref|XP_003548895.1|  PREDICTED: probable polyol transporter 3-like      125   1e-29   
dbj|BAK00091.1|  predicted protein                                      125   1e-29   
ref|XP_006451145.1|  hypothetical protein CICLE_v10008031mg             125   1e-29   
emb|CDY66868.1|  BnaUnng01720D                                          124   2e-29   
ref|XP_006475614.1|  PREDICTED: polyol transporter 5-like isoform X1    124   2e-29   
ref|XP_008447044.1|  PREDICTED: polyol transporter 5-like               124   2e-29   
gb|EEC66802.1|  hypothetical protein OsI_33208                          124   2e-29   
ref|XP_011025750.1|  PREDICTED: probable polyol transporter 3           124   3e-29   
ref|XP_010548048.1|  PREDICTED: putative polyol transporter 1           124   3e-29   
ref|NP_001064429.1|  Os10g0360100                                       124   3e-29   
gb|ACF83985.1|  unknown                                                 123   3e-29   
ref|XP_004148303.1|  PREDICTED: polyol transporter 5-like               124   3e-29   
gb|EAZ15802.1|  hypothetical protein OsJ_31220                          123   3e-29   
ref|XP_008679503.1|  PREDICTED: carbohydrate transporter/ sugar p...    124   3e-29   
ref|NP_001066878.1|  Os12g0514000                                       123   3e-29   
ref|NP_001151390.1|  carbohydrate transporter/ sugar porter             123   4e-29   
ref|XP_010229631.1|  PREDICTED: putative polyol transporter 1           124   4e-29   
ref|XP_006833286.1|  hypothetical protein AMTR_s00109p00027810          123   4e-29   
ref|XP_004163631.1|  PREDICTED: polyol transporter 5-like               123   4e-29   
gb|AAK13147.1|AC083945_22  Putative sugar transporter                   124   4e-29   
gb|EAY83298.1|  hypothetical protein OsI_38507                          123   4e-29   
ref|XP_004983248.1|  PREDICTED: probable polyol transporter 3-like      123   4e-29   
ref|NP_001146002.1|  uncharacterized protein LOC100279532               123   5e-29   
ref|XP_004980363.1|  PREDICTED: polyol transporter 5-like               123   5e-29   
ref|XP_002439891.1|  hypothetical protein SORBIDRAFT_09g022100          123   5e-29   
gb|ACL53204.1|  unknown                                                 122   6e-29   
ref|XP_002310213.2|  mannitol transporter family protein                122   6e-29   
ref|NP_001150711.1|  LOC100284344                                       122   8e-29   
ref|XP_004962895.1|  PREDICTED: polyol transporter 5-like               122   8e-29   
ref|XP_006409145.1|  hypothetical protein EUTSA_v10022657mg             122   8e-29   
ref|XP_007203922.1|  hypothetical protein PRUPE_ppa017052mg             122   9e-29   
ref|XP_010237226.1|  PREDICTED: putative polyol transporter 1           122   1e-28   
ref|XP_008440694.1|  PREDICTED: probable polyol transporter 6           122   1e-28   
ref|XP_004958138.1|  PREDICTED: polyol transporter 5-like               122   1e-28   
ref|NP_001060109.2|  Os07g0582500                                       122   1e-28   
ref|XP_006664062.1|  PREDICTED: polyol transporter 5-like               122   1e-28   
gb|EAZ04481.1|  hypothetical protein OsI_26630                          122   1e-28   
dbj|BAC83311.1|  putative sorbitol transporter                          122   1e-28   
ref|XP_003575479.1|  PREDICTED: polyol transporter 5-like               122   1e-28   
ref|XP_002531429.1|  sugar transporter, putative                        122   1e-28   
ref|XP_004962896.1|  PREDICTED: polyol transporter 5-like               121   2e-28   
ref|XP_002886176.1|  predicted protein                                  121   2e-28   
ref|XP_004983249.1|  PREDICTED: probable polyol transporter 3-like      121   2e-28   
ref|XP_010489553.1|  PREDICTED: probable polyol transporter 3           121   3e-28   
ref|XP_011458734.1|  PREDICTED: probable polyol transporter 6           121   3e-28   
gb|EMS66679.1|  Putative polyol transporter 2                           120   3e-28   
emb|CAJ29288.1|  putative polyol transporter 1                          120   3e-28   
gb|EMT00465.1|  Putative polyol transporter 1                           120   3e-28   
ref|XP_009396729.1|  PREDICTED: probable polyol transporter 6           120   3e-28   
gb|KHN41995.1|  Putative polyol transporter 3                           120   4e-28   
ref|XP_006590681.1|  PREDICTED: probable polyol transporter 3-like      120   5e-28   
gb|ACF82818.1|  unknown                                                 114   5e-28   
ref|XP_004301902.2|  PREDICTED: probable polyol transporter 6           120   6e-28   
ref|XP_006856084.1|  hypothetical protein AMTR_s00059p00122840          120   6e-28   
ref|XP_010028575.1|  PREDICTED: polyol transporter 5-like               120   7e-28   
gb|KGN48817.1|  hypothetical protein Csa_6G502060                       119   8e-28   
gb|EMS61468.1|  Putative polyol transporter 1                           119   1e-27   
ref|NP_001049269.1|  Os03g0197100                                       119   1e-27   
ref|XP_006664590.1|  PREDICTED: probable polyol transporter 6-like      114   1e-27   
ref|XP_002443259.1|  hypothetical protein SORBIDRAFT_08g016530          119   1e-27   
ref|XP_007203309.1|  hypothetical protein PRUPE_ppa025908mg             119   1e-27   
ref|XP_010467666.1|  PREDICTED: probable polyol transporter 3           119   1e-27   
gb|AFW56602.1|  major myo-inositol transporter iolT                     119   2e-27   
dbj|BAJ98962.1|  predicted protein                                      116   2e-27   
ref|XP_009627595.1|  PREDICTED: probable polyol transporter 6           119   2e-27   
ref|XP_003562818.1|  PREDICTED: polyol transporter 5-like               119   2e-27   
ref|XP_010414363.1|  PREDICTED: probable polyol transporter 3           118   2e-27   
ref|XP_007013176.1|  Polyol/monosaccharide transporter 5 isoform 3      117   2e-27   
ref|XP_002514303.1|  sugar transporter, putative                        118   2e-27   
gb|ACG47895.1|  polyol transporter protein 4                            118   2e-27   
gb|ACR36350.1|  unknown                                                 116   3e-27   
ref|XP_009799010.1|  PREDICTED: probable polyol transporter 6           118   3e-27   
ref|XP_007013174.1|  Polyol/monosaccharide transporter 5 isoform 1      118   3e-27   
gb|KDP33672.1|  hypothetical protein JCGZ_07243                         118   3e-27   
gb|EMS61414.1|  Polyol transporter 5                                    117   3e-27   
ref|XP_002443258.1|  hypothetical protein SORBIDRAFT_08g016520          118   4e-27   
ref|NP_179438.1|  putative polyol transporter 3                         117   4e-27   
gb|KCW58602.1|  hypothetical protein EUGRSUZ_H01261                     117   4e-27   
tpg|DAA43975.1|  TPA: polyol transporter protein 4                      117   4e-27   
ref|XP_007160334.1|  hypothetical protein PHAVU_002G312900g             117   4e-27   
ref|XP_008463391.1|  PREDICTED: probable polyol transporter 6           117   5e-27   
ref|NP_001142160.1|  hypothetical protein                               117   5e-27   
ref|XP_010070046.1|  PREDICTED: probable polyol transporter 6           117   6e-27   
ref|XP_008668471.1|  PREDICTED: hypothetical protein isoform X1         117   6e-27   
ref|XP_004150056.1|  PREDICTED: probable polyol transporter 6-like      117   7e-27   
ref|XP_004170584.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    117   7e-27   
ref|XP_004962897.1|  PREDICTED: polyol transporter 5-like               117   8e-27   
ref|XP_006649563.1|  PREDICTED: polyol transporter 5-like               117   9e-27   
ref|XP_010688202.1|  PREDICTED: polyol transporter 5-like               116   1e-26   
ref|XP_004503439.1|  PREDICTED: polyol transporter 5-like               116   1e-26   
ref|XP_002468337.1|  hypothetical protein SORBIDRAFT_01g044010          117   1e-26   
ref|XP_002308474.2|  hypothetical protein POPTR_0006s16130g             116   1e-26   
dbj|BAJ93015.1|  predicted protein                                      116   1e-26   
gb|KDP24153.1|  hypothetical protein JCGZ_25810                         116   2e-26   
ref|XP_004985339.1|  PREDICTED: polyol transporter 5-like               116   2e-26   
emb|CDP02044.1|  unnamed protein product                                116   2e-26   
ref|XP_006856085.1|  hypothetical protein AMTR_s00059p00123280          116   2e-26   
ref|XP_006297471.1|  hypothetical protein CARUB_v10013492mg             116   2e-26   
gb|AEI98623.1|  hypothetical protein 111O18.10                          115   2e-26   
ref|XP_011458741.1|  PREDICTED: polyol transporter 5-like               115   2e-26   
gb|AFW56605.1|  carbohydrate transporter/ sugar porter                  115   2e-26   
ref|NP_001151999.1|  LOC100285636                                       115   3e-26   
dbj|BAJ86526.1|  predicted protein                                      115   3e-26   
ref|XP_003630795.1|  Polyol transporter                                 115   3e-26   
ref|XP_010049436.1|  PREDICTED: polyol transporter 5-like               114   4e-26   
ref|XP_009398416.1|  PREDICTED: probable polyol transporter 4           115   5e-26   
gb|KCW58603.1|  hypothetical protein EUGRSUZ_H01262                     114   5e-26   
ref|XP_003558585.1|  PREDICTED: putative polyol transporter 1           115   6e-26   
gb|KCW81997.1|  hypothetical protein EUGRSUZ_C03362                     114   6e-26   
gb|EMS52712.1|  Putative polyol transporter 2                           114   7e-26   
ref|XP_007203539.1|  hypothetical protein PRUPE_ppa1027213mg            115   7e-26   
ref|XP_009374073.1|  PREDICTED: probable polyol transporter 6           114   7e-26   
ref|XP_010026167.1|  PREDICTED: probable polyol transporter 6           114   7e-26   
ref|XP_008337386.1|  PREDICTED: polyol transporter 5-like               114   7e-26   
ref|XP_007013362.1|  Polyol/monosaccharide transporter 5, putative      114   7e-26   
ref|XP_008242649.1|  PREDICTED: probable polyol transporter 6           114   8e-26   
ref|XP_004979803.1|  PREDICTED: polyol transporter 5-like               114   1e-25   
ref|XP_009371465.1|  PREDICTED: polyol transporter 5-like               114   1e-25   
ref|NP_001289849.1|  probable polyol transporter 6                      114   1e-25   
gb|AFK46229.1|  unknown                                                 114   1e-25   
ref|XP_002517946.1|  sugar transporter, putative                        114   1e-25   
ref|XP_010317209.1|  PREDICTED: probable polyol transporter 6 iso...    113   1e-25   
ref|XP_010317207.1|  PREDICTED: probable polyol transporter 6 iso...    113   1e-25   
ref|XP_002514302.1|  sugar transporter, putative                        114   1e-25   
ref|XP_004139937.1|  PREDICTED: probable polyol transporter 4-like      114   1e-25   
ref|XP_010099574.1|  putative polyol transporter 4                      114   1e-25   
ref|XP_004233513.1|  PREDICTED: probable polyol transporter 6 iso...    113   1e-25   
gb|EAZ20651.1|  hypothetical protein OsJ_36266                          112   2e-25   
ref|XP_003533389.1|  PREDICTED: polyol transporter 5-like               114   2e-25   
ref|XP_011100123.1|  PREDICTED: uncharacterized protein LOC105178355    115   2e-25   
ref|XP_010035723.1|  PREDICTED: probable polyol transporter 4           113   2e-25   
dbj|BAJ89668.1|  predicted protein                                      113   2e-25   
ref|XP_010041832.1|  PREDICTED: polyol transporter 5-like               113   2e-25   
gb|EEC69368.1|  hypothetical protein OsI_38495                          112   2e-25   
ref|XP_004979805.1|  PREDICTED: polyol transporter 5-like               112   2e-25   
ref|XP_010049692.1|  PREDICTED: polyol transporter 5-like               113   3e-25   
ref|XP_003618299.1|  Mannitol transporter                               113   3e-25   
gb|KHN41999.1|  Putative polyol transporter 6                           112   3e-25   
ref|NP_001066872.1|  Os12g0512100                                       112   3e-25   
ref|XP_008448266.1|  PREDICTED: probable polyol transporter 4           113   3e-25   
emb|CDP03333.1|  unnamed protein product                                112   3e-25   
ref|XP_010530848.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    112   3e-25   
ref|XP_004512978.1|  PREDICTED: polyol transporter 5-like               112   4e-25   
ref|XP_011045507.1|  PREDICTED: probable polyol transporter 4           112   4e-25   
ref|XP_008386449.1|  PREDICTED: polyol transporter 5-like               112   4e-25   
ref|XP_011015401.1|  PREDICTED: probable polyol transporter 4           112   4e-25   
ref|XP_002319907.2|  mannitol transporter family protein                112   4e-25   
ref|XP_003529995.1|  PREDICTED: polyol transporter 5-like               112   4e-25   
ref|XP_004976318.1|  PREDICTED: probable polyol transporter 4-lik...    112   5e-25   
ref|XP_003538845.1|  PREDICTED: probable polyol transporter 3-like      112   5e-25   
ref|XP_010100561.1|  putative polyol transporter 4                      110   5e-25   
ref|XP_006827104.1|  hypothetical protein AMTR_s00010p00243760          112   5e-25   
ref|XP_004976317.1|  PREDICTED: probable polyol transporter 4-lik...    112   6e-25   
ref|NP_001068332.1|  Os11g0637200                                       111   8e-25   
ref|XP_006475613.1|  PREDICTED: polyol transporter 5-like               112   8e-25   
gb|KDO50887.1|  hypothetical protein CISIN_1g009185mg                   112   8e-25   
ref|XP_006451144.1|  hypothetical protein CICLE_v10007938mg             112   9e-25   
gb|KDP33673.1|  hypothetical protein JCGZ_07244                         111   9e-25   
ref|XP_003539908.1|  PREDICTED: probable polyol transporter 4-like      111   1e-24   
ref|XP_008447045.1|  PREDICTED: polyol transporter 5-like               111   1e-24   
ref|XP_008225034.1|  PREDICTED: probable polyol transporter 4           111   1e-24   



>ref|XP_009766648.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=526

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LRATGC L   +NRVTSGVVSMTF+SL KAI+IGG+FFLY
Sbjct  403  FSIGAGPITWVYSSEIFPLRLRATGCGLAVALNRVTSGVVSMTFLSLEKAITIGGAFFLY  462

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGTLQ  331
            A +A + WVFFFTLMPETQGKTLEETE LFG FF+WRS  RE+ AK+ NNN+Q+QM T+ 
Sbjct  463  AGLAGLAWVFFFTLMPETQGKTLEETEELFGNFFKWRSTLRELQAKEENNNAQIQMATVP  522

Query  330  A  328
            A
Sbjct  523  A  523



>ref|XP_009596634.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=526

 Score =   197 bits (501),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LRATGCSL   +NRVTSGVVSMTF+SL KAI+IGG+FF Y
Sbjct  403  FSIGAGPITWVYSSEIFPLRLRATGCSLAVALNRVTSGVVSMTFLSLEKAITIGGAFFFY  462

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGTLQ  331
            A +A + WVFFFTLMPETQGKTLEETE LFGTFF+WR   RE+ AK+ NNN+Q+QM T+ 
Sbjct  463  AGLAGLAWVFFFTLMPETQGKTLEETEELFGTFFKWRLTLRELKAKEKNNNAQIQMATVP  522

Query  330  A  328
            A
Sbjct  523  A  523



>ref|XP_011092774.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=519

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G   NRVTSG++SMTFISLYKAISIGG+FFLY
Sbjct  396  FSIGMGPITWVYSSEIFPLRLRAQGCSMGVAANRVTSGMISMTFISLYKAISIGGAFFLY  455

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  337
            A IAA+ WVFF+TL PETQGKTLEE E  FGTFF+WRS  R ++ KK  +N QLQ+ T
Sbjct  456  AGIAAIAWVFFYTLYPETQGKTLEEMETFFGTFFKWRSTMRALEEKKGESNGQLQLTT  513



>ref|XP_006361759.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=475

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPI WVY SE+FPLKLRATG S+G  +NRVTSGV+SMTF+SL KAI+I G+FF Y
Sbjct  352  FSIGAGPIAWVYGSEVFPLKLRATGFSVGVAVNRVTSGVISMTFLSLEKAITIQGAFFSY  411

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  337
            A IA + WVFFFTLMPETQGKTLEET ALFGTFF WRS  RE+  KK NNN ++QM T
Sbjct  412  AGIAGMAWVFFFTLMPETQGKTLEETVALFGTFFEWRSTARELKGKKMNNNDEIQMAT  469



>ref|XP_011088358.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=532

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISLY AISIGG FFLY
Sbjct  404  FSIGMGPITWVYSSEIFPLRLRAQGCSMGVAMNRVTSGVISMTFISLYNAISIGGVFFLY  463

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGTLQ  331
            A IAAV WVFF+T +PETQGKTLEE E LFGTF++WRS  R ++ KK   + Q+QM    
Sbjct  464  AGIAAVAWVFFYTFLPETQGKTLEEMETLFGTFYKWRSTLRALNEKKREGDRQVQMRNAT  523

Query  330  AANK  319
            +++K
Sbjct  524  SSSK  527



>ref|XP_009611551.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=539

 Score =   184 bits (468),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 103/129 (80%), Gaps = 8/129 (6%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRATGCS+G  +NRVTSGVVSMTF+SL KAI+IGG+FFLY
Sbjct  408  FSIGMGPITWVYSSEIFPLRLRATGCSIGVAVNRVTSGVVSMTFLSLEKAITIGGAFFLY  467

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVD--------AKKANNNS  355
            A +AAV +VFFFTLMPETQGKTLEE EALFGTF+ WR   RE+          K +N+N 
Sbjct  468  AGLAAVAFVFFFTLMPETQGKTLEEMEALFGTFWNWRKTARELKEAKITEKTEKNSNDNG  527

Query  354  QLQMGTLQA  328
            Q+QMG   A
Sbjct  528  QIQMGIAPA  536



>ref|XP_009800568.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=534

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 103/126 (82%), Gaps = 5/126 (4%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRATGCS+G  +NRVTSGVVSMTF+SL K+I+IGG+FFLY
Sbjct  406  FSIGMGPITWVYSSEIFPLRLRATGCSIGVAVNRVTSGVVSMTFLSLVKSITIGGAFFLY  465

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQRE-----VDAKKANNNSQLQ  346
              +AAV +VFFFTLMPETQGKTLEE EALFG+F+ WR   RE     +  K +N+N Q+Q
Sbjct  466  FGLAAVAFVFFFTLMPETQGKTLEEMEALFGSFWDWRKTARELKEAKITEKNSNDNGQIQ  525

Query  345  MGTLQA  328
            MGT  A
Sbjct  526  MGTAPA  531



>gb|EYU42629.1| hypothetical protein MIMGU_mgv1a0059092mg, partial [Erythranthe 
guttata]
Length=275

 Score =   175 bits (444),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GC++G  +NRVTSGV+SMTF+SL +AI+IGG+FFLY
Sbjct  153  FSIGMGPITWVYSSEIFPLRLRAQGCAMGVALNRVTSGVISMTFLSLNRAITIGGAFFLY  212

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQM  343
            A +AA+  VFF+TL PETQGKTLEE E+LFGTF +WRS  R ++ KK+  N Q+Q+
Sbjct  213  AGVAAIALVFFYTLYPETQGKTLEEMESLFGTFSKWRSTLRTLNEKKSEKNGQIQL  268



>gb|EPS69995.1| sugar transport protein [Genlisea aurea]
Length=530

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTF+SLYKAISIGG+FFLY
Sbjct  403  FSIGMGPITWVYSSEIFPLQLRAQGCSVGVAVNRVTSGVISMTFLSLYKAISIGGTFFLY  462

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQM  343
              +A V WVFF++L+PETQG+TLEE E+LFGTFF+WRS +R ++  K      +QM
Sbjct  463  GGVAMVAWVFFYSLLPETQGRTLEEMESLFGTFFKWRSTRRALEENKKFGGKHVQM  518



>ref|XP_009785575.1| PREDICTED: polyol transporter 5-like isoform X2 [Nicotiana sylvestris]
Length=336

 Score =   172 bits (436),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 96/122 (79%), Gaps = 2/122 (2%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL+LRA GCS+G  +NR  SG + MTFISLYKAISIGG+FFLY
Sbjct  214  FSIGMGPIAWVYSSEIFPLRLRAQGCSIGVAVNRAMSGAILMTFISLYKAISIGGAFFLY  273

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK--ANNNSQLQMGT  337
              IA + W+FF+ L+PETQG+TLEE E LFGTFF+WRS  +E+   K  ++ ++Q+QMG 
Sbjct  274  TGIAIIAWIFFYALLPETQGRTLEEMEELFGTFFKWRSTMKELKKNKVESDGSAQVQMGN  333

Query  336  LQ  331
             Q
Sbjct  334  SQ  335



>ref|NP_001281033.1| polyol transporter 5-like [Malus domestica]
 dbj|BAD42345.1| sorbitol transporter [Malus domestica]
Length=535

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 98/130 (75%), Gaps = 7/130 (5%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA GCSLG  +NRV SGV+SMTFISLY+AI+IGG+FFLY
Sbjct  406  FSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLSMTFISLYEAITIGGAFFLY  465

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK-------ANNNSQ  352
            AAIA+V WVFFFT++PET G+TLE+ E LFG F +WR     +  KK         NN Q
Sbjct  466  AAIASVAWVFFFTMLPETHGRTLEDMEVLFGKFHKWRKANALLKQKKNASHGDGITNNGQ  525

Query  351  LQMGTLQAAN  322
            +Q+GT    N
Sbjct  526  VQLGTRGQVN  535



>ref|XP_011088761.1| PREDICTED: putative polyol transporter 1 [Sesamum indicum]
Length=336

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            F+IG GP+TWVYSSEIFPL++RA GC L   +NRVTS V++MTFISLYKAI+IGG+FFLY
Sbjct  211  FAIGMGPLTWVYSSEIFPLRVRAQGCGLAVAVNRVTSAVLTMTFISLYKAITIGGAFFLY  270

