BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF035A18

Length=769
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABC40984.1|  chloroplast allene oxide cyclase precursor              352   6e-119   Ipomoea nil [qian niu]
gb|ACD12705.1|  AOC                                                     299   4e-98    Petunia x hybrida [garden petunia]
ref|XP_010061864.1|  PREDICTED: allene oxide cyclase 4, chloropla...    299   4e-98    Eucalyptus grandis [rose gum]
emb|CAC83765.1|  allene oxide cyclase                                   295   1e-96    Nicotiana tabacum [American tobacco]
ref|XP_009790745.1|  PREDICTED: allene oxide cyclase 4, chloropla...    294   3e-96    Nicotiana sylvestris
ref|NP_001289444.1|  uncharacterized protein LOC104120106               294   3e-96    Nicotiana tomentosiformis
gb|AFV68275.1|  allene oxide cyclase                                    294   5e-96    Catharanthus roseus [chatas]
gb|EYU44656.1|  hypothetical protein MIMGU_mgv1a012403mg                290   2e-94    Erythranthe guttata [common monkey flower]
gb|ADY38579.1|  allene oxide cyclase                                    289   4e-94    Camellia sinensis [black tea]
gb|ACZ06580.1|  allene oxide cyclase                                    288   1e-93    Jatropha curcas
ref|XP_004309482.1|  PREDICTED: allene oxide cyclase 3, chloropla...    287   2e-93    Fragaria vesca subsp. vesca
ref|XP_007033323.1|  Allene oxide cyclase 4 isoform 1                   287   2e-93    
gb|ABK94763.1|  unknown                                                 286   5e-93    Populus trichocarpa [western balsam poplar]
ref|XP_002305951.2|  mangrin family protein                             286   6e-93    Populus trichocarpa [western balsam poplar]
ref|XP_006482294.1|  PREDICTED: allene oxide cyclase 4, chloropla...    286   8e-93    Citrus sinensis [apfelsine]
ref|XP_010265246.1|  PREDICTED: allene oxide cyclase 2, chloropla...    285   1e-92    Nelumbo nucifera [Indian lotus]
ref|XP_011004427.1|  PREDICTED: allene oxide cyclase 3, chloropla...    285   2e-92    Populus euphratica
ref|XP_006430815.1|  hypothetical protein CICLE_v10012552mg             285   2e-92    Citrus clementina [clementine]
ref|XP_006363132.1|  PREDICTED: allene oxide cyclase 3, chloropla...    284   2e-92    
gb|ABK96763.1|  unknown                                                 284   4e-92    Populus trichocarpa x Populus deltoides
ref|NP_001234019.1|  allene oxide cyclase                               283   7e-92    Solanum lycopersicum
gb|AAU11327.1|  allene oxide cyclase                                    283   1e-91    Hyoscyamus niger [black henbane]
dbj|BAB21610.2|  mangrin                                                283   2e-91    Bruguiera sexangula
ref|XP_010103817.1|  Allene oxide cyclase 4                             282   2e-91    Morus notabilis
gb|AAA80500.1|  unknown                                                 281   2e-91    Solanum lycopersicum
ref|XP_011021206.1|  PREDICTED: allene oxide cyclase 3, chloropla...    281   4e-91    Populus euphratica
gb|AFK41265.1|  unknown                                                 281   4e-91    Lotus japonicus
ref|NP_001275212.1|  allene oxide cyclase                               281   5e-91    Solanum tuberosum [potatoes]
ref|XP_003614458.1|  Allene oxide cyclase                               280   1e-90    Medicago truncatula
ref|XP_002530384.1|  Allene oxide cyclase 4, chloroplast precurso...    280   2e-90    Ricinus communis
dbj|BAE45342.1|  allene oxide cyclase                                   279   5e-90    Pisum sativum [garden pea]
gb|KJB22342.1|  hypothetical protein B456_004G046100                    278   5e-90    Gossypium raimondii
gb|AFB69864.1|  allene oxide cyclase                                    278   6e-90    Salvia miltiorrhiza [Chinese salvia]
