BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF035A23

Length=616
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABB45810.1|  acetoacetyl-CoA thiolase                                272   3e-89   Salvia miltiorrhiza [Chinese salvia]
dbj|BAD95031.1|  3-ketoacyl-CoA thiolase                                272   6e-87   Arabidopsis thaliana [mouse-ear cress]
emb|CDO99410.1|  unnamed protein product                                273   5e-86   Coffea canephora [robusta coffee]
ref|XP_010696158.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    273   5e-86   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006360332.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    273   8e-86   Solanum tuberosum [potatoes]
ref|XP_006294172.1|  hypothetical protein CARUB_v10023167mg             273   8e-86   Capsella rubella
pdb|2WU9|A  Chain A, Crystal Structure Of Peroxisomal Kat2 From A...    272   1e-85   Arabidopsis thaliana [mouse-ear cress]
gb|ACV70033.1|  3-ketoacyl CoA thiolase 2                               272   1e-85   Petunia x hybrida [garden petunia]
ref|NP_180873.1|  3-ketoacyl-CoA thiolase 2                             272   2e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009141289.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    271   4e-85   Brassica rapa
emb|CDY37750.1|  BnaA04g19180D                                          271   4e-85   Brassica napus [oilseed rape]
ref|XP_009619812.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    271   5e-85   Nicotiana tomentosiformis
gb|AGC59769.1|  3-ketoacyl-CoA thiolase 1                               271   5e-85   Rehmannia glutinosa [Chinese foxglove]
emb|CDY23766.1|  BnaC04g43560D                                          271   5e-85   Brassica napus [oilseed rape]
ref|XP_009784398.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    271   5e-85   Nicotiana sylvestris
emb|CAA63598.1|  glyoxysomal beta-ketoacyl-thiolase                     270   6e-85   Brassica napus [oilseed rape]
gb|KJB72150.1|  hypothetical protein B456_011G161700                    270   6e-85   Gossypium raimondii
ref|XP_006410451.1|  hypothetical protein EUTSA_v10016622mg             270   6e-85   Eutrema salsugineum [saltwater cress]
emb|CDY19452.1|  BnaC04g11470D                                          270   7e-85   Brassica napus [oilseed rape]
ref|XP_009143894.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    270   8e-85   Brassica rapa
ref|XP_010469514.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    270   9e-85   Camelina sativa [gold-of-pleasure]
ref|XP_010413914.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    270   9e-85   Camelina sativa [gold-of-pleasure]
ref|XP_010509924.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    270   9e-85   Camelina sativa [gold-of-pleasure]
ref|XP_004247828.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    270   1e-84   
ref|XP_010473862.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    259   1e-84   Camelina sativa [gold-of-pleasure]
ref|XP_011091395.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    270   2e-84   Sesamum indicum [beniseed]
ref|XP_009132912.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    269   2e-84   Brassica rapa
ref|XP_002881265.1|  hypothetical protein ARALYDRAFT_482251             269   2e-84   
gb|EYU32624.1|  hypothetical protein MIMGU_mgv1a005944mg                269   3e-84   Erythranthe guttata [common monkey flower]
ref|XP_011073762.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    269   3e-84   Sesamum indicum [beniseed]
emb|CDX84701.1|  BnaA03g15290D                                          269   3e-84   
emb|CDX79511.1|  BnaC03g18470D                                          268   3e-84   
gb|AGC24176.1|  3-ketoacyl-CoA thiolase 2                               268   5e-84   Rehmannia glutinosa [Chinese foxglove]
gb|KHG05724.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    268   7e-84   Gossypium arboreum [tree cotton]
ref|XP_007034450.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2    263   2e-83   
ref|XP_010556945.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    266   3e-83   Tarenaya hassleriana [spider flower]
ref|XP_002518136.1|  3-ketoacyl-CoA thiolase B, putative                266   4e-83   
gb|EPS68937.1|  hypothetical protein M569_05826                         265   7e-83   Genlisea aurea
ref|XP_007225741.1|  hypothetical protein PRUPE_ppa005421mg             264   1e-82   
gb|KDO43605.1|  hypothetical protein CISIN_1g012506mg                   261   1e-82   Citrus sinensis [apfelsine]
ref|XP_007034449.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1    264   2e-82   
gb|AFW68655.1|  hypothetical protein ZEAMMB73_512974                    256   2e-82   
ref|XP_010069076.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    264   3e-82   Eucalyptus grandis [rose gum]
ref|XP_002285653.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    263   3e-82   Vitis vinifera
emb|CAN81585.1|  hypothetical protein VITISV_023191                     263   3e-82   Vitis vinifera
ref|XP_007225742.1|  hypothetical protein PRUPE_ppa005421mg             263   3e-82   Prunus persica
gb|KDO43604.1|  hypothetical protein CISIN_1g012506mg                   261   5e-82   Citrus sinensis [apfelsine]
ref|XP_008224585.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    263   5e-82   Prunus mume [ume]
ref|XP_004164123.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    263   6e-82   
ref|NP_001142099.1|  uncharacterized protein LOC100274263               255   6e-82   
ref|XP_004138952.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    263   6e-82   Cucumis sativus [cucumbers]
ref|XP_008457258.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    262   8e-82   Cucumis melo [Oriental melon]
gb|ABK94786.1|  unknown                                                 259   8e-82   Populus trichocarpa [western balsam poplar]
gb|AFW68656.1|  hypothetical protein ZEAMMB73_512974                    257   1e-81   
gb|KDO43600.1|  hypothetical protein CISIN_1g012506mg                   261   1e-81   Citrus sinensis [apfelsine]
gb|KDO43599.1|  hypothetical protein CISIN_1g012506mg                   261   2e-81   Citrus sinensis [apfelsine]
ref|XP_004296638.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    261   2e-81   Fragaria vesca subsp. vesca
ref|XP_006420604.1|  hypothetical protein CICLE_v10004931mg             261   2e-81   Citrus clementina [clementine]
gb|KDP20330.1|  hypothetical protein JCGZ_06416                         261   3e-81   Jatropha curcas
ref|XP_009376354.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    261   3e-81   Pyrus x bretschneideri [bai li]
gb|AFW68657.1|  hypothetical protein ZEAMMB73_512974                    257   4e-81   
ref|XP_010522426.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    259   1e-80   Tarenaya hassleriana [spider flower]
ref|XP_008380600.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    259   1e-80   Malus domestica [apple tree]
ref|XP_002299284.2|  hypothetical protein POPTR_0001s14280g             259   1e-80   Populus trichocarpa [western balsam poplar]
pir||S72532  acetyl-CoA C-acyltransferase (EC 2.3.1.16) precursor...    258   4e-80   
gb|ACV70032.1|  3-ketoacyl CoA thiolase 1                               258   5e-80   Petunia x hybrida [garden petunia]
ref|XP_010243983.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    257   8e-80   Nelumbo nucifera [Indian lotus]
ref|XP_011002175.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    257   8e-80   Populus euphratica
gb|ACN29136.1|  unknown                                                 257   1e-79   Zea mays [maize]
ref|XP_006443651.1|  hypothetical protein CICLE_v10020068mg             257   1e-79   Citrus clementina [clementine]
gb|AFK34605.1|  unknown                                                 251   1e-79   Lotus japonicus
ref|XP_006662414.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    256   2e-79   Oryza brachyantha
gb|AFK47277.1|  unknown                                                 246   2e-79   Medicago truncatula
ref|NP_001267690.1|  3-ketoacyl-CoA thiolase 2, peroxisomal-like        256   3e-79   Cucumis sativus [cucumbers]
ref|XP_006368897.1|  hypothetical protein POPTR_0001s14290g             253   2e-78   
ref|XP_004497755.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    254   2e-78   Cicer arietinum [garbanzo]
ref|XP_011034453.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    253   2e-78   Populus euphratica
ref|XP_011002176.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    253   3e-78   Populus euphratica
ref|XP_002467133.1|  hypothetical protein SORBIDRAFT_01g020150          253   4e-78   Sorghum bicolor [broomcorn]
ref|XP_009796304.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    253   4e-78   Nicotiana sylvestris
ref|XP_009796305.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    252   6e-78   Nicotiana sylvestris
gb|ACN39947.1|  unknown                                                 252   6e-78   Picea sitchensis
ref|XP_009629663.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    253   6e-78   Nicotiana tomentosiformis
ref|XP_006854408.1|  hypothetical protein AMTR_s00039p00196630          252   9e-78   Amborella trichopoda
ref|XP_010918893.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    252   1e-77   Elaeis guineensis
gb|EEC67095.1|  hypothetical protein OsI_33888                          251   1e-77   Oryza sativa Indica Group [Indian rice]
ref|NP_001064764.1|  Os10g0457600                                       251   2e-77   
ref|NP_001238475.1|  peroxisomal 3-ketoacyl-CoA thiolase                251   3e-77   Glycine max [soybeans]
ref|XP_010099126.1|  3-ketoacyl-CoA thiolase 2                          251   3e-77   
ref|XP_007145410.1|  hypothetical protein PHAVU_007G236600g             250   4e-77   Phaseolus vulgaris [French bean]
ref|XP_011020688.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    249   6e-77   Populus euphratica
ref|XP_011020687.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    249   7e-77   Populus euphratica
ref|XP_003555712.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    249   1e-76   Glycine max [soybeans]
gb|KEH41248.1|  3-ketoacyl-CoA thiolase 2, peroxisomal-like protein     249   1e-76   Medicago truncatula
pdb|2WUA|A  Chain A, Structure Of The Peroxisomal 3-Ketoacyl-Coa ...    248   1e-76   Helianthus annuus
ref|XP_004247103.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    248   2e-76   
gb|EMT31542.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  248   2e-76   
dbj|BAI66423.1|  3-ketoacyl-CoA thiolase-like protein                   248   2e-76   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006350308.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    248   2e-76   Solanum tuberosum [potatoes]
ref|XP_008235516.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    248   3e-76   Prunus mume [ume]
ref|XP_009400955.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    248   4e-76   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAQ77242.1|  acetoacetyl CoA thiolase                                247   4e-76   Helianthus annuus
gb|ABR16781.1|  unknown                                                 248   4e-76   Picea sitchensis
ref|XP_007201004.1|  hypothetical protein PRUPE_ppa005303mg             248   5e-76   Prunus persica
dbj|BAJ87577.1|  predicted protein                                      247   6e-76   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004954382.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    247   7e-76   Setaria italica
ref|XP_008800565.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    247   8e-76   Phoenix dactylifera
gb|EMS60447.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  246   9e-76   Triticum urartu
ref|XP_002521123.1|  3-ketoacyl-CoA thiolase B, putative                246   1e-75   Ricinus communis
ref|XP_011006998.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    246   1e-75   Populus euphratica
ref|XP_008349047.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    241   2e-75   
ref|XP_003570403.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    246   3e-75   Brachypodium distachyon [annual false brome]
ref|XP_010935683.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    245   3e-75   Elaeis guineensis
ref|NP_001131193.1|  acetyl-CoA C-acyltransferase-like protein          245   4e-75   Zea mays [maize]
ref|XP_010940650.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    245   4e-75   Elaeis guineensis
ref|XP_008804745.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    244   6e-75   Phoenix dactylifera
gb|EYU17978.1|  hypothetical protein MIMGU_mgv1a005895mg                244   6e-75   Erythranthe guttata [common monkey flower]
ref|XP_010038353.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    244   6e-75   Eucalyptus grandis [rose gum]
ref|NP_001241698.1|  3-ketoacyl-CoA thiolase 2, peroxisomal precu...    244   9e-75   
ref|XP_004982961.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    244   1e-74   Setaria italica
ref|XP_010933143.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    244   1e-74   Elaeis guineensis
ref|XP_008804452.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    244   1e-74   Phoenix dactylifera
gb|KJB10128.1|  hypothetical protein B456_001G185200                    244   1e-74   Gossypium raimondii
ref|XP_007049825.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1    243   3e-74   
ref|XP_009411367.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    243   3e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003574006.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    242   5e-74   Brachypodium distachyon [annual false brome]
ref|XP_009385864.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    242   8e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010484155.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    241   8e-74   Camelina sativa [gold-of-pleasure]
gb|KHG11493.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    241   9e-74   Gossypium arboreum [tree cotton]
ref|XP_011083116.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    241   1e-73   Sesamum indicum [beniseed]
gb|ABR17647.1|  unknown                                                 241   1e-73   Picea sitchensis
ref|XP_002889522.1|  hypothetical protein ARALYDRAFT_470458             240   1e-73   
ref|XP_010484150.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    241   1e-73   Camelina sativa [gold-of-pleasure]
ref|XP_001762605.1|  predicted protein                                  241   1e-73   
pdb|2C7Y|A  Chain A, Plant Enzyme                                       239   1e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002963753.1|  hypothetical protein SELMODRAFT_450889             241   2e-73   Selaginella moellendorffii
ref|XP_006307517.1|  hypothetical protein CARUB_v10009140mg             240   2e-73   Capsella rubella
ref|XP_010457531.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    239   3e-73   Camelina sativa [gold-of-pleasure]
emb|CDP03848.1|  unnamed protein product                                240   3e-73   Coffea canephora [robusta coffee]
gb|EMS48058.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  240   3e-73   Triticum urartu
ref|XP_010547052.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    239   3e-73   Tarenaya hassleriana [spider flower]
ref|XP_002974835.1|  hypothetical protein SELMODRAFT_101898             239   6e-73   
ref|XP_008372446.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    239   7e-73   
ref|XP_010109695.1|  3-ketoacyl-CoA thiolase 2                          239   7e-73   Morus notabilis
ref|XP_010547051.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    239   7e-73   Tarenaya hassleriana [spider flower]
ref|XP_010547050.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    239   9e-73   Tarenaya hassleriana [spider flower]
ref|XP_010475137.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    238   1e-72   Camelina sativa [gold-of-pleasure]
ref|XP_009371217.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    238   2e-72   Pyrus x bretschneideri [bai li]
ref|XP_001764272.1|  predicted protein                                  238   2e-72   
gb|KDP26413.1|  hypothetical protein JCGZ_17571                         238   2e-72   Jatropha curcas
ref|NP_171965.1|  3-ketoacyl-CoA thiolase 1                             237   4e-72   Arabidopsis thaliana [mouse-ear cress]
gb|KJB42403.1|  hypothetical protein B456_007G152600                    234   4e-72   Gossypium raimondii
ref|XP_009336047.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    236   4e-72   
gb|AAB80634.1|  Strong similarity to Cucumis acetyl-CoA acyltrans...    237   6e-72   Arabidopsis thaliana [mouse-ear cress]
emb|CDX86611.1|  BnaC08g00920D                                          235   2e-71   
gb|KJB42405.1|  hypothetical protein B456_007G152600                    234   3e-71   Gossypium raimondii
gb|AAM61609.1|  putative acetyl-CoA acyltransferase                     234   4e-71   Arabidopsis thaliana [mouse-ear cress]
gb|KHG13200.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    234   4e-71   Gossypium arboreum [tree cotton]
ref|XP_008438387.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    234   5e-71   Cucumis melo [Oriental melon]
ref|XP_009111084.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    234   6e-71   Brassica rapa
dbj|BAD94007.1|  peroxisomal-3-keto-acyl-CoA thiolase 1                 226   1e-70   Arabidopsis thaliana [mouse-ear cress]
emb|CDY15520.1|  BnaA08g28040D                                          233   2e-70   Brassica napus [oilseed rape]
ref|XP_004290230.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    232   3e-70   Fragaria vesca subsp. vesca
gb|ACA58356.1|  3-ketoacyl-CoA thiolase                                 221   5e-70   Arachis diogoi
emb|CDY05657.1|  BnaC02g38800D                                          231   1e-69   
gb|ACU19231.1|  unknown                                                 223   1e-69   Glycine max [soybeans]
ref|XP_002865685.1|  KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA t...    231   1e-69   Arabidopsis lyrata subsp. lyrata
ref|XP_008365692.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    221   2e-69   
ref|XP_010684942.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    229   3e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009129751.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    228   3e-69   Brassica rapa
gb|AIB06952.1|  3-ketoacyl-CoA thiolase                                 229   6e-69   Vanda hybrid cultivar
emb|CDY33940.1|  BnaA02g30470D                                          229   6e-69   Brassica napus [oilseed rape]
ref|XP_009129750.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    229   6e-69   Brassica rapa
ref|XP_006649171.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    228   1e-68   Oryza brachyantha
gb|KJB42404.1|  hypothetical protein B456_007G152600                    228   1e-68   Gossypium raimondii
ref|XP_006395130.1|  hypothetical protein EUTSA_v10004174mg             226   4e-68   Eutrema salsugineum [saltwater cress]
ref|XP_009336051.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    226   4e-68   
ref|XP_010439770.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    225   5e-68   Camelina sativa [gold-of-pleasure]
ref|NP_001048523.1|  Os02g0817700                                       226   5e-68   
ref|NP_851157.1|  3-keto-acyl-CoA thiolase 2                            225   6e-68   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02017.1|  peroxisomal-3-keto-acyl-CoA thiolase 1                 225   6e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395129.1|  hypothetical protein EUTSA_v10004174mg             226   8e-68   Eutrema salsugineum [saltwater cress]
ref|XP_006280441.1|  hypothetical protein CARUB_v10026373mg             226   1e-67   Capsella rubella
ref|NP_568704.2|  3-keto-acyl-CoA thiolase 2                            226   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010439766.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    226   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010442338.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    224   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010442336.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    224   3e-67   Camelina sativa [gold-of-pleasure]
ref|XP_007034451.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3    221   3e-67   
ref|XP_004152018.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    224   4e-67   Cucumis sativus [cucumbers]
ref|NP_001237076.1|  3-ketoacyl-CoA thiolase                            224   4e-67   Glycine max [soybeans]
ref|XP_002301570.1|  hypothetical protein POPTR_0002s22410g             223   8e-67   Populus trichocarpa [western balsam poplar]
ref|XP_008454505.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    223   9e-67   
gb|ADE77908.1|  unknown                                                 222   2e-66   Picea sitchensis
ref|XP_005646163.1|  thiolase                                           222   3e-66   Coccomyxa subellipsoidea C-169
ref|XP_008454504.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    223   3e-66   
ref|XP_008382649.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    213   4e-66   
gb|KHN15993.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  220   1e-65   Glycine soja [wild soybean]
gb|AFK39397.1|  unknown                                                 209   2e-65   Lotus japonicus
ref|NP_001242568.1|  uncharacterized protein LOC100789930               219   3e-65   
ref|XP_003604976.1|  3-ketoacyl-CoA thiolase 2, peroxisomal             218   5e-65   Medicago truncatula
ref|XP_008355236.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    209   6e-65   
ref|XP_007153157.1|  hypothetical protein PHAVU_003G011600g             218   7e-65   Phaseolus vulgaris [French bean]
gb|KJB72152.1|  hypothetical protein B456_011G161700                    217   2e-64   Gossypium raimondii
gb|AFK40880.1|  unknown                                                 216   2e-64   Medicago truncatula
ref|XP_004506669.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    216   2e-64   Cicer arietinum [garbanzo]
ref|XP_010482155.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    214   9e-64   Camelina sativa [gold-of-pleasure]
gb|AAK76732.1|  3-ketoacyl-CoA thiolase                                 205   9e-64   Gossypium hirsutum [American cotton]
ref|XP_003632434.2|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    214   1e-63   
ref|XP_009384048.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    214   2e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010482154.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    214   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_004506590.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    213   5e-63   Cicer arietinum [garbanzo]
gb|KFK42814.1|  hypothetical protein AALP_AA1G042000                    213   8e-63   Arabis alpina [alpine rockcress]
emb|CAA53078.1|  3-ketoacyl-CoA thiolase B                              212   8e-63   Mangifera indica
gb|KDO43601.1|  hypothetical protein CISIN_1g012506mg                   211   2e-62   Citrus sinensis [apfelsine]
ref|XP_002989683.1|  hypothetical protein SELMODRAFT_447769             207   3e-61   
ref|XP_008678417.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    196   1e-58   
ref|XP_002991797.1|  hypothetical protein SELMODRAFT_236388             197   2e-57   
ref|XP_007049826.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2    197   1e-56   
gb|KCW50166.1|  hypothetical protein EUGRSUZ_K03601                     195   9e-56   Eucalyptus grandis [rose gum]
ref|XP_002946078.1|  hypothetical protein VOLCADRAFT_102696             188   2e-53   Volvox carteri f. nagariensis
ref|XP_003061899.1|  predicted protein                                  182   3e-52   Micromonas pusilla CCMP1545
ref|XP_011400620.1|  3-ketoacyl-CoA thiolase 2, peroxisomal             183   2e-51   Auxenochlorella protothecoides
gb|ABR25554.1|  peroxisomal 3-ketoacyl-coa thiolase 2 precursor         177   3e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_002500295.1|  acetyl-coa acyltransferase                         181   4e-51   Micromonas commoda
gb|KDD73648.1|  beta-ketoacyl-ACP synthase                              180   1e-50   Helicosporidium sp. ATCC 50920
ref|XP_004339798.1|  acetylCoA acyltransferase, putative                179   3e-50   Acanthamoeba castellanii str. Neff
gb|ELU09588.1|  hypothetical protein CAPTEDRAFT_229355                  175   1e-48   Capitella teleta
ref|XP_010172441.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    171   1e-48   Antrostomus carolinensis
gb|EDL76925.1|  rCG25918, isoform CRA_d                                 166   5e-48   Rattus norvegicus [brown rat]
ref|XP_010075883.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    172   6e-48   Pterocles gutturalis
gb|AAH26669.1|  Acaa1a protein                                          166   9e-48   Mus musculus [mouse]
ref|XP_009505170.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    168   1e-47   Phalacrocorax carbo [common cormorant]
ref|XP_005849380.1|  hypothetical protein CHLNCDRAFT_143854             172   2e-47   Chlorella variabilis
ref|XP_003283381.1|  acetyl-CoA C-acyltransferase                       171   2e-47   Dictyostelium purpureum
ref|XP_004676369.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    172   2e-47   Condylura cristata
gb|KFQ33519.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  170   2e-47   Merops nubicus
gb|EDL76924.1|  rCG25918, isoform CRA_c                                 167   3e-47   Rattus norvegicus [brown rat]
gb|EAW64515.1|  acetyl-Coenzyme A acyltransferase 1 (peroxisomal ...    164   3e-47   Homo sapiens [man]
gb|KFV08282.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  170   3e-47   Tauraco erythrolophus
ref|XP_008942616.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    170   3e-47   Merops nubicus
ref|XP_008844714.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    171   4e-47   
gb|KFW92214.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  167   4e-47   Phalacrocorax carbo [common cormorant]
gb|KFW09333.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  169   5e-47   Fulmarus glacialis
gb|EGW00823.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  167   5e-47   Cricetulus griseus [Chinese hamsters]
gb|EOA95880.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  169   5e-47   Anas platyrhynchos [duck]
ref|XP_006511987.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    167   6e-47   
ref|XP_006512177.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    167   6e-47   Mus musculus [mouse]
gb|EMC83181.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  169   6e-47   
gb|ELK29226.1|  3-ketoacyl-CoA thiolase, peroxisomal                    169   6e-47   Myotis davidii
ref|XP_008522879.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    171   6e-47   Equus przewalskii [Przewalski horse]
gb|EDL09222.1|  mCG20972, isoform CRA_b                                 166   7e-47   Mus musculus [mouse]
ref|XP_009941382.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    169   7e-47   Opisthocomus hoazin [hoatzin]
gb|EPQ17921.1|  3-ketoacyl-CoA thiolase, peroxisomal                    169   7e-47   Myotis brandtii
ref|XP_005027361.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    169   7e-47   
gb|KFR17430.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  169   7e-47   Opisthocomus hoazin [hoatzin]
ref|XP_009975644.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    169   7e-47   Tauraco erythrolophus
ref|XP_005424411.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    170   7e-47   
ref|XP_004759760.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    170   8e-47   
ref|XP_006109905.1|  PREDICTED: LOW QUALITY PROTEIN: acetyl-CoA a...    169   8e-47   
ref|XP_006749538.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    168   8e-47   
ref|XP_009580990.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    169   9e-47   Fulmarus glacialis
ref|XP_009963091.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    168   1e-46   Tyto alba [Schleiereule]
ref|XP_004823725.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    170   1e-46   
ref|XP_011217239.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    169   1e-46   
ref|XP_003781848.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    170   1e-46   
ref|XP_005509181.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    169   1e-46   Columba livia [carrier pigeon]
ref|XP_007615644.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    168   1e-46   
emb|CBJ49265.1|  3-ketoacyl-CoA thiolase                                169   1e-46   Ectocarpus siliculosus
ref|XP_001418570.1|  predicted protein                                  169   1e-46   Ostreococcus lucimarinus CCE9901
gb|KFW01783.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  167   1e-46   Eurypyga helias
gb|KFV42249.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  168   1e-46   Tyto alba [Schleiereule]
ref|XP_002199792.2|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    169   1e-46   
ref|XP_003464147.2|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    169   1e-46   Cavia porcellus [guinea pig]
ref|XP_003132151.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    169   2e-46   Sus scrofa [pigs]
dbj|BAC32386.1|  unnamed protein product                                166   2e-46   Mus musculus [mouse]
gb|KFO74220.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  168   2e-46   Cuculus canorus
ref|XP_006765161.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    169   2e-46   Myotis davidii
ref|WP_013075085.1|  acetyl-CoA acetyltransferase                       169   2e-46   Kyrpidia tusciae
ref|XP_010146289.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    167   2e-46   Eurypyga helias
ref|XP_009556582.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    167   2e-46   
ref|XP_005634306.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    167   2e-46   
gb|KFP47895.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  168   2e-46   
ref|XP_009707186.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    167   2e-46   
ref|XP_005527826.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    167   2e-46   
ref|XP_008929499.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    168   2e-46   
ref|XP_009473628.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    167   2e-46   
ref|XP_005317428.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    169   2e-46   
gb|KFW87055.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  168   2e-46   
gb|KFW73684.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  168   2e-46   
gb|KFR09032.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  168   2e-46   
ref|XP_004662051.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    168   2e-46   
ref|XP_001488609.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    169   2e-46   
ref|XP_002193705.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    169   3e-46   
gb|EGW00828.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  167   3e-46   
gb|KGL97637.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  167   3e-46   
ref|XP_010190011.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    167   3e-46   
ref|XP_004419563.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    169   3e-46   
ref|XP_010114568.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    167   3e-46   
ref|XP_008153138.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    169   3e-46   
gb|KFQ63006.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  167   3e-46   
gb|KFM05271.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  167   3e-46   
ref|XP_006713186.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    165   3e-46   
ref|XP_007910458.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    167   3e-46   
ref|XP_005442450.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    168   3e-46   
ref|XP_011217238.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    168   3e-46   
ref|XP_005241038.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    167   3e-46   
ref|XP_002914680.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    169   3e-46   
ref|XP_009484735.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    167   3e-46   
gb|KFP39992.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  167   3e-46   
ref|XP_003456538.2|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    169   4e-46   
ref|XP_005882731.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    169   4e-46   
ref|XP_007081088.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    168   4e-46   
ref|XP_007437964.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    164   4e-46   
ref|XP_009820505.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    167   4e-46   
ref|XP_003992303.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    168   4e-46   
gb|KFV40730.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  167   5e-46   
ref|XP_005348137.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    168   5e-46   
gb|EHB16856.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  168   5e-46   
ref|XP_004906796.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    168   5e-46   
ref|XP_005348140.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    168   5e-46   
ref|XP_004642271.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    168   5e-46   
gb|KFO08431.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  167   6e-46   
gb|KFQ13333.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  167   6e-46   
ref|XP_001697225.1|  acetyl-CoA acyltransferase                         169   6e-46   
ref|XP_010293422.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    166   6e-46   
ref|XP_011241272.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    166   6e-46   
gb|KFO66172.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  166   6e-46   
ref|XP_004835307.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    168   6e-46   
ref|XP_009078375.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    167   6e-46   
ref|XP_009888784.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    167   6e-46   
ref|XP_003505982.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    167   7e-46   
ref|XP_005386652.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    168   7e-46   
ref|XP_010311931.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    166   7e-46   
ref|XP_008641380.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    167   7e-46   
ref|NP_001184217.1|  acetyl-Coenzyme A acyltransferase 1 (peroxis...    168   7e-46   
gb|ELV10533.1|  3-ketoacyl-CoA thiolase, peroxisomal                    166   8e-46   
emb|CEF98532.1|  Thiolase-like, subgroup                                167   8e-46   
ref|XP_534222.2|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal...    167   9e-46   
ref|XP_010710649.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    167   9e-46   
dbj|BAA14106.1|  peroxisomal 3-ketoacyl-CoA thiolase A                  167   9e-46   
ref|XP_009066824.1|  hypothetical protein LOTGIDRAFT_134529             167   9e-46   
sp|P21775.2|THIKA_RAT  RecName: Full=3-ketoacyl-CoA thiolase A, p...    167   9e-46   
ref|XP_006986793.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    167   9e-46   
ref|XP_005317422.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    167   9e-46   
gb|KFP20301.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  166   9e-46   
ref|XP_004338982.1|  acetylCoA C-acetyltransferase subfamily protein    170   9e-46   
ref|NP_001035108.1|  3-ketoacyl-CoA thiolase B, peroxisomal precu...    167   1e-45   
sp|P07871.2|THIKB_RAT  RecName: Full=3-ketoacyl-CoA thiolase B, p...    167   1e-45   
gb|EDL76915.1|  rCG25819, isoform CRA_a                                 167   1e-45   
ref|XP_008710007.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    168   1e-45   
ref|XP_007644623.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    167   1e-45   
ref|XP_005491482.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    167   1e-45   
ref|XP_006890653.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    167   1e-45   
ref|XP_003080093.1|  Dynein 1-alpha heavy chain, flagellar inner ...    174   1e-45   
ref|XP_003415748.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    167   1e-45   
ref|XP_004835306.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    168   1e-45   
dbj|BAE35878.1|  unnamed protein product                                167   1e-45   
ref|XP_009084024.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    167   1e-45   
ref|XP_005040594.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    167   1e-45   
ref|XP_008250935.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    167   1e-45   
emb|CAA35825.1|  3-oxoacyl-CoA thiolase                                 164   2e-45   
ref|NP_570934.1|  3-ketoacyl-CoA thiolase A, peroxisomal precursor      167   2e-45   
dbj|BAE25296.1|  unnamed protein product                                167   2e-45   
ref|XP_010016183.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    165   2e-45   
ref|NP_666342.1|  3-ketoacyl-CoA thiolase B, peroxisomal precursor      167   2e-45   
ref|XP_006169029.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    166   2e-45   
ref|XP_004315495.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    165   2e-45   
ref|XP_009642386.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    166   2e-45   
ref|XP_009923469.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    165   2e-45   
ref|WP_005826653.1|  MULTISPECIES: acetyl-CoA acetyltransferase         166   2e-45   
ref|XP_004704131.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    166   2e-45   
gb|KFP07326.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  166   2e-45   
ref|XP_010393120.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    166   2e-45   
ref|NP_036621.1|  3-ketoacyl-CoA thiolase A, peroxisomal                166   2e-45   
gb|KFV66334.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  165   2e-45   
gb|KFQ52653.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  165   2e-45   
ref|XP_009897418.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    164   3e-45   
ref|XP_005150078.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    166   3e-45   
ref|XP_006806602.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    167   3e-45   
gb|KFV86553.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  165   3e-45   
ref|XP_006023013.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    164   3e-45   
dbj|BAA14107.1|  peroxisomal 3-ketoacyl-CoA thiolase B                  166   3e-45   
gb|EMP29415.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  165   3e-45   
dbj|BAG57147.1|  unnamed protein product                                164   4e-45   
ref|XP_008949804.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    164   4e-45   
ref|WP_012281246.1|  acetyl-CoA acetyltransferase                       165   4e-45   
ref|XP_007127846.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    165   4e-45   
ref|XP_010144408.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    164   5e-45   
ref|XP_006869210.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    166   5e-45   
gb|KFO38323.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  165   5e-45   
ref|XP_005994280.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    165   5e-45   
ref|XP_010004292.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    166   5e-45   
ref|XP_009274247.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    166   5e-45   
ref|XP_004360305.1|  acetyl-CoA C-acyltransferase                       171   5e-45   
ref|XP_007517129.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    165   5e-45   
ref|XP_005297193.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    164   5e-45   
ref|XP_004538713.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    165   6e-45   
ref|XP_007462753.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    165   6e-45   
ref|XP_004018276.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    164   6e-45   
ref|XP_010785602.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    165   6e-45   
ref|WP_025844039.1|  acetyl-CoA acetyltransferase                       164   6e-45   
ref|XP_007127844.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    165   7e-45   
ref|XP_004277954.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    165   7e-45   
ref|XP_008500452.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    166   7e-45   
ref|XP_009952311.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    166   8e-45   
ref|XP_010559421.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    165   8e-45   
ref|XP_010616927.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    165   8e-45   
ref|XP_005940527.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    166   8e-45   
ref|XP_003762905.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    166   9e-45   
ref|XP_004412369.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    165   9e-45   
ref|XP_007943891.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    163   1e-44   
ref|XP_002591918.1|  hypothetical protein BRAFLDRAFT_284464             165   1e-44   
ref|XP_011480271.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    163   1e-44   
ref|XP_006173724.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    163   1e-44   
ref|XP_005748614.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    166   1e-44   
ref|XP_007066606.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    163   1e-44   
ref|XP_009683500.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    165   1e-44   
ref|XP_010944140.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    163   1e-44   
ref|XP_003256905.2|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    164   1e-44   
gb|ACO51137.1|  acetyl-coenzyme A acyltransferase 1                     162   1e-44   
ref|XP_009443455.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    164   1e-44   
ref|WP_007726308.1|  acetyl-CoA acetyltransferase                       164   1e-44   
ref|XP_008066531.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    164   1e-44   
pdb|2IIK|A  Chain A, Crystal Structure Of Human Peroxisomal Acety...    164   1e-44   
ref|XP_003930949.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    164   1e-44   
ref|XP_004588416.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    164   2e-44   
ref|NP_001598.1|  3-ketoacyl-CoA thiolase, peroxisomal isoform a        164   2e-44   
ref|WP_015893130.1|  acetyl-CoA acetyltransferase                       163   2e-44   
ref|XP_002813979.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    164   2e-44   
ref|XP_006634258.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    164   2e-44   
ref|XP_004033892.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    164   2e-44   
ref|XP_006200711.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    164   2e-44   
ref|XP_005297192.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    164   2e-44   
ref|XP_003221941.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    164   2e-44   
gb|EWM24705.1|  3-ketoacyl- thiolase peroxisomal                        164   2e-44   
ref|XP_008161239.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    164   2e-44   
ref|WP_027718458.1|  acetyl-CoA acetyltransferase                       163   2e-44   
ref|XP_005854303.1|  beta-ketoacyl-CoA thiolase                         164   2e-44   
ref|XP_010980336.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    162   2e-44   
ref|XP_001519626.3|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    160   2e-44   
ref|XP_005975939.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    164   2e-44   
ref|NP_001029491.1|  3-ketoacyl-CoA thiolase, peroxisomal               164   2e-44   
ref|XP_005383786.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    164   2e-44   
ref|XP_002759778.2|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    164   2e-44   
ref|XP_008276561.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    164   3e-44   
ref|XP_008584769.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    162   3e-44   
ref|XP_006120630.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    162   3e-44   
ref|XP_007191535.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    163   3e-44   
ref|XP_005695607.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    162   3e-44   
ref|XP_001373770.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    163   4e-44   
ref|WP_027356783.1|  acetyl-CoA acetyltransferase                       162   4e-44   
ref|XP_007943890.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    163   4e-44   
ref|WP_010676464.1|  acetyl-CoA acetyltransferase                       162   5e-44   
ref|WP_016742937.1|  acetyl-CoA acetyltransferase                       162   5e-44   
ref|XP_002180190.1|  beta-ketoacyl-coa thiolase                         162   5e-44   
gb|KGL84935.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  162   5e-44   
ref|NP_001080604.1|  3-ketoacyl-CoA thiolase, peroxisomal               162   6e-44   
ref|NP_001072686.1|  3-ketoacyl-CoA thiolase, peroxisomal               162   6e-44   
ref|WP_017251472.1|  acetyl-CoA acetyltransferase                       162   7e-44   
ref|XP_006077082.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    162   8e-44   
ref|XP_010865004.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    162   9e-44   
ref|XP_005901200.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    162   9e-44   
emb|CCA20150.1|  3ketoacylCoA thiolase A putative                       162   9e-44   
gb|EPZ32623.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  162   1e-43   
ref|XP_010833811.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    162   1e-43   
ref|XP_006265991.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    162   1e-43   
ref|WP_023558379.1|  acetyl-CoA acetyltransferase                       161   1e-43   
ref|XP_002802920.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    160   1e-43   
ref|XP_009537056.1|  hypothetical protein PHYSODRAFT_340572             161   1e-43   
ref|WP_013821404.1|  acetyl-CoA acetyltransferase                       161   1e-43   
ref|XP_007253620.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    161   1e-43   
ref|XP_003724378.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    162   1e-43   
ref|XP_004614628.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    161   1e-43   
ref|XP_004880487.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    161   1e-43   
ref|XP_004854313.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    161   2e-43   
ref|WP_042352323.1|  acetyl-CoA acetyltransferase                       160   2e-43   
ref|XP_007513169.1|  unknown                                            162   2e-43   
ref|WP_019243830.1|  acetyl-CoA acetyltransferase                       160   2e-43   
ref|XP_004377453.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    161   2e-43   
ref|XP_010739674.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    161   2e-43   
ref|XP_009833031.1|  hypothetical protein, variant 2                    159   2e-43   
ref|XP_004854312.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    161   2e-43   
ref|XP_004635291.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    161   2e-43   
ref|WP_035299477.1|  acetyl-CoA acetyltransferase                       160   2e-43   
ref|WP_022585552.1|  acetyl-CoA acetyltransferase                       160   2e-43   
ref|WP_034673686.1|  acetyl-CoA acetyltransferase                       160   2e-43   
ref|XP_004880486.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    161   2e-43   
ref|WP_031411602.1|  acetyl-CoA acetyltransferase                       160   2e-43   
ref|XP_010224152.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    161   3e-43   
ref|NP_001002207.1|  3-ketoacyl-CoA thiolase, peroxisomal               160   3e-43   
ref|WP_024985577.1|  acetyl-CoA acetyltransferase                       160   3e-43   
ref|WP_003391319.1|  acetyl-CoA C-acyltransferase                       160   3e-43   
ref|XP_007578554.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    160   3e-43   
ref|WP_003334515.1|  acetyl-CoA acetyltransferase                       160   3e-43   
ref|WP_042461795.1|  acetyl-CoA acetyltransferase                       160   3e-43   
ref|NP_001187475.1|  peroxisomal 3-ketoacyl-CoA thiolase A              160   3e-43   
ref|WP_003341005.1|  acetyl-CoA acetyltransferase                       160   3e-43   
ref|WP_009791497.1|  MULTISPECIES: acetyl-CoA acetyltransferase         160   3e-43   
ref|XP_008853327.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    160   5e-43   
dbj|BAE72965.1|  hypothetical protein                                   160   5e-43   