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMG  340
            A  AA+ W+FF+TL PET+GKTLEE EALFGTFF+WRS  R ++ K  + + Q+Q G
Sbjct  271  AGFAALAWLFFYTLFPETRGKTLEEIEALFGTFFKWRSTMRALNQKSGDVSGQVQTG  327



>gb|KDP46229.1| hypothetical protein JCGZ_10069 [Jatropha curcas]
Length=514

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 97/122 (80%), Gaps = 4/122 (3%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+SMTFISLYK I+IGG+FFL+
Sbjct  384  FSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVISMTFISLYKGITIGGAFFLF  443

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK----ANNNSQLQM  343
            AAIA V W FFFT +PETQG+TLE+ E LFG F  WRS  +E + KK    + NN Q+Q+
Sbjct  444  AAIATVAWTFFFTCLPETQGRTLEDMEVLFGRFINWRSALKEENLKKKAANSENNGQIQL  503

Query  342  GT  337
            GT
Sbjct  504  GT  505



>ref|XP_009344431.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
 ref|XP_009344432.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=535

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 97/130 (75%), Gaps = 7/130 (5%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA GCS+G  +NRV SGV+SMTFISLYKAI+IGG+FFLY
Sbjct  406  FSIGMGPITWVYSSEIFPLKLRAQGCSMGVAMNRVVSGVLSMTFISLYKAITIGGAFFLY  465

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK-------ANNNSQ  352
            AAIA+V WVFFF ++PET G+TLE+ E LFG F +WR     +  KK         NN Q
Sbjct  466  AAIASVAWVFFFIMLPETHGRTLEDMEVLFGKFHKWRKANALLKQKKNVSHGDGNTNNGQ  525

Query  351  LQMGTLQAAN  322
            +Q+GT    N
Sbjct  526  VQLGTKGQVN  535



>emb|CDO97075.1| unnamed protein product [Coffea canephora]
Length=529

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 101/124 (81%), Gaps = 2/124 (2%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G   NRVTSGV+SMTF+SL KAI+ GG+FFL+
Sbjct  407  FSIGLGPITWVYSSEIFPLRLRAQGCSIGVAANRVTSGVISMTFLSLSKAITTGGAFFLF  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGTLQ  331
            A IA+V + FF+TL+PET+G+TLEE E LFGTFF+WR++ RE++ +K     QLQMGT  
Sbjct  467  AGIASVAFAFFYTLLPETRGRTLEEMEELFGTFFQWRTKMRELEKQK--TGQQLQMGTTA  524

Query  330  AANK  319
             A K
Sbjct  525  TAAK  528



>ref|XP_008387369.1| PREDICTED: putative polyol transporter 1 isoform X2 [Malus domestica]
Length=535

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 97/130 (75%), Gaps = 7/130 (5%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA GCS+G  +NRV SGV+SMTFISLY AI+IGG+FFLY
Sbjct  406  FSIGMGPITWVYSSEIFPLKLRAQGCSIGVAMNRVVSGVLSMTFISLYDAITIGGAFFLY  465

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK-------ANNNSQ  352
            AAIA+V WVFFFT++PET G+TLE+ E LFG F +WR     +  KK         NN Q
Sbjct  466  AAIASVAWVFFFTMLPETHGRTLEDMEVLFGKFHKWRKANALLKQKKNASHGDGNANNGQ  525

Query  351  LQMGTLQAAN  322
            +Q+GT    N
Sbjct  526  VQLGTRGQVN  535



>ref|XP_009375627.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=535

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 96/130 (74%), Gaps = 7/130 (5%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA GCSLG  +NRV SGV+SMTFISLY+AI+IGG+FFLY
Sbjct  406  FSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLSMTFISLYEAITIGGAFFLY  465

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK-------ANNNSQ  352
            AAIA V WVFFF ++PET G+TLE+ E LFG F +WR     +  KK         NN Q
Sbjct  466  AAIATVAWVFFFIMLPETHGRTLEDMEVLFGKFHKWRKANALLKQKKNLSHGDGNTNNGQ  525

Query  351  LQMGTLQAAN  322
            +Q+GT    N
Sbjct  526  VQLGTKGQVN  535



>gb|AGG19155.1| sorbitol transporter [Pyrus pyrifolia]
Length=535

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 96/130 (74%), Gaps = 7/130 (5%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA GCSLG  +NRV SGV+SMTFISLY+AI+IGG+FFLY
Sbjct  406  FSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLSMTFISLYEAITIGGAFFLY  465

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK-------ANNNSQ  352
            AAIA V WVFFF ++PET G+TLE+ E LFG F +WR     +  KK         NN Q
Sbjct  466  AAIATVAWVFFFIMLPETHGRTLEDMEVLFGKFHKWRKANALLKQKKNLSHGDGNTNNGQ  525

Query  351  LQMGTLQAAN  322
            +Q+GT    N
Sbjct  526  VQLGTKGQVN  535



>gb|AFI61955.1| polyol transporter [Camellia sinensis]
Length=532

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 98/123 (80%), Gaps = 5/123 (4%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL+LRA G S+GT +NR+ SG +SMTFISLY AISIGG+FFL+
Sbjct  406  FSIGMGPIAWVYSSEIFPLRLRAQGTSIGTAMNRLISGTISMTFISLYNAISIGGAFFLF  465

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKA-----NNNSQLQ  346
              +A V WVFF+TL+PETQG+TLEE + LFGTFF+WRS  RE++  K      N+N Q+Q
Sbjct  466  MGVAIVSWVFFYTLLPETQGRTLEEMQVLFGTFFKWRSTLREMEKNKKIRDNDNSNGQIQ  525

Query  345  MGT  337
            +GT
Sbjct  526  LGT  528



>gb|ABK29439.1| sugar transport protein [Coffea canephora]
Length=529

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 100/124 (81%), Gaps = 2/124 (2%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G   NRVTSGV+SMTF+SL KAI+ GG+FFL+
Sbjct  407  FSIGLGPITWVYSSEIFPLRLRAQGCSIGVAANRVTSGVISMTFLSLSKAITTGGAFFLF  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGTLQ  331
            A IA+V + FF+TL+PET+G+TLEE E LFGTFF+WR++ RE++ +K     QLQMGT  
Sbjct  467  AGIASVAFAFFYTLLPETRGRTLEEMEELFGTFFQWRTKMRELEKQK--TGQQLQMGTTA  524

Query  330  AANK  319
               K
Sbjct  525  TVAK  528



>ref|XP_010096202.1| Polyol transporter 5 [Morus notabilis]
 gb|EXB63597.1| Polyol transporter 5 [Morus notabilis]
Length=541

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 101/136 (74%), Gaps = 12/136 (9%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA G S+   +NRVTSGV+SM+FISLYK I+IGG+FFL+
Sbjct  406  FSIGLGPITWVYSSEIFPLKLRAQGASMAVAVNRVTSGVISMSFISLYKGITIGGAFFLF  465

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ---------REVDAKKANN-  361
            AA+A V WVFF+TL+PETQG+TLE+ E LFG FF+WRS           +EV+ +  NN 
Sbjct  466  AALAVVAWVFFYTLLPETQGRTLEDMEVLFGKFFKWRSANEILKNNSMGKEVNGQDNNNA  525

Query  360  --NSQLQMGTLQAANK  319
              N  +Q+GT +   K
Sbjct  526  KANGHIQLGTTKDQTK  541



>ref|XP_009785574.1| PREDICTED: polyol transporter 5-like isoform X1 [Nicotiana sylvestris]
Length=355

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL+LRA GCS+G  +NR  SG + MTFISLYKAISIGG+FFLY
Sbjct  214  FSIGMGPIAWVYSSEIFPLRLRAQGCSIGVAVNRAMSGAILMTFISLYKAISIGGAFFLY  273

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  358
              IA + W+FF+TL+PETQG+TLEE E LFGTFF+WRS  +E+   K  ++
Sbjct  274  TGIAIIAWIFFYTLLPETQGRTLEEMEELFGTFFKWRSTMKELKKNKVESD  324



>gb|ACB56939.1| mannitol transporter [Artemisia annua]
Length=522

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 95/118 (81%), Gaps = 8/118 (7%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR+ SGV+ MTFISLYKAI+IGG+FFL+
Sbjct  405  FSIGMGPITWVYSSEIFPLRLRAQGCSMGVAVNRIVSGVIGMTFISLYKAITIGGAFFLF  464

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVD--------AKKANN  361
              +A VG+VFF+TL PETQGK LEE E +FGTFFRWR+RQ E+D        +KKA N
Sbjct  465  TGVAIVGFVFFYTLYPETQGKNLEEVEEVFGTFFRWRTRQAELDRAKEAEMVSKKAQN  522



>ref|XP_004299107.1| PREDICTED: polyol transporter 5-like [Fragaria vesca subsp. vesca]
Length=535

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 98/125 (78%), Gaps = 7/125 (6%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA GCS+G  +NRV SG +SMTFISLY+AI+IGG+FFL+
Sbjct  407  FSIGMGPITWVYSSEIFPLKLRAQGCSIGVAVNRVVSGTLSMTFISLYEAITIGGAFFLF  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS-----RQREVDAKKAN--NNSQ  352
            A IAAVGWVFF+T++PETQG+TLE+ E LFG F +W+      R + VD    +  N  Q
Sbjct  467  AGIAAVGWVFFYTMLPETQGRTLEDMEVLFGKFHKWKKANALLRNKRVDPNSNDTANGGQ  526

Query  351  LQMGT  337
            +Q+GT
Sbjct  527  VQLGT  531



>ref|XP_011078884.1| PREDICTED: polyol transporter 5-like isoform X2 [Sesamum indicum]
Length=524

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL+LRA GCS+G   NR TSGVV MTFISLYKAI+IGG+FFL+
Sbjct  411  FSIGMGPIAWVYSSEIFPLRLRAQGCSMGVAANRFTSGVVLMTFISLYKAITIGGAFFLF  470

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  355
              +A + W+FF+TL+PETQG+ LEE EALFG+FFRWRS  RE+  KK   +S
Sbjct  471  TGVAVIAWIFFYTLLPETQGRNLEEIEALFGSFFRWRSTMRELKRKKLEQDS  522



>ref|XP_011078883.1| PREDICTED: polyol transporter 5-like isoform X1 [Sesamum indicum]
Length=526

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL+LRA GCS+G   NR TSGVV MTFISLYKAI+IGG+FFL+
Sbjct  413  FSIGMGPIAWVYSSEIFPLRLRAQGCSMGVAANRFTSGVVLMTFISLYKAITIGGAFFLF  472

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  355
              +A + W+FF+TL+PETQG+ LEE EALFG+FFRWRS  RE+  KK   +S
Sbjct  473  TGVAVIAWIFFYTLLPETQGRNLEEIEALFGSFFRWRSTMRELKRKKLEQDS  524



>ref|XP_009602627.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=531

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 96/122 (79%), Gaps = 2/122 (2%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL+LRA GCS+G  +NR  SG + MTFISLYKAISIGG+FFLY
Sbjct  409  FSIGMGPIAWVYSSEIFPLRLRAQGCSIGVAVNRAMSGAILMTFISLYKAISIGGAFFLY  468

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK--ANNNSQLQMGT  337
              IA + W+FF+TL+PETQG+TLEE E LFGTFF+WRS  +E+   K  ++ ++Q+QM  
Sbjct  469  TGIAVIAWIFFYTLLPETQGRTLEEMEELFGTFFKWRSTMKELKKNKVESDGSAQVQMEN  528

Query  336  LQ  331
             Q
Sbjct  529  SQ  530



>ref|XP_009345071.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   170 bits (431),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 97/121 (80%), Gaps = 8/121 (7%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISLYKAI+IGG+FFLY
Sbjct  409  FSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMTFISLYKAITIGGAFFLY  468

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANNNSQL  349
            A IAAVGWVFF+TL PETQG+TLE+ E LFG + +WR       + ++VD +  +N  Q+
Sbjct  469  AGIAAVGWVFFYTLYPETQGRTLEDMEVLFGKYHKWREANAMLKKTKQVDGE--DNKGQI  526

Query  348  Q  346
             
Sbjct  527  H  527



>ref|NP_001289249.1| polyol transporter 5-like [Pyrus x bretschneideri]
 ref|XP_009375824.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
 gb|AFM91103.1| sorbitol transporter [Pyrus x bretschneideri]
Length=526

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 96/117 (82%), Gaps = 1/117 (1%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISLYKAI+IGG+FFLY
Sbjct  409  FSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMTFISLYKAITIGGAFFLY  468

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV-DAKKANNNSQLQM  343
            A IAAVGWVFF+ L PETQG+TLE+ E LFG + +WR     +  AK+A+ + + Q+
Sbjct  469  AGIAAVGWVFFYMLYPETQGRTLEDMEVLFGKYHKWREANALLKKAKQADGDDKGQV  525



>ref|XP_002519083.1| sugar transporter, putative [Ricinus communis]
 gb|EEF43294.1| sugar transporter, putative [Ricinus communis]
Length=539

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 95/122 (78%), Gaps = 4/122 (3%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+S TFISLYK I+IGG+FFL+
Sbjct  407  FSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVISTTFISLYKGITIGGAFFLF  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKA----NNNSQLQM  343
            AAIA+V W FFFT +PETQG+TLE+ E LFG F +WRS  ++    KA      N Q+QM
Sbjct  467  AAIASVAWTFFFTCLPETQGRTLEDMEVLFGHFIKWRSAAKDEKLNKAEFHGETNGQIQM  526

Query  342  GT  337
            GT
Sbjct  527  GT  528



>ref|XP_002313809.1| putative sorbitol transporter family protein [Populus trichocarpa]
 gb|EEE87764.1| putative sorbitol transporter family protein [Populus trichocarpa]
Length=533

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 98/121 (81%), Gaps = 3/121 (2%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA G S+G  +NRVTSGV+S TFI LYKAI+IGGSFFL+
Sbjct  409  FSIGMGPITWVYSSEIFPLKLRAQGTSMGVAVNRVTSGVISTTFILLYKAITIGGSFFLF  468

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKAN---NNSQLQMG  340
            A +AAVGW+FF+  +PET+G+TLE+ E LFG+FF+WRS  ++   K+ +   N  Q+QMG
Sbjct  469  AGVAAVGWLFFYACLPETRGRTLEDMEVLFGSFFKWRSALKDEQRKEVSSGENGGQIQMG  528

Query  339  T  337
            T
Sbjct  529  T  529



>ref|NP_001280902.1| putative polyol transporter 1 [Malus domestica]
 dbj|BAD42343.1| sorbitol transporter [Malus domestica]
Length=526

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 96/120 (80%), Gaps = 7/120 (6%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA G S+G   NRVTSGVVSMTFISLYKAI+IGG+FFLY
Sbjct  407  FSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGVVSMTFISLYKAITIGGAFFLY  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANNNSQL  349
            A I+A  W+FF+T++PETQG+TLE+TE LFG + RWR        +++VD    NNN+Q+
Sbjct  467  AGISAAAWIFFYTMLPETQGRTLEDTEVLFGKYHRWRKANAMLKERKQVDGDD-NNNAQV  525



>ref|XP_009375628.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=537

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 98/130 (75%), Gaps = 7/130 (5%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA GCS+G  +NRV SGV+SMTFISLYKAI++GG+FFLY
Sbjct  408  FSIGLGPITWVYSSEIFPLKLRAQGCSMGVAMNRVVSGVLSMTFISLYKAITMGGAFFLY  467

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANNNS-Q  352
              IAAV WVFF+T+ PETQG+TLE+ E LFG F +WR        + +VD    NN +  
Sbjct  468  GGIAAVAWVFFYTMYPETQGRTLEDMEVLFGKFHKWREANAMLETKTQVDHGDGNNGTGA  527

Query  351  LQMGTLQAAN  322
            +++GT   AN
Sbjct  528  VELGTKGPAN  537



>gb|EYU37769.1| hypothetical protein MIMGU_mgv1a005015mg [Erythranthe guttata]
Length=500

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSE FPL+LRA GCS+G  +NR  S ++SMTFI+LYK I+IGG+F+LY
Sbjct  384  FSIGMGPIAWVYSSETFPLRLRAQGCSMGVALNRCISALISMTFITLYKGITIGGAFYLY  443

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  358
             AI+ V W+FFFTL+PETQGKTLEE E+LFGTFFRWR+  RE++ +K   N
Sbjct  444  GAISIVAWLFFFTLLPETQGKTLEEMESLFGTFFRWRTTLRELNERKREKN  494



>gb|AAZ80876.1| putative sorbitol transporter, partial [Nicotiana langsdorffii 
x Nicotiana sanderae]
Length=312

 Score =   164 bits (414),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 101/129 (78%), Gaps = 8/129 (6%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRATGCS+G  +NRVTSGVVSMTF++L K I+IGG+FFLY
Sbjct  181  FSIGMGPITWVYSSEIFPLRLRATGCSIGVAVNRVTSGVVSMTFLTLVKRITIGGAFFLY  240

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVD--------AKKANNNS  355
              +AA  +VFFFTLMPETQGKTLEE EALFGTF+ WR   RE+          K +N+N 
Sbjct  241  FGLAAAAFVFFFTLMPETQGKTLEEMEALFGTFWNWRKTARELKEAKITEKTEKNSNDNG  300

Query  354  QLQMGTLQA  328
            Q+QMGT  A
Sbjct  301  QIQMGTAPA  309



>ref|NP_001281038.1| polyol transporter 5-like [Malus domestica]
 gb|AAO88965.1| sorbitol transporter [Malus domestica]
Length=481

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 95/117 (81%), Gaps = 1/117 (1%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISLYKAI+IGG+FFLY
Sbjct  364  FSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMTFISLYKAITIGGAFFLY  423

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVD-AKKANNNSQLQM  343
            A IAAVGWVFF+ L PETQG+TLE+ E LFG + +WR     +  AK+ + + + Q+
Sbjct  424  AGIAAVGWVFFYMLYPETQGRTLEDMEVLFGKYHKWREANALLQKAKQVDGDDKGQV  480



>ref|XP_009344435.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=526

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 96/120 (80%), Gaps = 7/120 (6%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA G S+G   NRVTSG+VSMTFISLYKAI+IGG+FFLY
Sbjct  407  FSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGIVSMTFISLYKAITIGGAFFLY  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANNNSQL  349
            A I+A  W+FF+T++PETQG+TLE+ E LFG +FRWR        +++VD    NNN+Q+
Sbjct  467  AGISAAAWMFFYTMLPETQGRTLEDMEVLFGKYFRWRKANAMLKERKQVDGDD-NNNAQV  525



>ref|XP_009344433.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=537

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 98/130 (75%), Gaps = 7/130 (5%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA GCS+G  +NRV SG++SMTFISLYKAI++GG+FFLY
Sbjct  408  FSIGLGPITWVYSSEIFPLKLRAQGCSMGVAMNRVVSGILSMTFISLYKAITMGGAFFLY  467

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANNNS-Q  352
              IAAV WVFF+T+ PETQG+TLE+ E LFG F +WR        + +VD    NN +  
Sbjct  468  GGIAAVAWVFFYTMYPETQGRTLEDMEVLFGKFHKWREANAMLETKTQVDHGDGNNGTGA  527

Query  351  LQMGTLQAAN  322
            +++GT   AN
Sbjct  528  VELGTKGPAN  537



>ref|XP_011048787.1| PREDICTED: polyol transporter 5-like [Populus euphratica]
Length=532

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA G S+G  +NRVTSGV+S TFI LYKAI+IGGSFFL+
Sbjct  409  FSIGMGPITWVYSSEIFPLKLRAQGTSMGVAVNRVTSGVISTTFILLYKAITIGGSFFLF  468

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKAN--NNSQLQMGT  337
            A +AAVGW+FF+  +PET+G+TLE+ E LFG FF WRS  ++   K+ +  N  Q+QMGT
Sbjct  469  AGVAAVGWLFFYACLPETRGRTLEDMEVLFGHFFNWRSALKDEQRKEVSGENGGQIQMGT  528



>ref|XP_006365518.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=566

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 103/127 (81%), Gaps = 5/127 (4%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL LRATGCS+G  +NRVTSGVVSMTF+SL KAI+IG +FFLY
Sbjct  425  FSIGMGPITWVYSSEIFPLTLRATGCSIGVAVNRVTSGVVSMTFLSLQKAITIGAAFFLY  484

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVD-----AKKANNNSQLQ  346
            AA+AAV WVFF+TLMPETQGKTLEE E LFGTF+ WR R RE+       K +N+N Q+Q
Sbjct  485  AALAAVAWVFFYTLMPETQGKTLEEMETLFGTFWNWRERGRELKELKKTEKNSNDNGQIQ  544

Query  345  MGTLQAA  325
            MGT   A
Sbjct  545  MGTNNPA  551



>ref|XP_008361285.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=527

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 96/120 (80%), Gaps = 8/120 (7%)
 Frame = -1

Query  687  SIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLYA  508
            SIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISLYKAI+IGG+FFLYA
Sbjct  410  SIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMTFISLYKAITIGGAFFLYA  469

Query  507  AIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANNNSQLQ  346
             IAA+GWVFF+TL PETQG+TLE+ E LFG + +WR       + ++VD +  +N  Q+ 
Sbjct  470  GIAALGWVFFYTLYPETQGRTLEDMEVLFGKYHKWREANAMLKKTKQVDGE--DNKGQIH  527



>ref|XP_006349557.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=519

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GP+ WVYSSEIFPL+LRA GCS+G  +NR  SG + MTFISLYKAISIGG+FFLY
Sbjct  391  FSIGMGPLAWVYSSEIFPLRLRAQGCSIGVAVNRAVSGGILMTFISLYKAISIGGAFFLY  450

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQ  346
            A +A+V W+FF+TL+PET+G+TLEE E LFGTFF+WRS  +E+   +   +  L 
Sbjct  451  AGVASVAWIFFYTLLPETKGRTLEEMEPLFGTFFKWRSTMKELKKNRVEGDDMLS  505



>emb|CAR82417.1| polyol transporter [Plantago major]
Length=348

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FS+G GPI WVYSSEIFPLKLRA GC LG  +NR  SGV+ M+FISLYK I+IGGSFFL+
Sbjct  235  FSMGLGPIAWVYSSEIFPLKLRAQGCGLGVAMNRFMSGVILMSFISLYKEITIGGSFFLF  294

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  355
              I  +GW+FFFTL PET+G+TLEE E LFGTFF+WR+  +E+DAKK +   
Sbjct  295  GGITTLGWIFFFTLFPETRGRTLEEMEGLFGTFFKWRTTMKELDAKKRSGTD  346