ref|XP_011099573.1|  PREDICTED: LOW QUALITY PROTEIN: allene oxide...    278   6e-90    Sesamum indicum [beniseed]
ref|NP_001240078.1|  allene oxide cyclase 3, chloroplastic-like         278   7e-90    Glycine max [soybeans]
ref|XP_007033324.1|  Allene oxide cyclase isoform 2                     276   8e-90    
ref|NP_001240200.1|  membrane primary amine oxidase                     278   9e-90    Glycine max [soybeans]
ref|NP_001241361.1|  allene oxide cyclase 4, chloroplastic-like         278   9e-90    Glycine max [soybeans]
ref|XP_010660502.1|  PREDICTED: allene oxide cyclase                    278   1e-89    Vitis vinifera
ref|XP_004161644.1|  PREDICTED: allene oxide cyclase 3, chloropla...    277   2e-89    
ref|XP_004140337.1|  PREDICTED: allene oxide cyclase 3, chloropla...    277   2e-89    Cucumis sativus [cucumbers]
ref|XP_007154351.1|  hypothetical protein PHAVU_003G111500g             277   3e-89    Phaseolus vulgaris [French bean]
ref|XP_003518680.1|  PREDICTED: allene oxide cyclase 4, chloropla...    276   4e-89    
gb|AEE99197.1|  allene oxide cyclase 2                                  276   4e-89    Glycine max [soybeans]
ref|XP_010044291.1|  PREDICTED: allene oxide cyclase 3, chloropla...    276   5e-89    Eucalyptus grandis [rose gum]
ref|XP_008339701.1|  PREDICTED: allene oxide cyclase 4, chloropla...    276   6e-89    
ref|XP_008465778.1|  PREDICTED: allene oxide cyclase 1, chloropla...    276   6e-89    Cucumis melo [Oriental melon]
gb|AAT96852.1|  allene oxide cyclase C4                                 276   7e-89    Humulus lupulus [common hop]
ref|XP_009356280.1|  PREDICTED: allene oxide cyclase 4, chloropla...    276   8e-89    Pyrus x bretschneideri [bai li]
ref|NP_001240033.1|  allene oxide cyclase 4, chloroplastic-like         275   9e-89    Glycine max [soybeans]
emb|CDP00580.1|  unnamed protein product                                275   1e-88    Coffea canephora [robusta coffee]
ref|XP_008459463.1|  PREDICTED: allene oxide cyclase 4, chloropla...    275   1e-88    Cucumis melo [Oriental melon]
ref|XP_004297139.1|  PREDICTED: allene oxide cyclase 3, chloropla...    275   1e-88    Fragaria vesca subsp. vesca
gb|KHN47545.1|  Allene oxide cyclase 4, chloroplastic                   275   2e-88    Glycine soja [wild soybean]
ref|XP_007139329.1|  hypothetical protein PHAVU_008G020200g             274   2e-88    Phaseolus vulgaris [French bean]
ref|XP_011021732.1|  PREDICTED: allene oxide cyclase 3, chloropla...    275   2e-88    Populus euphratica
ref|NP_001242726.1|  allene oxide cyclase 4, chloroplastic-like         275   2e-88    Glycine max [soybeans]
gb|KJB22404.1|  hypothetical protein B456_004G046400                    274   2e-88    Gossypium raimondii
gb|KHG22804.1|  Allene oxide cyclase 4, chloroplastic -like protein     274   3e-88    Gossypium arboreum [tree cotton]
gb|AFK38605.1|  unknown                                                 274   3e-88    Lotus japonicus
gb|KHG22803.1|  Allene oxide cyclase 4, chloroplastic -like protein     274   3e-88    Gossypium arboreum [tree cotton]
ref|XP_007046300.1|  Allene oxide cyclase                               273   6e-88    Theobroma cacao [chocolate]
ref|XP_004514328.1|  PREDICTED: allene oxide cyclase 3, chloropla...    273   7e-88    Cicer arietinum [garbanzo]
ref|XP_009336614.1|  PREDICTED: allene oxide cyclase 4, chloropla...    273   1e-87    Pyrus x bretschneideri [bai li]
emb|CDP02799.1|  unnamed protein product                                272   1e-87    Coffea canephora [robusta coffee]
ref|XP_008389309.1|  PREDICTED: allene oxide cyclase 4, chloropla...    273   1e-87    
gb|KHG19305.1|  Allene oxide cyclase 4, chloroplastic -like protein     272   1e-87    Gossypium arboreum [tree cotton]
gb|ACU19690.1|  unknown                                                 272   1e-87    Glycine max [soybeans]