>gb|ABB45810.1| acetoacetyl-CoA thiolase [Salvia miltiorrhiza]
Length=172

 Score =   272 bits (695),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTF AVGVDPA+MG+GPAVAIPAAVKSAGLEL+DIDLFEINEAFASQ+LYC+ KLGL
Sbjct  28   GVFRTFVAVGVDPAIMGVGPAVAIPAAVKSAGLELEDIDLFEINEAFASQFLYCRNKLGL  87

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAA VFE
Sbjct  88   DPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAAVFE  147

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGDACDEL N RKVE   +LSKDAR
Sbjct  148  RGDACDELCNTRKVEAQNFLSKDAR  172



>dbj|BAD95031.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
Length=343

 Score =   272 bits (695),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  199  GVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  258

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  259  DPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  318

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NARKVE  G LSKDAR
Sbjct  319  RGDGVDELRNARKVEAQGLLSKDAR  343



>emb|CDO99410.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   273 bits (699),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGLEL+DIDLFEINEAFASQ++YC++KLGL
Sbjct  317  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLELEDIDLFEINEAFASQFVYCREKLGL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  377  DPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  436

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD+CDEL NARK+E +  LSKDAR
Sbjct  437  RGDSCDELCNARKIEANNLLSKDAR  461



>ref|XP_010696158.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Beta vulgaris 
subsp. vulgaris]
Length=462

 Score =   273 bits (698),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ+LYC+KKL L
Sbjct  318  GVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFLYCRKKLDL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  378  DPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGDA D+L NARKVE+HG LSKDA+
Sbjct  438  RGDAADDLCNARKVESHGLLSKDAK  462



>ref|XP_006360332.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Solanum 
tuberosum]
Length=465

 Score =   273 bits (697),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 140/145 (97%), Gaps = 1/145 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MGIGPAVAIPAAVKSAGLEL+DIDLFEINEAFASQ++YC+KKLGL
Sbjct  320  GVFRTFAAVGVDPAIMGIGPAVAIPAAVKSAGLELEDIDLFEINEAFASQFVYCRKKLGL  379

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  380  DPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  439

Query  256  RGDACDELSNARKVETHGY-LSKDA  185
            RGD+CDEL NARK+++H + LSKDA
Sbjct  440  RGDSCDELRNARKIDSHNHLLSKDA  464



>ref|XP_006294172.1| hypothetical protein CARUB_v10023167mg [Capsella rubella]
 gb|EOA27070.1| hypothetical protein CARUB_v10023167mg [Capsella rubella]
Length=462

 Score =   273 bits (697),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  318  GVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  378  DPEKINVNGGALAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NARKVET G LSKDAR
Sbjct  438  RGDGVDELRNARKVETQGLLSKDAR  462



>pdb|2WU9|A Chain A, Crystal Structure Of Peroxisomal Kat2 From Arabidopsis 
Thaliana
 pdb|2WU9|B Chain B, Crystal Structure Of Peroxisomal Kat2 From Arabidopsis 
Thaliana
Length=442

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  298  GVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  357

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  358  DPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  417

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NARKVE  G LSKDAR
Sbjct  418  RGDGVDELRNARKVEAQGLLSKDAR  442



>gb|ACV70033.1| 3-ketoacyl CoA thiolase 2 [Petunia x hybrida]
Length=463

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MGIGPAVAIPAAVKSAGLEL+DIDLFEINEAFASQY+YC+KKL L
Sbjct  319  GVFRTFAAVGVDPAIMGIGPAVAIPAAVKSAGLELEDIDLFEINEAFASQYVYCRKKLEL  378

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNG AMA+GH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  379  DPEKINVNGSAMALGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  438

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD+CDEL NARK+++H  LSKDA
Sbjct  439  RGDSCDELRNARKIDSHNLLSKDA  462



>ref|NP_180873.1| 3-ketoacyl-CoA thiolase 2 [Arabidopsis thaliana]
 sp|Q56WD9.2|THIK2_ARATH RecName: Full=3-ketoacyl-CoA thiolase 2, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 2; AltName: Full=Beta-ketothiolase 
2; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
2; AltName: Full=Peroxisome defective protein 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG42910.1|AF327529_1 putative 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAK15577.1|AF349530_1 putative 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAC04908.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 dbj|BAA25248.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 dbj|BAA25249.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAK96606.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
 gb|AAL36070.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
 gb|AAM65085.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AEC08791.1| 3-ketoacyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=462

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  318  GVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  378  DPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NARKVE  G LSKDAR
Sbjct  438  RGDGVDELRNARKVEAQGLLSKDAR  462



>ref|XP_009141289.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brassica rapa]
Length=462

 Score =   271 bits (692),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ+LYC+ KLGL
Sbjct  318  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFLYCRNKLGL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  378  DEEKVNVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NARKVE  GYLSKDAR
Sbjct  438  RGDGVDELRNARKVEAQGYLSKDAR  462



>emb|CDY37750.1| BnaA04g19180D [Brassica napus]
Length=462

 Score =   271 bits (692),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ+LYC+ KLGL
Sbjct  318  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFLYCRNKLGL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  378  DEEKVNVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NARKVE  GYLSKDAR
Sbjct  438  RGDGVDELRNARKVEAQGYLSKDAR  462



>ref|XP_009619812.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nicotiana 
tomentosiformis]
Length=464

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MGIGPAVAIPAAVKSAGLEL+DIDLFEINEAFASQY+YC+KKL L
Sbjct  320  GVFRTFAAVGVDPAIMGIGPAVAIPAAVKSAGLELEDIDLFEINEAFASQYVYCRKKLEL  379

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGAMA+GH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  380  DPEKINVNGGAMALGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  439

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD+CDEL NARK+ +H  LSKDA
Sbjct  440  RGDSCDELCNARKIGSHNLLSKDA  463



>gb|AGC59769.1| 3-ketoacyl-CoA thiolase 1 [Rehmannia glutinosa]
Length=464

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPA+MG+GPAVAIPAAVKSAGLEL DIDLFE+NEAFASQ++YC+KKL L
Sbjct  320  GVFRSFAAVGVDPAIMGVGPAVAIPAAVKSAGLELGDIDLFEVNEAFASQFVYCRKKLEL  379

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGAMAIGH LG TGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  380  DPEKINVNGGAMAIGHPLGVTGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  439

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD+CDELSNAR V TH +LSKDAR
Sbjct  440  RGDSCDELSNARTVGTHNFLSKDAR  464



>emb|CDY23766.1| BnaC04g43560D [Brassica napus]
Length=462

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ+LYC+ KLGL
Sbjct  318  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFLYCRNKLGL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  378  DAEKVNVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NARKVE  GYLSKDAR
Sbjct  438  RGDGVDELRNARKVEAQGYLSKDAR  462



>ref|XP_009784398.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nicotiana 
sylvestris]
Length=464

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MGIGPAVAIPAAVKSAGLEL+DIDLFEINEAFASQY+YC+KKL L
Sbjct  320  GVFRTFAAVGVDPAIMGIGPAVAIPAAVKSAGLELEDIDLFEINEAFASQYVYCRKKLEL  379

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGAMA+GH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  380  DPEKINVNGGAMALGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  439

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD+CDEL NARK+ +H  LSKDA
Sbjct  440  RGDSCDELCNARKIGSHNLLSKDA  463



>emb|CAA63598.1| glyoxysomal beta-ketoacyl-thiolase [Brassica napus]
Length=462

 Score =   270 bits (691),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  318  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EKINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  378  DAEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NARKVE+HG LSKDAR
Sbjct  438  RGDGVDELRNARKVESHGLLSKDAR  462



>gb|KJB72150.1| hypothetical protein B456_011G161700 [Gossypium raimondii]
Length=464

 Score =   270 bits (691),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGLELDD+DLFEINEAFASQ++YCQKKL L
Sbjct  320  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLELDDVDLFEINEAFASQFVYCQKKLEL  379

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP+KINVNGGAMAIGH LG TGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  380  DPQKINVNGGAMAIGHPLGVTGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  439

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NARKVET+  LSKDAR
Sbjct  440  RGDCVDELCNARKVETNSLLSKDAR  464



>ref|XP_006410451.1| hypothetical protein EUTSA_v10016622mg [Eutrema salsugineum]
 dbj|BAJ34444.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51904.1| hypothetical protein EUTSA_v10016622mg [Eutrema salsugineum]
Length=462

 Score =   270 bits (691),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  318  GVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EKINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  378  DAEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NARKVE HG LSKDAR
Sbjct  438  RGDGVDELRNARKVEAHGLLSKDAR  462



>emb|CDY19452.1| BnaC04g11470D [Brassica napus]
Length=463

 Score =   270 bits (691),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  319  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  378

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EKINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  379  DAEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  438

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NARKVE+HG LSKDAR
Sbjct  439  RGDGVDELRNARKVESHGLLSKDAR  463



>ref|XP_009143894.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brassica rapa]
 emb|CDY17140.1| BnaA05g10480D [Brassica napus]
Length=462

 Score =   270 bits (690),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  318  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EKINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  378  DAEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NARKVE+HG LSKDAR
Sbjct  438  RGDGVDELRNARKVESHGLLSKDAR  462



>ref|XP_010469514.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Camelina 
sativa]
Length=462