>ref|XP_008246181.1| PREDICTED: polyol transporter 5-like, partial [Prunus mume]
Length=359

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA G SLG  +NRV SG++SMTF+SLYKAI+IGG+FFLY
Sbjct  239  FSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIISMTFLSLYKAITIGGAFFLY  298

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  355
            A I  + WVFF+T++PETQG+TLEE E LFG + +WR     + +KK ++  
Sbjct  299  AGIGVLAWVFFYTMLPETQGRTLEEMEVLFGKYHKWRQANAMLKSKKVDHGD  350



>ref|XP_011088360.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=522

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            F +G GPITWVYSSEIFPL+LRA GC+L    NRVTS +++MTFISLYKAI++ G+FFLY
Sbjct  399  FGMGMGPITWVYSSEIFPLRLRAQGCALAIASNRVTSALLTMTFISLYKAITLAGAFFLY  458

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMG  340
            A  AAV WVFF+TL PET+GKTLEE  +LFGTFF+WRS  R ++ KK + N  +Q G
Sbjct  459  AGFAAVAWVFFYTLYPETKGKTLEEMGSLFGTFFKWRSTVRALEEKKGDYNGHVQTG  515



>ref|XP_008387370.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=538

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA GCS+G  +NRV SGV+SMTFISLYKAI++GG+FFLY
Sbjct  409  FSIGLGPITWVYSSEIFPLKLRAQGCSMGVAMNRVVSGVLSMTFISLYKAITMGGAFFLY  468

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  337
              IAAV WVFF+T+ PETQG+TLE+ E LFG F +WR     ++ K   N+     GT
Sbjct  469  GGIAAVAWVFFYTMYPETQGRTLEDMEILFGKFHKWREANAMLETKTQVNHGDGNNGT  526



>ref|XP_009375838.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=528

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 95/117 (81%), Gaps = 6/117 (5%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISLYKAI+IGG+FFLY
Sbjct  407  FSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMTFISLYKAITIGGAFFLY  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANNN  358
            A IAA+ WVFF+TL PETQG++LE+ E LFG + +WR      ++ ++ D   A++N
Sbjct  467  AGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANAMLNKTKQADHGFADHN  523



>gb|AAO39267.1|AF482011_1 sorbitol transporter [Prunus cerasus]
Length=509

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPLKLRA GCS+GT +NR+ SGV+SM+FISLYKAI++GG+FFLY
Sbjct  399  FSIGMGPIAWVYSSEIFPLKLRAQGCSMGTAVNRIMSGVLSMSFISLYKAITMGGTFFLY  458

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKA  367
            A IA VGWVFF+T++PETQG+TLE+ E LFG F+RWR     +  K+A
Sbjct  459  AGIATVGWVFFYTMLPETQGRTLEDMEVLFGKFWRWREGYALLRNKRA  506



>emb|CDP10064.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   165 bits (417),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FS G GPI WVYSSEIFPLKLRA G S+   INRVTSG++ MTFISLYKAI+IGGSFF Y
Sbjct  406  FSSGMGPIAWVYSSEIFPLKLRAQGNSIAVAINRVTSGIILMTFISLYKAITIGGSFFFY  465

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQ  352
             AIA  G++FF TL+PET+G++LEETE LFGTFFRWRSR REV+++K  N   
Sbjct  466  GAIAFAGFLFFCTLLPETKGRSLEETEELFGTFFRWRSRAREVESRKWENEKN  518



>ref|XP_009336961.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=526

 Score =   165 bits (417),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 93/119 (78%), Gaps = 5/119 (4%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA G S+G   NRVTSGVVS TFISLYKAI+IGG+FFLY
Sbjct  407  FSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGVVSTTFISLYKAITIGGAFFLY  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS-----RQREVDAKKANNNSQL  349
            A I+A  W+FF+TL+PETQG+TLE+ E LFG F RWR      ++R+      NNN+Q+
Sbjct  467  AGISAAAWIFFYTLLPETQGRTLEDMEVLFGKFHRWRKANAMLKERKQVHGDDNNNAQV  525



>ref|XP_008368693.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=353

 Score =   162 bits (409),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 92/118 (78%), Gaps = 6/118 (5%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR TSGV+SMTFISLYKAI+IGG+FFLY
Sbjct  232  FSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRXTSGVISMTFISLYKAITIGGAFFLY  291

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANNNS  355
            A IAA+ WVFF+TL PETQG++LE+ E LFG + +WR      ++  + D    ++N 
Sbjct  292  AGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANAMLNKTNQADHGLGDDNK  349



>gb|EYU20732.1| hypothetical protein MIMGU_mgv1a026176mg [Erythranthe guttata]
Length=509

 Score =   164 bits (416),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEI+PL+LRA GCS+G   NR  SGVV MTFISLY+ I+IGG+FFL+
Sbjct  397  FSIGMGPIAWVYSSEIYPLRLRAQGCSMGVAANRFMSGVVLMTFISLYETITIGGAFFLF  456

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  355
              IA V W+FF+TL+PET+G+TLEE E LFGTFF WRS  +E++ KK  NN+
Sbjct  457  TGIAVVAWIFFYTLLPETKGRTLEEMEDLFGTFFNWRSTSKELNIKKEANNT  508



>ref|XP_007199793.1| hypothetical protein PRUPE_ppa004456mg [Prunus persica]
 gb|EMJ00992.1| hypothetical protein PRUPE_ppa004456mg [Prunus persica]
Length=509

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPLKLRA GCS+GT +NR+ SGV++MTFI+LYKAI++GG+FFLY
Sbjct  399  FSIGMGPIAWVYSSEIFPLKLRAQGCSMGTAVNRIMSGVLTMTFITLYKAITMGGTFFLY  458

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKA  367
             AIA VGWVFF+T++PETQG+TLE+ E LFG F+RWR     +  K+A
Sbjct  459  GAIATVGWVFFYTMLPETQGRTLEDMEVLFGKFWRWREGYALLRNKRA  506



>gb|AIU41385.1| sorbitol transporter 1 [Prunus salicina]
Length=509

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPLKLRA GCS+GT +NR+ SGV++MTFI+LYKAI++GG+FFLY
Sbjct  399  FSIGMGPIAWVYSSEIFPLKLRAQGCSMGTAVNRIMSGVLTMTFITLYKAITMGGTFFLY  458

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKA  367
             AIA VGWVFF+T++PETQG+TLE+ E LFG F+RWR     +  K+A
Sbjct  459  GAIATVGWVFFYTMLPETQGRTLEDMEVLFGKFWRWREGYALLRNKRA  506



>ref|XP_008236796.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=509

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPLKLRA GCS+GT +NR+ SGV++MTFI+LYKAI++GG+FFLY
Sbjct  399  FSIGMGPIAWVYSSEIFPLKLRAQGCSMGTAVNRIMSGVLTMTFITLYKAITMGGTFFLY  458

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKA  367
             AIA VGWVFF+T++PETQG+TLE+ E LFG F+RWR     +  K+A
Sbjct  459  GAIATVGWVFFYTMLPETQGRTLEDMEVLFGKFWRWREGYALLRNKRA  506



>ref|XP_008368694.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=485

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR+TSGV+SMTFISLYKAI+IGG+FFLY
Sbjct  364  FSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRLTSGVISMTFISLYKAITIGGAFFLY  423

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  358
            A IAA+ WVFF+TL PETQG++LE+ E LFG + +WR     ++  K  ++
Sbjct  424  AGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANAMLNKTKQADH  474



>ref|XP_008345143.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=527

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISLYKAI+IGG+FFLY
Sbjct  406  FSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMTFISLYKAITIGGAFFLY  465

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  358
            A IAA+ WVFF+TL PETQG++LE+ E LFG + +WR     ++  K  ++
Sbjct  466  AGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANALLNKTKQADH  516



>ref|XP_009345072.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=523

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 91/116 (78%), Gaps = 6/116 (5%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA G S+G   NRVTSG+VSMTFISLYKAI+IGG+FFLY
Sbjct  407  FSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGIVSMTFISLYKAITIGGAFFLY  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANN  361
            + I+A  WVFF+T++PETQG+TLE+ E LFG + RWR        +++VD    NN
Sbjct  467  SGISAAAWVFFYTMLPETQGRTLEDMEVLFGKYHRWRKANAMLKERKQVDGDDNNN  522



>ref|XP_009378956.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=530

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISLYKAI+IGG+FFLY
Sbjct  409  FSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMTFISLYKAITIGGAFFLY  468

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  358
            A IAA+ WVFF+TL PETQG++LE+ E LFG + +W+     ++  K  ++
Sbjct  469  AGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWKEANAMLNKTKQADH  519



>ref|XP_009375629.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
Length=491

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FS G GPI WVYSSEIFPL+LRA GC +G  +NRV SG++SMTFISLYKAI++GG+FFLY
Sbjct  365  FSTGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRVMSGILSMTFISLYKAITMGGAFFLY  424

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  370
            AAI AVGW+FFFT++PETQG+TLE+ E LFG F +WR   + ++ K+
Sbjct  425  AAIGAVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKANKLLEKKR  471



>emb|CAD58710.1| polyol transporter [Plantago major]
Length=530

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FS+G GPI WVYSSEIFPLKLRA GC LG  +NR  SGV+ M+FISLYK I+IGGSFFL+
Sbjct  417  FSMGLGPIAWVYSSEIFPLKLRAQGCGLGVAMNRFMSGVILMSFISLYKEITIGGSFFLF  476

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  370
              I  +GW+FFFTL PET+G+TLEE E LFGTFF+WR+  +E+DAKK
Sbjct  477  GGITTLGWIFFFTLFPETRGRTLEEMEGLFGTFFKWRTTMKELDAKK  523



>dbj|BAM66295.1| sorbitol transporter, partial [Pyrus pyrifolia]
Length=454

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA GCSLG  +NRV SGV+SMTFISLY+AI+IGG+FFLY
Sbjct  357  FSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLSMTFISLYEAITIGGAFFLY  416

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS  397
            AAIA V WVFFF ++PET G+TLE+ E LFG F RWR 
Sbjct  417  AAIATVAWVFFFIMLPETHGRTLEDMEVLFGKFHRWRK  454



>gb|AGG19156.1| sorbitol transporter [Pyrus pyrifolia]
Length=491

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FS G GPI WVYSSEIFPL+LRA GC +G  +NRV SG++SMTFISLYKAI++GG+FFLY
Sbjct  365  FSTGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRVMSGILSMTFISLYKAITMGGAFFLY  424

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  370
            AAI AVGW+FFFT++PETQG+TLE+ E LFG F +WR   + ++ K+
Sbjct  425  AAIGAVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKANKLLEKKR  471



>emb|CAD58709.1| polyol transporter [Plantago major]
 emb|CAR82415.1| polyol transporter [Plantago major]
Length=529

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FS+G GPI WVYSSEIFPLKLRA GCS+G  +NR  SGV+ M+FISLYKAI+IGG+FFL+
Sbjct  416  FSMGLGPIAWVYSSEIFPLKLRAQGCSMGVAMNRFMSGVILMSFISLYKAITIGGAFFLF  475

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  358
              I  V ++FF+TL PETQG+TLEE E LFGTFF WR+R +E+DAKK   +
Sbjct  476  GGITTVAFIFFYTLFPETQGRTLEEMEELFGTFFSWRTRMKELDAKKKTGS  526



>ref|XP_009344434.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
Length=491

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FS G GPI WVYSSEIFPL+LRA GC +G  +NRV SG++SMTFISLYKAI++GG+FFLY
Sbjct  365  FSTGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRVMSGILSMTFISLYKAITMGGAFFLY  424

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  370
            AAI AVGW+FFFT++PETQG+TLE+ E LFG F +WR   + ++ K+
Sbjct  425  AAIGAVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKANKLLEKKR  471



>ref|XP_007200667.1| hypothetical protein PRUPE_ppa015294mg [Prunus persica]
 gb|EMJ01866.1| hypothetical protein PRUPE_ppa015294mg [Prunus persica]
Length=538

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GP+TWVY+SEIFPLKLRA GCS+G  INRVTSG++SMTFISLYKAI+IGG+FFLY
Sbjct  407  FSIGLGPVTWVYTSEIFPLKLRAQGCSMGVAINRVTSGIISMTFISLYKAITIGGAFFLY  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQ  346
            A +  V W+FF+T++PETQG+TLEE E LFG + +W+     +  +K      + 
Sbjct  467  AGVGVVAWIFFYTMLPETQGRTLEEMEVLFGKYHKWKEANAMLKKRKQGKKRDVH  521



>ref|XP_009342010.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR+TSGV+SMTFISLYKA++IGG+FFLY
Sbjct  408  FSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRLTSGVISMTFISLYKAVTIGGAFFLY  467

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  358
            A IAA+ WVFF+TL PETQG++LE+ E LFG + +WR     ++  K  ++
Sbjct  468  AGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANAMLNKTKQADH  518



>ref|XP_009350912.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR+TSGV+SMTFISLYKA++IGG+FFLY
Sbjct  406  FSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRLTSGVISMTFISLYKAVTIGGAFFLY  465

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  358
            A IAA+ WVFF+TL PETQG++LE+ E LFG + +WR     ++  K  ++
Sbjct  466  AGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANAMLNKTKQADH  516



>ref|XP_009342008.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR+TSGV+SMTFISLYKA++IGG+FFLY
Sbjct  406  FSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRLTSGVISMTFISLYKAVTIGGAFFLY  465

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  358
            A IAA+ WVFF+TL PETQG++LE+ E LFG + +WR     ++  K  ++
Sbjct  466  AGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANAMLNKTKQADH  516



>ref|XP_008245305.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=511

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 93/119 (78%), Gaps = 8/119 (7%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA G S+G  +NR+TSGV+SMTF+SLYKAI+IGGSFFLY
Sbjct  393  FSIGLGPITWVYSSEIFPLKLRAQGASMGVAVNRITSGVISMTFLSLYKAITIGGSFFLY  452

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR--------SRQREVDAKKANNN  358
            A IAAV WVFF+ L+PET+G+TLE+ E LFG + RW+        S+Q + D  K+  N
Sbjct  453  AGIAAVSWVFFYMLLPETRGRTLEDIEVLFGKYHRWKKANAVLKQSKQGDGDENKSQVN  511



>ref|XP_008236773.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
 ref|XP_008236774.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
Length=528

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA G SLG  +NRV SG++SMTF+SLYKAI+IGG+FFLY
Sbjct  408  FSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIISMTFLSLYKAITIGGAFFLY  467

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  355
            A I  + WVFF+T++PETQG+TLEE E LFG + +WR     + +KK ++  
Sbjct  468  AGIGVLAWVFFYTMLPETQGRTLEEMEVLFGKYHKWRQANAMLKSKKVDHGD  519



>ref|XP_006487182.1| PREDICTED: polyol transporter 5-like [Citrus sinensis]
Length=535

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 98/129 (76%), Gaps = 7/129 (5%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEI PLKLRA G S+G  +NRVTSGVVSMTF+SL KAI+IGGSFFLY
Sbjct  408  FSIGMGPITWVYSSEILPLKLRAQGASIGVMVNRVTSGVVSMTFLSLSKAITIGGSFFLY  467

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRW-RSRQREVDAKKAN-----NNSQL  349
            A+IA+V WVFF+T +PETQGKTLEE  ALFG  FRW R  +RE    KAN     + S +
Sbjct  468  ASIASVAWVFFYTCLPETQGKTLEEMGALFGN-FRWLRDSKREKRRNKANEINGDSASNV  526

Query  348  QMGTLQAAN  322
            Q+G +   N
Sbjct  527  QLGPVSNGN  535



>ref|XP_007200254.1| hypothetical protein PRUPE_ppa015090mg [Prunus persica]
 ref|XP_007200263.1| hypothetical protein PRUPE_ppa014975mg [Prunus persica]
 gb|EMJ01453.1| hypothetical protein PRUPE_ppa015090mg [Prunus persica]
 gb|EMJ01462.1| hypothetical protein PRUPE_ppa014975mg [Prunus persica]
Length=527

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA G SLG  +NRV SG+VSMTF+SLYKAI+IGG+FFLY
Sbjct  407  FSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIVSMTFLSLYKAITIGGAFFLY  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  355
            A I  + WVFF+T++PETQG+TLEE E LFG + +WR     +  KK ++  
Sbjct  467  AGIGVLAWVFFYTMLPETQGRTLEEMEVLFGKYHKWRQANAMLKTKKVDHGD  518



>ref|XP_007200033.1| hypothetical protein PRUPE_ppa024323mg [Prunus persica]
 gb|EMJ01232.1| hypothetical protein PRUPE_ppa024323mg [Prunus persica]
Length=534

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA G SLG  +NRV SG+VSMTF+SLYKAI+IGG+FFLY
Sbjct  407  FSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIVSMTFLSLYKAITIGGAFFLY  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  355
            A I  + WVFF+T++PETQG+TLEE E LFG + +WR     +  KK ++  
Sbjct  467  AGIGVLAWVFFYTMLPETQGRTLEEMEVLFGKYHKWRQANAMLKTKKVDHGD  518



>ref|XP_007200117.1| hypothetical protein PRUPE_ppa018884mg [Prunus persica]
 gb|EMJ01316.1| hypothetical protein PRUPE_ppa018884mg [Prunus persica]
Length=527

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA G SLG  +NRV SG+VSMTF+SLYKAI+IGG+FFLY
Sbjct  407  FSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIVSMTFLSLYKAITIGGAFFLY  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  355
            A I  + WVFF+T++PETQG+TLEE E LFG + +WR     +  KK ++  
Sbjct  467  AGIGVLAWVFFYTMLPETQGRTLEEMEVLFGKYHKWRQANAMLKTKKVDHGD  518



>ref|XP_006423215.1| hypothetical protein CICLE_v10028170mg [Citrus clementina]
 gb|ESR36455.1| hypothetical protein CICLE_v10028170mg [Citrus clementina]
Length=535

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 97/129 (75%), Gaps = 7/129 (5%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEI PLKLRA G S+G  +NRVTSGVVSMTF+SL KAI+IGGSFFLY
Sbjct  408  FSIGMGPITWVYSSEILPLKLRAQGASIGVMVNRVTSGVVSMTFLSLSKAITIGGSFFLY  467

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRW-RSRQREVDAKKANN-----NSQL  349
            A+IA+V WVFF+T +PETQGKTLEE  ALFG  FRW R  +RE    KAN       S +
Sbjct  468  ASIASVAWVFFYTCLPETQGKTLEEMGALFGN-FRWLRDSKREKRRNKANEINGDGASNV  526

Query  348  QMGTLQAAN  322
            Q+G +   N
Sbjct  527  QLGPVSNGN  535



>dbj|BAM66296.1| sorbitol transporter, partial [Pyrus pyrifolia]
 dbj|BAM66297.1| sorbitol transporter, partial [Pyrus pyrifolia]
Length=454

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA GCSLG  +NRV SGV+SMTFISLY+AI+IGG+FFLY
Sbjct  357  FSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLSMTFISLYEAITIGGAFFLY  416

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR  400
            AAIA V WVFFF ++PET G+TLE+ E LFG + RWR
Sbjct  417  AAIATVAWVFFFIMLPETHGRTLEDMEVLFGKYHRWR  453



>ref|NP_001281036.1| polyol transporter 5-like [Malus domestica]
 dbj|BAD42344.1| sorbitol transporter [Malus domestica]
Length=491

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FS G GPI WVYSSEIFPL+LRA GC +G  +NRV SGV+SMTFISLYKAI++GG+FFLY
Sbjct  365  FSTGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRVMSGVLSMTFISLYKAITMGGAFFLY  424

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  370
            AAI AVGW+FFFT++PETQG+TLE+ E LFG F +WR   + ++ ++
Sbjct  425  AAIGAVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKANKLLEKER  471



>ref|XP_008236797.1| PREDICTED: putative polyol transporter 2 [Prunus mume]
Length=531

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GP+TWVY+SEIFPLKLRA GCSLG  INRVTSG++SMTFISLYKAI+IGG+FFLY
Sbjct  410  FSIGLGPVTWVYTSEIFPLKLRAQGCSLGVAINRVTSGIISMTFISLYKAITIGGAFFLY  469

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANN  361
            A +  VGW+FF+T++PET G+TLEE E LFG + +W+     +   K  +
Sbjct  470  AGVGVVGWIFFYTMLPETHGRTLEEMEVLFGKYHKWKEANAMLKNGKQGD  519



>ref|XP_008387373.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=526

 Score =   162 bits (410),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 94/120 (78%), Gaps = 7/120 (6%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA G S+G   NRVTSG+VSMTFISLYKAI+IGG+FFLY
Sbjct  407  FSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGIVSMTFISLYKAITIGGAFFLY  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANNNSQL  349
            A I+A  W+FF+T++PETQG+ LE+ E LFG + RWR        +++VD    N+N+Q+
Sbjct  467  AGISAAAWMFFYTMLPETQGRPLEDMEVLFGKYHRWRKADAMLKERKQVDGDD-NDNAQV  525



>ref|XP_009345073.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
Length=491

 Score =   161 bits (408),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL+LRA GC +G  +NR+ SG++SMTFI+LYKAI++GG+FFLY
Sbjct  365  FSIGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRLMSGILSMTFITLYKAITMGGTFFLY  424

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  370
            AAI  VGW+FFFT++PETQG+TLE+ E LFG F +WR   + ++ KK
Sbjct  425  AAIGIVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKANKLLEKKK  471



>gb|AAN07021.1| putative mannitol transporter [Orobanche ramosa]
Length=519

 Score =   162 bits (409),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FS+G GPI WVYSSEIFPLKLRA GC LG  INR T+GV+ M+FISLY AI+IGG+F+L+
Sbjct  406  FSMGMGPIAWVYSSEIFPLKLRAQGCGLGVAINRATNGVILMSFISLYNAITIGGAFYLF  465

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANN  361
            + I  V W+FFFTL+PET+G+TLE+ E LFGTFF+WR+  RE+  K+A +
Sbjct  466  SGIGIVTWIFFFTLLPETRGRTLEDMEVLFGTFFKWRTTMRELHKKEAED  515



>gb|AGY96955.1| polyol transporter 1 [Vitis vinifera]
Length=528

 Score =   162 bits (409),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 96/122 (79%), Gaps = 5/122 (4%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G G+NRVTSGV+SMTFISLYKAI+IGG+FFLY
Sbjct  406  FSIGMGPITWVYSSEIFPLRLRAQGCSIGVGVNRVTSGVLSMTFISLYKAITIGGAFFLY  465