gb|AGU09699.1|  allene oxide cyclase                                    271   4e-87    Gossypium hirsutum [American cotton]
ref|XP_008459464.1|  PREDICTED: allene oxide cyclase 4, chloropla...    271   6e-87    
ref|XP_008459462.1|  PREDICTED: allene oxide cyclase 4, chloropla...    270   1e-86    
gb|KEH21777.1|  allene oxide cyclase                                    270   1e-86    Medicago truncatula
gb|AFK47606.1|  unknown                                                 270   1e-86    Medicago truncatula
ref|XP_010093405.1|  Allene oxide cyclase 4                             270   2e-86    Morus notabilis
gb|AET50928.1|  allene oxide cylase                                     270   2e-86    Lilium longiflorum [Easter lily]
gb|AAT96851.1|  allene oxide cyclase C1                                 270   2e-86    Humulus lupulus [common hop]
gb|AEC11095.1|  allene oxide cyclase                                    269   2e-86    Torenia fournieri [bluewings]
emb|CAI29046.1|  allene-oxide cyclase                                   269   2e-86    Medicago truncatula
gb|AAX56078.1|  allene oxide cyclase                                    269   3e-86    Camptotheca acuminata
gb|AGR49302.1|  allene oxide cyclase                                    269   3e-86    Catharanthus roseus [chatas]
gb|EYU29945.1|  hypothetical protein MIMGU_mgv1a012640mg                268   3e-86    Erythranthe guttata [common monkey flower]
gb|KHG12052.1|  Allene oxide cyclase 3, chloroplastic -like protein     268   6e-86    Gossypium arboreum [tree cotton]
ref|XP_006430816.1|  hypothetical protein CICLE_v10012528mg             268   7e-86    Citrus clementina [clementine]
ref|XP_008243177.1|  PREDICTED: allene oxide cyclase 3, chloropla...    268   9e-86    Prunus mume [ume]
ref|XP_007151755.1|  hypothetical protein PHAVU_004G072000g             267   1e-85    Phaseolus vulgaris [French bean]
gb|AHZ21033.1|  mangrin                                                 267   2e-85    Kandelia candel
gb|KHG19308.1|  Allene oxide cyclase 4, chloroplastic -like protein     264   2e-85    Gossypium arboreum [tree cotton]
ref|XP_004141500.1|  PREDICTED: allene oxide cyclase 4, chloropla...    266   3e-85    Cucumis sativus [cucumbers]
gb|EPS67695.1|  allene oxide cyclase                                    264   3e-85    Genlisea aurea
gb|KEH30395.1|  allene oxide cyclase                                    266   3e-85    Medicago truncatula
ref|XP_006482293.1|  PREDICTED: allene oxide cyclase 4, chloropla...    266   3e-85    Citrus sinensis [apfelsine]
gb|ADL60034.1|  allene oxide cyclase                                    266   3e-85    Salvia miltiorrhiza [Chinese salvia]
gb|KJB50746.1|  hypothetical protein B456_008G185600                    266   4e-85    Gossypium raimondii
ref|XP_007223720.1|  hypothetical protein PRUPE_ppa010397mg             266   5e-85    Prunus persica
ref|XP_007215041.1|  hypothetical protein PRUPE_ppa012079mg             263   5e-85    Prunus persica
ref|XP_009394846.1|  PREDICTED: allene oxide cyclase 1, chloropla...    265   7e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008230384.1|  PREDICTED: allene oxide cyclase 4, chloropla...    263   9e-85    Prunus mume [ume]
gb|AAT66741.1|  plastid allene oxide cyclase                            265   1e-84    Humulus lupulus [common hop]
gb|KHG03969.1|  Allene oxide cyclase 4, chloroplastic -like protein     265   1e-84    Gossypium arboreum [tree cotton]
ref|XP_006437732.1|  hypothetical protein CICLE_v10032510mg             265   1e-84    Citrus clementina [clementine]
ref|XP_004508556.1|  PREDICTED: allene oxide cyclase 3, chloropla...    264   3e-84    Cicer arietinum [garbanzo]
ref|XP_002278768.1|  PREDICTED: allene oxide cyclase 4, chloropla...    263   4e-84    Vitis vinifera
gb|ACS96438.1|  allene oxide cyclase                                    263   6e-84    Jatropha curcas