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  318  GVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  378  DPEKINVNGGALAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NARKVE  G LSKDAR
Sbjct  438  RGDGVDELRNARKVEAQGLLSKDAR  462



>ref|XP_010413914.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Camelina sativa]
Length=462

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  318  GVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  378  DPEKINVNGGALAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NARKVE  G LSKDAR
Sbjct  438  RGDGVDELRNARKVEAQGLLSKDAR  462



>ref|XP_010509924.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Camelina 
sativa]
Length=462

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  318  GVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  378  DPEKINVNGGALAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NARKVE  G LSKDAR
Sbjct  438  RGDGVDELRNARKVEAQGLLSKDAR  462



>ref|XP_004247828.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Solanum lycopersicum]
Length=465

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 139/145 (96%), Gaps = 1/145 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MGIGPAVAIPAAVKSAGLEL+DIDLFEINEAFASQ++YC+KKL L
Sbjct  320  GVFRTFAAVGVDPAIMGIGPAVAIPAAVKSAGLELEDIDLFEINEAFASQFVYCRKKLEL  379

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  380  DPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  439

Query  256  RGDACDELSNARKVETHGY-LSKDA  185
            RGD+CDEL NARK+++H + LSKDA
Sbjct  440  RGDSCDELRNARKIDSHNHLLSKDA  464



>ref|XP_010473862.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Camelina 
sativa]
Length=157

 Score =   259 bits (662),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  607  RTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPE  428
            RTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLDPE
Sbjct  16   RTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPE  75

Query  427  KINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  248
            KINVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD
Sbjct  76   KINVNGGALAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGD  135

Query  247  ACDELSNARKVETHGYLSKDAR  182
              DEL NARKVE  G LSKDAR
Sbjct  136  GVDELRNARKVEAQGLLSKDAR  157



>ref|XP_011091395.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Sesamum indicum]
Length=464

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPA+MG+GPAVAIPAAVKSAGLEL DIDLFEINEAFASQ++YC+KKL L
Sbjct  320  GVFRSFAAVGVDPAIMGVGPAVAIPAAVKSAGLELGDIDLFEINEAFASQFVYCRKKLEL  379

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EKINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAAGVFE
Sbjct  380  DAEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAGVFE  439

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD+CDEL N RKVET  +LSKDAR
Sbjct  440  RGDSCDELCNVRKVETQNFLSKDAR  464



>ref|XP_009132912.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Brassica 
rapa]
Length=460

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  316  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  375

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EKINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  376  DAEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  435

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NARKVE  G+LSKDAR
Sbjct  436  RGDGVDELRNARKVEAQGFLSKDAR  460



>ref|XP_002881265.1| hypothetical protein ARALYDRAFT_482251 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57524.1| hypothetical protein ARALYDRAFT_482251 [Arabidopsis lyrata subsp. 
lyrata]
Length=462

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  318  GVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            +PEKINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  378  NPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NA+KVE  G LSKDAR
Sbjct  438  RGDGVDELRNAKKVEAQGLLSKDAR  462



>gb|EYU32624.1| hypothetical protein MIMGU_mgv1a005944mg [Erythranthe guttata]
Length=464

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+F AVGVDPA+MGIGPAVAIPAAVK+AGLEL DIDLFEINEAFASQ+LYCQKKL L
Sbjct  320  GVFRSFCAVGVDPAIMGIGPAVAIPAAVKAAGLELGDIDLFEINEAFASQFLYCQKKLEL  379

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP KINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+G VSMCIGTGMGAA VFE
Sbjct  380  DPAKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGAVSMCIGTGMGAAAVFE  439

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD+CDELSNARK+E   +LSKDAR
Sbjct  440  RGDSCDELSNARKIEAQNFLSKDAR  464



>ref|XP_011073762.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Sesamum 
indicum]
Length=464

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPA+MG+GPAVAIPAAVKSAGLEL DIDLFEINEAFASQ++YC+KKL L
Sbjct  320  GVFRSFAAVGVDPAIMGVGPAVAIPAAVKSAGLELGDIDLFEINEAFASQFVYCRKKLEL  379

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGAMAIGH LG TGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  380  DPEKINVNGGAMAIGHPLGTTGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  439

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD+CDEL N R V+TH +LSKDAR
Sbjct  440  RGDSCDELCNVRTVQTHNFLSKDAR  464



>emb|CDX84701.1| BnaA03g15290D [Brassica napus]
Length=462

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  318  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EKINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  378  DAEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NARKVE  G+LSKDAR
Sbjct  438  RGDGVDELRNARKVEAQGFLSKDAR  462



>emb|CDX79511.1| BnaC03g18470D [Brassica napus]
Length=462

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  318  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EKINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  378  DAEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NARKVE  G+LSKDAR
Sbjct  438  RGDGVDELRNARKVEAQGFLSKDAR  462



>gb|AGC24176.1| 3-ketoacyl-CoA thiolase 2 [Rehmannia glutinosa]
Length=464

 Score =   268 bits (686),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPA+MG+GPAVAIPAAVKSAGLEL DIDLFEINEAFASQ++YC+KKL L
Sbjct  320  GVFRSFAAVGVDPAIMGVGPAVAIPAAVKSAGLELGDIDLFEINEAFASQFVYCRKKLEL  379

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGAMAIGH LG TGARCV TLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  380  DPEKINVNGGAMAIGHPLGVTGARCVVTLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  439

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD+CDELSN R V TH +LSKDAR
Sbjct  440  RGDSCDELSNTRTVGTHNFLSKDAR  464



>gb|KHG05724.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=464

 Score =   268 bits (684),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTF AVGVDPA+MG+GPAVAIPAAVKSAGLELDD+DLFEINEAFASQ++YCQKKL L
Sbjct  320  GVFRTFCAVGVDPAIMGVGPAVAIPAAVKSAGLELDDVDLFEINEAFASQFVYCQKKLEL  379

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP+KINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA V E
Sbjct  380  DPQKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVLE  439

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NARKVET+  LSKDAR
Sbjct  440  RGDCVDELCNARKVETNSLLSKDAR  464



>ref|XP_007034450.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
 gb|EOY05376.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
Length=355

 Score =   263 bits (672),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDL+EINEAFASQ++YC+KKL L
Sbjct  211  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLYEINEAFASQFVYCRKKLEL  270

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP+KINVNG AMAIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  271  DPKKINVNGAAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  330

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD  DEL NARKVET+ +LSKDA
Sbjct  331  RGDHTDELCNARKVETNSFLSKDA  354



>ref|XP_010556945.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA thiolase 2, peroxisomal-like 
[Tarenaya hassleriana]
Length=463

 Score =   266 bits (680),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 137/146 (94%), Gaps = 1/146 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVK-SAGLELDDIDLFEINEAFASQYLYCQKKLG  440
            GVFRTFAAVGVDPA+MG+GPAVAIP AVK +AGLELDDIDLFEINEAFASQ++YC+ KLG
Sbjct  318  GVFRTFAAVGVDPAIMGVGPAVAIPGAVKQAAGLELDDIDLFEINEAFASQFVYCRNKLG  377

Query  439  LDPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVF  260
            LDPE+INVNGGAMAIGH LGATGARCV TLLHEMKRRG+DCRYGVVSMCIGTGMGAA VF
Sbjct  378  LDPERINVNGGAMAIGHPLGATGARCVGTLLHEMKRRGRDCRYGVVSMCIGTGMGAAAVF  437

Query  259  ERGDACDELSNARKVETHGYLSKDAR  182
            ERGD  D+LSNARKVE HG+LSKD+R
Sbjct  438  ERGDGVDDLSNARKVEAHGFLSKDSR  463



>ref|XP_002518136.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
 gb|EEF44269.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
Length=460

 Score =   266 bits (679),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPA+MGIGPAVAIPAAVK+AGLEL+DIDLFEINEAFASQ++YC+KKL L
Sbjct  316  GVFRSFAAVGVDPAIMGIGPAVAIPAAVKAAGLELNDIDLFEINEAFASQFVYCRKKLEL  375

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPE+INVNGGAMAIGH LGATGARCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFE
Sbjct  376  DPERINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFE  435

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGDACD+L NARKVET   LSKDA
Sbjct  436  RGDACDDLCNARKVETSNLLSKDA  459



>gb|EPS68937.1| hypothetical protein M569_05826, partial [Genlisea aurea]
Length=457

 Score =   265 bits (677),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPA+MGIGPAVAIPAAVK+AGLE+ DIDL+EINEAFASQ++YC+KKL L
Sbjct  314  GVFRSFAAVGVDPAIMGIGPAVAIPAAVKAAGLEISDIDLYEINEAFASQFVYCRKKLEL  373

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGA+AIGH LGATGARCV TLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFE
Sbjct  374  DPEKINVNGGAIAIGHPLGATGARCVGTLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFE  433

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD+CDELSNARK+E H +LS+DA
Sbjct  434  RGDSCDELSNARKIERHNFLSRDA  457



>ref|XP_007225741.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
 gb|EMJ26940.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
Length=429

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+F+AVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQY+YC+ KLGL
Sbjct  285  GVFRSFSAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQYVYCRNKLGL  344

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGA+AIGH LGATGAR VATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  345  DPEKINVNGGALAIGHPLGATGARAVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  404

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD+ DEL NARKVE+  +LSKDAR
Sbjct  405  RGDSTDELCNARKVESLNHLSKDAR  429



>gb|KDO43605.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
 gb|KDO43606.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
 gb|KDO43607.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=345

 Score =   261 bits (666),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGL+LDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  201  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGL  260

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGA+AIGH LG TGARCVATLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFE
Sbjct  261  DPEKINVNGGALAIGHPLGTTGARCVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFE  320

Query  256  RGDACDELSNARKVETHGYLSKD  188
            RGD  DEL N RKVE++ +LSKD
Sbjct  321  RGDCADELCNVRKVESNNFLSKD  343



>ref|XP_007034449.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
 gb|EOY05375.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
Length=464

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDL+EINEAFASQ++YC+KKL L
Sbjct  320  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLYEINEAFASQFVYCRKKLEL  379

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP+KINVNG AMAIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  380  DPKKINVNGAAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  439

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD  DEL NARKVET+ +LSKDA
Sbjct  440  RGDHTDELCNARKVETNSFLSKDA  463



>gb|AFW68655.1| hypothetical protein ZEAMMB73_512974 [Zea mays]
Length=230

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPAVMGIGPAVAIPAAVK+AGL++DDIDLFEINEAFASQY+YC KKL L
Sbjct  86   GVFRTFAAVGVDPAVMGIGPAVAIPAAVKAAGLQMDDIDLFEINEAFASQYVYCCKKLKL  145

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGAMA+GH LGATGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  146  DPAKVNVNGGAMALGHPLGATGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFE  205

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD  DEL+NAR + TH +LSKDA
Sbjct  206  RGDGVDELTNARGISTHNWLSKDA  229



>ref|XP_010069076.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 gb|KCW57291.1| hypothetical protein EUGRSUZ_H00090 [Eucalyptus grandis]
Length=464

 Score =   264 bits (674),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  320  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  379

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            +PEK+NVNGGAMA+GH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA V E
Sbjct  380  EPEKVNVNGGAMAMGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVLE  439

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD+ DELSNARKV T+  LSKDAR
Sbjct  440  RGDSVDELSNARKVGTNSLLSKDAR  464



>ref|XP_002285653.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Vitis vinifera]
 emb|CBI33354.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   263 bits (673),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQ++YC+KKL L
Sbjct  317  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQFVYCRKKLDL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGAMAIGH LGATGARCV TLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  377  DPEKINVNGGAMAIGHPLGATGARCVGTLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  436

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NAR  E +  LSKDA+
Sbjct  437  RGDCVDELRNARTAENNNLLSKDAQ  461



>emb|CAN81585.1| hypothetical protein VITISV_023191 [Vitis vinifera]
Length=461

 Score =   263 bits (673),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQ++YC+KKL L
Sbjct  317  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQFVYCRKKLDL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGAMAIGH LGATGARCV TLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  377  DPEKINVNGGAMAIGHPLGATGARCVGTLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  436

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NAR  E +  LSKDA+
Sbjct  437  RGDCVDELRNARTAENNNLLSKDAQ  461



>ref|XP_007225742.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
 gb|EMJ26941.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
Length=462

 Score =   263 bits (673),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+F+AVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQY+YC+ KLGL
Sbjct  318  GVFRSFSAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQYVYCRNKLGL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGA+AIGH LGATGAR VATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  378  DPEKINVNGGALAIGHPLGATGARAVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD+ DEL NARKVE+  +LSKDAR
Sbjct  438  RGDSTDELCNARKVESLNHLSKDAR  462



>gb|KDO43604.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=388

 Score =   261 bits (666),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGL+LDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  244  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGL  303

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGA+AIGH LG TGARCVATLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFE
Sbjct  304  DPEKINVNGGALAIGHPLGTTGARCVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFE  363

Query  256  RGDACDELSNARKVETHGYLSKD  188
            RGD  DEL N RKVE++ +LSKD
Sbjct  364  RGDCADELCNVRKVESNNFLSKD  386



>ref|XP_008224585.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Prunus mume]
Length=462

 Score =   263 bits (672),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+F+AVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQY+YC+ KLGL
Sbjct  318  GVFRSFSAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQYVYCRNKLGL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGA+AIGH LGATGAR VATLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFE
Sbjct  378  DPEKINVNGGALAIGHPLGATGARAVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD+ DEL NARKVE+  +LSKDAR
Sbjct  438  RGDSTDELCNARKVESPNHLSKDAR  462



>ref|XP_004164123.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA thiolase 2, peroxisomal-like 
[Cucumis sativus]
Length=461

 Score =   263 bits (671),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KL L
Sbjct  317  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLEL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  377  DPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  436

Query  256  RGDACDELSNARKVETHGYLSKD  188
            RGD  DEL NARKV+ H  LSKD
Sbjct  437  RGDVADELCNARKVDNHNLLSKD  459



>ref|NP_001142099.1| uncharacterized protein LOC100274263 [Zea mays]
 gb|ACF87638.1| unknown [Zea mays]
Length=230

 Score =   255 bits (652),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPAVMGIGPAVAIPAAVK+AGL++DDIDLFEINEAFASQY+YC +KL L
Sbjct  86   GVFRTFAAVGVDPAVMGIGPAVAIPAAVKAAGLQMDDIDLFEINEAFASQYVYCCRKLKL  145

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGAMA+GH LGATGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  146  DPAKVNVNGGAMALGHPLGATGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFE  205

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD  DEL+NAR + TH +LSKDA
Sbjct  206  RGDGVDELTNARGISTHNWLSKDA  229



>ref|XP_004138952.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 gb|KGN61456.1| hypothetical protein Csa_2G129150 [Cucumis sativus]
Length=461

 Score =   263 bits (671),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KL L
Sbjct  317  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLEL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  377  DPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  436

Query  256  RGDACDELSNARKVETHGYLSKD  188
            RGD  DEL NARKV+ H  LSKD
Sbjct  437  RGDVADELCNARKVDNHNLLSKD  459



>ref|XP_008457258.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
melo]
Length=461

 Score =   262 bits (670),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KL L
Sbjct  317  GVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLEL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            +PEKINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  377  NPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  436

Query  256  RGDACDELSNARKVETHGYLSKD  188
            RGD  DEL NARKV+ H  LSKD
Sbjct  437  RGDVADELCNARKVDNHNLLSKD  459



>gb|ABK94786.1| unknown [Populus trichocarpa]
Length=346

 Score =   259 bits (661),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 137/146 (94%), Gaps = 1/146 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLEL+DIDLFEINEAFASQ++YC+KKL L
Sbjct  201  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELEDIDLFEINEAFASQFVYCRKKLEL  260

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP+KINVNGGAMAIGH LGATGARCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFE
Sbjct  261  DPQKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFE  320

Query  256  RGDACDELSN-ARKVETHGYLSKDAR  182
            RGD CDEL N  RKVE++  LS+D+R
Sbjct  321  RGDGCDELCNGGRKVESNNLLSRDSR  346



>gb|AFW68656.1| hypothetical protein ZEAMMB73_512974 [Zea mays]
Length=295

 Score =   257 bits (656),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPAVMGIGPAVAIPAAVK+AGL++DDIDLFEINEAFASQY+YC KKL L
Sbjct  151  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKAAGLQMDDIDLFEINEAFASQYVYCCKKLKL  210

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGAMA+GH LGATGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  211  DPAKVNVNGGAMALGHPLGATGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFE  270

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD  DEL+NAR + TH +LSKDA
Sbjct  271  RGDGVDELTNARGISTHNWLSKDA  294



>gb|KDO43600.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=438

 Score =   261 bits (667),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGL+LDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  294  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGL  353

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGA+AIGH LG TGARCVATLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFE
Sbjct  354  DPEKINVNGGALAIGHPLGTTGARCVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFE  413

Query  256  RGDACDELSNARKVETHGYLSKD  188
            RGD  DEL N RKVE++ +LSKD
Sbjct  414  RGDCADELCNVRKVESNNFLSKD  436



>gb|KDO43599.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=445

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGL+LDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  301  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGL  360

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGA+AIGH LG TGARCVATLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFE
Sbjct  361  DPEKINVNGGALAIGHPLGTTGARCVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFE  420

Query  256  RGDACDELSNARKVETHGYLSKD  188
            RGD  DEL N RKVE++ +LSKD
Sbjct  421  RGDCADELCNVRKVESNNFLSKD  443



>ref|XP_004296638.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Fragaria vesca 
subsp. vesca]
Length=458

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+F AVGVDPA+MG+GPA AIP AVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  314  GVFRSFVAVGVDPAIMGVGPAAAIPVAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  373

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCRYGV+SMCIGTGMGAA VFE
Sbjct  374  DPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVISMCIGTGMGAAAVFE  433

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NARKV++  +LSKDAR
Sbjct  434  RGDRTDELCNARKVDSLNFLSKDAR  458



>ref|XP_006420604.1| hypothetical protein CICLE_v10004931mg [Citrus clementina]
 ref|XP_006489799.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Citrus 
sinensis]
 gb|ESR33844.1| hypothetical protein CICLE_v10004931mg [Citrus clementina]
 gb|KDO43598.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=462

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGL+LDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  318  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGA+AIGH LG TGARCVATLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFE
Sbjct  378  DPEKINVNGGALAIGHPLGTTGARCVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKD  188
            RGD  DEL N RKVE++ +LSKD
Sbjct  438  RGDCADELCNVRKVESNNFLSKD  460



>gb|KDP20330.1| hypothetical protein JCGZ_06416 [Jatropha curcas]
Length=462

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGLEL DIDLFEINEAFASQ++YC+KKL L
Sbjct  318  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLELGDIDLFEINEAFASQFVYCRKKLEL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EKINVNGGAMAIGH LGATGARCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFE
Sbjct  378  DSEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD CDEL NARK ET   LSKDA
Sbjct  438  RGDGCDELCNARKAETDKLLSKDA  461



>ref|XP_009376354.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Pyrus x bretschneideri]
Length=459

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 137/146 (94%), Gaps = 1/146 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+F+AVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQYLYC+ KLGL
Sbjct  314  GVFRSFSAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQYLYCRNKLGL  373

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGA+AIGH LGATGAR VATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  374  DPEKINVNGGALAIGHPLGATGARTVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  433

Query  256  RGDACDELSNARKVETHGY-LSKDAR  182
            RGD+ D L NARKVETH + LSKDAR
Sbjct  434  RGDSVDGLCNARKVETHIHLLSKDAR  459



>gb|AFW68657.1| hypothetical protein ZEAMMB73_512974 [Zea mays]
Length=345

 Score =   257 bits (656),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPAVMGIGPAVAIPAAVK+AGL++DDIDLFEINEAFASQY+YC KKL L
Sbjct  201  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKAAGLQMDDIDLFEINEAFASQYVYCCKKLKL  260

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGAMA+GH LGATGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  261  DPAKVNVNGGAMALGHPLGATGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFE  320

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD  DEL+NAR + TH +LSKDA
Sbjct  321  RGDGVDELTNARGISTHNWLSKDA  344



>ref|XP_010522426.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Tarenaya hassleriana]
Length=464

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 134/146 (92%), Gaps = 2/146 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  318  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EKINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAA VFE
Sbjct  378  DAEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVET--HGYLSKDA  185
            RGDA D LSNAR+VE      LSKD+
Sbjct  438  RGDAVDSLSNARRVEAAHSSLLSKDS  463



>ref|XP_008380600.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Malus domestica]
Length=459

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 137/146 (94%), Gaps = 1/146 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+F+AVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQYLYC+ KLGL
Sbjct  314  GVFRSFSAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQYLYCRNKLGL  373

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGA+AIGH LGATGAR VATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  374  DPEKINVNGGALAIGHPLGATGARAVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  433

Query  256  RGDACDELSNARKVETHGY-LSKDAR  182
            RGD+ D L NARKVE+H + LSKDAR
Sbjct  434  RGDSVDGLCNARKVESHIHLLSKDAR  459



>ref|XP_002299284.2| hypothetical protein POPTR_0001s14280g [Populus trichocarpa]
 gb|EEE84089.2| hypothetical protein POPTR_0001s14280g [Populus trichocarpa]
Length=461

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 137/146 (94%), Gaps = 1/146 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLEL+DIDLFEINEAFASQ++YC+KKL L
Sbjct  316  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELEDIDLFEINEAFASQFVYCRKKLEL  375

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP+KINVNGGAMAIGH LGATGARCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFE
Sbjct  376  DPQKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFE  435

Query  256  RGDACDELSN-ARKVETHGYLSKDAR  182
            RGD CDEL N  RKVE++  LS+D+R
Sbjct  436  RGDGCDELCNGGRKVESNNLLSRDSR  461



>pir||S72532 acetyl-CoA C-acyltransferase (EC 2.3.1.16) precursor - cucurbit
 dbj|BAA11117.1| 3-ketoacyl-CoA thiolase [Cucurbita cv. Kurokawa Amakuri]
Length=461

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTF AVGVDPA+MG+GPAVAIPAAVK+AGLEL+DIDLFEINEAFASQ++YC+ KLGL
Sbjct  317  GVFRTFTAVGVDPAIMGVGPAVAIPAAVKAAGLELNDIDLFEINEAFASQFVYCRNKLGL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGA+AIGH LG TGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  377  DPEKINVNGGAIAIGHPLGTTGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  436

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NA+KVE    LSKDAR
Sbjct  437  RGDCVDELCNAKKVEGINLLSKDAR  461



>gb|ACV70032.1| 3-ketoacyl CoA thiolase 1 [Petunia x hybrida]
Length=462

 Score =   258 bits (658),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIP AVKSAGL+LDDIDL+EINEAFASQ++YCQKKL L
Sbjct  318  GVFRSFAAVGVDPAVMGIGPAVAIPPAVKSAGLDLDDIDLYEINEAFASQFVYCQKKLNL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGAMA+GH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  378  DPEKVNVNGGAMALGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGSGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGDA D+L NAR    + +LSKDA+
Sbjct  438  RGDAVDDLCNARVSNNNSFLSKDAK  462



>ref|XP_010243983.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nelumbo nucifera]
Length=460

 Score =   257 bits (657),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLELDDIDLFEINEAFASQY+YC KKL L
Sbjct  316  GVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYVYCCKKLEL  375

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  376  DPEKVNVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  435

Query  256  RGDACDELSNARKVETHGYLSKD  188
            RGD  D L NAR+V T+  LSKD
Sbjct  436  RGDCVDPLCNARQVGTNNLLSKD  458



>ref|XP_011002175.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Populus euphratica]
Length=462

 Score =   257 bits (657),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 136/145 (94%), Gaps = 1/145 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLEL+DIDLFEINEAFASQ++YC+KKL L
Sbjct  317  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELEDIDLFEINEAFASQFVYCRKKLEL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP+KINVNGGAMAIGH LGATGARCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFE
Sbjct  377  DPQKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFE  436

Query  256  RGDACDELSN-ARKVETHGYLSKDA  185
            RGD CDEL N  RKVE++  LS+D+
Sbjct  437  RGDGCDELCNGGRKVESNNLLSRDS  461