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS----QLQM  343
            + +A VGW+FF+T +PETQG+TLE+ E LF T   W  ++   +    N+N     Q+Q+
Sbjct  466  SGVALVGWIFFYTWLPETQGRTLEDMEILF-TNSSWNKKKSSTNDTSGNSNDHINGQIQL  524

Query  342  GT  337
            GT
Sbjct  525  GT  526



>ref|XP_003631630.1| PREDICTED: polyol transporter 5 [Vitis vinifera]
 gb|ADP37154.1| putative polyol/monosaccharide transporter [Vitis vinifera]
Length=528

 Score =   162 bits (409),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 96/122 (79%), Gaps = 5/122 (4%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G G+NRVTSGV+SMTFISLYKAI+IGG+FFLY
Sbjct  406  FSIGMGPITWVYSSEIFPLRLRAQGCSIGVGVNRVTSGVLSMTFISLYKAITIGGAFFLY  465

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS----QLQM  343
            + +A VGW+FF+T +PETQG+TLE+ E LF T   W  ++   +    N+N     Q+Q+
Sbjct  466  SGVALVGWIFFYTWLPETQGRTLEDMEILF-TNSSWNKKKSSTNDTSGNSNDHINGQIQL  524

Query  342  GT  337
            GT
Sbjct  525  GT  526



>gb|AAO88964.1| sorbitol transporter [Malus domestica]
Length=491

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 94/124 (76%), Gaps = 2/124 (2%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FS G GPI WVYSSEIFPL+LRA GC +G  +NR+ SG++SMTFISLYKAI++GG+FFLY
Sbjct  365  FSSGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRLMSGILSMTFISLYKAITMGGTFFLY  424

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGTLQ  331
            AAI  VGW+FFFT++PETQG+TLE+ E LFG F +WR   + ++ KK   +  +  GT  
Sbjct  425  AAIGTVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKANKLLEKKKRVAHGDI--GTSD  482

Query  330  AANK  319
              N+
Sbjct  483  PDNR  486



>ref|XP_008387375.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=520

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 92/117 (79%), Gaps = 6/117 (5%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISLYKAI+IGG+FFLY
Sbjct  399  FSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMTFISLYKAITIGGAFFLY  458

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANNN  358
            A IAA+ WVFF+TL PETQG++LE+ E LFG + +W        + ++ D    ++N
Sbjct  459  AGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWXEANXMLKKTKQADHXFGDDN  515



>ref|XP_004300990.1| PREDICTED: polyol transporter 5-like [Fragaria vesca subsp. vesca]
Length=530

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 91/117 (78%), Gaps = 5/117 (4%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GP+TWVY+SEIFPLKLRA G S+G  +NRV SG++SMTFISLYKAI+IGG+FFLY
Sbjct  407  FSIGMGPVTWVYTSEIFPLKLRAQGFSIGVAVNRVASGILSMTFISLYKAITIGGAFFLY  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS-----RQREVDAKKANNNS  355
            A I  VGWVFF+T++PET+G+TLE+ E LFG F RW+      + + VD     NN+
Sbjct  467  AGIGVVGWVFFYTMLPETKGRTLEDIEVLFGKFHRWKETNAFLKNKRVDPNNNGNNT  523



>ref|XP_009342009.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR TSGV+SMTFISLYK I+IGG+FFLY
Sbjct  408  FSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRFTSGVISMTFISLYKTITIGGAFFLY  467

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  358
            A IAA+ WVFF+TL PETQG++LE+ E LFG + +WR     ++  K  ++
Sbjct  468  AGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANAMLNKSKQADH  518



>ref|XP_009350914.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR TSGV+SMTFISLYK I+IGG+FFLY
Sbjct  408  FSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRFTSGVISMTFISLYKTITIGGAFFLY  467

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  358
            A IAA+ WVFF+TL PETQG++LE+ E LFG + +WR     ++  K  ++
Sbjct  468  AGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANAMLNKSKQADH  518



>gb|AAT06053.2| sorbitol transporter [Malus domestica]
Length=533

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 94/124 (76%), Gaps = 2/124 (2%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FS G GPI WVYSSEIFPL+LRA GC +G  +NR+ SG++SMTFISLYKAI++GG+FFLY
Sbjct  407  FSSGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRLMSGILSMTFISLYKAITMGGTFFLY  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGTLQ  331
            AAI  VGW+FFFT++PETQG+TLE+ E LFG F +WR   + ++ KK   +  +  GT  
Sbjct  467  AAIGTVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKANKLLEKKKRVAHGDI--GTSD  524

Query  330  AANK  319
              N+
Sbjct  525  PDNR  528



>ref|XP_008466959.1| PREDICTED: polyol transporter 5-like, partial [Cucumis melo]
Length=276

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 90/116 (78%), Gaps = 1/116 (1%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA G S+G  +NRVTSGV+SM+F+SL KAI+ GG+FFL+
Sbjct  152  FSIGMGPITWVYSSEIFPLKLRAQGTSMGVAVNRVTSGVISMSFLSLSKAITTGGAFFLF  211

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQM  343
            AAIA V W FF+T +PETQGKTLEE E LFG  FRW+S       +K N +  +Q+
Sbjct  212  AAIAIVAWFFFYTALPETQGKTLEEMEMLFG-HFRWKSAAAPAATEKDNGSGGVQL  266



>ref|XP_008236860.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
Length=525

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA G S+G  +NR+TSGV+SMTF+SLYKAI+IGGSFFLY
Sbjct  407  FSIGLGPITWVYSSEIFPLKLRAQGVSMGVAVNRITSGVISMTFLSLYKAITIGGSFFLY  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQ  352
            A IAAV WVFF+ L+PET+G+TLE+ E LFG + +W+     +   K  +  +
Sbjct  467  AGIAAVSWVFFYMLLPETRGRTLEDIEVLFGKYHKWKKANALLKQSKQGDGEE  519



>gb|KHG20989.1| Polyol transporter 5 -like protein [Gossypium arboreum]
Length=539

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 92/124 (74%), Gaps = 7/124 (6%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+SMTFISLYKAISIGG+FFL+
Sbjct  411  FSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVISMTFISLYKAISIGGAFFLF  470

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK-------ANNNSQ  352
            A IA V  +FF+   PETQGKTLEE E LFG F  WR   +++  KK         +N Q
Sbjct  471  AGIATVATLFFYMFYPETQGKTLEEMEGLFGKFIGWREEAKKLKMKKTMEVNGDGTSNGQ  530

Query  351  LQMG  340
            +Q+G
Sbjct  531  IQLG  534



>ref|XP_006349565.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=518

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GP+ WVYSSEIFPL+LRA GCS+G  +NR  SG + MTFISLYKAISIGG+FFLY
Sbjct  405  FSIGMGPLAWVYSSEIFPLRLRAQGCSIGVAVNRAVSGGILMTFISLYKAISIGGAFFLY  464

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKAN  364
              IA V W+FF+TL+PET+G+TLEE E LFGTFF+WRS  +E+   +  
Sbjct  465  TGIAIVAWIFFYTLLPETKGRTLEEMEPLFGTFFKWRSTMKELKRSRVE  513



>ref|XP_010254895.1| PREDICTED: polyol transporter 5-like [Nelumbo nucifera]
Length=531

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 89/114 (78%), Gaps = 1/114 (1%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA G ++G  +NRVTSGV++MTFISLYKAI+IGG+FFLY
Sbjct  399  FSIGLGPITWVYSSEIFPLRLRAQGAAVGVAVNRVTSGVLAMTFISLYKAITIGGAFFLY  458

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQL  349
              +A V W FFFT +PETQG+ LEETE LFG  FRWRS   +    K  N SQL
Sbjct  459  GGVATVAWFFFFTFLPETQGRALEETEELFGN-FRWRSALTKKKMNKNQNQSQL  511



>gb|KJB32189.1| hypothetical protein B456_005G228500 [Gossypium raimondii]
Length=539

 Score =   160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 93/124 (75%), Gaps = 7/124 (6%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+SMTFISLY+AISIGG+FFL+
Sbjct  411  FSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVISMTFISLYEAISIGGAFFLF  470

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK-------ANNNSQ  352
            A +A V  +FF+   PETQGKTLEE E LFG FF WR   +++  KK         +N Q
Sbjct  471  AGVAMVATLFFYMFYPETQGKTLEEMEGLFGKFFGWREEAKKLKMKKTMEVSGDGTSNGQ  530

Query  351  LQMG  340
            +Q+G
Sbjct  531  IQLG  534



>ref|XP_004507415.1| PREDICTED: polyol transporter 5-like [Cicer arietinum]
Length=526

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 97/122 (80%), Gaps = 5/122 (4%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LRA G ++G  +NRVTSGV+SMTF+SL KAI+IGG+FFL+
Sbjct  402  FSIGAGPITWVYSSEIFPLRLRAQGAAMGVVVNRVTSGVISMTFLSLSKAITIGGAFFLF  461

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFR----WRSRQREVDAKKANNNSQLQM  343
             AIAA GWVFF+T++PETQGKTLEE E  FG F R    + S   E+D  K +  +Q+Q+
Sbjct  462  GAIAAAGWVFFYTMLPETQGKTLEEMEGSFGKFGRKSQSYDSTHNELDNGK-DQVAQVQL  520

Query  342  GT  337
            GT
Sbjct  521  GT  522



>ref|XP_011037561.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037562.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037564.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037565.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037566.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037567.1| PREDICTED: polyol transporter 5 [Populus euphratica]
Length=531

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 91/122 (75%), Gaps = 5/122 (4%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL+LRA G  +G  +NRVTSGV+S TFI LYKAISIGGSFFL+
Sbjct  409  FSIGMGPIAWVYSSEIFPLRLRAQGTGMGVAVNRVTSGVISTTFIMLYKAISIGGSFFLF  468

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS----RQREVDAKKANNNSQLQM  343
            A IA V WVFFF   PET+G+TLE+ E LFG F  WRS     Q+E +A    N+ Q+QM
Sbjct  469  AGIATVAWVFFFACFPETRGRTLEDMEVLFGNFISWRSALKDEQKEGEA-HGGNDGQIQM  527

Query  342  GT  337
            GT
Sbjct  528  GT  529



>ref|XP_007042744.1| Polyol/monosaccharide transporter 5 [Theobroma cacao]
 gb|EOX98575.1| Polyol/monosaccharide transporter 5 [Theobroma cacao]
Length=538

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 92/125 (74%), Gaps = 8/125 (6%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA G S+G   NRVTSGV+SM+FISLYKAISIGG+FFL+
Sbjct  409  FSIGMGPITWVYSSEIFPLRLRAQGASMGVAANRVTSGVISMSFISLYKAISIGGAFFLF  468

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS-------RQREVDAKKANNNSQ  352
            A +A V W FF+T +PETQGKTLEE E LFG    WR        R +EV+     +N Q
Sbjct  469  AGVATVAWFFFYTCLPETQGKTLEEMEGLFGKLMGWRKEAKKLKMRMKEVNG-DGTSNGQ  527

Query  351  LQMGT  337
            +Q+G 
Sbjct  528  IQLGN  532



>ref|XP_008393068.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=538

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 95/130 (73%), Gaps = 9/130 (7%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRV SGV+SMTFISLYKAI++GG+FF Y
Sbjct  408  FSIGLGPITWVYSSEIFPLRLRAQGCSIGVAMNRVVSGVLSMTFISLYKAITMGGAFFFY  467

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANNNSQL  349
            A IA V WVFF+T++PETQG+TLE+ E LFG F +W+        + +VD     NN   
Sbjct  468  AGIATVAWVFFYTMLPETQGRTLEDMEVLFGKFHKWKEVNALLETKTQVDHGGDGNN---  524

Query  348  QMGTLQAANK  319
            + G +Q   K
Sbjct  525  RSGMIQLETK  534



>ref|XP_009407915.1| PREDICTED: putative polyol transporter 1 [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   159 bits (402),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 99/124 (80%), Gaps = 10/124 (8%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LRA G S+G  +NRVTSGV++MTFISLYKAIS+GGSFFLY
Sbjct  402  FSIGAGPITWVYSSEIFPLRLRAVGASIGVAVNRVTSGVITMTFISLYKAISLGGSFFLY  461

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGTLQ  331
              IAAV WVFFFT +PET+G+TLE+ E LFG       +++EVD K+    ++++M  + 
Sbjct  462  GGIAAVAWVFFFTYLPETRGRTLEDMEELFG-------KEKEVD-KQTKEENRVEM--VN  511

Query  330  AANK  319
            A+N+
Sbjct  512  ASNR  515



>ref|XP_010065409.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
 gb|KCW62859.1| hypothetical protein EUGRSUZ_G00453 [Eucalyptus grandis]
Length=535

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GC++G  +NRVTSGV++M+FISLY+AISIGG+FFL+
Sbjct  411  FSIGMGPITWVYSSEIFPLRLRAQGCAIGVAMNRVTSGVLAMSFISLYEAISIGGAFFLF  470

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  370
             A+A   W+FF+ LMPETQG+TLEE    FG + +WRS  RE+D ++
Sbjct  471  MAVACAAWLFFYILMPETQGRTLEEMGQFFGNYTKWRSVAREIDIQR  517



>ref|XP_007199207.1| hypothetical protein PRUPE_ppa021762mg [Prunus persica]
 gb|EMJ00406.1| hypothetical protein PRUPE_ppa021762mg [Prunus persica]
Length=528

 Score =   159 bits (402),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 93/122 (76%), Gaps = 11/122 (9%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA G S+G  +NR+TSGV+SMTF+SLYKAI+IGGSFFLY
Sbjct  407  FSIGLGPITWVYSSEIFPLKLRAQGVSMGVAVNRITSGVISMTFLSLYKAITIGGSFFLY  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR-----------SRQREVDAKKAN  364
            A IAA+ WVFF+ L+PET+G+TLE+ E LFG + RW+           ++Q + D  K+ 
Sbjct  467  AGIAALSWVFFYMLLPETRGRTLEDIEVLFGKYHRWKKANAVLKQTKQTKQGDGDENKSQ  526

Query  363  NN  358
             N
Sbjct  527  VN  528



>gb|ACB86853.1| mannitol transporter [Citrus sinensis]
Length=535

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 97/129 (75%), Gaps = 7/129 (5%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPIT VYSSEI PLKLRA G S+G  +NRVTSGVVSMTF+SL KAI+IGGSFFLY
Sbjct  408  FSIGMGPITLVYSSEILPLKLRAQGASIGIMVNRVTSGVVSMTFLSLSKAITIGGSFFLY  467

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRW-RSRQREVDAKKAN-----NNSQL  349
            A+IA+V WVFF+T +PETQGKTLEE  ALFG  FRW R  +RE    KAN     + S +
Sbjct  468  ASIASVAWVFFYTCLPETQGKTLEEMGALFGN-FRWLRDSKREKRRNKANEINGDSASNV  526

Query  348  QMGTLQAAN  322
            Q+G +   N
Sbjct  527  QLGPVSNGN  535



>ref|XP_006423216.1| hypothetical protein CICLE_v10028174mg [Citrus clementina]
 gb|ESR36456.1| hypothetical protein CICLE_v10028174mg [Citrus clementina]
Length=535

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 97/129 (75%), Gaps = 7/129 (5%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPIT VYSSEI PLKLRA G S+G  +NRVTSGVVSMTF+SL KAI+IGGSFFLY
Sbjct  408  FSIGMGPITLVYSSEILPLKLRAQGASIGIMVNRVTSGVVSMTFLSLSKAITIGGSFFLY  467

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRW-RSRQREVDAKKAN-----NNSQL  349
            A+IA+V WVFF+T +PETQGKTLEE  ALFG  FRW R  +RE    KAN     + S +
Sbjct  468  ASIASVAWVFFYTCLPETQGKTLEEMGALFGN-FRWLRDSKREKRRNKANEINGDSASNV  526

Query  348  QMGTLQAAN  322
            Q+G +   N
Sbjct  527  QLGPVSNGN  535



>ref|XP_010065405.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
 gb|KCW62856.1| hypothetical protein EUGRSUZ_G00450 [Eucalyptus grandis]
Length=535

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GC++G  +NRVTSGV +M+FISLY AISIGG+FFL+
Sbjct  411  FSIGMGPITWVYSSEIFPLRLRAQGCAIGVAMNRVTSGVSAMSFISLYDAISIGGAFFLF  470

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  370
             A+A   W+FF+ LMPETQG+TLEE    FG + +WRS  RE+D ++
Sbjct  471  MAVACAAWLFFYILMPETQGRTLEEMGQFFGNYTKWRSVAREIDIQR  517



>gb|KEH30427.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=333

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 93/119 (78%), Gaps = 3/119 (3%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LRA G + G  +NRVTSGV+SMTF+SL K I+IGG+FFL+
Sbjct  213  FSIGAGPITWVYSSEIFPLRLRAQGAACGVVVNRVTSGVISMTFLSLSKGITIGGAFFLF  272

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN-SQLQMGT  337
              IA +GW+FF+ ++PETQGKTLEE EA FG    WR  +   +A+K N   +Q+Q+GT
Sbjct  273  GGIATIGWIFFYIMLPETQGKTLEEMEASFGKI--WRKSKNTKEAEKDNAQVAQVQLGT  329



>ref|XP_008387377.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=520

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GP+TWVYSSEI+PL+LRA GC++G  +NRV SGV+SMTFISLYKAI+IGG+FFLY
Sbjct  406  FSIGLGPVTWVYSSEIYPLQLRAQGCAMGVAMNRVMSGVISMTFISLYKAITIGGAFFLY  465

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQ  352
            A  +++ ++FF+T++PETQG+TLE+ E LFG + +WR     +  K+A   SQ
Sbjct  466  AGTSSIAFIFFYTMLPETQGRTLEDMELLFGKYHKWRQANAMLKKKEAAEKSQ  518



>ref|XP_008387376.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=520

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GP+TWVYSSEI+PL+LRA GC++G  +NRV SGV+SMTFISLYKAI+IGG+FFLY
Sbjct  406  FSIGLGPVTWVYSSEIYPLQLRAQGCAMGVAMNRVMSGVISMTFISLYKAITIGGAFFLY  465

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQ  352
            A  +++ ++FF+T++PETQG+TLE+ E LFG + +WR     +  K+A   SQ
Sbjct  466  AGTSSIAFIFFYTMLPETQGRTLEDMELLFGKYHKWRQANAMLKKKEAAEKSQ  518



>ref|XP_008245258.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=511

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 91/119 (76%), Gaps = 8/119 (7%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA G S+G  +NR+TSGV+SMTF+SLYKAI+IGG+FFLY
Sbjct  393  FSIGLGPITWVYSSEIFPLKLRAQGVSMGVAVNRITSGVISMTFLSLYKAITIGGAFFLY  452

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS-----RQREV---DAKKANNN  358
            A I A+ WVFF+ L+PET+G+TLEETE LFG + R        RQRE    D  K+  N
Sbjct  453  AGIGALSWVFFYMLLPETRGRTLEETEVLFGKYHRLEKANAVLRQREQGFGDENKSQVN  511



>ref|XP_009345075.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=538

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 91/121 (75%), Gaps = 7/121 (6%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRV SGV+SMTFISLYKAI++GG+FF Y
Sbjct  408  FSIGLGPITWVYSSEIFPLRLRAQGCSIGVAMNRVVSGVLSMTFISLYKAITMGGAFFFY  467

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAK-------KANNNSQ  352
              IA V W+FF+T++PETQG+TLE+ E LFG F +W+    +++ +         NN S 
Sbjct  468  GGIATVAWLFFYTMLPETQGRTLEDMEVLFGKFHKWKEANAQLETRAQVDHGGDGNNKSG  527

Query  351  L  349
            +
Sbjct  528  M  528



>gb|AAM44082.1| putative sorbitol transporter [Prunus cerasus]
Length=538

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 101/132 (77%), Gaps = 9/132 (7%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRV SGV+SMTFISLYKAI+IGG+FFL+
Sbjct  407  FSIGMGPITWVYSSEIFPLQLRAQGCSIGVAVNRVVSGVLSMTFISLYKAITIGGAFFLF  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS--------  355
            AAIAAVGW FFFT++PETQG+TLE+ E LFG F+RWR     +  KK  ++         
Sbjct  467  AAIAAVGWTFFFTMLPETQGRTLEDMEVLFGKFYRWRKANALLKQKKQVDHGDGNNNPNN  526

Query  354  -QLQMGTLQAAN  322
             Q+Q+GT   AN
Sbjct  527  PQIQLGTKGQAN  538



>gb|AAY88181.2| mannitol transporter 1 [Olea europaea]
Length=480

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 91/115 (79%), Gaps = 6/115 (5%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSE+FPL+LRA GCS+G  +NR TSG++SMTF+SLYKAISI G+F+L+
Sbjct  364  FSIGLGPIAWVYSSEVFPLRLRAQGCSIGVAVNRGTSGIISMTFLSLYKAISIAGAFYLF  423

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS-----RQREV-DAKKAN  364
            AAIA V W+F FTL+PETQG++LEE   LFGT+F WR      + RE  +AK AN
Sbjct  424  AAIAGVAWIFIFTLLPETQGRSLEEMGLLFGTYFGWRKTLKGLKNREAEEAKNAN  478



>ref|XP_008359575.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Malus 
domestica]
Length=527

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 92/122 (75%), Gaps = 7/122 (6%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIF L+LRA GCS+G  +NR+TSGV+SMTFISLYKAI+IGG+FFLY
Sbjct  406  FSIGLGPITWVYSSEIFSLQLRAQGCSMGEAVNRMTSGVISMTFISLYKAITIGGAFFLY  465

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKA-------NNNSQ  352
            A IAA+ WVFF+TL PET G++LE+ E LFG + +WR     ++  K        +N +Q
Sbjct  466  AGIAALSWVFFYTLYPETXGRSLEDMEVLFGKYHKWREANAMLNKTKQADQGFGDDNKAQ  525

Query  351  LQ  346
            + 
Sbjct  526  IH  527



>gb|KDP46230.1| hypothetical protein JCGZ_10070 [Jatropha curcas]
Length=542

 Score =   156 bits (395),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 93/122 (76%), Gaps = 4/122 (3%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSE+FPL+LRA G S+G  +  VTSGV+S TFISLYK I+IGG+FFL+
Sbjct  412  FSIGMGPITWVYSSEVFPLRLRAQGASMGVAVGGVTSGVISTTFISLYKGITIGGAFFLF  471

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK----ANNNSQLQM  343
            AAIA   W FFFT +PET+G+TLE+ E  FG+F  WRS  +E + KK    + N+ Q+Q+
Sbjct  472  AAIATGAWTFFFTCLPETRGRTLEDMEVRFGSFINWRSALKEENLKKKAASSENDDQIQL  531

Query  342  GT  337
            GT
Sbjct  532  GT  533



>ref|XP_008236795.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=538

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 99/132 (75%), Gaps = 9/132 (7%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRV SGV+SMTFISLYKAI+IGG+FFL+
Sbjct  407  FSIGMGPITWVYSSEIFPLQLRAQGCSIGVAVNRVVSGVLSMTFISLYKAITIGGAFFLF  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS--------  355
            AAIAAVGW FFFT++PETQG+TLE+ E LFG F+RWR     +  KK             
Sbjct  467  AAIAAVGWTFFFTMLPETQGRTLEDMEVLFGKFYRWRKANALLKQKKQGERGDGNNNPNN  526

Query  354  -QLQMGTLQAAN  322
             Q+Q+GT   AN
Sbjct  527  PQIQLGTKGVAN  538



>ref|XP_009375822.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=520

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEI+PL+LRA GC++G  +NR+ SGV+SMTFISLYKAI+IGG+FFLY
Sbjct  406  FSIGLGPITWVYSSEIYPLQLRAQGCAMGVAMNRLMSGVISMTFISLYKAITIGGAFFLY  465

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQ  352
            A  +++ ++FF+T++PETQG++LE+ E LFG + +WR     +  K+A   SQ
Sbjct  466  AGTSSIAFMFFYTMLPETQGRSLEDMELLFGKYHKWRQANAMLKKKEAAEKSQ  518



>ref|XP_002305419.2| hypothetical protein POPTR_0004s15960g [Populus trichocarpa]
 gb|EEE85930.2| hypothetical protein POPTR_0004s15960g [Populus trichocarpa]
Length=531

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 89/123 (72%), Gaps = 7/123 (6%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL+LRA G  +G  +NRVTSGV+S TFI LYKAISIGG+FFL+
Sbjct  409  FSIGMGPIPWVYSSEIFPLRLRAQGTGMGVAMNRVTSGVISTTFIMLYKAISIGGAFFLF  468

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK-----ANNNSQLQ  346
            A  A V WVFFF   PET+G+TLE+ E LFG F  WRS  +  D KK       N+ Q+Q
Sbjct  469  AGFATVAWVFFFACFPETRGRTLEDMEVLFGNFISWRSVLK--DGKKEEEVHGGNDGQIQ  526

Query  345  MGT  337
            MGT
Sbjct  527  MGT  529



>gb|KEH30425.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=472

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 93/119 (78%), Gaps = 3/119 (3%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LRA G + G  +NRVTSGV+SMTF+SL K I+IGG+FFL+
Sbjct  352  FSIGAGPITWVYSSEIFPLRLRAQGAACGVVVNRVTSGVISMTFLSLSKGITIGGAFFLF  411

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN-SQLQMGT  337
              IA +GW+FF+ ++PETQGKTLEE EA FG    WR  +   +A+K N   +Q+Q+GT
Sbjct  412  GGIATIGWIFFYIMLPETQGKTLEEMEASFGKI--WRKSKNTKEAEKDNAQVAQVQLGT  468



>gb|KEH30426.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=522

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 93/119 (78%), Gaps = 3/119 (3%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LRA G + G  +NRVTSGV+SMTF+SL K I+IGG+FFL+
Sbjct  402  FSIGAGPITWVYSSEIFPLRLRAQGAACGVVVNRVTSGVISMTFLSLSKGITIGGAFFLF  461

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN-SQLQMGT  337
              IA +GW+FF+ ++PETQGKTLEE EA FG    WR  +   +A+K N   +Q+Q+GT
Sbjct  462  GGIATIGWIFFYIMLPETQGKTLEEMEASFGKI--WRKSKNTKEAEKDNAQVAQVQLGT  518



>gb|AAL85876.2|AF480069_1 mannitol transporter [Apium graveolens Dulce Group]
 gb|ABH03025.1| mannitol transporter MaT2 [Apium graveolens]
Length=524

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 90/115 (78%), Gaps = 6/115 (5%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI W YSSE+FPL+LRA GCS+G  +NR TSG++SMTF+SLYKAISI G+F+L+
Sbjct  408  FSIGLGPIAWGYSSEVFPLRLRAQGCSIGVAVNRGTSGIISMTFLSLYKAISIAGAFYLF  467

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS-----RQREV-DAKKAN  364
            AAIA V W+F FTL+PETQG++LEE   LFGT+F WR      + RE  +AK AN
Sbjct  468  AAIAGVAWIFIFTLLPETQGRSLEEMGLLFGTYFGWRKTLKGLKNREAEEAKNAN  522



>ref|XP_010068107.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
Length=487

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL+LRA GC++G  INRV SGV+ MTF+SL KAI+IGG+FFLY
Sbjct  364  FSIGLGPIAWVYSSEIFPLRLRAQGCAIGVAINRVASGVLVMTFLSLSKAITIGGAFFLY  423

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  370
              I    WVFF+ LMPETQG+TLEE +  FG + +WRS  RE++ ++
Sbjct  424  TGIVCASWVFFYVLMPETQGRTLEEIDQFFGKYTKWRSTARELEMRR  470



>gb|KCW62858.1| hypothetical protein EUGRSUZ_G00452 [Eucalyptus grandis]
Length=529

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL+LRA GC++G  INRV SGV+ MTF+SL KAI+IGG+FFLY
Sbjct  400  FSIGLGPIAWVYSSEIFPLRLRAQGCAIGVAINRVASGVLVMTFLSLSKAITIGGAFFLY  459

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  370
              I    WVFF+ LMPETQG+TLEE +  FG + +WRS  RE++ ++
Sbjct  460  TGIVCASWVFFYVLMPETQGRTLEEIDQFFGKYTKWRSTARELEMRR  506



>gb|ACD68477.1| plasma membrane mannitol transporter [Arachis hypogaea]
Length=434

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 92/118 (78%), Gaps = 3/118 (3%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LRA G ++G  +NRVTSGV+SMTF+SL KAISIGG+FFL+
Sbjct  319  FSIGAGPITWVYSSEIFPLRLRAQGAAMGVVVNRVTSGVISMTFLSLSKAISIGGAFFLF  378

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  337
              IA VGW+FF+T++PET+GKTLE+ E  FG F    +  + VD     N  Q+Q+GT
Sbjct  379  GGIATVGWIFFYTMLPETRGKTLEDMEGSFGQFRANPAGTKGVD---NGNKGQVQLGT  433



>ref|XP_006487181.1| PREDICTED: polyol transporter 5-like [Citrus sinensis]
Length=539

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 97/133 (73%), Gaps = 11/133 (8%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLG----TGINRVTSGVVSMTFISLYKAISIGGS  523
            FSIG GPIT VYSSEI PLKLRA G S+G      +NRVTSGVVSMTF+SL KAI+IGGS
Sbjct  408  FSIGMGPITLVYSSEILPLKLRAQGASIGIMVGVMVNRVTSGVVSMTFLSLSKAITIGGS  467

Query  522  FFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRW-RSRQREVDAKKAN-----N  361
            FFLYA+IA+V WVFF+T +PETQGKTLEE  ALFG  FRW R  +RE    KAN     +
Sbjct  468  FFLYASIASVAWVFFYTCLPETQGKTLEEMGALFGN-FRWLRDSKREKRRNKANEINGDS  526

Query  360  NSQLQMGTLQAAN  322
             S +Q+G +   N
Sbjct  527  ASNVQLGPVSNGN  539



>ref|XP_008447049.1| PREDICTED: polyol transporter 5 [Cucumis melo]
Length=516

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPLKLRA G S+G  +NRVTSGV++MTF+SL KAI+IGG+FFLY
Sbjct  397  FSIGMGPIAWVYSSEIFPLKLRAQGASVGVIVNRVTSGVITMTFLSLTKAITIGGAFFLY  456

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  337
            A IAA+ W+FF+ + PETQGKTLE+ E LFG+     S+  ++D        QLQ+ T
Sbjct  457  AGIAAISWLFFYVVFPETQGKTLEDMEGLFGSLLWKFSKDGKIDKNDVGVTRQLQLHT  514



>ref|NP_001287655.1| polyol transporter 5-like [Solanum lycopersicum]
 dbj|BAO96229.1| polyol/monosaccharide transporter 4 [Solanum lycopersicum]
Length=541

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 102/126 (81%), Gaps = 5/126 (4%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRATGCS+G  +NRVTSGVVSMTF+SL KAI+IG +FFLY
Sbjct  399  FSIGMGPITWVYSSEIFPLRLRATGCSIGVAVNRVTSGVVSMTFLSLEKAITIGAAFFLY  458

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVD-----AKKANNNSQLQ  346
            AA+AAV  VFF+TLMPETQGKTLEE E LFGTF+ WR+R RE+       K +N+N  + 
Sbjct  459  AALAAVALVFFYTLMPETQGKTLEEMETLFGTFWNWRARARELKELKKTEKNSNDNGHIP  518

Query  345  MGTLQA  328
            MGT  A
Sbjct  519  MGTSNA  524



>gb|KJB12318.1| hypothetical protein B456_002G011700 [Gossypium raimondii]
Length=525

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 89/113 (79%), Gaps = 4/113 (4%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            F+IG GPI  +Y+SEIFPLKLRA G SLG  +NRVTSG++SMTF+SLY+AI+IGG+FFL+
Sbjct  406  FAIGMGPIAGIYTSEIFPLKLRAQGISLGVAVNRVTSGIISMTFLSLYQAITIGGAFFLF  465

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQ  352
            A IAAVGW+FF   +PET+GKTLEETE LFG    W    REVD K   +N++
Sbjct  466  AGIAAVGWLFFNICLPETRGKTLEETERLFGNLVGW----REVDKKMKEDNTK  514



>ref|XP_004148312.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
Length=492

 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPLKLRA G S+G  +NRVTSGV++MTF+SL KAI+IGG+FFLY
Sbjct  373  FSIGMGPIAWVYSSEIFPLKLRAQGASVGVIVNRVTSGVITMTFLSLTKAITIGGAFFLY  432

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  337
            A IAA+  VFF+ + PETQGKTLE+ E LFG      S+ R        + +QLQ+ T
Sbjct  433  AGIAAISLVFFYVVFPETQGKTLEDMEGLFGNLLWKFSKHRHFHKNDVGDVAQLQLHT  490



>gb|AAG43998.1|AF215837_1 mannitol transporter [Apium graveolens Dulce Group]
Length=513

 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FS G GPI WVYSSE+FPL+LRA GCS+G  +NR  SG++ MTFIS+YKA++IGG+F L+
Sbjct  396  FSSGMGPIAWVYSSEVFPLRLRAQGCSIGVAVNRGMSGIIGMTFISMYKAMTIGGAFLLF  455

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKA  367
            A +A++GWVF +T+ PETQG+ LEE E LFG++F WR   +++ AK+A
Sbjct  456  AVVASIGWVFMYTMFPETQGRNLEEIELLFGSYFGWRKTLKDLKAKEA  503



>ref|XP_003607077.1| Sorbitol-like transporter [Medicago truncatula]
 gb|AES89274.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=520

 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 88/115 (77%), Gaps = 2/115 (2%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG+GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+SMTF+SL  AI+IGG+FFL+
Sbjct  398  FSIGSGPITWVYSSEIFPLRLRAQGVSIGAVVNRVTSGVISMTFLSLSNAITIGGAFFLF  457

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQ  346
            A IA V W+F +T++PETQGKTLEE E  FG F  WR  +    A+ AN   QL 
Sbjct  458  AGIAIVAWIFHYTMLPETQGKTLEEIEGSFGNF--WRKPKASATAEGANGKIQLS  510



>gb|KHN14857.1| Polyol transporter 5, partial [Glycine soja]
Length=120

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 89/120 (74%), Gaps = 1/120 (1%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGP+TWVYSSEIFPL+LRA G + G  +NR TSG++SMTF+SL KAI+IGG+FFLY
Sbjct  1    FSIGAGPVTWVYSSEIFPLRLRAQGMAAGVDVNRTTSGIISMTFLSLSKAITIGGAFFLY  60

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGTLQ  331
              IA  GW+FF+T++PET+GKTLEE E  FG F+  +S   + +        QL++G + 
Sbjct  61   CGIATFGWIFFYTVLPETRGKTLEEIEGSFGKFWV-KSNTNKGEDNGNGQVPQLELGKIN  119



>ref|XP_004171995.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Cucumis 
sativus]
Length=516

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPLKLRA G S+G  +NRVTSGV++MTF+SL KAI+IGG+FFLY
Sbjct  397  FSIGMGPIAWVYSSEIFPLKLRAQGASVGVIVNRVTSGVITMTFLSLTKAITIGGAFFLY  456

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  337
            A IAA+  VFF+ + PETQGKTLE+ E LFG      S+ R        + +QLQ+ T
Sbjct  457  AGIAAISLVFFYVVFPETQGKTLEDMEGLFGNLLWKFSKHRHFHKNDVGDVAQLQLHT  514



>gb|KGN44323.1| Sugar transporter [Cucumis sativus]
Length=516

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPLKLRA G S+G  +NRVTSGV++MTF+SL KAI+IGG+FFLY
Sbjct  397  FSIGMGPIAWVYSSEIFPLKLRAQGASVGVIVNRVTSGVITMTFLSLTKAITIGGAFFLY  456

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  337
            A IAA+  VFF+ + PETQGKTLE+ E LFG      S+ R        + +QLQ+ T
Sbjct  457  AGIAAISLVFFYVVFPETQGKTLEDMEGLFGNLLWKFSKHRHFHKNDVGDVAQLQLHT  514



>ref|XP_003540961.2| PREDICTED: polyol transporter 5-like [Glycine max]
Length=531

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 92/118 (78%), Gaps = 5/118 (4%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG+GPITWVYSSEIFPL+LRA G ++G  +NRVTSGV++MTF+SL KAI+IGG+FFL+
Sbjct  410  FSIGSGPITWVYSSEIFPLRLRAQGVAIGAAVNRVTSGVIAMTFLSLQKAITIGGAFFLF  469

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  337
            A +AAV W+F +TL+PET+GKTLEE E  FG F R    +  +D     +N ++Q+ T
Sbjct  470  AGVAAVAWIFHYTLLPETRGKTLEEIEKSFGNFCRKPKAEEGLD-----DNVEIQLKT  522



>ref|XP_007135989.1| hypothetical protein PHAVU_009G008900g [Phaseolus vulgaris]
 gb|ESW07983.1| hypothetical protein PHAVU_009G008900g [Phaseolus vulgaris]
Length=514

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 90/116 (78%), Gaps = 3/116 (3%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FS+GAGPITWVYSSEIFPL+LRA G ++G  +NRVTSGV+SMTF+SL   I+IGG+FF++
Sbjct  400  FSVGAGPITWVYSSEIFPLRLRAQGAAMGVVVNRVTSGVISMTFLSLSNKITIGGAFFIF  459

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQM  343
              IA  GW+FFFT++PETQGKTLEETE  FG F  W   +     K  +N++++++
Sbjct  460  GGIAMCGWIFFFTMLPETQGKTLEETEECFGKFGSWSHSKGN---KDTHNSAEIEL  512



>ref|XP_004148857.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
 gb|KGN61777.1| hypothetical protein Csa_2G245410 [Cucumis sativus]
Length=533

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 88/116 (76%), Gaps = 1/116 (1%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA G S+G  +NRVTSGV+SM+F+SL KAI+ GG+FFL+
Sbjct  410  FSIGMGPITWVYSSEIFPLKLRAQGTSMGVAVNRVTSGVISMSFLSLSKAITTGGAFFLF  469

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQM  343
            AAIA V W FF+T +PETQGKTLEE E LFG   R +S       +K N +  +Q+
Sbjct  470  AAIAIVAWFFFYTALPETQGKTLEEMETLFG-HIRCKSAAASAGTEKDNGSGGVQL  524



>gb|KHN25361.1| Polyol transporter 5 [Glycine soja]
Length=521

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 92/120 (77%), Gaps = 5/120 (4%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LRA G + G  +NR TSGVVSMTF+SL +AI+IGG+FFLY
Sbjct  401  FSIGAGPITWVYSSEIFPLRLRAQGAAAGVVVNRTTSGVVSMTFLSLSEAITIGGAFFLY  460

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN--SQLQMGT  337
              IA +GW+FF+TL+PET+GKTLE+ E  FGTF   RS+       +  N   +Q+Q+GT
Sbjct  461  CGIATLGWIFFYTLLPETRGKTLEDMEGSFGTF---RSKSNATKGVENGNGQVAQVQLGT  517



>ref|XP_003541068.1| PREDICTED: polyol transporter 5-like [Glycine max]
Length=523

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 92/120 (77%), Gaps = 5/120 (4%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LRA G + G  +NR TSGVVSMTF+SL +AI+IGG+FFLY
Sbjct  403  FSIGAGPITWVYSSEIFPLRLRAQGAAAGVVVNRTTSGVVSMTFLSLSEAITIGGAFFLY  462

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN--SQLQMGT  337
              IA +GW+FF+TL+PET+GKTLE+ E  FGTF   RS+       +  N   +Q+Q+GT
Sbjct  463  CGIATLGWIFFYTLLPETRGKTLEDMEGSFGTF---RSKSNATKGVENGNGQVAQVQLGT  519



>ref|XP_007042751.1| Polyol/monosaccharide transporter 5, putative [Theobroma cacao]
 gb|EOX98582.1| Polyol/monosaccharide transporter 5, putative [Theobroma cacao]
Length=532

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 89/119 (75%), Gaps = 1/119 (1%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI  VY+SEIFPL+LRA G S+   +NRVTSGV +MTFISLY AI+IGG+FFL+
Sbjct  408  FSIGMGPIAGVYTSEIFPLRLRAQGVSMAVAVNRVTSGVTAMTFISLYNAITIGGAFFLF  467

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS-QLQMGT  337
            A IAA+GWVFF+T +PET+GKTLEE E LFG    WR   +++ +      S Q+Q+G 
Sbjct  468  AGIAAMGWVFFYTCVPETRGKTLEEMEGLFGKLVGWREEAKKMKSTVMEEESRQVQLGN  526



>gb|KJB12317.1| hypothetical protein B456_002G011600 [Gossypium raimondii]
Length=486

 Score =   147 bits (372),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            F+IG GPIT VY SEIFPL+LRA G S+G  +NRV SG++SMTFISLYKAI+IGG+FFL+
Sbjct  377  FAIGMGPITNVYMSEIFPLRLRAQGVSMGVAVNRVVSGIISMTFISLYKAITIGGAFFLF  436

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVD  379
            A IA VGWVFF+  MPET+GKTLEE E LFG    W+   ++++
Sbjct  437  AGIATVGWVFFYVCMPETRGKTLEEMECLFGKLVGWKEASKKMN  480



>ref|XP_004170410.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Cucumis 
sativus]
Length=533

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 87/116 (75%), Gaps = 1/116 (1%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSE FPLKLRA G S+G  +NRVTSGV+SM+F+SL KAI+ GG+FFL+
Sbjct  410  FSIGMGPITWVYSSEXFPLKLRAQGTSMGVAVNRVTSGVISMSFLSLSKAITTGGAFFLF  469

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQM  343
            AAIA V W FF+T +PETQGKTLEE E LFG   R +S       +K N +  +Q+
Sbjct  470  AAIAIVAWXFFYTALPETQGKTLEEMETLFG-HIRCKSAAASAGTEKDNGSGGVQL  524



>gb|KHN25431.1| Polyol transporter 5 [Glycine soja]
Length=518

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 91/118 (77%), Gaps = 5/118 (4%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG+GPITWVYSSEIFPL+LRA G ++G  +NRVTSGV++MTF+SL  AI+IGG+FFL+
Sbjct  397  FSIGSGPITWVYSSEIFPLRLRAQGVAIGAAVNRVTSGVIAMTFLSLQNAITIGGAFFLF  456

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  337
            A +AAV W+F +TL+PET+GKTLEE E  FG F R    +  +D     +N ++Q+ T
Sbjct  457  AGVAAVAWIFHYTLLPETRGKTLEEIEKSFGNFCRKPKAEEGLD-----DNVEIQLKT  509



>ref|XP_007131852.1| hypothetical protein PHAVU_011G046800g [Phaseolus vulgaris]
 gb|ESW03846.1| hypothetical protein PHAVU_011G046800g [Phaseolus vulgaris]
Length=519

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 94/120 (78%), Gaps = 1/120 (1%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGP+TWVYSSEIFPL+LRA G ++G  +NR TSGV+S+TF+SL KAI+IGG+FFLY
Sbjct  398  FSIGAGPVTWVYSSEIFPLRLRAQGMAVGVVVNRTTSGVLSITFLSLSKAITIGGAFFLY  457

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGTLQ  331
            +AIAA GW+F +T++PET+GKTLEE +  FG F+   +  + V+ + A    QLQ GT+ 
Sbjct  458  SAIAAFGWLFIYTVLPETRGKTLEEMDTSFGKFWVKSTTTKPVNNRHA-QVPQLQQGTIH  516



>ref|XP_009395604.1| PREDICTED: putative polyol transporter 1 [Musa acuminata subsp. 
malaccensis]
Length=561

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 86/114 (75%), Gaps = 9/114 (8%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GP+TWVY SEI PL+LRA G S+G  +NRVTSGV++MTFISLYKAI+IGGSFFLY
Sbjct  447  FSIGLGPVTWVYCSEILPLRLRAQGASIGVAVNRVTSGVITMTFISLYKAITIGGSFFLY  506

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQL  349
              IA   WVFFFT +PET+G+TLE+ E LFGT         + DA++A N  Q+
Sbjct  507  GGIALAAWVFFFTYLPETRGRTLEDMEELFGT---------KKDAEEAPNGVQM  551



>ref|XP_010909852.1| PREDICTED: putative polyol transporter 1 [Elaeis guineensis]
Length=520

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV++MTFISLYKAI+IGGSFFLY
Sbjct  408  FSIGLGPITWVYSSEIFPLRLRAQGASVGVVVNRVTSGVITMTFISLYKAITIGGSFFLY  467

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
            A +AAV WVFFFT + ET+GKTLEE E LFG
Sbjct  468  AGVAAVAWVFFFTYLKETRGKTLEEMENLFG  498



>ref|XP_007131851.1| hypothetical protein PHAVU_011G046700g [Phaseolus vulgaris]
 gb|ESW03845.1| hypothetical protein PHAVU_011G046700g [Phaseolus vulgaris]
Length=518