>gb|ACN29136.1| unknown [Zea mays]
 gb|AFW68658.1| hypothetical protein ZEAMMB73_512974 [Zea mays]
Length=461

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPAVMGIGPAVAIPAAVK+AGL++DDIDLFEINEAFASQY+YC KKL L
Sbjct  317  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKAAGLQMDDIDLFEINEAFASQYVYCCKKLKL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGAMA+GH LGATGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  377  DPAKVNVNGGAMALGHPLGATGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFE  436

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD  DEL+NAR + TH +LSKDA
Sbjct  437  RGDGVDELTNARGISTHNWLSKDA  460



>ref|XP_006443651.1| hypothetical protein CICLE_v10020068mg [Citrus clementina]
 ref|XP_006480201.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Citrus 
sinensis]
 gb|ESR56891.1| hypothetical protein CICLE_v10020068mg [Citrus clementina]
Length=461

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDP+VMGIGPAVAIPAAVKSAGL+LDDI+LFEINEAFASQY+YC KKLGL
Sbjct  317  GVFRSFAAVGVDPSVMGIGPAVAIPAAVKSAGLQLDDINLFEINEAFASQYVYCIKKLGL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGA+A+GH LGATGARCVATLL EMKRRGKDCR+GV+SMCIG+GMGAA V E
Sbjct  377  DPEKVNVNGGAVALGHPLGATGARCVATLLSEMKRRGKDCRFGVISMCIGSGMGAAAVLE  436

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NAR V TH +LSKDA+
Sbjct  437  RGDCVDELCNARMVPTHTHLSKDAK  461



>gb|AFK34605.1| unknown [Lotus japonicus]
Length=296

 Score =   251 bits (642),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 132/144 (92%), Gaps = 1/144 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPAVMG+GPA AIP AVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  151  GVFRTFAAVGVDPAVMGVGPAAAIPVAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  210

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EKINVNGGAMAIGH LGATGARCVATLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFE
Sbjct  211  DLEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFE  270

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD  DEL NARKV+   +LSKDA
Sbjct  271  RGDGVDELRNARKVDNL-HLSKDA  293



>ref|XP_006662414.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Oryza 
brachyantha]
Length=460

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMG+GPAVAIPAAVK+AGL++DD+DLFEINEAFASQY+YC KKLGL
Sbjct  315  GVFRSFAAVGVDPAVMGVGPAVAIPAAVKAAGLQIDDVDLFEINEAFASQYVYCCKKLGL  374

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGAMA+GH LGATGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  375  DPTKVNVNGGAMALGHPLGATGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFE  434

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGDA DEL+NAR + +H +LSKDA
Sbjct  435  RGDAVDELTNARGIPSHNWLSKDA  458



>gb|AFK47277.1| unknown [Medicago truncatula]
Length=158

 Score =   246 bits (628),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 132/145 (91%), Gaps = 1/145 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+F AVGVDPA+MG+GPA AIP AVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  15   GVFRSFVAVGVDPAIMGVGPAAAIPVAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  74

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D +KINVNGGAMAIGH LGATGARCVATLLHEMK+RGKDCRYGV+SMCIGTGMGAA VFE
Sbjct  75   DSQKINVNGGAMAIGHPLGATGARCVATLLHEMKKRGKDCRYGVISMCIGTGMGAAAVFE  134

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD+ DEL NARK +   +LSKDAR
Sbjct  135  RGDSVDELCNARKGDNL-FLSKDAR  158



>ref|NP_001267690.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis sativus]
 emb|CAA47926.1| 3-ketoacyl-CoA thiolase [Cucumis sativus]
 gb|KGN56763.1| hypothetical protein Csa_3G133140 [Cucumis sativus]
Length=462

 Score =   256 bits (653),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 135/146 (92%), Gaps = 1/146 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTF+AVGVDPA+MG+GPAVAIPAAVK+AGLEL+DIDLFEINEAFASQ++YC+ KLGL
Sbjct  317  GVFRTFSAVGVDPAIMGVGPAVAIPAAVKAAGLELNDIDLFEINEAFASQFVYCRNKLGL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  377  DPEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  436

Query  256  RGDACDELSNARKVETH-GYLSKDAR  182
            RGD  DEL NA+KVE     LSKDAR
Sbjct  437  RGDCVDELCNAKKVEGGVNLLSKDAR  462



>ref|XP_006368897.1| hypothetical protein POPTR_0001s14290g [Populus trichocarpa]
 gb|ERP65466.1| hypothetical protein POPTR_0001s14290g [Populus trichocarpa]
Length=455

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTF  VGVDPA+MG+GPAVAIPAAVK+AGLEL+DIDLFEINEAFASQ++YC KKL L
Sbjct  311  GVFRTFVVVGVDPAIMGVGPAVAIPAAVKAAGLELEDIDLFEINEAFASQFVYCCKKLEL  370

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D +KINVNGGA+AIGH LG TGARCVAT+LHEMKRRG+DCR+GVVSMCIGTGMGAA VFE
Sbjct  371  DLQKINVNGGAIAIGHPLGTTGARCVATILHEMKRRGRDCRFGVVSMCIGTGMGAAAVFE  430

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD CDEL NARKVE++  LSKD+R
Sbjct  431  RGDGCDELCNARKVESNNLLSKDSR  455



>ref|XP_004497755.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=458

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 133/145 (92%), Gaps = 1/145 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+F AVGVDPA+MG+GPA AIP AVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  315  GVFRSFVAVGVDPAIMGVGPAAAIPVAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  374

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D +KINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  375  DSQKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  434

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD+ DEL NARKV+   YLSKDAR
Sbjct  435  RGDSVDELRNARKVDDL-YLSKDAR  458



>ref|XP_011034453.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=455

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTF  VGVDPA+MG+GPAVAIPAAVK+AGLEL+DIDLFEINEAFASQ++YC KKL L
Sbjct  311  GVFRTFVVVGVDPAIMGVGPAVAIPAAVKAAGLELEDIDLFEINEAFASQFVYCCKKLEL  370

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D +KINVNGGA+AIGH LG TGARCVAT+LHEMKRRG+DCR+GVVSMCIGTGMGAA VFE
Sbjct  371  DLQKINVNGGAIAIGHPLGTTGARCVATILHEMKRRGRDCRFGVVSMCIGTGMGAAAVFE  430

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD CDEL NARKVE++  LSKD+R
Sbjct  431  RGDDCDELCNARKVESNNLLSKDSR  455



>ref|XP_011002176.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=455

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTF  VGVDPA+MG+GPAVAIPAAVK+AGLEL+DIDLFEINEAFASQ++YC KKL L
Sbjct  311  GVFRTFVVVGVDPAIMGVGPAVAIPAAVKAAGLELEDIDLFEINEAFASQFVYCCKKLEL  370

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D +KINVNGGA+AIGH LG TGARCVAT+LHEMKRRG+DCR+GVVSMCIGTGMGAA VFE
Sbjct  371  DLQKINVNGGAIAIGHPLGTTGARCVATILHEMKRRGRDCRFGVVSMCIGTGMGAAAVFE  430

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD CDEL NARKVE++  LSKD+R
Sbjct  431  RGDDCDELCNARKVESNNLLSKDSR  455



>ref|XP_002467133.1| hypothetical protein SORBIDRAFT_01g020150 [Sorghum bicolor]
 gb|EER94131.1| hypothetical protein SORBIDRAFT_01g020150 [Sorghum bicolor]
Length=462

 Score =   253 bits (645),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPAVMGIGPAVAIPAAVK+AGL++DDIDLFEINEAFASQY+YC KKL L
Sbjct  318  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKAAGLQMDDIDLFEINEAFASQYVYCCKKLEL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGAMA+GH LG TGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  378  DPAKVNVNGGAMALGHPLGCTGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD  DEL+N+R + TH +LSKDA
Sbjct  438  RGDCVDELTNSRGIPTHNWLSKDA  461



>ref|XP_009796304.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Nicotiana sylvestris]
Length=486

 Score =   253 bits (647),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLELD+IDLFEINEAFASQ++YC+KKL L
Sbjct  342  GVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDNIDLFEINEAFASQFVYCRKKLNL  401

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGAMA+GH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  402  DSEKVNVNGGAMALGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGSGMGAAAVFE  461

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGDA D+L NAR    + +LSKDA+
Sbjct  462  RGDAVDDLCNARVNNNNNFLSKDAK  486



>ref|XP_009796305.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X2 [Nicotiana sylvestris]
Length=462

 Score =   252 bits (644),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLELD+IDLFEINEAFASQ++YC+KKL L
Sbjct  318  GVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDNIDLFEINEAFASQFVYCRKKLNL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGAMA+GH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  378  DSEKVNVNGGAMALGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGSGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGDA D+L NAR    + +LSKDA+
Sbjct  438  RGDAVDDLCNARVNNNNNFLSKDAK  462



>gb|ACN39947.1| unknown [Picea sitchensis]
 gb|ACN40646.1| unknown [Picea sitchensis]
Length=462

 Score =   252 bits (644),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+F AVGVDPAVMG+GPAVAIPAAVK+AGLE+DDIDLFEINEAFASQ+ YC +KL L
Sbjct  318  GVFRSFTAVGVDPAVMGVGPAVAIPAAVKAAGLEIDDIDLFEINEAFASQFTYCSQKLEL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGA+A+GH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  378  DPEKVNVNGGALALGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RG A D+L NAR ++ H  LSKDA+
Sbjct  438  RGSAVDQLCNARPIKDHTSLSKDAQ  462



>ref|XP_009629663.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Nicotiana 
tomentosiformis]
Length=494

 Score =   253 bits (647),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLELD+IDLFEINEAFASQ++YC+KKL L
Sbjct  350  GVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDNIDLFEINEAFASQFVYCRKKLNL  409

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGAMA+GH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  410  DSEKVNVNGGAMALGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGSGMGAAAVFE  469

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGDA D+L NAR    + +LSKDA+
Sbjct  470  RGDAVDDLCNARVNNNNNFLSKDAK  494



>ref|XP_006854408.1| hypothetical protein AMTR_s00039p00196630 [Amborella trichopoda]
 gb|ERN15875.1| hypothetical protein AMTR_s00039p00196630 [Amborella trichopoda]
Length=460

 Score =   252 bits (643),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+F AVGVDPAVMG+GPAVAIPAAVK+AGLEL+DIDLFEINEAF SQ++YC+ KLGL
Sbjct  316  GVFRSFVAVGVDPAVMGVGPAVAIPAAVKAAGLELNDIDLFEINEAFGSQFVYCRNKLGL  375

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGAMAIGH LGATGARCVATLLHEMKR+GKDCR+GV+SMCIGTGMGAA VFE
Sbjct  376  DPEKVNVNGGAMAIGHPLGATGARCVATLLHEMKRQGKDCRFGVISMCIGTGMGAAAVFE  435

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD  D L+NARK+     LSKDA
Sbjct  436  RGDGVDPLNNARKIGASNLLSKDA  459



>ref|XP_010918893.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=460

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAAVK+AGL++DDIDLFEINEAFASQY+YC KKL L
Sbjct  316  GVFRSFAAVGVDPAVMGIGPAVAIPAAVKAAGLQIDDIDLFEINEAFASQYVYCCKKLEL  375

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGAMA GH LGATGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  376  DPSKVNVNGGAMAFGHPLGATGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFE  435

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD  D+LSNAR+++++  LSKDA
Sbjct  436  RGDVVDQLSNARRIQSNNQLSKDA  459



>gb|EEC67095.1| hypothetical protein OsI_33888 [Oryza sativa Indica Group]
Length=461

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMG+GPAVAIPAAVK+AGL++DD+DLFEINEAFASQY+YC KKLGL
Sbjct  317  GVFRSFAAVGVDPAVMGVGPAVAIPAAVKAAGLQIDDVDLFEINEAFASQYVYCCKKLGL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGAMA+GH LGATGAR V+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  377  DPAKVNVNGGAMALGHPLGATGARSVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFE  436

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGDA DEL+NAR + TH  LSKDA
Sbjct  437  RGDAVDELTNARCIPTHNRLSKDA  460



>ref|NP_001064764.1| Os10g0457600 [Oryza sativa Japonica Group]
 gb|AAK54299.1|AC034258_17 putative thiolase [Oryza sativa Japonica Group]
 gb|AAP54100.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26678.1| Os10g0457600 [Oryza sativa Japonica Group]
 gb|EAZ16317.1| hypothetical protein OsJ_31778 [Oryza sativa Japonica Group]
 dbj|BAG92981.1| unnamed protein product [Oryza sativa Japonica Group]
Length=461

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPA+MG+GPAVAIPAAVK+AGL++DD+DLFEINEAFASQY+YC KKLGL
Sbjct  317  GVFRSFAAVGVDPAIMGVGPAVAIPAAVKAAGLQIDDVDLFEINEAFASQYVYCCKKLGL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGAMA+GH LGATGAR V+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  377  DPAKVNVNGGAMALGHPLGATGARSVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFE  436

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGDA DEL+NAR + TH  LSKDA
Sbjct  437  RGDAVDELTNARCIPTHNRLSKDA  460



>ref|NP_001238475.1| peroxisomal 3-ketoacyl-CoA thiolase [Glycine max]
 dbj|BAG09380.1| peroxisomal 3-ketoacyl-CoA thiolase precursor [Glycine max]
 gb|KHN21671.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=463

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 132/145 (91%), Gaps = 1/145 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPA AIP AVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  318  GVFRTFAAVGVDPAIMGVGPAAAIPVAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGAMAIGH LG+TGARCVATLLHEMK+RG+DCR+GV+SMCIGTGMGAA VFE
Sbjct  378  DPEKINVNGGAMAIGHPLGSTGARCVATLLHEMKKRGRDCRFGVISMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
             GD  DEL NARKV+    LSKDAR
Sbjct  438  SGDCADELCNARKVDDL-LLSKDAR  461



>ref|XP_010099126.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
 gb|EXB76920.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
Length=464

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G+FR F AVGVDPA+MG+GPA AIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  320  GIFRNFVAVGVDPAIMGVGPAFAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  379

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  380  DPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  439

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            R    DEL NAR   T+  LSKDAR
Sbjct  440  RAGHTDELCNARVAATNSLLSKDAR  464



>ref|XP_007145410.1| hypothetical protein PHAVU_007G236600g [Phaseolus vulgaris]
 gb|ESW17404.1| hypothetical protein PHAVU_007G236600g [Phaseolus vulgaris]
Length=458

 Score =   250 bits (638),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 131/145 (90%), Gaps = 1/145 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTF AVGVDPA+MG+GPA AIP AVK+AGLELDDIDLFEINEAFASQ+LYC+ KLGL
Sbjct  315  GVFRTFTAVGVDPAIMGVGPAAAIPVAVKAAGLELDDIDLFEINEAFASQFLYCRNKLGL  374

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGAMAIGH LGATGARCVATLLHEM++RG+DCR+GV+SMCIGTGMGAA VFE
Sbjct  375  DPEKINVNGGAMAIGHPLGATGARCVATLLHEMRKRGRDCRFGVISMCIGTGMGAAAVFE  434

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
             GD  DEL NARKV+    LSKDAR
Sbjct  435  SGDCADELCNARKVDDL-LLSKDAR  458



>ref|XP_011020688.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X2 [Populus euphratica]
Length=458

 Score =   249 bits (637),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTF AVGVDPA+MG+GPAVAIPAAVK+AGL L+DIDLFEINEAFASQ++YC+KKL L
Sbjct  316  GVFRTFTAVGVDPAIMGVGPAVAIPAAVKAAGLALEDIDLFEINEAFASQFVYCRKKLEL  375

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D +KINVNGGAMAIGH LGATGARCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFE
Sbjct  376  DSQKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFE  435

Query  256  RGDACDELSNARKVETHGYLSK  191
            RGD CDEL N RKVE++  LS 
Sbjct  436  RGDGCDELCNGRKVESNNLLSN  457



>ref|XP_011020687.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Populus euphratica]
Length=460

 Score =   249 bits (637),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTF AVGVDPA+MG+GPAVAIPAAVK+AGL L+DIDLFEINEAFASQ++YC+KKL L
Sbjct  318  GVFRTFTAVGVDPAIMGVGPAVAIPAAVKAAGLALEDIDLFEINEAFASQFVYCRKKLEL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D +KINVNGGAMAIGH LGATGARCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFE
Sbjct  378  DSQKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSK  191
            RGD CDEL N RKVE++  LS 
Sbjct  438  RGDGCDELCNGRKVESNNLLSN  459



>ref|XP_003555712.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Glycine max]
 gb|KHN18010.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=461

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 131/145 (90%), Gaps = 1/145 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPA AIP AVK+AGLELDDIDLFEINEAFASQ++YC+  LGL
Sbjct  318  GVFRTFAAVGVDPAIMGVGPAAAIPVAVKAAGLELDDIDLFEINEAFASQFVYCRNNLGL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGAMAIGH LG+TGARCVATLLHEMK+RG+DCR+GV+SMCIGTGMGAA VFE
Sbjct  378  DPEKINVNGGAMAIGHPLGSTGARCVATLLHEMKKRGRDCRFGVISMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
             GD  DEL NARKV+    LSKDAR
Sbjct  438  SGDCADELCNARKVDDL-LLSKDAR  461



>gb|KEH41248.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like protein [Medicago 
truncatula]
Length=462

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 132/145 (91%), Gaps = 1/145 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+F AVGVDPA+MG+GPA AIP AVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  319  GVFRSFVAVGVDPAIMGVGPAAAIPVAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  378

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D +KINVNGGAMAIGH LGATGARCVATLLHEMK+RGKDCRYGV+SMCIGTGMGAA VFE
Sbjct  379  DSQKINVNGGAMAIGHPLGATGARCVATLLHEMKKRGKDCRYGVISMCIGTGMGAAAVFE  438

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD+ DEL NARK +   +LSKDAR
Sbjct  439  RGDSVDELCNARKGDNL-FLSKDAR  462



>pdb|2WUA|A Chain A, Structure Of The Peroxisomal 3-Ketoacyl-Coa Thiolase 
From Sunflower
 pdb|2WUA|B Chain B, Structure Of The Peroxisomal 3-Ketoacyl-Coa Thiolase 
From Sunflower
Length=440

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGV P++MGIGPAVAIPAAVK+AGL++DDIDLFEINEAFASQ++YCQKKL +
Sbjct  301  GVFRTFAAVGVPPSIMGIGPAVAIPAAVKAAGLQIDDIDLFEINEAFASQFVYCQKKLEI  360

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP+KINVNGGAMAIGH LGATGARCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFE
Sbjct  361  DPQKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFE  420

Query  256  RGDACDELSNAR  221
            RGDACDEL NA+
Sbjct  421  RGDACDELCNAK  432



>ref|XP_004247103.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Solanum lycopersicum]
Length=456

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLEL++IDLFEINEAFASQY+YCQKKL L
Sbjct  312  GVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLELNNIDLFEINEAFASQYVYCQKKLNL  371

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPE +NVNGGA+A+GH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  372  DPENVNVNGGALALGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGSGMGAAAVFE  431

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGDA D+L NAR    + +LSKDA+
Sbjct  432  RGDAVDDLCNARANNNNNFLSKDAK  456



>gb|EMT31542.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Aegilops tauschii]
Length=459

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLE+DDIDLFE+NEAFASQ++YC  KLGL
Sbjct  314  GVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLEIDDIDLFELNEAFASQFVYCCNKLGL  373

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D  K+NVNGGA+A+GH LGATGARC++TLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFE
Sbjct  374  DRSKVNVNGGAIAMGHPLGATGARCISTLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFE  433

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD+ DELSN R +++H +LSKDA
Sbjct  434  RGDSVDELSNVRHIQSHNFLSKDA  457



>dbj|BAI66423.1| 3-ketoacyl-CoA thiolase-like protein [Triticum aestivum]
Length=459

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLE+DDIDLFE+NEAFASQ++YC  KLGL
Sbjct  314  GVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLEIDDIDLFELNEAFASQFVYCCNKLGL  373

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D  K+NVNGGA+A+GH LGATGARC++TLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFE
Sbjct  374  DRSKVNVNGGAIAMGHPLGATGARCISTLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFE  433

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD+ DELSN R +++H +LSKDA
Sbjct  434  RGDSVDELSNVRHIQSHNFLSKDA  457



>ref|XP_006350308.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Solanum 
tuberosum]
Length=456

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLEL++IDLFEINEAFASQY+YCQKKL L
Sbjct  312  GVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLELNNIDLFEINEAFASQYVYCQKKLNL  371

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPE +NVNGGA+A+GH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  372  DPENVNVNGGALALGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGSGMGAAAVFE  431

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGDA D+L NAR    + +LSKDA+
Sbjct  432  RGDAVDDLCNARANNNNNFLSKDAK  456



>ref|XP_008235516.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Prunus mume]
Length=467

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPA AIP AVKSAGLELDDIDLFEINEAFASQY+YC KKL L
Sbjct  323  GVFRSFAAVGVDPAVMGIGPAAAIPVAVKSAGLELDDIDLFEINEAFASQYVYCCKKLEL  382

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGA+A+GH LGATGARCVATLL+EMKRRGKD R+GV+SMCIG+GMGAA VFE
Sbjct  383  DPEKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGKDHRFGVISMCIGSGMGAAAVFE  442

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD+ DEL N R VE +  LS DAR
Sbjct  443  RGDSVDELCNVRTVERNNLLSNDAR  467



>ref|XP_009400955.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009400962.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=459

 Score =   248 bits (632),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMG+GPA+AIPAAVKSAGL+++D+DLFEINEAFASQ++YC+KKL L
Sbjct  315  GVFRSFAAVGVDPAVMGVGPAIAIPAAVKSAGLQIEDVDLFEINEAFASQFVYCRKKLEL  374

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGA+A+GH LGATGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  375  DPAKVNVNGGAIALGHPLGATGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFE  434

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGDA D L+NAR++ +H  LS+DA
Sbjct  435  RGDAVDGLTNARQIHSHNLLSEDA  458



>gb|AAQ77242.1| acetoacetyl CoA thiolase [Helianthus annuus]
Length=449

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGV P++MGIGPAVAIPAAVK+AGL++DDIDLFEINEAFASQ++YCQKKL +
Sbjct  316  GVFRTFAAVGVPPSIMGIGPAVAIPAAVKAAGLQIDDIDLFEINEAFASQFVYCQKKLEI  375

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP+KINVNGGAMAIGH LGATGARCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA VFE
Sbjct  376  DPQKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFE  435

Query  256  RGDACDELSNAR  221
            RGDACDEL NA+
Sbjct  436  RGDACDELCNAK  447



>gb|ABR16781.1| unknown [Picea sitchensis]
Length=462

 Score =   248 bits (632),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+F AVGVDPAVMG+GPAVAIPAAVK+AGLE+DDIDLFEINEAFASQ+ YC +KL L
Sbjct  318  GVFRSFTAVGVDPAVMGVGPAVAIPAAVKAAGLEIDDIDLFEINEAFASQFTYCSQKLEL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGA+A+GH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  378  DPEKVNVNGGAIALGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            R  A D+L NAR ++ H  LS+DA+
Sbjct  438  RSGAVDQLCNARPIKDHTSLSRDAQ  462



>ref|XP_007201004.1| hypothetical protein PRUPE_ppa005303mg [Prunus persica]
 gb|EMJ02203.1| hypothetical protein PRUPE_ppa005303mg [Prunus persica]
Length=467

 Score =   248 bits (632),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPA AIP AVKSAGLELDDIDLFEINEAFASQY+YC KKL L
Sbjct  323  GVFRSFAAVGVDPAVMGIGPAAAIPVAVKSAGLELDDIDLFEINEAFASQYVYCCKKLEL  382

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGA+A+GH LGATGARCVATLL+EMKRRGKD R+GV+SMCIG+GMGAA VFE
Sbjct  383  DPEKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGKDHRFGVISMCIGSGMGAAAVFE  442

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD+ DEL N R VE +  LS DAR
Sbjct  443  RGDSVDELCNVRTVERNNLLSNDAR  467



>dbj|BAJ87577.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=460

 Score =   247 bits (631),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+F AVGVDPAVMGIGPAVAIPAAVKSAGLE+DDIDLFE+NEAFASQ++YC  KLGL
Sbjct  315  GVFRSFVAVGVDPAVMGIGPAVAIPAAVKSAGLEIDDIDLFELNEAFASQFVYCCNKLGL  374

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D  K+NVNGGA+A+GH LGATGARC++TLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFE
Sbjct  375  DRSKVNVNGGAIAMGHPLGATGARCISTLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFE  434

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD+ DELSN R +++H +LSKDA
Sbjct  435  RGDSVDELSNVRHIQSHNFLSKDA  458



>ref|XP_004954382.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Setaria 
italica]
Length=461

 Score =   247 bits (630),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLE++DIDLFE+NEAFASQ++YC  KLGL
Sbjct  317  GVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLEIEDIDLFELNEAFASQFVYCCNKLGL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D  K+NVNGGA+A+GH LGATGARCVATLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFE
Sbjct  377  DRSKVNVNGGAIAMGHPLGATGARCVATLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFE  436

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DELSN R +++H +LS+DA+
Sbjct  437  RGDTVDELSNVRDIQSHNFLSRDAK  461



>ref|XP_008800565.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Phoenix 
dactylifera]
Length=461

 Score =   247 bits (630),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGL+++DIDLFE+NEAFASQ++YC KKL L
Sbjct  317  GVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLQIEDIDLFELNEAFASQFVYCCKKLEL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGA+A+GH LGATGARCVATLL+EMKR+GKDCR+GVV+MCIG+GMGAA VFE
Sbjct  377  DPAKVNVNGGAIALGHPLGATGARCVATLLNEMKRKGKDCRFGVVTMCIGSGMGAAAVFE  436

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD  DEL NARK+++   LSKDA
Sbjct  437  RGDGVDELCNARKIQSQNLLSKDA  460



>gb|EMS60447.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Triticum urartu]
Length=435

 Score =   246 bits (628),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G++R+FAAVGVDPAVMG+GPAVAIPAAVK+AGL+++D+DLFEINEAFASQY+YC KKL L
Sbjct  291  GIYRSFAAVGVDPAVMGVGPAVAIPAAVKAAGLQINDVDLFEINEAFASQYVYCSKKLDL  350

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGA+A+GH LGATGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  351  DPAKVNVNGGAIALGHPLGATGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFE  410

Query  256  RGDACDELSNARKVETHGYLSKD  188
            RGDA DEL+NAR V +  +LSKD
Sbjct  411  RGDAVDELTNARGVPSLNWLSKD  433



>ref|XP_002521123.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
 gb|EEF41274.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
Length=467

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMG+GPA AIPAAVK+AGLELD+IDLFEINEAFASQY+YC KKL L
Sbjct  323  GVFRSFAAVGVDPAVMGVGPAFAIPAAVKAAGLELDNIDLFEINEAFASQYVYCCKKLEL  382

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGA+A+GH LGATGARCVATLLHEMKR GKDCR+GV+SMCIGTGMGAA VFE
Sbjct  383  DPEKVNVNGGAIALGHPLGATGARCVATLLHEMKRCGKDCRFGVISMCIGTGMGAAAVFE  442

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD  DEL NAR V  +  LSKDA
Sbjct  443  RGDCVDELCNARPVNGNDLLSKDA  466



>ref|XP_011006998.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=457

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMG+GPA AIPAAV+SAGLEL+DIDLFEINEAFASQY+YC KKL L
Sbjct  313  GVFRSFAAVGVDPAVMGVGPAAAIPAAVQSAGLELNDIDLFEINEAFASQYVYCIKKLEL  372

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGA+A+GH LGATGARCV TLL+EMKRRGKD R+GV+SMCIG+GMGAA VFE
Sbjct  373  DPEKVNVNGGAIALGHPLGATGARCVGTLLNEMKRRGKDSRFGVISMCIGSGMGAAAVFE  432

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  D L N RKVE++  LSKDAR
Sbjct  433  RGDCVDALCNVRKVESNDLLSKDAR  457



>ref|XP_008349047.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA thiolase 2, peroxisomal-like 
[Malus domestica]
Length=292

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDP VMG+GPA AIP AVKSAGLELDDIDLFEINEAFASQY+YC KKL L
Sbjct  148  GVFRSFAAVGVDPTVMGVGPAAAIPVAVKSAGLELDDIDLFEINEAFASQYVYCCKKLEL  207

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGA+A+GH LGATGARCVATLL+EMKRRG+D R+GV+SMCIG+GMGAA VFE
Sbjct  208  DPEKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGRDHRFGVISMCIGSGMGAAAVFE  267

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD+ DEL NAR V ++  +S DA+
Sbjct  268  RGDSVDELCNARTVXSNNLVSNDAK  292



>ref|XP_003570403.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brachypodium 
distachyon]
Length=461

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLE+DDIDLFE+NEAFASQ++YC K LGL
Sbjct  317  GVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLEIDDIDLFELNEAFASQFVYCCKTLGL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D  K+NVNGGA+A+GH LGATGARC+ATLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFE
Sbjct  377  DRSKVNVNGGAIAMGHPLGATGARCIATLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFE  436

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD+ DELSN R V +  +LS+DA+
Sbjct  437  RGDSVDELSNVRHVPSQNFLSRDAK  461



>ref|XP_010935683.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=461

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGL+++DIDLFE+NEAFASQ++YC KKL L
Sbjct  317  GVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLQIEDIDLFELNEAFASQFVYCCKKLEL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGA+A+GH LGATGARCV+TLL+EMKRRGKDCR+GVV+MCIG+GMGAA VFE
Sbjct  377  DPAKVNVNGGAIALGHPLGATGARCVSTLLNEMKRRGKDCRFGVVTMCIGSGMGAAAVFE  436

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  D L NARK+ +   LSKDAR
Sbjct  437  RGDGVDALCNARKIPSQNLLSKDAR  461



>ref|NP_001131193.1| acetyl-CoA C-acyltransferase-like protein [Zea mays]
 gb|ACF79501.1| unknown [Zea mays]
 gb|AFW74042.1| LOW QUALITY PROTEIN: acetyl-CoA C-acyltransferase-like protein 
[Zea mays]
Length=461

 Score =   245 bits (626),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLE+ DIDLFE+NEAFASQ++YC  KLGL
Sbjct  317  GVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLEIGDIDLFELNEAFASQFVYCCNKLGL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D  K+NVNGGA+A+GH LGATGARCVATLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFE
Sbjct  377  DRSKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFE  436

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGDA D LSN R ++ H +LSKDA+
Sbjct  437  RGDAVDGLSNVRDIQAHNFLSKDAK  461



>ref|XP_010940650.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=461

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGL+++DIDLFE+NEAFASQ++YC KKL L
Sbjct  317  GVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLQIEDIDLFELNEAFASQFVYCCKKLEL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGA+A+GH LGATGARCV TLL+EMKRRGKDCR+GVV+MCIG+GMGAA VFE
Sbjct  377  DPAKVNVNGGAIALGHPLGATGARCVGTLLNEMKRRGKDCRFGVVTMCIGSGMGAAAVFE  436

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD  DEL N RK+++   LSKDA
Sbjct  437  RGDGVDELCNTRKIQSQNLLSKDA  460



>ref|XP_008804745.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Phoenix dactylifera]
Length=460

 Score =   244 bits (624),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAAVK+AGL++DDIDLFEINEAFASQ++YC KKL L
Sbjct  316  GVFRSFAAVGVDPAVMGIGPAVAIPAAVKAAGLQIDDIDLFEINEAFASQFVYCCKKLEL  375

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGA+A+GH LGATGAR V+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  376  DPSKVNVNGGAIALGHPLGATGARSVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFE  435

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD  D+LSN R+++++  LSKDA
Sbjct  436  RGDVVDQLSNVRRIQSNNLLSKDA  459



>gb|EYU17978.1| hypothetical protein MIMGU_mgv1a005895mg [Erythranthe guttata]
Length=466

 Score =   244 bits (624),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G+FR+FAAVGVDP VMGIGPAVAIPAAV SAGLE+ DIDLFEINEAFASQ++YC KKL L
Sbjct  322  GIFRSFAAVGVDPGVMGIGPAVAIPAAVNSAGLEIADIDLFEINEAFASQFVYCCKKLDL  381

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGAMA+GH LGATGARCVATLL+EMKRRGKDCR+GV+SMCIG+GMGAA V E
Sbjct  382  DPEKVNVNGGAMALGHPLGATGARCVATLLNEMKRRGKDCRFGVISMCIGSGMGAAAVLE  441

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD  DELSNA+ +    +LSKDA
Sbjct  442  RGDCVDELSNAQAISAQNFLSKDA  465



>ref|XP_010038353.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 ref|XP_010038354.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 gb|KCW50167.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
 gb|KCW50168.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=466

 Score =   244 bits (624),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGL LDDIDL EINEAFASQY+YC KKLGL
Sbjct  322  GVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLTLDDIDLLEINEAFASQYVYCCKKLGL  381

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGA+A+GH LGATGARCVATLL+EMKR+G+D R+GV+SMCIG+GMGAA VFE
Sbjct  382  DPEKVNVNGGALALGHPLGATGARCVATLLNEMKRQGRDSRFGVISMCIGSGMGAAAVFE  441

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DEL NAR ++ +  LS+DA+
Sbjct  442  RGDCADELCNARPIKINNLLSRDAQ  466



>ref|NP_001241698.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor [Zea mays]
 gb|ACG36949.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor [Zea mays]
Length=461

 Score =   244 bits (623),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLE+ DIDLFE+NEAFASQ++YC  KLGL
Sbjct  317  GVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLEIGDIDLFELNEAFASQFVYCCNKLGL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D  K+NVNGGA+A+GH LGATGARCVATLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFE
Sbjct  377  DRSKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFE  436

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGDA D LSN R ++ H +LSKDA+
Sbjct  437  RGDAVDGLSNVRDMQAHNFLSKDAK  461



>ref|XP_004982961.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Setaria 
italica]
Length=461

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAAV++AGL++ DIDLFEINEAFASQY+YC KKL L
Sbjct  317  GVFRSFAAVGVDPAVMGIGPAVAIPAAVQAAGLQIGDIDLFEINEAFASQYVYCCKKLEL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGA+A+GH LGATGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  377  DPTKVNVNGGAIALGHPLGATGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFE  436

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD  DEL+NAR + +  +LSKDA
Sbjct  437  RGDGVDELTNARDIPSLNWLSKDA  460



>ref|XP_010933143.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=460

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+F AVGVDPAVMGIGPAVAIPAAVK+AGL++DDIDLFEINEAFASQ++YC KKL L
Sbjct  316  GVFRSFGAVGVDPAVMGIGPAVAIPAAVKAAGLQIDDIDLFEINEAFASQFVYCCKKLEL  375

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGA+A+GH LGATGARCV TLL+EMKRRGK CR+GV+SMCIG+GMGAA VFE
Sbjct  376  DPSKVNVNGGAIALGHPLGATGARCVITLLNEMKRRGKKCRFGVISMCIGSGMGAAAVFE  435

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD  D+LSNAR++++   LSKDA
Sbjct  436  RGDVVDQLSNARRIQSTSLLSKDA  459



>ref|XP_008804452.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Phoenix 
dactylifera]
Length=460

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAAV +AGL+ DDIDLFEINEAFASQ++YC KKL L
Sbjct  316  GVFRSFAAVGVDPAVMGIGPAVAIPAAVNAAGLQTDDIDLFEINEAFASQFVYCCKKLEL  375

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGA+A+GH LG TGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  376  DPSKVNVNGGALALGHPLGDTGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFE  435

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD  D+LSNAR++ ++  LSKDA
Sbjct  436  RGDVVDQLSNARRIRSNNLLSKDA  459



>gb|KJB10128.1| hypothetical protein B456_001G185200 [Gossypium raimondii]
Length=465

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAA+KSAGLELDDIDLFEINEAFASQ++Y  KKLGL
Sbjct  321  GVFRSFAAVGVDPAVMGIGPAVAIPAAIKSAGLELDDIDLFEINEAFASQFVYSCKKLGL  380

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+A+GH LGATGARCV TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  381  DREKVNVNGGAIALGHPLGATGARCVGTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFE  440

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  D+  NAR V+ +  LSKDAR
Sbjct  441  RGDCVDDFCNARAVQKNDLLSKDAR  465



>ref|XP_007049825.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
 gb|EOX93982.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
Length=470

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAG+EL DIDLFEINEAFASQY+YC KKL L
Sbjct  326  GVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGIELADIDLFEINEAFASQYVYCCKKLEL  385

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+A+GH LGATGARCV TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  386  DSEKVNVNGGAIALGHPLGATGARCVGTLLYEMKRRGKDCRFGVISMCIGSGMGAAAVFE  445

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  DE  N R V+ + +LSKDAR
Sbjct  446  RGDCVDEFCNVRAVKYNEFLSKDAR  470



>ref|XP_009411367.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=459

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGV+P VMGIGPAVAIPAAV++AGL+ DDID+FEINEAFASQ++YC KKL L
Sbjct  315  GVFRSFAAVGVEPGVMGIGPAVAIPAAVRAAGLQPDDIDIFEINEAFASQFVYCCKKLEL  374

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGA+A+GH LGATGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  375  DPEKVNVNGGAIALGHPLGATGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFE  434

Query  256  RGDACDELSNARKVETHGYLSKDA  185
             GD  D+L+NAR+VE + +LSKDA
Sbjct  435  HGDVVDQLTNARQVEANSFLSKDA  458



>ref|XP_003574006.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Brachypodium 
distachyon]
Length=453

 Score =   242 bits (617),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G++R+FAAVGVDPAVMG+GPAVAIPAAVK+AGL+++D+DLFEINEAFASQ++YC KKL L
Sbjct  309  GIYRSFAAVGVDPAVMGVGPAVAIPAAVKAAGLQINDVDLFEINEAFASQFVYCAKKLEL  368

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP KINVNGGAMA+GH LGATGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  369  DPVKINVNGGAMALGHPLGATGARCVSTLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFE  428

Query  256  RGDACDELSNARKVETHGYLSKD  188
            RGDA DEL+NAR   +   LSKD
Sbjct  429  RGDAVDELTNARGTPSLNLLSKD  451



>ref|XP_009385864.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=463

 Score =   242 bits (617),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGL+++DIDLFEINEAFASQ++YC KKL L
Sbjct  318  GVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLQIEDIDLFEINEAFASQFVYCCKKLEL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D  K+NVNGGA+A+GH LGATGAR V+TLL+EMKRRGKDCR GV+SMCIGTGMGAA VFE
Sbjct  378  DATKVNVNGGAIALGHPLGATGARSVSTLLNEMKRRGKDCRLGVISMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGDA D L+NAR++++H  LSKDA
Sbjct  438  RGDATDGLTNARRMQSHNLLSKDA  461



>ref|XP_010484155.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=440

 Score =   241 bits (615),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDP +MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQY+YC+ KLGL
Sbjct  307  GVFRTFAAVGVDPEIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQYVYCRNKLGL  366

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            +PEKINVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFE
Sbjct  367  NPEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFE  426

Query  256  RGDACDELSNA  224
            RG + DEL N+
Sbjct  427  RGGSVDELPNS  437



>gb|KHG11493.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=463

 Score =   241 bits (616),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAA+KSAGLELDDIDLFEINEAFASQ++Y  KKLGL
Sbjct  320  GVFRSFAAVGVDPAVMGIGPAVAIPAAIKSAGLELDDIDLFEINEAFASQFVYSCKKLGL  379

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+A+GH LGATGARCV TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  380  DREKVNVNGGAIALGHPLGATGARCVGTLLNEMKRRGKDCRFGVISMCIGSGMGAASVFE  439

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD  DE  NAR V  +  LSKDA
Sbjct  440  RGDCVDEFCNARAVHKNELLSKDA  463



>ref|XP_011083116.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Sesamum indicum]
Length=463

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G+FR+FAAVGVDP VMGIGPAVAIP AVKSAGLEL DIDLFEINEAFASQ++YC KKL L
Sbjct  319  GIFRSFAAVGVDPGVMGIGPAVAIPPAVKSAGLELSDIDLFEINEAFASQFVYCCKKLDL  378

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGAMA+GH LGATGARCVATLL+EMKRRGKDCR+GV+SMCIG+GMGAA V E
Sbjct  379  DREKVNVNGGAMALGHPLGATGARCVATLLNEMKRRGKDCRFGVISMCIGSGMGAAAVLE  438

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD  D+L NAR V  + +LSKDA
Sbjct  439  RGDCVDDLCNARAVSENNFLSKDA  462



>gb|ABR17647.1| unknown [Picea sitchensis]
Length=462

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+F AVGVDPAVMG+GPAVAIPAAVK+AGLE+DDIDLFEINEAFASQ+ YC +KL L
Sbjct  318  GVFRSFTAVGVDPAVMGVGPAVAIPAAVKAAGLEIDDIDLFEINEAFASQFTYCSQKLEL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGA+A+GH LGATGA CVATLLHEMK RGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  378  DPEKVNVNGGAIALGHPLGATGALCVATLLHEMKLRGKDCRFGVISMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            R  A D+L NAR ++ H  LS+DA+
Sbjct  438  RSGAVDQLCNARPIKDHTSLSRDAQ  462



>ref|XP_002889522.1| hypothetical protein ARALYDRAFT_470458 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65781.1| hypothetical protein ARALYDRAFT_470458 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLEL+DIDLFEINEAFASQ++YC+ KLG+
Sbjct  284  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELNDIDLFEINEAFASQFVYCRNKLGI  343

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFE
Sbjct  344  DPEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFE  403

Query  256  RGDACDELSNARKV  215
            RG   DEL + RKV
Sbjct  404  RGGGVDELCDVRKV  417



>ref|XP_010484150.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=446

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDP +MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQY+YC+ KLGL
Sbjct  313  GVFRTFAAVGVDPEIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQYVYCRNKLGL  372

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            +PEKINVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFE
Sbjct  373  NPEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFE  432

Query  256  RGDACDELSNA  224
            RG + DEL N+
Sbjct  433  RGGSVDELPNS  443



>ref|XP_001762605.1| predicted protein [Physcomitrella patens]
 gb|EDQ72728.1| predicted protein [Physcomitrella patens]
Length=455

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDP+VMGIGPAVAIPAAVK+AGLEL DIDLFEINEAFASQ+ YC ++LGL
Sbjct  311  GVFRSFAAVGVDPSVMGIGPAVAIPAAVKAAGLELSDIDLFEINEAFASQFTYCAQELGL  370

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGAMA+GH LGATGARC ATLLHEMK+RGKDCR+G+VSMCIG+GMGAA VFE
Sbjct  371  DEEKVNVNGGAMALGHPLGATGARCTATLLHEMKKRGKDCRFGIVSMCIGSGMGAAAVFE  430

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            +G A D LSNAR V  +  LS+DA+
Sbjct  431  QGGAIDPLSNARAVGQNNLLSRDAK  455



>pdb|2C7Y|A Chain A, Plant Enzyme
 pdb|2C7Y|B Chain B, Plant Enzyme
 pdb|2C7Z|A Chain A, Plant Enzyme Crystal Form Ii
Length=404

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/123 (93%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  281  GVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  340

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGAMAIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  341  DPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  400

Query  256  RGD  248
            RGD
Sbjct  401  RGD  403



>ref|XP_002963753.1| hypothetical protein SELMODRAFT_450889 [Selaginella moellendorffii]
 gb|EFJ35624.1| hypothetical protein SELMODRAFT_450889 [Selaginella moellendorffii]
Length=462

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIP AVK AGLE+ DIDLFE+NEAFASQ+ Y  KKL L
Sbjct  318  GVFRSFAAVGVDPAVMGIGPAVAIPKAVKDAGLEISDIDLFELNEAFASQFTYSCKKLDL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGAMA+GH LGATGARCVATLLHEM +RGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  378  DIEKVNVNGGAMALGHPLGATGARCVATLLHEMSKRGKDCRFGVISMCIGSGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RG+A D LSNAR V+ +  LSKDAR
Sbjct  438  RGNAVDNLSNARPVQNNSLLSKDAR  462



>ref|XP_006307517.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
 gb|EOA40415.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
Length=444

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MGIGPAVAIP AVK+A LELDDIDLFEINEAFASQ++YC+ KLG+
Sbjct  310  GVFRTFAAVGVDPAIMGIGPAVAIPTAVKAASLELDDIDLFEINEAFASQFVYCRNKLGI  369

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            +PEKINVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFE
Sbjct  370  NPEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFE  429

Query  256  RGDACDELSN  227
            RGD+ DEL N
Sbjct  430  RGDSVDELRN  439



>ref|XP_010457531.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal [Camelina sativa]
Length=439

 Score =   239 bits (611),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPA+AIPAAVK+AGLELDDIDLFEINEAFASQY+YC+ KLGL
Sbjct  307  GVFRTFAAVGVDPAIMGVGPALAIPAAVKAAGLELDDIDLFEINEAFASQYVYCRNKLGL  366

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            +PE INVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFE
Sbjct  367  NPENINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFE  426

Query  256  RGDACDELSNARK  218
            RG + DEL N  +
Sbjct  427  RGGSVDELPNVSR  439



>emb|CDP03848.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G+FR+F+  GVDPAVMGIGPAVAIPAA KSAGL +DDIDLFEINEAFASQY+YC KKL L
Sbjct  322  GIFRSFSVAGVDPAVMGIGPAVAIPAAAKSAGLGVDDIDLFEINEAFASQYVYCCKKLEL  381

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGAMA+GH LGATGARCVATLLHEMKRRG+DCR+GV+SMCIG+GMGAAGVFE
Sbjct  382  DMEKVNVNGGAMALGHPLGATGARCVATLLHEMKRRGRDCRFGVISMCIGSGMGAAGVFE  441

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD+ D+L NAR V     LSKD +
Sbjct  442  RGDSTDDLCNARPVSKVNLLSKDVK  466



>gb|EMS48058.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Triticum urartu]
Length=453

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -1

Query  607  RTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPE  428
            R+FAAVGVDPAVMG+GPAVAIPAAVKSAGL++DDIDLFE+NEAFASQ++YC  KLGLD  
Sbjct  311  RSFAAVGVDPAVMGVGPAVAIPAAVKSAGLDIDDIDLFELNEAFASQFVYCCNKLGLDRS  370

Query  427  KINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  248
            K+NVNGGA+A+GH LGATGARC++TLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFERGD
Sbjct  371  KVNVNGGAIAMGHPLGATGARCISTLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFERGD  430

Query  247  ACDELSNARKVETHGYLSKDA  185
            + DELSN R +++H +LSKDA
Sbjct  431  SVDELSNVRHIQSHNFLSKDA  451



>ref|XP_010547052.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X3 
[Tarenaya hassleriana]
Length=426

 Score =   239 bits (610),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FA  GVDPAVMG+GPA AIPAA K AGL + DIDLFEINEAFASQ++Y  KKL L
Sbjct  282  GVFRSFAVTGVDPAVMGVGPAFAIPAAAKLAGLRVSDIDLFEINEAFASQFVYSCKKLEL  341

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+A+GH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  342  DREKVNVNGGAIALGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  401

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGDA D+LSNAR V  +G+LSKDA+
Sbjct  402  RGDAVDDLSNARTVNLNGHLSKDAK  426



>ref|XP_002974835.1| hypothetical protein SELMODRAFT_101898 [Selaginella moellendorffii]
 gb|EFJ24355.1| hypothetical protein SELMODRAFT_101898 [Selaginella moellendorffii]
Length=454

 Score =   239 bits (610),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIP AVK AGLE+ DIDLFE+NEAFASQ+ Y  KKL L
Sbjct  310  GVFRSFAAVGVDPAVMGIGPAVAIPKAVKDAGLEISDIDLFELNEAFASQFTYSCKKLDL  369

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+A+GH LGATGARCVATLLHEM +RGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  370  DMEKVNVNGGAIALGHPLGATGARCVATLLHEMSKRGKDCRFGVISMCIGSGMGAAAVFE  429

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RG+A D LSNAR V+ +  LSKDAR
Sbjct  430  RGNAVDNLSNARPVQNNSLLSKDAR  454



>ref|XP_008372446.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Malus domestica]
Length=453

 Score =   239 bits (610),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMG+GPA AIP AVKSAGLE+DDIDLFEINEAFASQY+YC KKL L
Sbjct  320  GVFRSFAAVGVDPAVMGVGPAAAIPVAVKSAGLEIDDIDLFEINEAFASQYVYCVKKLEL  379