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 89/118 (75%), Gaps = 3/118 (3%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LRA G + G  +NR TSGV+SMTF+SL KAI+IGG+FFLY
Sbjct  400  FSIGAGPITWVYSSEIFPLRLRAQGAAAGVVVNRTTSGVISMTFLSLTKAITIGGAFFLY  459

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  337
              IA VGW+FFF ++PET+GKTLE+ E  FGTF   R++       +     Q+Q+GT
Sbjct  460  CGIAVVGWLFFFIVLPETRGKTLEDMEGSFGTF---RAKSNNGVENENAKVPQVQLGT  514



>gb|KJB12316.1| hypothetical protein B456_002G011500 [Gossypium raimondii]
Length=533

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 94/125 (75%), Gaps = 6/125 (5%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYS+EIFPL+LRA G SLG  +NRV SGV+SM+FISLYKAI+IGG+FFLY
Sbjct  409  FSIGMGPITWVYSTEIFPLRLRAQGASLGVAVNRVMSGVISMSFISLYKAITIGGAFFLY  468

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK--AN----NNSQL  349
            A +A V + FFFT +PET+GKTLEE E LFG    WR   +++  K+  AN     N Q+
Sbjct  469  AGVALVAFFFFFTFLPETRGKTLEEMEGLFGKLVGWREEAKKMKRKRNEANGDGIGNDQI  528

Query  348  QMGTL  334
            Q+G +
Sbjct  529  QLGKI  533



>ref|XP_002467638.1| hypothetical protein SORBIDRAFT_01g031360 [Sorghum bicolor]
 gb|EER94636.1| hypothetical protein SORBIDRAFT_01g031360 [Sorghum bicolor]
Length=535

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL LRA GC+LG G+NRVTSGV+SMTF+SL K I+IGGSFFLY
Sbjct  408  FSIGLGPITWVYSSEIFPLHLRALGCALGVGVNRVTSGVISMTFLSLSKGITIGGSFFLY  467

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  337
            A +A + WVFFFT +PET+G+TLE+   LFG         ++   K+    S ++M +
Sbjct  468  AGVATLAWVFFFTYLPETRGRTLEQMGDLFGIPNMAGDSDQQSPEKEKTTLSNVEMSS  525



>ref|NP_001049270.1| Os03g0197200 [Oryza sativa Japonica Group]
 dbj|BAF11184.1| Os03g0197200, partial [Oryza sativa Japonica Group]
Length=295

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL+LRA GC+LGT +NRV SG VSM+FISLYKAI+  GSF+LY
Sbjct  177  FSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRVVSGAVSMSFISLYKAITFAGSFYLY  236

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
            A IAA GWVF F  +PETQG++LE+T  LFG
Sbjct  237  AGIAAAGWVFMFFFLPETQGRSLEDTVKLFG  267



>gb|KJB12315.1| hypothetical protein B456_002G011400 [Gossypium raimondii]
Length=536

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 92/120 (77%), Gaps = 2/120 (2%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYS+EIFPL+LRA G S+G  +NRVTSGV+SM+FISLY+AI+IGG+FFLY
Sbjct  409  FSIGMGPIAWVYSTEIFPLRLRAQGASIGVAVNRVTSGVISMSFISLYEAITIGGAFFLY  468

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANN--NSQLQMGT  337
            A +A V + FFFT +PETQGKTLEE E LFG    WR   +++  K+  N  N Q+Q+G 
Sbjct  469  AGVALVAFFFFFTFLPETQGKTLEEMEWLFGKLVGWREEAQKLKRKRKMNEANHQIQLGN  528



>ref|XP_004985337.1| PREDICTED: polyol transporter 5-like isoform X1 [Setaria italica]
Length=517

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL+LRA GC+LGT +NR+ SG ++M+FISLYKAI+  GSF++Y
Sbjct  405  FSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRIMSGAITMSFISLYKAITFAGSFYVY  464

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  370
            A IAA GWVF F  +PET+G++LE+TE LFG       R+ E DA+K
Sbjct  465  AGIAAAGWVFMFFFLPETRGRSLEDTEKLFGGGDGQDGREDERDAQK  511



>ref|XP_004985338.1| PREDICTED: polyol transporter 5-like isoform X2 [Setaria italica]
Length=504

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL+LRA GC+LGT +NR+ SG ++M+FISLYKAI+  GSF++Y
Sbjct  392  FSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRIMSGAITMSFISLYKAITFAGSFYVY  451

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  358
            A IAA GWVF F  +PET+G++LE+TE LFG       R+ E DA+K +  
Sbjct  452  AGIAAAGWVFMFFFLPETRGRSLEDTEKLFGGGDGQDGREDERDAQKKSTE  502



>ref|XP_003603886.1| Mannitol transporter [Medicago truncatula]
 gb|AES74137.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=514

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LRA G S G  +NRVTSG++SMTF+SL   ISIGG+FFL+
Sbjct  402  FSIGAGPITWVYSSEIFPLRLRAQGASAGVVVNRVTSGIISMTFLSLSDKISIGGAFFLF  461

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTF  412
              IAA GW+FF+TL+PETQGKTLEE E  FG F
Sbjct  462  GGIAACGWIFFYTLLPETQGKTLEEMEGTFGKF  494



>ref|XP_004500821.1| PREDICTED: polyol transporter 5-like [Cicer arietinum]
Length=517

 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 85/112 (76%), Gaps = 1/112 (1%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LRA G S G  +NRVTSG++SMTF+SL   ISIGG+FFL+
Sbjct  406  FSIGAGPITWVYSSEIFPLRLRAQGASAGVVVNRVTSGIISMTFLSLSDKISIGGAFFLF  465

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTF-FRWRSRQREVDAKKANNN  358
              IAA GW+FF+ L+PETQGKTLEE E  FG F  +  ++    + +  NNN
Sbjct  466  GGIAACGWIFFYALLPETQGKTLEEMEGSFGKFGVKLSTKNDNGEIQFTNNN  517



>ref|XP_009396401.1| PREDICTED: polyol transporter 5-like [Musa acuminata subsp. malaccensis]
Length=513

 Score =   145 bits (366),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEI PL+LRA G S+   +NRVTSGV++MTFISLYKAI+IGGSFFLY
Sbjct  399  FSIGLGPITWVYSSEILPLRLRAQGASIAVAVNRVTSGVITMTFISLYKAITIGGSFFLY  458

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQ  352
              IAA+ WVFFF  +PET+G+TLE+ E LFGT    +     V+   A+  ++
Sbjct  459  GGIAALAWVFFFACLPETRGRTLEDMEDLFGTRNDTKETTNGVEMANASQGNE  511



>gb|EAY77363.1| hypothetical protein OsI_05348 [Oryza sativa Indica Group]
Length=461

 Score =   144 bits (364),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL LRA GC+LG G+NRVTSGV+SMTF+SL KAI+IGGSFFLY
Sbjct  324  FSIGLGPITWVYSSEIFPLHLRALGCALGVGLNRVTSGVISMTFLSLSKAITIGGSFFLY  383

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
            A IA++ W+FFFT +PET+G+TLE+   LFG
Sbjct  384  AGIASLAWLFFFTYLPETRGRTLEQMGELFG  414



>ref|XP_003562817.1| PREDICTED: polyol transporter 5-like [Brachypodium distachyon]
Length=513

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 88/117 (75%), Gaps = 2/117 (2%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL +RA GCSLG   NR+TSGV+SMTFISL KAI+IGG+FFL+
Sbjct  396  FSIGLGPITWVYSSEIFPLHVRALGCSLGVAANRLTSGVISMTFISLSKAITIGGAFFLF  455

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMG  340
            A IA++ WVFFFT +PET+G+TLE+  ALFG       +Q+  +        +++MG
Sbjct  456  AGIASLAWVFFFTYLPETRGRTLEDMSALFGN--TATHKQQGSNGADDGKEKKVEMG  510



>ref|XP_004983902.1| PREDICTED: polyol transporter 5-like isoform X2 [Setaria italica]
Length=523

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 87/115 (76%), Gaps = 1/115 (1%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL LRA GC+LG G+NRVTSGV+SMTF+SL K I+IGGSFFLY
Sbjct  397  FSIGLGPIAWVYSSEIFPLHLRALGCALGVGLNRVTSGVISMTFLSLSKGITIGGSFFLY  456

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFG-TFFRWRSRQREVDAKKANNNSQL  349
            A IA++ WVFFFT + ET+G+TLE+   LFG       S Q++   +K  NN ++
Sbjct  457  AGIASLAWVFFFTYLKETRGRTLEQMGELFGIPNMAGDSYQQQQSPEKERNNVEM  511



>ref|XP_008795608.1| PREDICTED: putative polyol transporter 1 [Phoenix dactylifera]
Length=522

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA G S G  +NRVTSGV++MTFISLYKAI+IGGSFFLY
Sbjct  408  FSIGLGPITWVYSSEIFPLRLRAQGASAGVVVNRVTSGVITMTFISLYKAITIGGSFFLY  467

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGT  415
            A +AA  WVFFFT + ET+GKTLEE E LFG 
Sbjct  468  AGVAAAAWVFFFTYLKETRGKTLEEMENLFGN  499



>ref|XP_004983901.1| PREDICTED: polyol transporter 5-like isoform X1 [Setaria italica]
Length=535

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 87/115 (76%), Gaps = 1/115 (1%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL LRA GC+LG G+NRVTSGV+SMTF+SL K I+IGGSFFLY
Sbjct  409  FSIGLGPIAWVYSSEIFPLHLRALGCALGVGLNRVTSGVISMTFLSLSKGITIGGSFFLY  468

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGT-FFRWRSRQREVDAKKANNNSQL  349
            A IA++ WVFFFT + ET+G+TLE+   LFG       S Q++   +K  NN ++
Sbjct  469  AGIASLAWVFFFTYLKETRGRTLEQMGELFGIPNMAGDSYQQQQSPEKERNNVEM  523



>ref|XP_006577924.1| PREDICTED: polyol transporter 5-like [Glycine max]
Length=509

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 88/114 (77%), Gaps = 5/114 (4%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FS+GAGPITWVYSSEIFPL+LRA G ++G  +NRVTSGV+SMTF+SL   I+IGG+FFL+
Sbjct  399  FSVGAGPITWVYSSEIFPLRLRAQGAAMGVVVNRVTSGVISMTFLSLSNKITIGGAFFLF  458

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQL  349
              IA  GW+FF+T++PETQGKTLEE E  FG F  W S+ ++ D    N + QL
Sbjct  459  GGIAMCGWIFFYTMLPETQGKTLEEMEGSFGKFASW-SKGKDGD----NGDIQL  507



>tpg|DAA45950.1| TPA: hypothetical protein ZEAMMB73_850316 [Zea mays]
Length=519

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL LRA GC+LG G+NRVTSGV+SMTF+SL K I+IGGSFFLY
Sbjct  408  FSIGLGPITWVYSSEIFPLHLRALGCALGVGLNRVTSGVISMTFLSLSKGITIGGSFFLY  467

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
            A IA++ WVFFFT +PET+G+TLE+   LFG
Sbjct  468  AGIASLAWVFFFTYLPETRGRTLEQMGGLFG  498



>ref|NP_001147446.1| sorbitol transporter [Zea mays]
 gb|ACF84429.1| unknown [Zea mays]
 gb|ACG27557.1| sorbitol transporter [Zea mays]
 tpg|DAA43973.1| TPA: Sorbitol transporter [Zea mays]
Length=525

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 84/115 (73%), Gaps = 0/115 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL+LRA GC+LGT +NRV SG ++M+FISLYKAI+  GSF+LY
Sbjct  410  FSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRVMSGTITMSFISLYKAITFAGSFYLY  469

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQ  346
            A IAA GW+F F  +PET+G  LE+TE LFG       ++   DA+K+   S  Q
Sbjct  470  AGIAAAGWLFMFFFLPETRGSNLEDTEKLFGGGDHDEDKEDGHDAQKSTELSSSQ  524



>gb|EAZ04480.1| hypothetical protein OsI_26629 [Oryza sativa Indica Group]
Length=510

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL++RA GCSLG   NRVTSGV+SMTF+SL KAI+IGGSFFLY
Sbjct  396  FSIGLGPITWVYSSEIFPLQVRALGCSLGVAANRVTSGVISMTFLSLSKAITIGGSFFLY  455

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  370
            + IAA+ WVFF+T +PET+G+TLEE   LFG              KK
Sbjct  456  SGIAALAWVFFYTYLPETRGRTLEEMSKLFGDTAAASESDEPAKEKK  502



>dbj|BAC83310.1| putative sorbitol transporter [Oryza sativa Japonica Group]
 gb|EAZ40438.1| hypothetical protein OsJ_24893 [Oryza sativa Japonica Group]
Length=510

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL++RA GCSLG   NRVTSGV+SMTF+SL KAI+IGGSFFLY
Sbjct  396  FSIGLGPITWVYSSEIFPLQVRALGCSLGVAANRVTSGVISMTFLSLSKAITIGGSFFLY  455

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  370
            + IAA+ WVFF+T +PET+G+TLEE   LFG              KK
Sbjct  456  SGIAALAWVFFYTYLPETRGRTLEEMSKLFGDTAAASESDEPAKEKK  502



>ref|NP_001060108.1| Os07g0582400 [Oryza sativa Japonica Group]
 gb|AAL14615.1|AF416867_1 putative sugar transporter [Oryza sativa]
 dbj|BAF22022.1| Os07g0582400 [Oryza sativa Japonica Group]
Length=577

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL++RA GCSLG   NRVTSGV+SMTF+SL KAI+IGGSFFLY
Sbjct  463  FSIGLGPITWVYSSEIFPLQVRALGCSLGVAANRVTSGVISMTFLSLSKAITIGGSFFLY  522

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  370
            + IAA+ WVFF+T +PET+G+TLEE   LFG              KK
Sbjct  523  SGIAALAWVFFYTYLPETRGRTLEEMSKLFGDTAAASESDEPAKEKK  569



>emb|CDX95491.1| BnaC01g33830D [Brassica napus]
Length=531

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 94/118 (80%), Gaps = 2/118 (2%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVY+SEIFPL+LR+ G S+   +NRVTSGV+SMTF+ L KA++ GG+F+L+
Sbjct  409  FSIGAGPITWVYTSEIFPLRLRSQGSSMAVVVNRVTSGVISMTFLLLSKAMTTGGAFYLF  468

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR-SRQREVDAKKANNNSQLQMG  340
              IA V WVFF+T +PETQG++LE+ + LF + FRWR S+ +  + K +++N Q+++G
Sbjct  469  GGIATVAWVFFYTFLPETQGRSLEDMDELF-SGFRWRDSKSKPKNNKNSSSNPQVEIG  525



>dbj|BAJ85302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=546

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 88/117 (75%), Gaps = 1/117 (1%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL +RA GCSLG  +NR+TSGV+SMTFISL KA++IGG+FFL+
Sbjct  428  FSIGLGPITWVYSSEIFPLHVRALGCSLGVAVNRLTSGVISMTFISLSKAMTIGGAFFLF  487

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMG  340
            A IA+  WVFFF  +PET+G+TLE+  +LFG+    +    E D   A  + +++M 
Sbjct  488  AGIASFAWVFFFAYLPETRGRTLEDMSSLFGSTATRKQGATEAD-DDAGKDKKVEMA  543



>ref|XP_010527602.1| PREDICTED: polyol transporter 5-like [Tarenaya hassleriana]
Length=150

 Score =   135 bits (340),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 83/111 (75%), Gaps = 5/111 (5%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            +SIG GPITWVYSSEIFPL+LRA G S+   +NRVTSGV++MTF+SL KAI+IGG+FFL+
Sbjct  41   YSIGLGPITWVYSSEIFPLRLRAQGLSICVIVNRVTSGVITMTFLSLSKAITIGGAFFLF  100

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR----SRQREVDAKK  370
              IA   WVFF+T +PET+GK LEE + LF   FRWR     R  EV+ + 
Sbjct  101  GGIAIAAWVFFYTFLPETKGKMLEEMDELFDN-FRWRGPSGDRNGEVELQN  150



>ref|NP_001045505.2| Os01g0966900 [Oryza sativa Japonica Group]
 dbj|BAD88259.1| putative sorbitol transporter [Oryza sativa Japonica Group]
 gb|EAZ14958.1| hypothetical protein OsJ_04892 [Oryza sativa Japonica Group]
 dbj|BAF07419.2| Os01g0966900 [Oryza sativa Japonica Group]
Length=479

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 85/112 (76%), Gaps = 4/112 (4%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL LRA GC+LG G+NRVTSGV+SMTF+SL KAI+IGGSFFLY
Sbjct  342  FSIGLGPITWVYSSEIFPLHLRALGCALGVGLNRVTSGVISMTFLSLSKAITIGGSFFLY  401

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  355
            A +A++ W+FFFT +PET+G+TLE+     G  FR  +   + D+      S
Sbjct  402  AGVASLAWLFFFTYLPETRGRTLEQ----MGELFRIHNMAGDDDSAATRPPS  449



>ref|XP_006657888.1| PREDICTED: polyol transporter 5-like [Oryza brachyantha]
Length=510

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 84/114 (74%), Gaps = 3/114 (3%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL++RA GC+LG   NRVTSGV+SMTF+SL  AI+IGGSFFLY
Sbjct  396  FSIGLGPITWVYSSEIFPLQVRALGCALGVASNRVTSGVISMTFLSLSNAITIGGSFFLY  455

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQL  349
            A IAA+ WVFF+T +PET+G+TLEE   LFG      +R    D  K     ++
Sbjct  456  AGIAALAWVFFYTYLPETRGRTLEEMSKLFGA---TDARPEADDTAKEKQKVEM  506



>gb|EMT15230.1| Polyol transporter 5 [Aegilops tauschii]
Length=524

 Score =   142 bits (359),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 86/116 (74%), Gaps = 1/116 (1%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL +RA GCSLG  +NR+TSGV+SMTFISL KA++IGG+FFL+
Sbjct  406  FSIGLGPITWVYSSEIFPLHVRALGCSLGVAVNRLTSGVISMTFISLSKAMTIGGAFFLF  465

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQM  343
            A IA+  WVFFF  +PET+G+TLE+  +LFG     +    E D   A    +++M
Sbjct  466  AGIASFAWVFFFAYLPETRGRTLEDMSSLFGNTATHKQGAAEAD-DDAGKEKKVEM  520



>emb|CAJ29291.1| putative polyol transporter protein 4 [Lotus japonicus]
Length=519

 Score =   142 bits (359),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LRA GC++G  +NRVTSGV+SMTF+SL K I+IGG+FFL+
Sbjct  405  FSIGAGPITWVYSSEIFPLRLRAQGCAMGVVVNRVTSGVISMTFLSLSKGITIGGAFFLF  464

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  355
              IA  GW+FF+T++PET+GKTLE+ E  FG         + V   K N+ +
Sbjct  465  GGIAICGWIFFYTMLPETRGKTLEDMEGSFGQSKSKIKGNKGVGNGKDNDQA  516



>gb|EAY88906.1| hypothetical protein OsI_10385 [Oryza sativa Indica Group]
Length=521

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL+LRA GC+LGT +NRV SG VSM+FISLYKAI+  GSF+LY
Sbjct  403  FSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRVVSGAVSMSFISLYKAITFAGSFYLY  462

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
            A IAA GWVF F  +PETQG++LE+T  LFG
Sbjct  463  AGIAAAGWVFMFFFLPETQGRSLEDTVKLFG  493



>gb|EEE58504.1| hypothetical protein OsJ_09775 [Oryza sativa Japonica Group]
Length=521

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL+LRA GC+LGT +NRV SG VSM+FISLYKAI+  GSF+LY
Sbjct  403  FSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRVVSGAVSMSFISLYKAITFAGSFYLY  462

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
            A IAA GWVF F  +PETQG++LE+T  LFG
Sbjct  463  AGIAAAGWVFMFFFLPETQGRSLEDTVKLFG  493



>gb|ABF94465.1| Sugar transporter family protein, expressed [Oryza sativa Japonica 
Group]
Length=553

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL+LRA GC+LGT +NRV SG VSM+FISLYKAI+  GSF+LY
Sbjct  435  FSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRVVSGAVSMSFISLYKAITFAGSFYLY  494

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
            A IAA GWVF F  +PETQG++LE+T  LFG
Sbjct  495  AGIAAAGWVFMFFFLPETQGRSLEDTVKLFG  525



>ref|XP_007131748.1| hypothetical protein PHAVU_011G038700g [Phaseolus vulgaris]
 gb|ESW03742.1| hypothetical protein PHAVU_011G038700g [Phaseolus vulgaris]
Length=495

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 90/115 (78%), Gaps = 3/115 (3%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG+GPITWVYSSEIFPL+LRA G ++G  +NRVTSGV+SMTF+SL KAI+ GG+FFL+
Sbjct  374  FSIGSGPITWVYSSEIFPLRLRAQGVAIGAVVNRVTSGVISMTFLSLCKAITTGGAFFLF  433

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQ  346
            A +A   W+F +T++PET+GKTLEE E  FG F  WR+ + +     AN ++QL+
Sbjct  434  AGVAVAAWIFHYTMLPETRGKTLEEIEGSFGNF--WRNPKPK-GLHCANGDAQLR  485



>ref|XP_010527590.1| PREDICTED: polyol transporter 5-like [Tarenaya hassleriana]
Length=519

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 81/102 (79%), Gaps = 1/102 (1%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+SMTF+SL KAI+ GG+FFL+
Sbjct  408  FSIGAGPITWVYSSEIFPLRLRAQGASMGVIVNRVTSGVISMTFLSLSKAITTGGAFFLF  467

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQRE  385
              IA V WVFF+T +PETQGK LEE + LF   F WR  + +
Sbjct  468  GGIATVAWVFFYTFLPETQGKMLEEMDELFEK-FNWRDSKSK  508



>ref|XP_002440825.1| hypothetical protein SORBIDRAFT_09g007450 [Sorghum bicolor]
 gb|EES19255.1| hypothetical protein SORBIDRAFT_09g007450 [Sorghum bicolor]
Length=524

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 83/112 (74%), Gaps = 3/112 (3%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL+LRA GC+LGT +NR+ SG ++M+FISLYKAI++ GSF+LY
Sbjct  413  FSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRIMSGAITMSFISLYKAITLAGSFYLY  472

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  355
            A IAA GW+F F  +PET+G++LE+TE LFG        + E D     N S
Sbjct  473  AGIAAAGWLFMFFFLPETRGRSLEDTEKLFGG---GDHGEDEEDGHDGQNKS  521