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGA+A+GH LGATGARCVATLL+EMKRRGKD R+GV+SMCIG+GMGAA VFE
Sbjct  380  DPEKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGKDNRFGVISMCIGSGMGAAAVFE  439

Query  256  RGDACDELSNARKV  215
            RGD+ DELSNAR V
Sbjct  440  RGDSVDELSNARAV  453



>ref|XP_010109695.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
 gb|EXC24165.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
Length=452

 Score =   239 bits (610),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLEL+DIDLFEINEAFASQY+YC KKLGL
Sbjct  319  GVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLELNDIDLFEINEAFASQYVYCIKKLGL  378

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGA+A+GH LGATGAR V+TLL+EMKRRGKDCR+G++SMCIG+GMGAA V E
Sbjct  379  DPEKVNVNGGALALGHPLGATGARSVSTLLNEMKRRGKDCRFGIISMCIGSGMGAAAVLE  438

Query  256  RGDACDELSNAR  221
            RGD+ DEL NAR
Sbjct  439  RGDSVDELRNAR  450



>ref|XP_010547051.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Tarenaya hassleriana]
Length=468

 Score =   239 bits (611),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FA  GVDPAVMG+GPA AIPAA K AGL + DIDLFEINEAFASQ++Y  KKL L
Sbjct  324  GVFRSFAVTGVDPAVMGVGPAFAIPAAAKLAGLRVSDIDLFEINEAFASQFVYSCKKLEL  383

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+A+GH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  384  DREKVNVNGGAIALGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  443

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGDA D+LSNAR V  +G+LSKDA+
Sbjct  444  RGDAVDDLSNARTVNLNGHLSKDAK  468



>ref|XP_010547050.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Tarenaya hassleriana]
Length=474

 Score =   239 bits (610),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FA  GVDPAVMG+GPA AIPAA K AGL + DIDLFEINEAFASQ++Y  KKL L
Sbjct  330  GVFRSFAVTGVDPAVMGVGPAFAIPAAAKLAGLRVSDIDLFEINEAFASQFVYSCKKLEL  389

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+A+GH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  390  DREKVNVNGGAIALGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  449

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGDA D+LSNAR V  +G+LSKDA+
Sbjct  450  RGDAVDDLSNARTVNLNGHLSKDAK  474



>ref|XP_010475137.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like [Camelina 
sativa]
Length=446

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQY+YC+ KLG+
Sbjct  306  GVFRSFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQYVYCRNKLGI  365

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            +PEKINVNGGA+AIGH LGATGARCVATLLHEMKRRGK CR+GVVSMCIG+GMGAA VFE
Sbjct  366  NPEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKYCRFGVVSMCIGSGMGAAAVFE  425

Query  256  RGDACDELSNARKVE  212
            RG + DEL N  K E
Sbjct  426  RGGSVDELRNVSKGE  440



>ref|XP_009371217.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Pyrus x bretschneideri]
Length=453

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMG+GPA AIP AVKSAGLELDDIDLFE+NEAFASQY+YC KKL L
Sbjct  320  GVFRSFAAVGVDPAVMGVGPAAAIPVAVKSAGLELDDIDLFEMNEAFASQYVYCIKKLEL  379

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGA+A+GH LGATGARCVATLL+EMKRRGKD R+GV+SMCIG+GMGAA VFE
Sbjct  380  DPEKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGKDNRFGVISMCIGSGMGAAAVFE  439

Query  256  RGDACDELSNARKV  215
            RGD+ DELSNAR V
Sbjct  440  RGDSVDELSNARAV  453



>ref|XP_001764272.1| predicted protein [Physcomitrella patens]
 gb|EDQ70826.1| predicted protein [Physcomitrella patens]
Length=460

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAA+K+AGLE++DIDLFEINEAFASQ+ YC ++LGL
Sbjct  316  GVFRSFAAVGVDPAVMGIGPAVAIPAAIKAAGLEINDIDLFEINEAFASQFTYCAQELGL  375

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EKINVNGGA+A+GH LGATGARC ATLLHEMK+RGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  376  DEEKINVNGGAIALGHPLGATGARCTATLLHEMKKRGKDCRFGVISMCIGSGMGAAAVFE  435

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            +G A D LSN R V  +  LS+DA+
Sbjct  436  QGGAIDPLSNVRAVGQNNLLSRDAK  460



>gb|KDP26413.1| hypothetical protein JCGZ_17571 [Jatropha curcas]
Length=452

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMG+GPA AIPAAVK+AGLEL+DI LFEINEAFASQY+YC KKLGL
Sbjct  322  GVFRSFAAVGVDPAVMGVGPAYAIPAAVKAAGLELNDISLFEINEAFASQYVYCIKKLGL  381

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGA+A+GH LGATGARCV+T+LHEMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  382  DPEKVNVNGGALALGHPLGATGARCVSTILHEMKRRGKDCRFGVISMCIGSGMGAAAVFE  441

Query  256  RGDACDELSNA  224
            RGD  DELS+A
Sbjct  442  RGDGVDELSSA  452



>ref|NP_171965.1| 3-ketoacyl-CoA thiolase 1 [Arabidopsis thaliana]
 sp|Q8LF48.2|THIK1_ARATH RecName: Full=3-ketoacyl-CoA thiolase 1, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 1; AltName: Full=Beta-ketothiolase 
1; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM20592.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
 gb|AAO30078.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
 gb|AEE27736.1| 3-ketoacyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=443

 Score =   237 bits (604),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTF+AVGVDPA+MG+GPAVAIPAAVK+AGLEL+D+DLFEINEAFASQ++YC+ KLGL
Sbjct  310  GVFRTFSAVGVDPAIMGVGPAVAIPAAVKAAGLELNDVDLFEINEAFASQFVYCRNKLGL  369

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EKINVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFE
Sbjct  370  DAEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFE  429

Query  256  RGDACDELSNARKV  215
            RG   DEL + RKV
Sbjct  430  RGGGVDELCDVRKV  443



>gb|KJB42403.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=372

 Score =   234 bits (598),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLE+DDIDLFEINEAFASQ++Y  KKLGL
Sbjct  237  GVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLEIDDIDLFEINEAFASQFVYSCKKLGL  296

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+A+GH LG TGARCV TLL+EMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  297  DREKVNVNGGAIALGHPLGVTGARCVGTLLYEMKRRGKDCRFGVISMCIGTGMGAAAVFE  356

Query  256  RGDACDELSNARKVET  209
            RGD  DEL NAR V+ 
Sbjct  357  RGDCVDELCNARAVKN  372



>ref|XP_009336047.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Pyrus 
x bretschneideri]
Length=443

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMG+GPA AIP AVKS GLELDDIDLFEINEAFASQY+YC KKLGL
Sbjct  310  GVFRSFAAVGVDPAVMGVGPAAAIPVAVKSPGLELDDIDLFEINEAFASQYVYCCKKLGL  369

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGA+A+GH LGATGARCVATLL+EMKRRG+D R+GV+SMCIG+GMGAA VFE
Sbjct  370  DPEKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGRDHRFGVISMCIGSGMGAAAVFE  429

Query  256  RGDACDELSNARKV  215
            RGD+ DEL NAR V
Sbjct  430  RGDSVDELCNARTV  443



>gb|AAB80634.1| Strong similarity to Cucumis acetyl-CoA acyltransferase (gb|D70895) 
[Arabidopsis thaliana]
Length=460

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTF+AVGVDPA+MG+GPAVAIPAAVK+AGLEL+D+DLFEINEAFASQ++YC+ KLGL
Sbjct  327  GVFRTFSAVGVDPAIMGVGPAVAIPAAVKAAGLELNDVDLFEINEAFASQFVYCRNKLGL  386

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EKINVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFE
Sbjct  387  DAEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFE  446

Query  256  RGDACDELSNARKV  215
            RG   DEL + RKV
Sbjct  447  RGGGVDELCDVRKV  460



>emb|CDX86611.1| BnaC08g00920D [Brassica napus]
Length=451

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPAVMG+GPA AIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  317  GVFRTFAAVGVDPAVMGVGPAAAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GVV+MCIG+GMGAAGVFE
Sbjct  377  DPEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVTMCIGSGMGAAGVFE  436

Query  256  RGDACDELSNARKVE  212
            RGD  DELSN RKVE
Sbjct  437  RGDGVDELSNVRKVE  451



>gb|KJB42405.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=454

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLE+DDIDLFEINEAFASQ++Y  KKLGL
Sbjct  319  GVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLEIDDIDLFEINEAFASQFVYSCKKLGL  378

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+A+GH LG TGARCV TLL+EMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  379  DREKVNVNGGAIALGHPLGVTGARCVGTLLYEMKRRGKDCRFGVISMCIGTGMGAAAVFE  438

Query  256  RGDACDELSNARKVET  209
            RGD  DEL NAR V+ 
Sbjct  439  RGDCVDELCNARAVKN  454



>gb|AAM61609.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
Length=443

 Score =   234 bits (597),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTF+AVGVDPA+MG+GPAVAIPAAVK+AGLEL+D+DLFEINEAFASQ++YC+ KLG 
Sbjct  310  GVFRTFSAVGVDPAIMGVGPAVAIPAAVKAAGLELNDVDLFEINEAFASQFVYCRNKLGQ  369

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EKINVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFE
Sbjct  370  DAEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFE  429

Query  256  RGDACDELSNARKV  215
            RG   DEL + RKV
Sbjct  430  RGGDVDELCDVRKV  443



>gb|KHG13200.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
 gb|KHG18802.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=454

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLE+DDIDLFEINEAFASQ++Y  KKLGL
Sbjct  319  GVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLEIDDIDLFEINEAFASQFVYSCKKLGL  378

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+A+GH LG TGARCV TLL+EMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  379  DREKVNVNGGAIALGHPLGVTGARCVGTLLNEMKRRGKDCRFGVISMCIGTGMGAAAVFE  438

Query  256  RGDACDELSNARKVET  209
            RGD  DEL NAR V+ 
Sbjct  439  RGDCVDELCNARAVKN  454



>ref|XP_008438387.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Cucumis melo]
Length=462

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 135/146 (92%), Gaps = 1/146 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTF+AVGVDPA+MG+GPA AIPAAVK+AGLEL+DIDLFEINEAFASQ++YC++KLGL
Sbjct  317  GVFRTFSAVGVDPAIMGVGPAAAIPAAVKAAGLELNDIDLFEINEAFASQFVYCREKLGL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEKINVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  377  DPEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  436

Query  256  RGDACDELSNARKVETH-GYLSKDAR  182
            RGD  DEL NA+KVE     LSKDAR
Sbjct  437  RGDCVDELCNAKKVEGGVNLLSKDAR  462



>ref|XP_009111084.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal [Brassica rapa]
Length=451

 Score =   234 bits (597),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPAVMG+GPA AIPAAVK+AGLE+DDIDLFEINEAFASQ++YC+ KLGL
Sbjct  317  GVFRTFAAVGVDPAVMGVGPAAAIPAAVKAAGLEVDDIDLFEINEAFASQFVYCRNKLGL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP+KINVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAAGVFE
Sbjct  377  DPQKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAGVFE  436

Query  256  RGDACDELSNARKVE  212
            RGD  DELSN RKVE
Sbjct  437  RGDGVDELSNVRKVE  451



>dbj|BAD94007.1| peroxisomal-3-keto-acyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=213

 Score =   226 bits (576),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FA  GV+P+VMGIGPAVAIPAA K AGL + DIDLFEINEAFASQY+Y  KKL L
Sbjct  75   GVFRSFAVTGVEPSVMGIGPAVAIPAATKLAGLNVSDIDLFEINEAFASQYVYSCKKLEL  134

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  135  DMEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  194

Query  256  RGDACDELSNAR  221
            RGD+ D LSNAR
Sbjct  195  RGDSVDNLSNAR  206



>emb|CDY15520.1| BnaA08g28040D [Brassica napus]
Length=451

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPAVMG+GPA AIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  317  GVFRTFAAVGVDPAVMGVGPAAAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
             PEKINVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAAGVFE
Sbjct  377  VPEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAGVFE  436

Query  256  RGDACDELSNARKVE  212
            RGD  DELSN RKVE
Sbjct  437  RGDGVDELSNVRKVE  451



>ref|XP_004290230.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Fragaria 
vesca subsp. vesca]
Length=456

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMG+GPA AIP AVKSAGLEL DIDLFEINEAFASQY+YCQKKL L
Sbjct  322  GVFRSFAAVGVDPAVMGVGPAAAIPVAVKSAGLELGDIDLFEINEAFASQYVYCQKKLEL  381

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D +K+NVNGGA+A+GH LGATGARCVATLL+EMKRRGKDCR+GV+SMCIG+GMGAA V E
Sbjct  382  DSDKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGKDCRFGVISMCIGSGMGAAAVLE  441

Query  256  RGDACDELSNAR  221
            RGD+ DEL NAR
Sbjct  442  RGDSVDELCNAR  453



>gb|ACA58356.1| 3-ketoacyl-CoA thiolase [Arachis diogoi]
Length=127

 Score =   221 bits (563),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  559  PAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHSLG  380
            PA AIP AVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLD EKINVNGGAMA+GH LG
Sbjct  2    PAAAIPVAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMALGHPLG  61

Query  379  ATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  200
            ATGARC ATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DELSNARKV T+  
Sbjct  62   ATGARCTATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDGVDELSNARKVATNNL  121

Query  199  LSKDAR  182
            LSKDAR
Sbjct  122  LSKDAR  127



>emb|CDY05657.1| BnaC02g38800D [Brassica napus]
Length=462

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 124/138 (90%), Gaps = 1/138 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G+FR+FA  GVDPAVMGIGPA AIPAA   AGL++ DIDLFEINEAFASQY+YC KKL L
Sbjct  323  GIFRSFAVTGVDPAVMGIGPAYAIPAAANLAGLKVSDIDLFEINEAFASQYVYCCKKLEL  382

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  383  DVEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  442

Query  256  RGDACDELSNARKVETHG  203
            RGD+ D+LSNAR VET+G
Sbjct  443  RGDSVDDLSNAR-VETNG  459



>gb|ACU19231.1| unknown [Glycine max]
Length=198

 Score =   223 bits (567),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G+FR+FAAVGVDPAVMG+GPAVAIPAAVKS GLEL +IDLFEINEAFASQY+YC KKLGL
Sbjct  75   GIFRSFAAVGVDPAVMGVGPAVAIPAAVKSVGLELGNIDLFEINEAFASQYVYCLKKLGL  134

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGA+A+GH LG TGARCVATLL EMKRRGKDCRYGV+SMCIG+GMGAA VFE
Sbjct  135  DPRKVNVNGGAIALGHPLGVTGARCVATLLSEMKRRGKDCRYGVISMCIGSGMGAAAVFE  194

Query  256  RGD  248
            RGD
Sbjct  195  RGD  197



>ref|XP_002865685.1| KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA thiolase [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH41944.1| KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA thiolase [Arabidopsis 
lyrata subsp. lyrata]
Length=457

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FA  GVDP+VMGIGPAVAIPAA K AGL + DIDLFEINEAFASQY+YC KKL L
Sbjct  319  GVFRSFAVTGVDPSVMGIGPAVAIPAATKLAGLNVSDIDLFEINEAFASQYVYCCKKLEL  378

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  379  DMEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  438

Query  256  RGDACDELSNAR  221
            RGD+ D LSNAR
Sbjct  439  RGDSVDNLSNAR  450



>ref|XP_008365692.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like, partial 
[Malus domestica]
Length=162

 Score =   221 bits (562),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDP VMG+GPA AIP AVKSAGLELDDIDLFEINEAFASQY+YC KKL L
Sbjct  29   GVFRSFAAVGVDPTVMGVGPAAAIPVAVKSAGLELDDIDLFEINEAFASQYVYCCKKLEL  88

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+N NGGA+A+GH LGATGARCVAT L+EMKRRG+D  +GV SMCIG+GM AA VFE
Sbjct  89   DPEKVNXNGGAIALGHPLGATGARCVATXLNEMKRRGRDHXFGVXSMCIGSGMXAAAVFE  148

Query  256  RGDACDELSNARKV  215
            RGD+ DEL NAR V
Sbjct  149  RGDSVDELCNARTV  162



>ref|XP_010684942.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Beta vulgaris 
subsp. vulgaris]
Length=453

 Score =   229 bits (585),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPA AIPAAVKSAGL+LDDI+LFEINEAFASQY+YC KKL L
Sbjct  316  GVFRSFAAVGVDPAVMGIGPAFAIPAAVKSAGLKLDDINLFEINEAFASQYVYCCKKLNL  375

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGA+A+GH LGATGARCVATLL+EM RRG DCR+GV+SMCIG+GMGAA VFE
Sbjct  376  DPAKVNVNGGALALGHPLGATGARCVATLLNEMNRRGTDCRFGVISMCIGSGMGAAAVFE  435

Query  256  RGDACDELSNARKVETH  206
            RGD  + L+N R  +T+
Sbjct  436  RGDHANGLTNTRAAQTN  452



>ref|XP_009129751.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Brassica rapa]
Length=415

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FA  GVDPAVMGIGPA AIPAA   AGL++ DIDLFEINEAFASQY+YC KKL L
Sbjct  276  GVFRSFAVTGVDPAVMGIGPAYAIPAAANLAGLKVSDIDLFEINEAFASQYVYCCKKLEL  335

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  336  DVEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  395

Query  256  RGDACDELSNARKV  215
            RGD+ D+LSNAR V
Sbjct  396  RGDSVDDLSNARVV  409



>gb|AIB06952.1| 3-ketoacyl-CoA thiolase [Vanda hybrid cultivar]
Length=450

 Score =   229 bits (583),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G+FR+FAAVGVDPAVMGIGPAVAIPAAVK+AGL++ DIDL+EINEAFASQ++YC K+LGL
Sbjct  315  GIFRSFAAVGVDPAVMGIGPAVAIPAAVKAAGLQIKDIDLYEINEAFASQFVYCIKELGL  374

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGA+A+GH LGATGARCV+TLL+EMKRRG DCR+G++SMCIG+GMGAA VFE
Sbjct  375  DPEKVNVNGGAIALGHPLGATGARCVSTLLNEMKRRGNDCRFGIISMCIGSGMGAAAVFE  434

Query  256  RGDACDELSNAR  221
            RGD  D LSN +
Sbjct  435  RGDVADRLSNVQ  446



>emb|CDY33940.1| BnaA02g30470D [Brassica napus]
Length=456

 Score =   229 bits (583),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FA  GVDPAVMGIGPA AIPAA   AGL++ DIDLFEINEAFASQY+YC KKL L
Sbjct  317  GVFRSFAVTGVDPAVMGIGPAYAIPAAANLAGLKVSDIDLFEINEAFASQYVYCCKKLEL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  377  DVEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  436

Query  256  RGDACDELSNARKV  215
            RGD+ D+LSNAR V
Sbjct  437  RGDSVDDLSNARVV  450



>ref|XP_009129750.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Brassica rapa]
Length=456

 Score =   229 bits (583),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FA  GVDPAVMGIGPA AIPAA   AGL++ DIDLFEINEAFASQY+YC KKL L
Sbjct  317  GVFRSFAVTGVDPAVMGIGPAYAIPAAANLAGLKVSDIDLFEINEAFASQYVYCCKKLEL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  377  DVEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  436

Query  256  RGDACDELSNARKV  215
            RGD+ D+LSNAR V
Sbjct  437  RGDSVDDLSNARVV  450



>ref|XP_006649171.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Oryza 
brachyantha]
Length=449

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGL+++DIDLFE+NEAFASQ++YC  KLGL
Sbjct  316  GVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLQIEDIDLFELNEAFASQFVYCCNKLGL  375

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D  K+NVNGGA+A+GH LGATGARCVATLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFE
Sbjct  376  DRSKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFE  435

Query  256  RGDACDELSNAR  221
            RGD+ D+ SN R
Sbjct  436  RGDSVDQFSNVR  447



>gb|KJB42404.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=453

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 123/136 (90%), Gaps = 1/136 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVF +FAAVGVDPAVMGIGPAVAIPAAVKSAGLE+DDIDLFEINEAFASQ++Y  KKLGL
Sbjct  319  GVF-SFAAVGVDPAVMGIGPAVAIPAAVKSAGLEIDDIDLFEINEAFASQFVYSCKKLGL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+A+GH LG TGARCV TLL+EMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  378  DREKVNVNGGAIALGHPLGVTGARCVGTLLYEMKRRGKDCRFGVISMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVET  209
            RGD  DEL NAR V+ 
Sbjct  438  RGDCVDELCNARAVKN  453



>ref|XP_006395130.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
 gb|ESQ32416.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
Length=414

 Score =   226 bits (575),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G+FR+FA  GV+PAVMG+GPA AIPAA   AGL++ DIDLFEINEAFASQY+YC KKL L
Sbjct  276  GIFRSFAVTGVEPAVMGVGPAYAIPAATNLAGLKVSDIDLFEINEAFASQYVYCCKKLEL  335

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  336  DLEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  395

Query  256  RGDACDELSNARKVETHGY  200
            RGD+ DELSNA+     G+
Sbjct  396  RGDSVDELSNAQVANGDGH  414



>ref|XP_009336051.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Pyrus 
x bretschneideri]
Length=453

 Score =   226 bits (577),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAA+GVDPAVMG+GPA AIP AVKSAGLELDDIDLFEINEAFASQY+YC KKLGL
Sbjct  320  GVFRSFAAIGVDPAVMGVGPAAAIPVAVKSAGLELDDIDLFEINEAFASQYVYCCKKLGL  379

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGA+A+GH LGAT    VATLL+EMKRRG+D R+GV+SMCIG+GMGAA VFE
Sbjct  380  DPEKVNVNGGAIALGHPLGATXXXXVATLLNEMKRRGRDHRFGVISMCIGSGMGAAAVFE  439

Query  256  RGDACDELSNARKV  215
            RGD+ DEL NAR V
Sbjct  440  RGDSVDELCNARTV  453



>ref|XP_010439770.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Camelina sativa]
Length=414

 Score =   225 bits (574),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FA  GVDP+VMGIGPAVAIPAA   AGL + DIDLFEINEAFASQY+Y  KKL L
Sbjct  276  GVFRSFAVTGVDPSVMGIGPAVAIPAATNLAGLNVSDIDLFEINEAFASQYVYSCKKLDL  335

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D +K+NVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  336  DMKKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  395

Query  256  RGDACDELSNARKVETHGY  200
            RGD+ D LSNAR     G+
Sbjct  396  RGDSVDNLSNARVANGEGH  414



>ref|NP_001048523.1| Os02g0817700 [Oryza sativa Japonica Group]
 gb|AAO72588.1| 3-ketoacyl-CoA thiolase-like protein [Oryza sativa Japonica Group]
 dbj|BAD21525.1| putative 3-ketoacyl-CoA thiolase; acetyl-CoA acyltransferase 
[Oryza sativa Japonica Group]
 dbj|BAF10437.1| Os02g0817700 [Oryza sativa Japonica Group]
 gb|EAY88029.1| hypothetical protein OsI_09452 [Oryza sativa Indica Group]
Length=448

 Score =   226 bits (577),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGL+++DIDLFE+NEAFASQ++YC  KLGL
Sbjct  315  GVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLQIEDIDLFELNEAFASQFVYCCNKLGL  374

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D  K+NVNGGA+A+GH LGATGARCVATLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFE
Sbjct  375  DRSKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFE  434

Query  256  RGDACDELSNAR  221
            RGD+ D+ SN R
Sbjct  435  RGDSVDQFSNVR  446



>ref|NP_851157.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAC17876.1| 3-keto-acyl-CoA-thiolase 1 [Arabidopsis thaliana]
 gb|AAC19122.1| peroxisomal-3-keto-acyl-CoA thiolase 1 [Arabidopsis thaliana]
 gb|AAM97120.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAO00954.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AED95736.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=414

 Score =   225 bits (574),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FA  GV+P+VMGIGPAVAIPAA K AGL + DIDLFEINEAFASQY+Y  KKL L
Sbjct  276  GVFRSFAVTGVEPSVMGIGPAVAIPAATKLAGLNVSDIDLFEINEAFASQYVYSCKKLEL  335