>ref|XP_009112300.1| PREDICTED: polyol transporter 5 [Brassica rapa]
 emb|CDY18552.1| BnaA01g26430D [Brassica napus]
Length=529

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 94/118 (80%), Gaps = 2/118 (2%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVY+SEIFPL+LR+ G S+   +NRVTSGV+SMTF+ L +A++ GG+F+L+
Sbjct  409  FSIGAGPITWVYTSEIFPLRLRSQGSSMAVVVNRVTSGVISMTFLLLSEAMTTGGAFYLF  468

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR-SRQREVDAKKANNNSQLQMG  340
              IA V WVFF+T +PETQG++LE+ + LF + FRWR S+ +  + K +++N Q+++G
Sbjct  469  GGIATVAWVFFYTFLPETQGRSLEDMDELF-SGFRWRDSKSKPKNNKNSSSNPQVEIG  525



>ref|XP_008812826.1| PREDICTED: polyol transporter 5-like, partial [Phoenix dactylifera]
Length=281

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVY+SEIFPL+LRA G SLGTG NR+ SGV+SMTFISLYKAI+I GS+F Y
Sbjct  162  FSIGLGPIAWVYTSEIFPLRLRAQGASLGTGTNRIVSGVISMTFISLYKAITIAGSYFFY  221

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALF  421
            A IAA GW+FF+  +PET+G++LE+ E LF
Sbjct  222  AGIAAAGWLFFYFFLPETRGRSLEDMEVLF  251



>gb|AAL38359.1| sugar transporter protein [Arabidopsis thaliana]
 gb|AAM10180.1| sugar transporter protein [Arabidopsis thaliana]
Length=245

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 91/119 (76%), Gaps = 3/119 (3%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+S++F+ + KA++ GG+F+L+
Sbjct  115  FSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISISFLPMSKAMTTGGAFYLF  174

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV--DAKKANNNSQLQMG  340
              IA V WVFF+T +PETQG+ LE+ + LF + FRWR  + +   + +K   N ++++G
Sbjct  175  GGIATVAWVFFYTFLPETQGRMLEDMDELF-SGFRWRDSKSKPKGNPEKTVPNPEVEIG  232



>emb|CAP58707.1| putative polyol transported protein 2 [Hevea brasiliensis]
Length=547

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+S TFISLYK I+IGG+FFL+
Sbjct  409  FSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVISTTFISLYKGITIGGAFFLF  468

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQRE  385
            AAIAAV W FFFT +PETQG+TLE+ E LFG F +WRS  +E
Sbjct  469  AAIAAVAWTFFFTCLPETQGRTLEDMEILFGHFIKWRSALKE  510



>ref|XP_010905472.1| PREDICTED: polyol transporter 5-like [Elaeis guineensis]
Length=525

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVY+SEIFPL+LRA G SLGT  NRV SGV++MTFISLYKAI+I GSFFLY
Sbjct  404  FSIGLGPIAWVYTSEIFPLRLRAQGVSLGTATNRVMSGVITMTFISLYKAITIAGSFFLY  463

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALF  421
            A IAAVGW+FF+  +PET+G++LEE E +F
Sbjct  464  AGIAAVGWLFFYFFLPETRGRSLEEMEVIF  493



>ref|XP_002460923.1| hypothetical protein SORBIDRAFT_02g037570 [Sorghum bicolor]
 gb|EER97444.1| hypothetical protein SORBIDRAFT_02g037570 [Sorghum bicolor]
Length=510

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSE+FPL +RA GC+LG   NRVTSGV+SMTFISL KAI+IGG+FFLY
Sbjct  396  FSIGMGPITWVYSSEVFPLHVRALGCALGVASNRVTSGVISMTFISLTKAITIGGAFFLY  455

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
            A +A + WVFFFT +PET+G+TLE    LFG
Sbjct  456  AGVAVLAWVFFFTFLPETRGRTLEAMHKLFG  486



>gb|AEX55225.1| sugar transporter [Allium sativum]
Length=522

 Score =   139 bits (351),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVY+SE+FPL+LRA G ++G  +NR TSGV++MTFISLYKAI+IGG+FFLY
Sbjct  402  FSIGLGPITWVYTSEVFPLRLRAQGAAIGVAVNRTTSGVLTMTFISLYKAITIGGAFFLY  461

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGTLQ  331
              +A + W+FFFT +PET+GKTLEE E  FG   +  + +++    + ++ S ++ G ++
Sbjct  462  GGVALIAWIFFFTYLPETRGKTLEEMEEFFGVRGKDLTDRKQGAGVELSSASGVESGDVK  521



>ref|NP_001236592.1| sorbitol-like transporter [Glycine max]
 emb|CAD91337.1| sorbitol-like transporter [Glycine max]
Length=523

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LRA G + G  +NR TS VVSMTF+SL +AI+IGG+FFLY
Sbjct  403  FSIGAGPITWVYSSEIFPLRLRAQGAAAGVAVNRTTSAVVSMTFLSLTRAITIGGAFFLY  462

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  337
              IA VGW+FF+T++PET+GKTLE+ E  FGT FR +S   +    +    +Q+Q+GT
Sbjct  463  CGIATVGWIFFYTVLPETRGKTLEDMEGSFGT-FRSKSNASKAVENENGQVAQVQLGT  519



>gb|KHN39768.1| Polyol transporter 5 [Glycine soja]
Length=523

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LRA G + G  +NR TS VVSMTF+SL +AI+IGG+FFLY
Sbjct  403  FSIGAGPITWVYSSEIFPLRLRAQGAAAGVAVNRTTSAVVSMTFLSLTRAITIGGAFFLY  462

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  337
              IA VGW+FF+T++PET+GKTLE+ E  FGT FR +S   +    +    +Q+Q+GT
Sbjct  463  CGIATVGWIFFYTVLPETRGKTLEDMEGSFGT-FRSKSNASKAVENENGQVAQVQLGT  519



>gb|ACF85526.1| unknown [Zea mays]
Length=159

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 82/110 (75%), Gaps = 8/110 (7%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GP+T VY+SEIFPL++RA G ++G   NRVTS V+SMTF+SL K I+IGGSFFLY
Sbjct  41   FSIGLGPVTGVYNSEIFPLQVRALGFAVGVACNRVTSAVISMTFLSLSKGITIGGSFFLY  100

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANN  361
            + IAAVGWVFFFT +PET+G+TLEE   LFG          + D  +A+N
Sbjct  101  SGIAAVGWVFFFTCLPETRGRTLEEMGKLFG--------MPDTDMAEAHN  142



>ref|XP_010446763.1| PREDICTED: probable polyol transporter 6 [Camelina sativa]
Length=494

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 83/112 (74%), Gaps = 9/112 (8%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSE+FPLKLRA G SLG  +NR+ +  VSM+F+SL +AI+ GG+FF++
Sbjct  390  FSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRIMNATVSMSFLSLSRAITTGGAFFMF  449

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  355
            A +AAV W FFF LMPET+GK+LEE EALF         QR+ D  +  NNS
Sbjct  450  AGVAAVAWNFFFFLMPETKGKSLEEIEALF---------QRDGDKVRGENNS  492



>ref|XP_009407903.1| PREDICTED: polyol transporter 5-like [Musa acuminata subsp. malaccensis]
Length=507

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL+LRA G SLG  +NR+ SG V+M+F+SLYKAISI GSF+LY
Sbjct  386  FSIGLGPIAWVYSSEIFPLRLRAQGASLGASMNRLMSGAVTMSFLSLYKAISISGSFYLY  445

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQRE  385
            A IAA GWVFF+  +PET+G+ LEE E LFG   +   +  E
Sbjct  446  AGIAAAGWVFFYVFLPETRGRNLEEMEELFGKASKSSEKAEE  487



>gb|EMS55536.1| Polyol transporter 5 [Triticum urartu]
Length=515

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GP+TWVYSSEIFPL +RA GCSLG  +NR+TSGV+SMTFISL KA++IGG+FFL+
Sbjct  397  FSIGLGPVTWVYSSEIFPLHVRALGCSLGVAVNRLTSGVISMTFISLSKAMTIGGAFFLF  456

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
            A IA+  WVFFF  +PET+G+TLE+  +LFG
Sbjct  457  AGIASFAWVFFFAYLPETRGRTLEDMSSLFG  487



>ref|XP_008653287.1| PREDICTED: polyol transporter 5-like [Zea mays]
 tpg|DAA63325.1| TPA: hypothetical protein ZEAMMB73_442702 [Zea mays]
Length=513

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSE+FPL +RA GC+LG   NR+TSGV+SMTFISL KAI+IGG+FFLY
Sbjct  396  FSIGLGPITWVYSSEVFPLHVRAMGCALGVASNRLTSGVISMTFISLSKAITIGGAFFLY  455

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
            A +A + WVFFFT +PET+G+TLE    LFG
Sbjct  456  AGVAVLAWVFFFTFLPETRGRTLEAMSKLFG  486



>emb|CAP58706.1| putative polyol transporter protein 1 [Hevea brasiliensis]
 emb|CAN88842.1| polyols transporter 1 [Hevea brasiliensis]
Length=525

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 91/118 (77%), Gaps = 2/118 (2%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVY++EI PL+LRA G S+G  +NRVTSGV+S TFISLYK I+IGG+FFL+
Sbjct  408  FSIGLGPIAWVYTTEIIPLRLRAQGASMGAAVNRVTSGVISTTFISLYKGITIGGAFFLF  467

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS--RQREVDAKKANNNSQLQM  343
            AAIAAV W FFFT +PETQG+TLE+ E LFG F +WRS  ++ E   K   +N Q Q+
Sbjct  468  AAIAAVAWSFFFTCLPETQGRTLEDMEVLFGHFIKWRSALKKHEEGNKDGESNGQTQL  525



>ref|XP_002885281.1| ATPLT5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61540.1| ATPLT5 [Arabidopsis lyrata subsp. lyrata]
Length=538

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 90/120 (75%), Gaps = 3/120 (3%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+SM F+ L K I+ GG+F+L+
Sbjct  409  FSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISMAFLPLSKGITTGGAFYLF  468

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV--DAKKANNNSQLQMGT  337
              IA V WVFF+T +PETQG+ LE+ + LF + FRWR  + +   + +   +N ++++G+
Sbjct  469  GGIATVAWVFFYTFLPETQGRMLEDMDELF-SGFRWRDSKNKPKSNPEMTVSNPEVEIGS  527



>ref|NP_188513.1| polyol transporter 5 [Arabidopsis thaliana]
 sp|Q8VZ80.2|PLT5_ARATH RecName: Full=Polyol transporter 5; AltName: Full=Protein POLYOL 
TRANSPORTER 5; Short=AtPLT5; AltName: Full=Sugar-proton 
symporter PLT5 [Arabidopsis thaliana]
 dbj|BAB01812.1| sugar transporter protein [Arabidopsis thaliana]
 gb|AEE76153.1| polyol transporter 5 [Arabidopsis thaliana]
Length=539

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 92/120 (77%), Gaps = 3/120 (3%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+S++F+ + KA++ GG+F+L+
Sbjct  409  FSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISISFLPMSKAMTTGGAFYLF  468

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV--DAKKANNNSQLQMGT  337
              IA V WVFF+T +PETQG+ LE+ + LF + FRWR  + +   + +K   N ++++G+
Sbjct  469  GGIATVAWVFFYTFLPETQGRMLEDMDELF-SGFRWRDSKSKPKGNPEKTVPNPEVEIGS  527



>emb|CDP18000.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FS+G GP+ WVYSSEIFPL+LRA G  L   +NR+ SGV+ MTFISLYKAI+IGG+FFL+
Sbjct  388  FSMGMGPVAWVYSSEIFPLRLRALGSGLAAAMNRLVSGVILMTFISLYKAITIGGAFFLF  447

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  370
            A IA V ++FFFTL+PETQG+ LEE E +FGTFF+WRS  RE++ +K
Sbjct  448  AGIAFVAFIFFFTLLPETQGRGLEEMEEMFGTFFKWRSTVRELEERK  494



>gb|ABX71752.1| mannitol transporter [Apium graveolens]
Length=524

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FS G GPI WVYSSE+FPL+LRA GCS+G  +NR  SG++ MTFIS+YKA++IGG+FF++
Sbjct  407  FSSGMGPIAWVYSSEVFPLRLRAQGCSIGVAVNRGVSGIIGMTFISMYKALTIGGAFFVF  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKA  367
            A +AA+GWVF FT+ PETQG+ LEE E LFG++F WR   +++  K+A
Sbjct  467  AVVAAIGWVFMFTMFPETQGRNLEEIEVLFGSYFGWRKTLKDLKKKEA  514



>ref|XP_008791366.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=507

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVY+SEIFPL+LRA G SLGTG NR+ SGVV+MTFISLYKAI+I GSFFLY
Sbjct  386  FSIGLGPIAWVYTSEIFPLRLRAQGVSLGTGTNRILSGVVTMTFISLYKAITIAGSFFLY  445

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALF  421
            A IAA GW+FF+  +PET+G++LE+  ALF
Sbjct  446  AGIAAAGWLFFYFFLPETRGRSLEDMGALF  475



>ref|XP_004958137.1| PREDICTED: polyol transporter 5-like [Setaria italica]
Length=515

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL++RA GC+LG   NRVTSGV+SMTFISL  AI+IGG+FFLY
Sbjct  396  FSIGLGPITWVYSSEIFPLQVRAMGCALGVATNRVTSGVISMTFISLSNAITIGGAFFLY  455

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
              IA + WVFFF+ +PET+G+TLE    LFG
Sbjct  456  GGIAVLAWVFFFSFLPETRGRTLESMSKLFG  486



>ref|XP_009138439.1| PREDICTED: probable polyol transporter 6 [Brassica rapa]
 emb|CDY42700.1| BnaA03g53530D [Brassica napus]
Length=502

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 81/112 (72%), Gaps = 9/112 (8%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSE+FPLKLRA G SLG  +NRV +  VSM+F+SL KAI+ GG+FF++
Sbjct  398  FSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVSMSFLSLSKAITTGGAFFMF  457

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  355
            A IAAV W FFF LMPET+GK+LEE EALF         QR+ D K    N 
Sbjct  458  AGIAAVAWNFFFFLMPETKGKSLEEIEALF---------QRDGDHKVRGEND  500



>emb|CDX75588.1| BnaA01g01140D [Brassica napus]
Length=481

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 81/111 (73%), Gaps = 9/111 (8%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSE+FPLKLRA G SLG  +NRV +  VSM+F+SL KAI+ GG+FF++
Sbjct  377  FSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVSMSFLSLTKAITTGGAFFMF  436

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  358
            A +AAV W FFF LMPET+GK+LEE EALF         QR+ D K    N
Sbjct  437  AGVAAVAWNFFFFLMPETKGKSLEEIEALF---------QRDGDHKVRGEN  478



>ref|XP_006297395.1| hypothetical protein CARUB_v10013420mg [Capsella rubella]
 gb|EOA30293.1| hypothetical protein CARUB_v10013420mg [Capsella rubella]
Length=536

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 92/126 (73%), Gaps = 7/126 (6%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LR+ G SLG  +NRVTSGV+SMTF+ +   ++ GG+F+L+
Sbjct  409  FSIGAGPITWVYSSEIFPLRLRSQGSSLGVVVNRVTSGVISMTFLPMSDGMTTGGAFYLF  468

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV--DAKKANNNSQLQMGT  337
              IA V WVFF+T +PETQGK LE+ + LF + FRWR  + +   + +K   N ++++  
Sbjct  469  GGIATVAWVFFYTFLPETQGKMLEDMDELF-SGFRWRDSKNKPKGNPEKTIPNPEVEI--  525

Query  336  LQAANK  319
              A+NK
Sbjct  526  --ASNK  529



>ref|XP_008775333.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=528

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVY+SEIFPL+LRA G SLGT  NR+ SGVV+MTFISLYKAI+I GSFFLY
Sbjct  407  FSIGLGPIAWVYTSEIFPLRLRAQGASLGTATNRILSGVVTMTFISLYKAITIAGSFFLY  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALF  421
            + IAA GW+FF+  +PET+G++LE+ E LF
Sbjct  467  SGIAAAGWLFFYFFLPETRGRSLEDMEVLF  496



>ref|XP_008800418.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=528

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVY+SEIFPL+LRA G SLGT  NR+ SGV++MTFISLYK I+I GSFFLY
Sbjct  407  FSIGLGPIAWVYTSEIFPLRLRAQGASLGTATNRIVSGVITMTFISLYKTITIAGSFFLY  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALF  421
            A IAA GW+FF+  +PET+G++LE+ E LF
Sbjct  467  AGIAAAGWIFFYFFLPETRGRSLEDMEVLF  496



>ref|XP_010507195.1| PREDICTED: polyol transporter 5 [Camelina sativa]
Length=534

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 93/126 (74%), Gaps = 7/126 (6%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+SMTF+ + K ++ GG+F+L+
Sbjct  410  FSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISMTFLPMSKKMTTGGAFYLF  469

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV--DAKKANNNSQLQMGT  337
              IA V W+FF+T +PETQG+ LE+ E LF + FRWR  + +   + +K   N ++++  
Sbjct  470  GGIATVAWLFFYTFLPETQGRMLEDMEELF-SGFRWRDSKNKPKGNPEKTIANPEVEI--  526

Query  336  LQAANK  319
              A+NK
Sbjct  527  --ASNK  530



>ref|XP_008800420.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=526

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVY+SEIFPL+LRA G SLGT  NR+ SGV+SMTFISLYK I+I GS+F Y
Sbjct  407  FSIGLGPIAWVYTSEIFPLRLRAQGASLGTATNRIVSGVISMTFISLYKTITIAGSYFFY  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
            A IAA GW+FF+  +PET+G++LE+ E LFG
Sbjct  467  AGIAAAGWLFFYFFLPETRGRSLEDMEVLFG  497



>emb|CDX72594.1| BnaC07g46160D [Brassica napus]
Length=681

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 82/107 (77%), Gaps = 3/107 (3%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSE+FPLKLRA G SLG  +NRV +  VSM+F+SL KAI+ GG+FF++
Sbjct  398  FSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVSMSFLSLSKAITTGGAFFMF  457

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  370
            A IAAV W FFF LMPET+GK+LEE EALF    R   R  +V AK+
Sbjct  458  AGIAAVAWNFFFFLMPETKGKSLEEIEALFQ---RDDQRLVQVSAKE  501



>ref|XP_009109331.1| PREDICTED: probable polyol transporter 6 [Brassica rapa]
Length=506

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 81/111 (73%), Gaps = 9/111 (8%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSE+FPLKLRA G SLG  +NRV +  VSM+F+SL +AI+ GG+FF++
Sbjct  402  FSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVSMSFLSLTRAITTGGAFFMF  461

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  358
            A +AAV W FFF LMPET+GK+LEE EALF         QR+ D K    N
Sbjct  462  AGVAAVAWNFFFFLMPETKGKSLEEIEALF---------QRDGDNKTKGEN  503



>emb|CDY35469.1| BnaC03g61910D [Brassica napus]
Length=507

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 81/111 (73%), Gaps = 9/111 (8%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSE+FPLKLRA G SLG  +NRV +  VSM+F+SL +AI+ GG+FF++
Sbjct  403  FSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVSMSFLSLTRAITTGGAFFMF  462

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  358
            A +AAV W FFF LMPET+GK+LEE EALF         QR+ D K    N
Sbjct  463  AGVAAVAWNFFFFLMPETKGKSLEEIEALF---------QRDGDNKTKGEN  504



>emb|CDY24775.1| BnaA08g15350D [Brassica napus]
Length=506

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 81/111 (73%), Gaps = 9/111 (8%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSE+FPLKLRA G SLG  +NRV +  VSM+F+SL +AI+ GG+FF++
Sbjct  402  FSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVSMSFLSLTRAITTGGAFFMF  461

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  358
            A +AAV W FFF LMPET+GK+LEE EALF         QR+ D K    N
Sbjct  462  AGVAAVAWNFFFFLMPETKGKSLEEIEALF---------QRDGDNKTKGEN  503



>ref|XP_010527594.1| PREDICTED: polyol transporter 5-like isoform X4 [Tarenaya hassleriana]
Length=526

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 87/124 (70%), Gaps = 8/124 (6%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FS G GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV++MTF+SL KAI+ GG+FFL+
Sbjct  401  FSTGLGPITWVYSSEIFPLRLRAQGMSMGLIVNRVTSGVIAMTFLSLTKAITTGGAFFLF  460

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGTLQ  331
              +A   W+FF+T +PET+GK LEE + LF   FRWR         K   + +++M T +
Sbjct  461  GGLAMAAWMFFYTFLPETKGKMLEEMDELFDN-FRWR-------GSKTKEHMEVEMTTER  512

Query  330  AANK  319
            +  K
Sbjct  513  SPEK  516



>ref|XP_006285274.1| hypothetical protein CARUB_v10006648mg [Capsella rubella]
 gb|EOA18172.1| hypothetical protein CARUB_v10006648mg [Capsella rubella]
Length=493

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 83/112 (74%), Gaps = 9/112 (8%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSE+FPLKLRA G SLG  +NRV +  VSM+F+SL KAI+ GG+FF++
Sbjct  390  FSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVSMSFLSLTKAITTGGAFFMF  449

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  355
            A +AAV W FFF L+PET+GK+LEE EALF         QR+ D  +  N++
Sbjct  450  AGVAAVAWNFFFFLLPETKGKSLEEIEALF---------QRDGDKVRGENSA  492



>emb|CDY61985.1| BnaC03g73840D [Brassica napus]
Length=530

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 89/117 (76%), Gaps = 5/117 (4%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+SMTF+ + K ++ GG+F+L+
Sbjct  415  FSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISMTFLPMSKGMTTGGAFYLF  474

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMG  340
              IA V WVFF+T + ETQG+ LE+ + LF + FRWR  +     K + +N+++++G
Sbjct  475  GGIATVAWVFFYTFLRETQGRMLEDMDELF-SGFRWRDSKN----KNSGSNTEVEIG  526



>ref|XP_010465998.1| PREDICTED: polyol transporter 5-like [Camelina sativa]
Length=534

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 88/118 (75%), Gaps = 3/118 (3%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+SMTF+ + K ++ GG+F+L+
Sbjct  410  FSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISMTFLPMSKKMTTGGAFYLF  469

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV--DAKKANNNSQLQM  343
              IA V W+FF+T +PETQG+ LE+ E LF   FRWR  + +   + +K   N ++++
Sbjct  470  GGIATVAWLFFYTFLPETQGRMLEDMEELFNG-FRWRDSKNKPKGNPEKTIANPEVEI  526