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  336  DMEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  395

Query  256  RGDACDELSNAR  221
            RGD+ D LSNAR
Sbjct  396  RGDSVDNLSNAR  407



>dbj|BAF02017.1| peroxisomal-3-keto-acyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=414

 Score =   225 bits (574),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FA  GV+P+VMGIGPAVAIPAA K AGL + DIDLFEINEAFASQY+Y  KKL L
Sbjct  276  GVFRSFAVTGVEPSVMGIGPAVAIPAATKLAGLNVSDIDLFEINEAFASQYVYSCKKLEL  335

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  336  DMEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  395

Query  256  RGDACDELSNAR  221
            RGD+ D LSNAR
Sbjct  396  RGDSVDNLSNAR  407



>ref|XP_006395129.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
 gb|ESQ32415.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
Length=460

 Score =   226 bits (576),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G+FR+FA  GV+PAVMG+GPA AIPAA   AGL++ DIDLFEINEAFASQY+YC KKL L
Sbjct  322  GIFRSFAVTGVEPAVMGVGPAYAIPAATNLAGLKVSDIDLFEINEAFASQYVYCCKKLEL  381

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  382  DLEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  441

Query  256  RGDACDELSNARKVETHGY  200
            RGD+ DELSNA+     G+
Sbjct  442  RGDSVDELSNAQVANGDGH  460



>ref|XP_006280441.1| hypothetical protein CARUB_v10026373mg [Capsella rubella]
 gb|EOA13339.1| hypothetical protein CARUB_v10026373mg [Capsella rubella]
Length=457

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FA  GVDP+VMGIGP+VAIPAA   AGL + DIDLFEINEAFASQY+Y  KKL L
Sbjct  319  GVFRSFAVTGVDPSVMGIGPSVAIPAATNLAGLNVSDIDLFEINEAFASQYVYSCKKLEL  378

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  379  DMEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  438

Query  256  RGDACDELSNARKVETHGY  200
            RGD+ D LSNAR     G+
Sbjct  439  RGDSVDNLSNARVANGDGH  457



>ref|NP_568704.2| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 ref|NP_001032037.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 sp|Q570C8.2|THIK5_ARATH RecName: Full=3-ketoacyl-CoA thiolase 5, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 5; AltName: Full=Beta-ketothiolase 
5; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
5; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC17877.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAC23571.1| peroxisomal 3-keto-acyl-CoA thiolase 2 precursor [Arabidopsis 
thaliana]
 dbj|BAB09441.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAL84980.1| AT5g48880/K24G6_22 [Arabidopsis thaliana]
 gb|AED95737.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AED95738.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=457

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FA  GV+P+VMGIGPAVAIPAA K AGL + DIDLFEINEAFASQY+Y  KKL L
Sbjct  319  GVFRSFAVTGVEPSVMGIGPAVAIPAATKLAGLNVSDIDLFEINEAFASQYVYSCKKLEL  378

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  379  DMEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  438

Query  256  RGDACDELSNAR  221
            RGD+ D LSNAR
Sbjct  439  RGDSVDNLSNAR  450



>ref|XP_010439766.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Camelina sativa]
Length=456

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FA  GVDP+VMGIGPAVAIPAA   AGL + DIDLFEINEAFASQY+Y  KKL L
Sbjct  318  GVFRSFAVTGVDPSVMGIGPAVAIPAATNLAGLNVSDIDLFEINEAFASQYVYSCKKLDL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D +K+NVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  378  DMKKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  437

Query  256  RGDACDELSNARKVETHGY  200
            RGD+ D LSNAR     G+
Sbjct  438  RGDSVDNLSNARVANGEGH  456



>ref|XP_010442338.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=414

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GV R+FA  GVDP+VMGIGPAVAIPAA   AGL + DIDLFEINEAFASQY+Y  KKL L
Sbjct  276  GVLRSFAVTGVDPSVMGIGPAVAIPAATNLAGLNVSDIDLFEINEAFASQYVYSCKKLDL  335

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  336  DMEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  395

Query  256  RGDACDELSNARKVETHGY  200
            RGD+ D LSNAR     G+
Sbjct  396  RGDSVDNLSNARVANGEGH  414



>ref|XP_010442336.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=458

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GV R+FA  GVDP+VMGIGPAVAIPAA   AGL + DIDLFEINEAFASQY+Y  KKL L
Sbjct  320  GVLRSFAVTGVDPSVMGIGPAVAIPAATNLAGLNVSDIDLFEINEAFASQYVYSCKKLDL  379

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  380  DMEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  439

Query  256  RGDACDELSNARKVETHGY  200
            RGD+ D LSNAR     G+
Sbjct  440  RGDSVDNLSNARVANGEGH  458



>ref|XP_007034451.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3 [Theobroma cacao]
 gb|EOY05377.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3 [Theobroma cacao]
Length=326

 Score =   221 bits (562),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 119/144 (83%), Gaps = 19/144 (13%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDL+EINEAFASQ++YC+KKL L
Sbjct  201  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLYEINEAFASQFVYCRKKLEL  260

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP                   GARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  261  DP-------------------GARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  301

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RGD  DEL NARKVET+ +LSKDA
Sbjct  302  RGDHTDELCNARKVETNSFLSKDA  325



>ref|XP_004152018.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 ref|XP_004163039.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 gb|KGN58339.1| hypothetical protein Csa_3G624070 [Cucumis sativus]
Length=452

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+F+ VGVDPAVMGIGPAVAIPAAVKSAGL L DIDLFEINEAFASQY+YC KKL L
Sbjct  317  GVFRSFSVVGVDPAVMGIGPAVAIPAAVKSAGLTLQDIDLFEINEAFASQYVYCCKKLNL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+A+GH LG TGARCVATLL EMKRRG+D R+GV+SMCIGTGMGAA V E
Sbjct  377  DTEKVNVNGGAIALGHPLGTTGARCVATLLSEMKRRGRDSRFGVISMCIGTGMGAAAVIE  436

Query  256  RGDACDELSNAR  221
            RGD  DEL NAR
Sbjct  437  RGDYVDELRNAR  448



>ref|NP_001237076.1| 3-ketoacyl-CoA thiolase [Glycine max]
 ref|XP_006605407.1| PREDICTED: 3-ketoacyl-CoA thiolase isoform X1 [Glycine max]
 gb|AAQ93070.1| 3-ketoacyl-CoA thiolase [Glycine max]
 gb|KHM99006.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=445

 Score =   224 bits (570),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G+FR+FAAVGVDPAVMG+GPAVAIPAAVKS GLEL +IDLFEINEAFASQY+YC KKLGL
Sbjct  322  GIFRSFAAVGVDPAVMGVGPAVAIPAAVKSVGLELGNIDLFEINEAFASQYVYCLKKLGL  381

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGA+A+GH LG TGARCVATLL+EMKRRGKDCRYGV+SMCIG+GMGAA VFE
Sbjct  382  DPRKVNVNGGAIALGHPLGVTGARCVATLLNEMKRRGKDCRYGVISMCIGSGMGAAAVFE  441

Query  256  RGD  248
            RGD
Sbjct  442  RGD  444



>ref|XP_002301570.1| hypothetical protein POPTR_0002s22410g [Populus trichocarpa]
 gb|EEE80843.1| hypothetical protein POPTR_0002s22410g [Populus trichocarpa]
Length=457

 Score =   223 bits (569),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMG+GPA AIPAAV++AGLEL+DIDLFEINEAFASQY+YC KKL L
Sbjct  313  GVFRSFAAVGVDPAVMGVGPAAAIPAAVQAAGLELNDIDLFEINEAFASQYVYCIKKLEL  372

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGA+A+GH LGATGARCV TLL+EMKRRGKD R+GV+SMCIG+GMGAA VFE
Sbjct  373  DPEKVNVNGGAIALGHPLGATGARCVGTLLNEMKRRGKDSRFGVISMCIGSGMGAAAVFE  432

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            RGD  D L N RKV ++  LSKDAR
Sbjct  433  RGDCVDALCNVRKVGSNDLLSKDAR  457



>ref|XP_008454505.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X2 [Cucumis melo]
Length=461

 Score =   223 bits (569),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+F+ VGVDPAVMGIGPAVAIPAAVKSAGL L DIDLFEINEAFASQY+YC KKL L
Sbjct  326  GVFRSFSVVGVDPAVMGIGPAVAIPAAVKSAGLTLQDIDLFEINEAFASQYVYCCKKLKL  385

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+A+GH LGATGARCVATLL EMKRRG+D R+GV+SMCIGTGMGAA V E
Sbjct  386  DTEKVNVNGGAIALGHPLGATGARCVATLLSEMKRRGRDSRFGVISMCIGTGMGAAAVIE  445

Query  256  RGDACDELSNAR  221
            RGD  DE  NAR
Sbjct  446  RGDYVDEFCNAR  457



>gb|ADE77908.1| unknown [Picea sitchensis]
Length=444

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 120/134 (90%), Gaps = 6/134 (4%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVG DPAVMGIGPAVAIPAAVK+AGL++ DIDLFEINEAFASQY+YC +KL L
Sbjct  317  GVFRSFAAVGCDPAVMGIGPAVAIPAAVKAAGLQIGDIDLFEINEAFASQYVYCCQKLEL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+NVNGGA+A+GH LGATGARCV TLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFE
Sbjct  377  DPEKVNVNGGAIALGHPLGATGARCVGTLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFE  436

Query  256  RGDACDELSNARKV  215
            RG      SNAR +
Sbjct  437  RG------SNARPI  444



>ref|XP_005646163.1| thiolase [Coccomyxa subellipsoidea C-169]
 gb|EIE21619.1| thiolase [Coccomyxa subellipsoidea C-169]
Length=470

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G+FR+FAAVGVDPAVMGIGPAVAIPAAV+ AGL +DDID+FE+NEAFASQ  YC KKLGL
Sbjct  325  GIFRSFAAVGVDPAVMGIGPAVAIPAAVQKAGLSIDDIDVFELNEAFASQATYCVKKLGL  384

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPE++N NGGA+A+GH LG TGARC ATLLHEM +RGK  R+GVVSMCIG+GMGAA VFE
Sbjct  385  DPERVNPNGGAVALGHPLGCTGARCTATLLHEMNKRGKASRFGVVSMCIGSGMGAAAVFE  444

Query  256  RGDACDELSNARKVETHGYLSKDA  185
            RG   D L NA      G+LS DA
Sbjct  445  RGGEVDALRNAAPTHAQGFLSHDA  468



>ref|XP_008454504.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X1 [Cucumis melo]
Length=502

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+F+ VGVDPAVMGIGPAVAIPAAVKSAGL L DIDLFEINEAFASQY+YC KKL L
Sbjct  367  GVFRSFSVVGVDPAVMGIGPAVAIPAAVKSAGLTLQDIDLFEINEAFASQYVYCCKKLKL  426

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+A+GH LGATGARCVATLL EMKRRG+D R+GV+SMCIGTGMGAA V E
Sbjct  427  DTEKVNVNGGAIALGHPLGATGARCVATLLSEMKRRGRDSRFGVISMCIGTGMGAAAVIE  486

Query  256  RGDACDELSNAR  221
            RGD  DE  NAR
Sbjct  487  RGDYVDEFCNAR  498



>ref|XP_008382649.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Malus 
domestica]
 ref|XP_008382650.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Malus 
domestica]
 ref|XP_008382651.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Malus 
domestica]
Length=181

 Score =   213 bits (542),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 118/134 (88%), Gaps = 1/134 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVF +FAA+GVDPAVMG+GPA AIP AVKSAGLELDDIDLFEINEAFASQY+ C KKL L
Sbjct  49   GVFGSFAAIGVDPAVMGVGPAAAIPVAVKSAGLELDDIDLFEINEAFASQYVXCCKKLEL  108

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+N NGGA+A+GH LGATGARCVAT+L+EMKRRG+D  +GV SMCIG+GM AA VFE
Sbjct  109  DPEKVNANGGAIALGH-LGATGARCVATVLNEMKRRGRDHSFGVTSMCIGSGMEAAAVFE  167

Query  256  RGDACDELSNARKV  215
            RGD+ DEL NAR V
Sbjct  168  RGDSVDELCNARTV  181



>gb|KHN15993.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=445

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G+FR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLEL +IDLFEINEAFASQY+YC KKLGL
Sbjct  322  GIFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLELGNIDLFEINEAFASQYVYCLKKLGL  381

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGA+A+GH LG TGARCVATLL+EMKR GKDCR+GV+SMCIG+GMGAA VFE
Sbjct  382  DPRKVNVNGGAIALGHPLGVTGARCVATLLNEMKRGGKDCRFGVISMCIGSGMGAAAVFE  441

Query  256  RGD  248
            RGD
Sbjct  442  RGD  444



>gb|AFK39397.1| unknown [Lotus japonicus]
Length=138

 Score =   209 bits (533),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G+FR+FAAVGVDP+VMG+GPA AIPAAVKSAGLEL +IDLFEINEAFASQ++Y  KKLGL
Sbjct  15   GIFRSFAAVGVDPSVMGVGPAFAIPAAVKSAGLELGNIDLFEINEAFASQFVYSCKKLGL  74

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D  K+NVNGGA+A+GH LGATGARCVATLL+EMKRRGKDCR+G +SMCIG+GMGAA VFE
Sbjct  75   DTRKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGKDCRFGAISMCIGSGMGAAAVFE  134

Query  256  RGD  248
            RGD
Sbjct  135  RGD  137



>ref|NP_001242568.1| uncharacterized protein LOC100789930 [Glycine max]
 gb|ACU23006.1| unknown [Glycine max]
Length=445

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G+FR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLEL +IDLFEINEAFASQY+YC KKLGL
Sbjct  322  GIFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLELGNIDLFEINEAFASQYVYCLKKLGL  381

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGA+A+GH LG TGARCVATLL+EMKR GKDCR+GV+SMCIG+GMGA  VFE
Sbjct  382  DPRKVNVNGGAIALGHPLGVTGARCVATLLNEMKRGGKDCRFGVISMCIGSGMGATAVFE  441

Query  256  RGD  248
            RGD
Sbjct  442  RGD  444



>ref|XP_003604976.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Medicago truncatula]
 gb|AES87173.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like protein [Medicago 
truncatula]
Length=435

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G+FR+F+AVGVDPAVMG+GPA AIPAAVKSAGLEL +IDL+EINEAFASQ++Y  KKLGL
Sbjct  312  GIFRSFSAVGVDPAVMGVGPAFAIPAAVKSAGLELSNIDLYEINEAFASQFVYSCKKLGL  371

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGAMA GH LGATGARCVATLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  372  DPTKVNVNGGAMAFGHPLGATGARCVATLLNEMKRRGKDCRFGVISMCIGSGMGAAAVFE  431

Query  256  RGD  248
            RGD
Sbjct  432  RGD  434



>ref|XP_008355236.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Malus 
domestica]
Length=145

 Score =   209 bits (531),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 116/134 (87%), Gaps = 3/134 (2%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAA+GVDPAVMG+GPA AIP AVKSAGLELDDIDLFEINEAFASQY+ C KKL L
Sbjct  15   GVFRSFAAIGVDPAVMGVGPAAAIPVAVKSAGLELDDIDLFEINEAFASQYVSCCKKLEL  74

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DPEK+N NGGA+A+G   GATGARCVAT L+EMKRRG+D  +GV SMCIG+GM AA VFE
Sbjct  75   DPEKVNANGGAIALG---GATGARCVATXLNEMKRRGRDHSFGVTSMCIGSGMEAAAVFE  131

Query  256  RGDACDELSNARKV  215
            RGD+ DEL NAR V
Sbjct  132  RGDSVDELCNARTV  145



>ref|XP_007153157.1| hypothetical protein PHAVU_003G011600g [Phaseolus vulgaris]
 gb|ESW25151.1| hypothetical protein PHAVU_003G011600g [Phaseolus vulgaris]
Length=445

 Score =   218 bits (555),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G+FR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLEL +I L+EINEAFASQY+YC KKLGL
Sbjct  322  GIFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLELGNIGLYEINEAFASQYVYCCKKLGL  381

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGA+A+GH LGATGARCVATLL+EMKR GKDCRYGV+SMCIG+GMGAA VFE
Sbjct  382  DPRKVNVNGGAIALGHPLGATGARCVATLLNEMKRHGKDCRYGVISMCIGSGMGAAAVFE  441

Query  256  RGD  248
            RG+
Sbjct  442  RGE  444



>gb|KJB72152.1| hypothetical protein B456_011G161700 [Gossypium raimondii]
Length=453

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/111 (91%), Positives = 108/111 (97%), Gaps = 0/111 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGLELDD+DLFEINEAFASQ++YCQKKL L
Sbjct  320  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLELDDVDLFEINEAFASQFVYCQKKLEL  379

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGT  284
            DP+KINVNGGAMAIGH LG TGARCVATLLHEMKRRGKDCR+GVVSMCIGT
Sbjct  380  DPQKINVNGGAMAIGHPLGVTGARCVATLLHEMKRRGKDCRFGVVSMCIGT  430



>gb|AFK40880.1| unknown [Medicago truncatula]
Length=435

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G+FR+F+AVGVDPAVMG+GPA AIPAAVKSAGLEL +IDL+EINEAFASQ++Y  KKLGL
Sbjct  312  GIFRSFSAVGVDPAVMGVGPAFAIPAAVKSAGLELSNIDLYEINEAFASQFVYSCKKLGL  371

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGAMA GH LGATGARCVATLL+EMKRRGKDCR+GV+SMCIG GMGAA VFE
Sbjct  372  DPTKVNVNGGAMAFGHPLGATGARCVATLLNEMKRRGKDCRFGVISMCIGFGMGAAAVFE  431

Query  256  RGD  248
            RGD
Sbjct  432  RGD  434



>ref|XP_004506669.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=440

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G+FR+FAAVGVDPAVMG+GPA AIPAAVKSAGLEL +IDLFEINEAFASQ++Y  KKLGL
Sbjct  317  GIFRSFAAVGVDPAVMGVGPAFAIPAAVKSAGLELGNIDLFEINEAFASQFVYSCKKLGL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGA+A+GH LGATGAR VATLL+EMKRRGKDCRYGV+SMCIG+GMGAA VFE
Sbjct  377  DPSKVNVNGGAIALGHPLGATGARTVATLLNEMKRRGKDCRYGVISMCIGSGMGAAAVFE  436

Query  256  RGD  248
            RGD
Sbjct  437  RGD  439



>ref|XP_010482155.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=414

 Score =   214 bits (545),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FA  GVDP+VMGIGPAVAIPAA   AGL + DIDLFEINEAFASQY+Y  KKL L
Sbjct  276  GVFRSFAVTGVDPSVMGIGPAVAIPAATNLAGLNVSDIDLFEINEAFASQYVYSCKKLDL  335

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  336  DMEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  395

Query  256  RGDACDELSNARKVETHGY  200
             GD+    S+A+     G+
Sbjct  396  SGDSFKNNSDAQVANGEGH  414



>gb|AAK76732.1| 3-ketoacyl-CoA thiolase [Gossypium hirsutum]
Length=133

 Score =   205 bits (522),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLE+DDIDLFEINEAFASQ++Y  KKLGL
Sbjct  15   GVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLEIDDIDLFEINEAFASQFVYSCKKLGL  74

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVF  260
            D EK+NVNGGA+A+GH LG TGARCV TLL+EMKRRGKDCR+GV+SMCIGTGMG +  F
Sbjct  75   DREKVNVNGGAIALGHPLGVTGARCVGTLLYEMKRRGKDCRFGVISMCIGTGMGGSSCF  133



>ref|XP_003632434.2| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Vitis 
vinifera]
 emb|CBI37268.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G+FR++AAVGV+P VMG+GPAVAIP A K+AGLE+ DIDLFEINEAFASQY+YC KKL L
Sbjct  319  GLFRSYAAVGVEPGVMGVGPAVAIPIAAKNAGLEVADIDLFEINEAFASQYVYCCKKLDL  378

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP+K+NVNGGA+A+GH LGATGARCV+TLL+EMKRRGKDCRYGV+SMCIG+GMGAA VFE
Sbjct  379  DPKKVNVNGGALALGHPLGATGARCVSTLLYEMKRRGKDCRYGVISMCIGSGMGAAAVFE  438

Query  256  RGDA  245
            RGD+
Sbjct  439  RGDS  442



>ref|XP_009384048.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=451

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+F AVGV+P +MGIGP  AIPAAVK+AGLELDDIDLFEINEAFASQY+YC KKL L
Sbjct  314  GVFRSFVAVGVEPNIMGIGPVAAIPAAVKAAGLELDDIDLFEINEAFASQYVYCCKKLKL  373

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGAMA+GH LG TGARCV+TLL+EMKRRGKDCR+GV+SMCIG+GMGAA VFE
Sbjct  374  DPAKVNVNGGAMALGHPLGCTGARCVSTLLYEMKRRGKDCRFGVISMCIGSGMGAAAVFE  433

Query  256  RGDACDELSNARKV  215
            RGD  D+LSNAR+V
Sbjct  434  RGDGVDQLSNARQV  447



>ref|XP_010482154.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=458

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FA  GVDP+VMGIGPAVAIPAA   AGL + DIDLFEINEAFASQY+Y  KKL L
Sbjct  320  GVFRSFAVTGVDPSVMGIGPAVAIPAATNLAGLNVSDIDLFEINEAFASQYVYSCKKLDL  379

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D EK+NVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE
Sbjct  380  DMEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFE  439

Query  256  RGDACDELSNARKVETHGY  200
             GD+    S+A+     G+
Sbjct  440  SGDSFKNNSDAQVANGEGH  458



>ref|XP_004506590.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=440

 Score =   213 bits (542),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G+FR+FAAVGVDPAVMG+GPA AIPAAVKSAGLEL +IDLFEINEAFASQ++Y  KKLGL
Sbjct  317  GIFRSFAAVGVDPAVMGVGPAFAIPAAVKSAGLELGNIDLFEINEAFASQFVYSCKKLGL  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D  K+NVNGGA+A+GH LGATGAR VATLL+EMKRRGKDCRYGV+SMCIG+GMGAA VFE
Sbjct  377  DRSKVNVNGGAIALGHPLGATGARSVATLLNEMKRRGKDCRYGVISMCIGSGMGAAAVFE  436

Query  256  RGD  248
            RGD
Sbjct  437  RGD  439



>gb|KFK42814.1| hypothetical protein AALP_AA1G042000 [Arabis alpina]
Length=439

 Score =   213 bits (541),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = -1

Query  613  VFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLD  434
            VFRTFAAVGVDPA+MG+GPA AIPAAVK+AGLEL+DIDLFEINEAFASQ++YC+ KLGLD
Sbjct  314  VFRTFAAVGVDPAIMGVGPAAAIPAAVKAAGLELNDIDLFEINEAFASQFVYCRNKLGLD  373

Query  433  PEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFER  254
            PEKINVNGGA+AIGH LGATGARCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAAGVFER
Sbjct  374  PEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAGVFER  433

Query  253  GD  248
            GD
Sbjct  434  GD  435



>emb|CAA53078.1| 3-ketoacyl-CoA thiolase B [Mangifera indica]
Length=430

 Score =   212 bits (540),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  318  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCI  290
            DPEKINVNGGAMAIGH LGATGARCVATLLHEMKRRG+DCR+GV+SMCI
Sbjct  378  DPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGVISMCI  426



>gb|KDO43601.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=437

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGL+LDDIDLFEINEAFASQ++YC+ KLGL
Sbjct  318  GVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGL  377

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIG  287
            DPEKINVNGGA+AIGH LG TGARCVATLLHEMKRRG+DCR+GV+SMCIG
Sbjct  378  DPEKINVNGGALAIGHPLGTTGARCVATLLHEMKRRGRDCRFGVISMCIG  427



>ref|XP_002989683.1| hypothetical protein SELMODRAFT_447769 [Selaginella moellendorffii]
 gb|EFJ09160.1| hypothetical protein SELMODRAFT_447769 [Selaginella moellendorffii]
Length=408

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G FR+FA VGV+P VMGIGPAVAIP A+K AGLE+ DI LFEINEAFASQY YC KKL L
Sbjct  285  GAFRSFAVVGVEPGVMGIGPAVAIPKAIKDAGLEISDIHLFEINEAFASQYTYCCKKLQL  344

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGA+A+GH LGATGARCVATLLHEM +RG  CRYGVVSMCIGTGMGAA VFE
Sbjct  345  DPAKVNVNGGAIALGHPLGATGARCVATLLHEMAKRGSACRYGVVSMCIGTGMGAAAVFE  404

Query  256  RGD  248
            RGD
Sbjct  405  RGD  407



>ref|XP_008678417.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Zea mays]
Length=230

 Score =   196 bits (497),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPA MG+GPAVAIPAAVK AGLE+ DIDLFE+NE FASQ++YC  KLGL
Sbjct  61   GVFRSFAAVGVDPADMGVGPAVAIPAAVKFAGLEIGDIDLFELNEPFASQFVYCCNKLGL  120

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D  K+NVNGGA+A+GH L ATGARC+ATLL+EMKR+G DCR+GVV+MCIG+GMGAA VFE
Sbjct  121  DRSKVNVNGGAIALGHPLDATGARCMATLLNEMKRQGIDCRFGVVTMCIGSGMGAAAVFE  180

Query  256  RGDACDELSN  227
               A  E+S 
Sbjct  181  LCSARLEVST  190



>ref|XP_002991797.1| hypothetical protein SELMODRAFT_236388 [Selaginella moellendorffii]
 gb|EFJ07201.1| hypothetical protein SELMODRAFT_236388 [Selaginella moellendorffii]
Length=395

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 104/123 (85%), Gaps = 3/123 (2%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G FR+FA VGV+P VMGIGPAVAIP AVK AGLE+ DI LFEINEAFASQY YC KKL L
Sbjct  275  GAFRSFAVVGVEPGVMGIGPAVAIPKAVKDAGLEISDIHLFEINEAFASQYTYCCKKLQL  334

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+NVNGGA+A+GH L   GARCVATLLHEM +RG  CRYGVVSMCIGTGMGAA VFE
Sbjct  335  DPAKVNVNGGAIALGHPL---GARCVATLLHEMAKRGSACRYGVVSMCIGTGMGAAAVFE  391

Query  256  RGD  248
            RGD
Sbjct  392  RGD  394



>ref|XP_007049826.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
 gb|EOX93983.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
Length=472

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAG+EL DIDLFEINEAFASQY+YC KKL L
Sbjct  326  GVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGIELADIDLFEINEAFASQYVYCCKKLEL  385

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCI  290
            D EK+NVNGGA+A+GH LGATGARCV TLL+EMKRRGKDCR+GV+SMCI
Sbjct  386  DSEKVNVNGGAIALGHPLGATGARCVGTLLYEMKRRGKDCRFGVISMCI  434



>gb|KCW50166.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=474

 Score =   195 bits (495),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGL LDDIDL EINEAFASQY+YC KKLGL
Sbjct  322  GVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLTLDDIDLLEINEAFASQYVYCCKKLGL  381

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMG  275
            DPEK+NVNGGA+A+GH LGATGARCVATLL+EMKR+G+D R+GV+S+ I + +G
Sbjct  382  DPEKVNVNGGALALGHPLGATGARCVATLLNEMKRQGRDSRFGVISILITSCLG  435



>ref|XP_002946078.1| hypothetical protein VOLCADRAFT_102696 [Volvox carteri f. nagariensis]
 gb|EFJ53073.1| hypothetical protein VOLCADRAFT_102696 [Volvox carteri f. nagariensis]
Length=462

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 116/144 (81%), Gaps = 0/144 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G+FR+FAAVGVDP++MGIGPAVAIP AV  AGL LDDID++EINEAFASQ  YC  KLG+
Sbjct  317  GIFRSFAAVGVDPSIMGIGPAVAIPEAVARAGLSLDDIDVYEINEAFASQASYCVAKLGI  376

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            D  K+N NGGA+A+GH LGATGARC ATLLHE++RRG+  R+GVVSMCIG+GMGAA VFE
Sbjct  377  DENKVNPNGGAIAMGHPLGATGARCTATLLHELRRRGRGSRFGVVSMCIGSGMGAAAVFE  436

Query  256  RGDACDELSNARKVETHGYLSKDA  185
             G   D+   AR V+    LSKDA
Sbjct  437  TGGEVDKFMTARAVKGQVLLSKDA  460



>ref|XP_003061899.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53611.1| predicted protein [Micromonas pusilla CCMP1545]
Length=332

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 103/122 (84%), Gaps = 3/122 (2%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAG-LELDDIDLFEINEAFASQYLYCQKKLG  440
            G F +FAAVGVDP VMGIGPAVAIP A+K AG L +DD+DLFE+NEAFASQ  YC +KLG
Sbjct  211  GTFVSFAAVGVDPIVMGIGPAVAIPEALKRAGNLSVDDVDLFELNEAFASQATYCAEKLG  270

Query  439  LDPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVF  260
            LD EK+NVNGGA+A+GH LGATGARCVATL+HEM RR  D   GVVSMCIG+GMGAAGVF
Sbjct  271  LDSEKVNVNGGAIALGHPLGATGARCVATLMHEMHRRRSDV--GVVSMCIGSGMGAAGVF  328

Query  259  ER  254
             R
Sbjct  329  AR  330



>ref|XP_011400620.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Auxenochlorella protothecoides]
 gb|KFM27633.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Auxenochlorella protothecoides]
Length=455

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 110/143 (77%), Gaps = 1/143 (1%)
 Frame = -1

Query  613  VFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLD  434
            +FR+FAAVGV PA+MGIGP  AIP AV+ AGL LDD+D+FEINEAFASQ LY  KKLGLD
Sbjct  310  IFRSFAAVGVPPAIMGIGPVAAIPEAVRRAGLGLDDVDVFEINEAFASQALYTVKKLGLD  369

Query  433  PEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFER  254
             E++N NGGA+A+GH LG TGAR  ATL++EM+RRGK  R+GV+SMCIG+GMGAA V ER
Sbjct  370  LERVNPNGGAIALGHPLGCTGARQAATLINEMQRRGKAARFGVISMCIGSGMGAAAVLER  429

Query  253  GDACDELSNARKVE-THGYLSKD  188
              + D   +AR     H  LS+ 
Sbjct  430  DFSDDAERSARPATGVHAGLSRQ  452



>gb|ABR25554.1| peroxisomal 3-ketoacyl-coa thiolase 2 precursor [Oryza sativa 
Indica Group]
Length=243

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVF++FAAVGV PAVMG+GPAVAIPAAV SAGL+++DIDLFE+NEAFASQ +YC  KLGL
Sbjct  130  GVFKSFAAVGVHPAVMGVGPAVAIPAAVNSAGLQIEDIDLFELNEAFASQLVYCCNKLGL  189

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMG  275
            D  K+NVNGGA+A+GH LGAT A+CVATLL+EM RRG DC + VV+MCI +GMG
Sbjct  190  DRSKVNVNGGAIALGHPLGATRAQCVATLLNEMNRRGTDCIFSVVTMCIVSGMG  243



>ref|XP_002500295.1| acetyl-coa acyltransferase [Micromonas sp. RCC299]
 gb|ACO61553.1| acetyl-coa acyltransferase [Micromonas sp. RCC299]
Length=425

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 103/121 (85%), Gaps = 3/121 (2%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE-LDDIDLFEINEAFASQYLYCQKKLG  440
            G F +FAAVGVDP VMGIGPAVAIP A++ AGL  + D+DLFE+NEAFASQ  YC  KLG
Sbjct  304  GRFVSFAAVGVDPKVMGIGPAVAIPVAIEKAGLRSVADVDLFELNEAFASQATYCATKLG  363

Query  439  LDPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVF  260
            LD EK+NVNGGA+A+GH LGATGARCVATL+HEM+RRG   R GVVSMCIG+GMGAAGVF
Sbjct  364  LDVEKVNVNGGAIALGHPLGATGARCVATLMHEMQRRG--ARNGVVSMCIGSGMGAAGVF  421

Query  259  E  257
            E
Sbjct  422  E  422



>gb|KDD73648.1| beta-ketoacyl-ACP synthase, partial [Helicosporidium sp. ATCC 
50920]
Length=427

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 107/145 (74%), Gaps = 0/145 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGV P +MGIGPA AIPAAVK AGL + D+D++EINEAFASQ  Y    L +
Sbjct  283  GVFRSFAAVGVPPRIMGIGPAFAIPAAVKLAGLGVQDVDVYEINEAFASQASYSVDTLKI  342

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
            DP K+N NGGA+A+GH LG TGAR  ATLL+EM RRGK  R+GVVSMCIG+GMGAA VFE
Sbjct  343  DPAKVNPNGGAIALGHPLGCTGARQTATLLYEMARRGKTARFGVVSMCIGSGMGAAAVFE  402

Query  256  RGDACDELSNARKVETHGYLSKDAR  182
            R  + D  S A        LS DA+
Sbjct  403  REGSEDRTSFAAPATARTGLSADAQ  427



>ref|XP_004339798.1| acetylCoA acyltransferase, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR17785.1| acetylCoA acyltransferase, putative [Acanthamoeba castellanii 
str. Neff]
Length=430

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 105/121 (87%), Gaps = 2/121 (2%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FAAVGV+PAVMGIGPAVAIPAAV+ AG+ L D+D++EINEAFASQ +YC +KLG+
Sbjct  310  GVFRSFAAVGVEPAVMGIGPAVAIPAAVQKAGISLQDVDVYEINEAFASQAVYCVQKLGI  369

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
              EK+N NGGA+A+GH LG TGAR  ATLL+E+KRR  + R+GVVSMCIG+GMGAA V+E
Sbjct  370  PVEKVNPNGGAIALGHPLGCTGARQTATLLNELKRR--NARFGVVSMCIGSGMGAAAVYE  427

Query  256  R  254
            R
Sbjct  428  R  428



>gb|ELU09588.1| hypothetical protein CAPTEDRAFT_229355 [Capitella teleta]
Length=428

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GVFR+FA VGV P VMGIGPAVAIPAA+K AGL +DDID++EINEAFASQ  YC +KLG+
Sbjct  305  GVFRSFAVVGVPPDVMGIGPAVAIPAALKKAGLAVDDIDVYEINEAFASQARYCVEKLGI  364

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
              EK+N  GGA+A+GH LG TGAR +ATLLHEMKRRGK    GV+SMCIGTGMGAA V E
Sbjct  365  PMEKVNPKGGAIALGHPLGCTGARQMATLLHEMKRRGKKRSNGVISMCIGTGMGAAAVIE  424



>ref|XP_010172441.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal [Caprimulgus 
carolinensis]
Length=272

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GV R+FA VGV P VMGIGPA AIP AV+ AGL L+DID++EINEAFASQ +YC +KLG+
Sbjct  150  GVLRSFAVVGVPPDVMGIGPAYAIPVAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGI  209

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
              EK+N  GGA+A+GH LG TGAR V TLLHE+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  210  PMEKVNPLGGAIALGHPLGCTGARQVVTLLHELKRRGKRA-YGVVSMCIGTGMGAAAVFE  268



>gb|EDL76925.1| rCG25918, isoform CRA_d [Rattus norvegicus]
Length=171

 Score =   166 bits (421),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GV R++A VGV P +MGIGPA AIPAA++ AGL ++DID+FEINEAFASQ LYC +KLG+
Sbjct  49   GVLRSYAVVGVPPDIMGIGPAYAIPAALQKAGLTVNDIDIFEINEAFASQALYCVEKLGI  108

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
              EK+N  GGA+A+GH LG TGAR V TLL+E+KRRG+   YGVVSMCIGTGMGAA VFE
Sbjct  109  PAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRA-YGVVSMCIGTGMGAAAVFE  167



>ref|XP_010075883.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal, partial [Pterocles 
gutturalis]
Length=367

 Score =   172 bits (435),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GV R+FA VGV P VMGIGPA AIPAAV++AGL LDDID+FEINEAFASQ LYC +KLG+
Sbjct  245  GVLRSFAVVGVPPDVMGIGPAYAIPAAVENAGLTLDDIDVFEINEAFASQALYCVEKLGI  304

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
              EK+N  GGA+A+GH LG TGAR V TLL+E+KRRGK   YGVVSMCIGTGMGAA VF+
Sbjct  305  PMEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFK  363



>gb|AAH26669.1| Acaa1a protein [Mus musculus]
 gb|EDL09237.1| mCG21883, isoform CRA_b [Mus musculus]
Length=171

 Score =   166 bits (419),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GV R++A VGV P VMGIGPA AIPAA++ AGL ++DID+FEINEAFASQ +YC +KLG+
Sbjct  49   GVLRSYAVVGVPPDVMGIGPAYAIPAALQKAGLTVNDIDIFEINEAFASQAVYCVEKLGI  108

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
              EK+N  GGA+A+GH LG TGAR V TLL+E+KRRG+   YGVVSMCIGTGMGAA VFE
Sbjct  109  PAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRA-YGVVSMCIGTGMGAAAVFE  167



>ref|XP_009505170.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal [Phalacrocorax 
carbo]
Length=272

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GV R+FA VGV P VMGIGPA AIP AV+ AGL L+DID++EINEAFASQ +YC +KLG+
Sbjct  150  GVLRSFAVVGVPPDVMGIGPAYAIPVAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGI  209

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
              EK+N  GGA+A+GH LG TGAR V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  210  PMEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  268



>ref|XP_005849380.1| hypothetical protein CHLNCDRAFT_143854 [Chlorella variabilis]
 gb|EFN57278.1| hypothetical protein CHLNCDRAFT_143854 [Chlorella variabilis]
Length=453

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 99/122 (81%), Gaps = 3/122 (2%)
 Frame = -1

Query  613  VFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLD  434
              ++FAAVGV+PAVMGIGPAVAIPAA++ AGL  DDID+FE+NEAFASQ+ YC K+LGLD
Sbjct  323  TLKSFAAVGVEPAVMGIGPAVAIPAALEKAGLSKDDIDVFELNEAFASQFAYCLKELGLD  382

Query  433  PEKINVNGGAMAIGHSLGATGARCVATLLHEMKRR---GKDCRYGVVSMCIGTGMGAAGV  263
             EK+N NGGA+A+GH +G TGAR   TLLHEM RR   G+   YGVVSMC G+GMGAA V
Sbjct  383  EEKVNPNGGAIALGHPIGCTGARQTVTLLHEMARRNSNGRGAHYGVVSMCTGSGMGAAAV  442

Query  262  FE  257
            FE
Sbjct  443  FE  444



>ref|XP_003283381.1| acetyl-CoA C-acyltransferase [Dictyostelium purpureum]
 gb|EGC40032.1| acetyl-CoA C-acyltransferase [Dictyostelium purpureum]
Length=418

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 99/120 (83%), Gaps = 2/120 (2%)
 Frame = -1

Query  613  VFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLD  434
            VFR+FAAVGV+P+VMGIGPA AIP AVK AGL ++DID+FEINEAFASQ  Y  KKLGLD
Sbjct  299  VFRSFAAVGVEPSVMGIGPAAAIPVAVKQAGLSINDIDVFEINEAFASQAYYSCKKLGLD  358

Query  433  PEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFER  254
              K+N NG  +++GH LGATGAR  AT+ +EMKRRG   R+GVVSMCIGTGMGAA V+ER
Sbjct  359  MSKVNPNGSGISLGHPLGATGARLTATISNEMKRRG--ARFGVVSMCIGTGMGAACVYER  416



>ref|XP_004676369.1| PREDICTED: 3-ketoacyl-CoA thiolase A, peroxisomal isoform X1 
[Condylura cristata]
Length=426

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GV R++A VGV P VMGIGPA AIP A++ AGL +DD+D+FEINEAFASQ +YC +KLGL
Sbjct  304  GVLRSYAVVGVPPDVMGIGPAYAIPVALQKAGLTIDDVDIFEINEAFASQAVYCVEKLGL  363

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
             PEK+N  GGA+A+GH LG TGAR V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  364  PPEKVNPLGGAVALGHPLGCTGARQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  422



>gb|KFQ33519.1| 3-ketoacyl-CoA thiolase B, peroxisomal, partial [Merops nubicus]
Length=369

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GV R+FA VGV PAVMGIGPA AIPAAV+ AGL L+DID++EINEAFASQ +YC +KLG+
Sbjct  247  GVLRSFAVVGVPPAVMGIGPAYAIPAAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGI  306

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
              EK+N  GGA+A+GH LG TG R V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  307  PMEKVNPLGGAIALGHPLGCTGTRQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  365



>gb|EDL76924.1| rCG25918, isoform CRA_c [Rattus norvegicus]
Length=272

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GV R++A VGV P +MGIGPA AIPAA++ AGL ++DID+FEINEAFASQ LYC +KLG+
Sbjct  150  GVLRSYAVVGVPPDIMGIGPAYAIPAALQKAGLTVNDIDIFEINEAFASQALYCVEKLGI  209

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
              EK+N  GGA+A+GH LG TGAR V TLL+E+KRRG+   YGVVSMCIGTGMGAA VFE
Sbjct  210  PAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRA-YGVVSMCIGTGMGAAAVFE  268



>gb|EAW64515.1| acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3-oxoacyl-Coenzyme 
A thiolase), isoform CRA_c [Homo sapiens]
Length=162

 Score =   164 bits (415),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 96/120 (80%), Gaps = 1/120 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GV R++A VGV P +MGIGPA AIP A++ AGL + D+D+FEINEAFASQ  YC +KL L
Sbjct  40   GVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRL  99

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
             PEK+N  GGA+A+GH LG TGAR V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  100  PPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  158



>gb|KFV08282.1| 3-ketoacyl-CoA thiolase B, peroxisomal, partial [Tauraco erythrolophus]
Length=369

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GV R+FA VGV P VMGIGPA AIP AV+ AGL L+DID++EINEAFASQ +YC +KLG+
Sbjct  247  GVLRSFAVVGVPPDVMGIGPAYAIPVAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGI  306

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
              EK+N  GGA+A+GH LG TGAR V TLLHE+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  307  PMEKVNPLGGAIALGHPLGCTGARQVVTLLHELKRRGKRA-YGVVSMCIGTGMGAAAVFE  365



>ref|XP_008942616.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal, partial [Merops 
nubicus]
Length=375

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GV R+FA VGV PAVMGIGPA AIPAAV+ AGL L+DID++EINEAFASQ +YC +KLG+
Sbjct  253  GVLRSFAVVGVPPAVMGIGPAYAIPAAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGI  312

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
              EK+N  GGA+A+GH LG TG R V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  313  PMEKVNPLGGAIALGHPLGCTGTRQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  371



>ref|XP_008844714.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal [Nannospalax 
galili]
 ref|XP_008844715.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal [Nannospalax 
galili]
Length=424

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GV R+FA VGV P +MGIGPA AIP A++ AGL + DID+FEINEAFASQ LYC +KLG+
Sbjct  302  GVLRSFAVVGVPPDIMGIGPAYAIPEALQKAGLTVSDIDIFEINEAFASQALYCVEKLGI  361

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
             PEK+N  GGA+A+GH LG TGAR V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  362  PPEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  420



>gb|KFW92214.1| 3-ketoacyl-CoA thiolase A, peroxisomal, partial [Phalacrocorax 
carbo]
Length=292

 Score =   167 bits (424),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GV R+FA VGV P VMGIGPA AIP AV+ AGL L+DID++EINEAFASQ +YC +KLG+
Sbjct  170  GVLRSFAVVGVPPDVMGIGPAYAIPVAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGI  229

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
              EK+N  GGA+A+GH LG TGAR V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  230  PMEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  288



>gb|KFW09333.1| 3-ketoacyl-CoA thiolase A, peroxisomal, partial [Fulmarus glacialis]
Length=367

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GV R+FA VGV P VMGIGPA AIPAAV+ AGL L+DID++EINEAFASQ +YC +KLG+
Sbjct  245  GVLRSFAVVGVPPDVMGIGPAYAIPAAVEKAGLTLNDIDIYEINEAFASQAVYCVEKLGI  304

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
              EK+N  GGA+A+GH LG TGAR V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  305  PMEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  363



>gb|EGW00823.1| 3-ketoacyl-CoA thiolase B, peroxisomal [Cricetulus griseus]
Length=279

 Score =   167 bits (423),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GV R++A VGV P +MGIGPA AIPAA++ AGL ++DID+FEINEAFASQ +YC +KLG+
Sbjct  157  GVLRSYAVVGVPPDIMGIGPAYAIPAALQKAGLTVNDIDIFEINEAFASQAVYCVEKLGI  216

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
              EK+N  GGA+A+GH LG TGAR V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  217  PAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  275



>gb|EOA95880.1| 3-ketoacyl-CoA thiolase B, peroxisomal, partial [Anas platyrhynchos]
Length=369

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GV ++FA VGV P VMGIGPA AIPAAV+ AGL L+DID+FEINEAFASQ +YC +KLG+
Sbjct  247  GVLKSFAVVGVPPDVMGIGPAYAIPAAVEKAGLTLNDIDIFEINEAFASQAVYCVEKLGI  306

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
              EK+N  GGA+A+GH LG TGAR V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  307  PMEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  365



>ref|XP_006511987.1| PREDICTED: 3-ketoacyl-CoA thiolase A, peroxisomal isoform X2 
[Mus musculus]
Length=272

 Score =   167 bits (422),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GV R++A VGV P VMGIGPA AIPAA++ AGL ++DID+FEINEAFASQ +YC +KLG+
Sbjct  150  GVLRSYAVVGVPPDVMGIGPAYAIPAALQKAGLTVNDIDIFEINEAFASQAVYCVEKLGI  209

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
              EK+N  GGA+A+GH LG TGAR V TLL+E+KRRG+   YGVVSMCIGTGMGAA VFE
Sbjct  210  PAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRA-YGVVSMCIGTGMGAAAVFE  268



>ref|XP_006512177.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal isoform X2 
[Mus musculus]
 gb|EDL09236.1| mCG21883, isoform CRA_a [Mus musculus]
Length=272

 Score =   167 bits (422),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GV R++A VGV P VMGIGPA AIPAA++ AGL ++DID+FEINEAFASQ +YC +KLG+
Sbjct  150  GVLRSYAVVGVPPDVMGIGPAYAIPAALQKAGLTVNDIDIFEINEAFASQAVYCVEKLGI  209

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
              EK+N  GGA+A+GH LG TGAR V TLL+E+KRRG+   YGVVSMCIGTGMGAA VFE
Sbjct  210  PAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRA-YGVVSMCIGTGMGAAAVFE  268



>gb|EMC83181.1| 3-ketoacyl-CoA thiolase B, peroxisomal, partial [Columba livia]
Length=367

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GV R+FA VGV P VMGIGPA AIPAA++ AGL L+DID+FEINEAFASQ +YC +KLG+
Sbjct  245  GVLRSFAVVGVPPDVMGIGPAYAIPAALEKAGLTLNDIDIFEINEAFASQAMYCVEKLGI  304

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
              EK+N  GGA+A+GH LG TGAR V TLL E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  305  PMEKVNPLGGAIALGHPLGCTGARQVVTLLSELKRRGKRA-YGVVSMCIGTGMGAAAVFE  363



>gb|ELK29226.1| 3-ketoacyl-CoA thiolase, peroxisomal, partial [Myotis davidii]
Length=369

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            G+ R++A VGV P +MGIGPA AIP A+K AGL + D+D+FEINEAFASQ +YC +KLGL
Sbjct  247  GILRSYAVVGVPPDIMGIGPAYAIPVALKKAGLTVHDVDIFEINEAFASQAVYCMEKLGL  306

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
             PEK+N  GGA+A+GH LG TGAR V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  307  PPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  365



>ref|XP_008522879.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal [Equus przewalskii]
Length=426

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  616  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  437
            GV R++A VGV P +MGIGPA AIP A++ AGL ++D+D+FEINEAFASQ +YC KKLGL
Sbjct  304  GVLRSYAVVGVPPDIMGIGPAFAIPVALQKAGLTVNDVDIFEINEAFASQAVYCVKKLGL  363

Query  436  DPEKINVNGGAMAIGHSLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  257
             PEK+N  GGA+A+GH LG TGAR V TLL+E+KRRGK   YGVVSMCIGTGMGAA VFE
Sbjct  364  PPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE  422



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090