>ref|XP_008795662.1| PREDICTED: probable polyol transporter 6 [Phoenix dactylifera]
Length=480

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 86/121 (71%), Gaps = 9/121 (7%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPLKLRA G S+G  +NRV +G +SMTFISLYKAI+IGG+FF++
Sbjct  364  FSIGLGPITWVYSSEIFPLKLRAQGASIGVAVNRVMNGTISMTFISLYKAITIGGAFFMF  423

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGTLQ  331
            A I+ + W+FFF L PET+G+ LEE E +F    +W          +  N  + +MG ++
Sbjct  424  AGISILAWMFFFFLCPETKGRPLEEMEEVFSK--KWLY-------SRPVNRERFEMGKVE  474

Query  330  A  328
            A
Sbjct  475  A  475



>emb|CDY67098.1| BnaCnng53530D [Brassica napus]
Length=481

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 81/111 (73%), Gaps = 9/111 (8%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYS+E+FPLKLRA G SLG  +NRV +  VSM+F+SL KAI+ GG+FF++
Sbjct  377  FSIGLGPITWVYSAEVFPLKLRAQGASLGVAVNRVMNATVSMSFLSLTKAITTGGAFFMF  436

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  358
            A +AAV W FFF LMPET+GK+LEE EALF         QR+ D K    N
Sbjct  437  AGVAAVAWNFFFFLMPETKGKSLEEIEALF---------QRDGDHKVRGEN  478



>ref|XP_010487804.1| PREDICTED: polyol transporter 5-like [Camelina sativa]
Length=535

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 89/118 (75%), Gaps = 3/118 (3%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+SMTF+ + K ++ GG+F+L+
Sbjct  410  FSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISMTFLPMSKKMTTGGAFYLF  469

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV--DAKKANNNSQLQM  343
              IA V W+FF+T +PETQG+ LE+ E LF + FRWR  + +   + +K   N ++++
Sbjct  470  GGIATVAWLFFYTFLPETQGRMLEDMEELF-SGFRWRDSKNKPKGNPEKTIANPEVEI  526



>ref|XP_006406559.1| hypothetical protein EUTSA_v10020495mg [Eutrema salsugineum]
 gb|ESQ48012.1| hypothetical protein EUTSA_v10020495mg [Eutrema salsugineum]
Length=529

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 87/117 (74%), Gaps = 1/117 (1%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LR+ G S    +NRVTSGV+SM F+ L + I+ GG+F+L+
Sbjct  410  FSIGAGPITWVYSSEIFPLRLRSQGSSFAVVVNRVTSGVISMGFLPLTEGITTGGAFYLF  469

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMG  340
              IA V W FF+T +PETQG+ LE+ + LF + FRWR  + +   + +++N ++++G
Sbjct  470  CGIATVAWFFFYTFLPETQGRMLEDMDELF-SGFRWRDSKSKPKNRSSSSNPEVEIG  525



>ref|NP_001168177.1| uncharacterized protein LOC100381931 [Zea mays]
 gb|ACN27335.1| unknown [Zea mays]
 tpg|DAA63326.1| TPA: hypothetical protein ZEAMMB73_286001 [Zea mays]
Length=510

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPIT VY+SEIFPL+LRA G ++G   NRVTS V+SMTF+SL KAI+IGGSFFLY
Sbjct  396  FSIGLGPITGVYNSEIFPLQLRALGFAVGVACNRVTSAVISMTFLSLSKAITIGGSFFLY  455

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  370
            + IAAVGWVFFFT +PET+G+TLEE   LFG      +   +  AK+
Sbjct  456  SGIAAVGWVFFFTCLPETRGRTLEEMGKLFGMPDTDMAEADDTAAKE  502



>emb|CDP02097.1| unnamed protein product [Coffea canephora]
Length=512

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FS+G GP+ WVYSSEIFPL+LRA G ++  G NR++SG++ MTF+SL KAI+IGG+FFL+
Sbjct  392  FSMGMGPVAWVYSSEIFPLRLRALGGAMAAGANRLSSGIILMTFLSLSKAITIGGAFFLF  451

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  370
              IA + ++FFFTL+PET+G+ LEE E LFGTFF+WRS  +E++ +K
Sbjct  452  GGIALLAFIFFFTLLPETRGRGLEEMEELFGTFFKWRSTAKELEERK  498



>emb|CDY70259.1| BnaCnng67460D [Brassica napus]
Length=244

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGP+TWVY SEIFP++LRA G SLG  +NR+ SG++ MTF+SL K ++IGG+F L+
Sbjct  133  FSIGAGPVTWVYCSEIFPVRLRAQGASLGVMLNRLMSGIIGMTFLSLSKGLTIGGAFLLF  192

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
            A +AA  WVFFFT +PET+G  LEE E+LFG++   + + 
Sbjct  193  AGVAAAAWVFFFTFLPETRGMPLEEMESLFGSYTANKKKN  232



>gb|KGN44326.1| Mannitol transporter [Cucumis sativus]
Length=522

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 82/102 (80%), Gaps = 1/102 (1%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GP+  VY+SEIFPL+LRA G S+   +NR+ SGVV+MTF+SLY A++IGG+FFLY
Sbjct  412  FSIGLGPMAPVYTSEIFPLRLRALGVSVSVTLNRIVSGVVAMTFLSLYHALTIGGAFFLY  471

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQRE  385
            A IAAV W+FFF + PET+G+ LE+ EALFG  F WRS++ +
Sbjct  472  AGIAAVSWLFFFLVFPETRGQNLEDIEALFGN-FPWRSKKNK  512



>ref|XP_009142783.1| PREDICTED: LOW QUALITY PROTEIN: probable polyol transporter 6 
[Brassica rapa]
Length=506

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 80/111 (72%), Gaps = 9/111 (8%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSE+FPLKLRA G SLG  +NRV +  VSM+F+SL KAI+ GG+FF++
Sbjct  402  FSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVSMSFLSLTKAITTGGAFFMF  461

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  358
            A +AAV W FFF LMPET+GK+LEE E LF         QR+ D K    N
Sbjct  462  AGVAAVAWNFFFFLMPETKGKSLEEIEVLF---------QRDGDHKVRGEN  503



>gb|KJB40206.1| hypothetical protein B456_007G051000 [Gossypium raimondii]
Length=499

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA G S+G  +NR+ + +VSM+FIS+YKAI+IGG+FF++
Sbjct  389  FSIGLGPITWVYSSEIFPLRLRAQGASIGVAVNRLMNAIVSMSFISIYKAITIGGAFFMF  448

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANN  361
            A ++ V W FFF L+PET+GK+LEE E LF    R  ++  E+    +N+
Sbjct  449  AGVSLVAWWFFFFLLPETKGKSLEEIEILFTKNTRHENQGLEIQPTTSNS  498



>ref|XP_006384498.1| hypothetical protein POPTR_0004s15900g [Populus trichocarpa]
 gb|ERP62295.1| hypothetical protein POPTR_0004s15900g [Populus trichocarpa]
Length=503

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI  VYSSEIFPL+LRA G  +G  +NRVTSGV++ TFI LYKAISIGG+FFL+
Sbjct  409  FSIGMGPIAGVYSSEIFPLRLRAQGIGMGVAVNRVTSGVITTTFIMLYKAISIGGAFFLF  468

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFR  406
            A IA V WVFFF   PET+G+TLE+ E LFG F +
Sbjct  469  AGIATVAWVFFFACYPETRGRTLEDMEVLFGNFIK  503



>ref|XP_007131850.1| hypothetical protein PHAVU_011G046600g [Phaseolus vulgaris]
 gb|ESW03844.1| hypothetical protein PHAVU_011G046600g [Phaseolus vulgaris]
Length=510

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 86/114 (75%), Gaps = 6/114 (5%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYS+EIFPL+LRA G + G  +NR+TSGV++MTF+SL KAI++GG+FFLY
Sbjct  400  FSIGAGPITWVYSAEIFPLRLRAQGVAAGVVVNRITSGVITMTFLSLTKAITVGGTFFLY  459

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQL  349
              IAA G +FF+  +PET+GKTLE+ EA FG F    ++  E      N N++L
Sbjct  460  CGIAATGGLFFYIALPETRGKTLEDMEASFGNFNLKSNKGLE------NGNAKL  507



>ref|XP_006411974.1| hypothetical protein EUTSA_v10024974mg [Eutrema salsugineum]
 gb|ESQ53427.1| hypothetical protein EUTSA_v10024974mg [Eutrema salsugineum]
Length=503

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 81/111 (73%), Gaps = 9/111 (8%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSE+FPLKLRA G SLG  +NRV +  VSM+F+SL KAI+ GG+FF++
Sbjct  399  FSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVSMSFLSLTKAITTGGAFFMF  458

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  358
            A +AAV W FFF L+PET+GK+LEE EALF         QR+ D K    N
Sbjct  459  AGVAAVAWNFFFFLLPETKGKSLEEIEALF---------QRDGDNKVRGEN  500



>ref|XP_009135601.1| PREDICTED: polyol transporter 5 [Brassica rapa]
Length=532

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+SMTF+ + K ++ GG+F+L+
Sbjct  415  FSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISMTFLPMSKGMTTGGAFYLF  474

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS  397
              IA V WVFF+T +PETQG+ LE+ + LF + FRWR 
Sbjct  475  GGIATVAWVFFYTFLPETQGRMLEDMDELF-SGFRWRD  511



>ref|XP_008447047.1| PREDICTED: polyol transporter 5-like [Cucumis melo]
Length=519

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 83/107 (78%), Gaps = 1/107 (1%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GP++ VY+SEIFPL+LRA G S+   +NR+ SGVV+MTF+SLY A++IGG+FFLY
Sbjct  409  FSIGLGPMSPVYTSEIFPLRLRALGVSVAVTLNRIVSGVVAMTFLSLYHALTIGGAFFLY  468

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  370
            A IAAVGW+FFF + PET+G  LE+ E LFG  F WR ++ +  A +
Sbjct  469  AGIAAVGWLFFFVVFPETRGHNLEDIEGLFGN-FSWRLKKNKNTAME  514



>ref|XP_010432153.1| PREDICTED: probable polyol transporter 6 [Camelina sativa]
Length=494

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 83/112 (74%), Gaps = 9/112 (8%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSE+FPLKLRA G SLG  +NR+ +  VSM+F+SL KAI+ GG+FF++
Sbjct  390  FSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRIMNATVSMSFLSLSKAITTGGAFFMF  449

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  355
            A +AAV W FFF L+PET+GK+LEE EALF         QR+ D  +  ++S
Sbjct  450  AGVAAVAWNFFFFLLPETKGKSLEEIEALF---------QRDGDKVRGESSS  492



>ref|XP_008452333.1| PREDICTED: polyol transporter 5-like isoform X2 [Cucumis melo]
Length=516

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 84/113 (74%), Gaps = 2/113 (2%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FS+G GP+++V SSE+FPLKLRA G S+G  +N VTSG+VSMTF+SLY+AI+IGG+FFLY
Sbjct  404  FSMGIGPMSYV-SSELFPLKLRAQGMSMGMVVNNVTSGIVSMTFLSLYRAITIGGAFFLY  462

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQ  352
            AAIA VGWVFF+   PET+G  LE  E LFG    W+   ++ D    + NS+
Sbjct  463  AAIAMVGWVFFYVTFPETRGHNLEHVERLFGNLL-WKFSVKKNDTLDDDENSE  514



>ref|XP_003558586.1| PREDICTED: polyol transporter 5-like [Brachypodium distachyon]
Length=521

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL+LRA GC+LGT +NR+ SG ++M+F SL K I++ GSFFLY
Sbjct  405  FSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRIMSGAITMSFYSLSKKITLAGSFFLY  464

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQL  349
            A +A  GWVF F  +PET+G++LE+TE LFG         +E    + N +++L
Sbjct  465  AGVATAGWVFMFFFLPETRGRSLEDTERLFGGGGGDVDGVKEDGHGQQNKSTEL  518



>ref|XP_008452332.1| PREDICTED: putative polyol transporter 2 isoform X1 [Cucumis 
melo]
Length=546

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 84/113 (74%), Gaps = 2/113 (2%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FS+G GP+++V SSE+FPLKLRA G S+G  +N VTSG+VSMTF+SLY+AI+IGG+FFLY
Sbjct  434  FSMGIGPMSYV-SSELFPLKLRAQGMSMGMVVNNVTSGIVSMTFLSLYRAITIGGAFFLY  492

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQ  352
            AAIA VGWVFF+   PET+G  LE  E LFG    W+   ++ D    + NS+
Sbjct  493  AAIAMVGWVFFYVTFPETRGHNLEHVERLFGNLL-WKFSVKKNDTLDDDENSE  544



>ref|XP_002460924.1| hypothetical protein SORBIDRAFT_02g037580 [Sorghum bicolor]
 gb|EER97445.1| hypothetical protein SORBIDRAFT_02g037580 [Sorghum bicolor]
Length=510

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 84/112 (75%), Gaps = 8/112 (7%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPIT VY+SEIFPL++RA G ++G   NRVTS V+SMTF+SL K I+IGGSFFLY
Sbjct  396  FSIGLGPITGVYNSEIFPLQVRALGFAVGMACNRVTSAVISMTFLSLSKGITIGGSFFLY  455

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  355
            + IAAVGWVFFFT +PET+G+TLEE   LFG          ++D  +A++ +
Sbjct  456  SGIAAVGWVFFFTCLPETRGRTLEEMGKLFG--------MPDIDMAQADDTA  499



>ref|XP_004958139.1| PREDICTED: putative polyol transporter 1-like [Setaria italica]
Length=508

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GP+T VY+SEIFPL++RA G ++G   NRVTSGVVSMTF+SL  AI+IGGSFFLY
Sbjct  392  FSIGLGPMTAVYTSEIFPLRVRALGYAVGVACNRVTSGVVSMTFLSLSSAITIGGSFFLY  451

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMG  340
            A I A+ WVFFFT +PET+G+TLEE   LFGT     +   +   +  +++S   +G
Sbjct  452  AGIVALSWVFFFTCLPETRGRTLEEMAELFGTTSAAGTEAEDATRRGTDSSSSRLLG  508



>ref|XP_010527591.1| PREDICTED: polyol transporter 5-like isoform X1 [Tarenaya hassleriana]
Length=537

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 81/103 (79%), Gaps = 2/103 (2%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FS G GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV++MTF+SL KAI+ GG+FFL+
Sbjct  401  FSTGLGPITWVYSSEIFPLRLRAQGMSMGLIVNRVTSGVIAMTFLSLTKAITTGGAFFLF  460

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR-SRQRE  385
              +A   W+FF+T +PET+GK LEE + LF   FRWR S+ +E
Sbjct  461  GGLAMAAWMFFYTFLPETKGKMLEEMDELFDN-FRWRGSKTKE  502



>ref|XP_010095276.1| putative polyol transporter 6 [Morus notabilis]
 gb|EXB59122.1| putative polyol transporter 6 [Morus notabilis]
Length=501

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 82/115 (71%), Gaps = 3/115 (3%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSEIFPL+LRA G S+G  +NRV +  VSMTFIS+YKAI+IGG+FF++
Sbjct  389  FSIGLGPITWVYSSEIFPLRLRAQGMSIGVAVNRVMNATVSMTFISIYKAITIGGTFFMF  448

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQ  346
            A IA + W FF+  +PET+G+TLEE E LF    R   +   VD +    N  +Q
Sbjct  449  AGIAVLAWGFFYFFLPETKGRTLEEMETLFS---RNGKKSGNVDIEIQRRNGYVQ  500



>ref|XP_010527593.1| PREDICTED: polyol transporter 5-like isoform X3 [Tarenaya hassleriana]
Length=528

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 81/103 (79%), Gaps = 2/103 (2%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FS G GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV++MTF+SL KAI+ GG+FFL+
Sbjct  401  FSTGLGPITWVYSSEIFPLRLRAQGMSMGLIVNRVTSGVIAMTFLSLTKAITTGGAFFLF  460

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR-SRQRE  385
              +A   W+FF+T +PET+GK LEE + LF   FRWR S+ +E
Sbjct  461  GGLAMAAWMFFYTFLPETKGKMLEEMDELFDN-FRWRGSKTKE  502



>ref|NP_001182999.1| uncharacterized protein LOC100501319 [Zea mays]
 gb|ACR35394.1| unknown [Zea mays]
Length=406

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GP+T VY+SEIFPL++RA G ++G   NRVTSGVVSMTF+SL  AI+IGGSFFLY
Sbjct  293  FSIGLGPMTAVYTSEIFPLRVRALGYAVGVACNRVTSGVVSMTFLSLSSAITIGGSFFLY  352

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAK  373
            A I A+ WVFFFT +PET+G+TLEE   LFGT        R+  A+
Sbjct  353  AGIVALSWVFFFTCLPETRGRTLEEMGELFGTIDAGTEADRDSAAR  398



>ref|XP_002866999.1| hypothetical protein ARALYDRAFT_490969 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43258.1| hypothetical protein ARALYDRAFT_490969 [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 82/112 (73%), Gaps = 9/112 (8%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSE+FPLKLRA G SLG  +NR+ +  VSM+F+SL  AI+ GG+FF++
Sbjct  391  FSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRIMNATVSMSFLSLTSAITTGGAFFMF  450

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  355
            A +AAV W FFF L+PET+GK+LEE EALF         QR+ D  +  N++
Sbjct  451  AGVAAVAWNFFFFLLPETKGKSLEEIEALF---------QRDGDKVRGENSA  493



>ref|NP_195385.1| putative polyol transporter 6 [Arabidopsis thaliana]
 sp|Q8GXR2.2|PLT6_ARATH RecName: Full=Probable polyol transporter 6 [Arabidopsis thaliana]
 emb|CAB16808.1| sugar transporter like protein [Arabidopsis thaliana]
 emb|CAB80333.1| sugar transporter like protein [Arabidopsis thaliana]
 gb|ABP88116.1| At4g36670 [Arabidopsis thaliana]
 gb|AEE86685.1| putative polyol transporter 6 [Arabidopsis thaliana]
Length=493

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 81/112 (72%), Gaps = 9/112 (8%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPITWVYSSE+FPLKLRA G SLG  +NRV +  VSM+F+SL  AI+ GG+FF++
Sbjct  390  FSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVSMSFLSLTSAITTGGAFFMF  449

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  355
            A +AAV W FFF L+PET+GK+LEE EALF         QR+ D  +  N +
Sbjct  450  AGVAAVAWNFFFFLLPETKGKSLEEIEALF---------QRDGDKVRGENGA  492



>ref|XP_010527592.1| PREDICTED: polyol transporter 5-like isoform X2 [Tarenaya hassleriana]
Length=532

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 81/103 (79%), Gaps = 2/103 (2%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FS G GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV++MTF+SL KAI+ GG+FFL+
Sbjct  401  FSTGLGPITWVYSSEIFPLRLRAQGMSMGLIVNRVTSGVIAMTFLSLTKAITTGGAFFLF  460

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR-SRQRE  385
              +A   W+FF+T +PET+GK LEE + LF   FRWR S+ +E
Sbjct  461  GGLAMAAWMFFYTFLPETKGKMLEEMDELFDN-FRWRGSKTKE  502



>dbj|BAJ86116.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97918.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL+LRA GC+LGT +NR+ SG ++M+F SL   I++ GSF+LY
Sbjct  407  FSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRIMSGAITMSFYSLSNKITLAGSFYLY  466

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
            A+IAA GWVF F  +PET+G+ LE+TE LFG
Sbjct  467  ASIAAAGWVFMFCFLPETRGEGLEDTEKLFG  497



>tpg|DAA63328.1| TPA: hypothetical protein ZEAMMB73_585953 [Zea mays]
Length=469

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GP+T VY+SEIFPL++RA G ++G   NRVTSGVVSMTF+SL  AI+IGGSFFLY
Sbjct  356  FSIGLGPMTAVYTSEIFPLRVRALGYAVGVACNRVTSGVVSMTFLSLSSAITIGGSFFLY  415

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAK  373
            A I A+ WVFFFT +PET+G+TLEE   LFGT        R+  A+
Sbjct  416  AGIVALSWVFFFTCLPETRGRTLEEMGELFGTIDAGTEADRDSAAR  461



>ref|XP_006649564.1| PREDICTED: polyol transporter 5-like [Oryza brachyantha]
Length=518

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GPI WVYSSEIFPL+LRA GC+LGT +NR+ SG +SM+F+SL KAI+  GSF+LY
Sbjct  403  FSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRIMSGAISMSFLSLCKAITFAGSFYLY  462

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
            A IA  GWVF F  +PET+G++LE+T  LFG
Sbjct  463  AGIATAGWVFMFFFLPETRGRSLEDTIVLFG  493



>ref|XP_010435020.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 81/110 (74%), Gaps = 10/110 (9%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGP+TWVY SEIFP++LRA G SLG  +NR+ SG++ MTF+SL K ++IGG+F L+
Sbjct  400  FSIGAGPVTWVYCSEIFPVRLRAQGASLGVMLNRLMSGIIGMTFLSLAKGLTIGGAFLLF  459

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANN  361
            A +AA  WVFFFT +PET+G  LEE E+LFG++          +A K NN
Sbjct  460  AGVAAAAWVFFFTFLPETRGVALEEMESLFGSY----------NANKKNN  499



>ref|XP_008651795.1| PREDICTED: uncharacterized protein LOC100501319 isoform X1 [Zea 
mays]
Length=509

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIG GP+T VY+SEIFPL++RA G ++G   NRVTSGVVSMTF+SL  AI+IGGSFFLY
Sbjct  396  FSIGLGPMTAVYTSEIFPLRVRALGYAVGVACNRVTSGVVSMTFLSLSSAITIGGSFFLY  455

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAK  373
            A I A+ WVFFFT +PET+G+TLEE   LFGT        R+  A+
Sbjct  456  AGIVALSWVFFFTCLPETRGRTLEEMGELFGTIDAGTEADRDSAAR  501



>ref|XP_010442448.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = -1

Query  690  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  511
            FSIGAGP+TWVY SEIFP++LRA G SLG  +NR+ SG++ MTF+SL K ++IGG+F L+
Sbjct  400  FSIGAGPVTWVYCSEIFPVRLRAQGVSLGVMLNRLMSGIIGMTFLSLSKGLTIGGAFLLF  459

Query  510  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  370
            A +AA+ WVFFFT +PET+G  LEE E+LFG++   +     +  K+
Sbjct  460  AGVAAIAWVFFFTFLPETRGVPLEEIESLFGSYSANKKNNVTIKGKE  506



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520