gb|KJB22328.1|  hypothetical protein B456_004G046300                    259   3e-83    Gossypium raimondii
ref|XP_009392456.1|  PREDICTED: allene oxide cyclase 3, chloropla...    258   5e-82    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001267900.1|  allene oxide cyclase                               258   6e-82    Vitis vinifera
ref|XP_009357038.1|  PREDICTED: allene oxide cyclase 4, chloropla...    255   7e-82    Pyrus x bretschneideri [bai li]
ref|XP_008810937.1|  PREDICTED: allene oxide cyclase 3, chloropla...    256   2e-81    Phoenix dactylifera
ref|XP_004304145.1|  PREDICTED: allene oxide cyclase 4, chloropla...    253   3e-81    Fragaria vesca subsp. vesca
ref|XP_008348108.1|  PREDICTED: allene oxide cyclase 4, chloropla...    253   5e-81    
ref|XP_009394154.1|  PREDICTED: allene oxide cyclase 2, chloropla...    256   6e-81    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006857130.1|  hypothetical protein AMTR_s00065p00146710          254   2e-80    Amborella trichopoda
gb|ADE76918.1|  unknown                                                 254   3e-80    Picea sitchensis
ref|XP_008379524.1|  PREDICTED: allene oxide cyclase 4, chloropla...    251   4e-80    
gb|ABK21165.1|  unknown                                                 254   4e-80    Picea sitchensis
emb|CDY59866.1|  BnaC09g52550D                                          252   1e-79    Brassica napus [oilseed rape]
ref|XP_009395977.1|  PREDICTED: allene oxide cyclase 1, chloropla...    253   2e-79    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAI58542.1|  mangrin                                                249   2e-79    Rhizophora apiculata
ref|XP_007042039.1|  Allene oxide cyclase, putative                     251   2e-79    
ref|XP_002524412.1|  Allene oxide cyclase 3, chloroplast precurso...    251   4e-79    Ricinus communis
gb|AEO13839.1|  allene oxide cyclase                                    251   4e-79    Gladiolus hybrid cultivar
ref|XP_003637011.1|  Allene oxide cyclase C4                            250   4e-79    
gb|AHZ35333.1|  allene oxide cyclase                                    250   6e-79    Picrorhiza kurrooa
gb|EMT08815.1|  Allene oxide cyclase 3, chloroplastic                   249   1e-78    
ref|XP_009114114.1|  PREDICTED: allene oxide cyclase 3, chloropla...    249   1e-78    Brassica rapa
ref|XP_010556382.1|  PREDICTED: allene oxide cyclase 3, chloropla...    249   2e-78    Tarenaya hassleriana [spider flower]
gb|ACY74378.1|  allene oxidase cyclase                                  249   2e-78    Brassica napus [oilseed rape]
gb|KFK35078.1|  hypothetical protein AALP_AA5G232400                    249   2e-78    Arabis alpina [alpine rockcress]
gb|ACY74377.1|  allene oxidase cyclase                                  249   2e-78    Brassica napus [oilseed rape]
gb|AFP87550.1|  allene oxide cyclase 4                                  248   3e-78    Oryza sativa Indica Group [Indian rice]
gb|AHA93095.1|  allene oxide cyclase 1                                  248   3e-78    Triticum aestivum [Canadian hard winter wheat]
ref|NP_001050447.1|  Os03g0438100                                       248   4e-78    
gb|EAZ27451.1|  hypothetical protein OsJ_11399                          248   4e-78    Oryza sativa Japonica Group [Japonica rice]
gb|ADL16493.1|  allene oxide cyclase                                    248   6e-78    Artemisia annua [sweet Annie]
dbj|BAJ96870.1|  predicted protein                                      247   9e-78    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAC83766.1|  allene oxide cyclase                                   246   1e-77    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010916944.1|  PREDICTED: allene oxide cyclase 1, chloropla...    247   1e-77    Elaeis guineensis
ref|XP_011078449.1|  PREDICTED: allene oxide cyclase 3, chloropla...    247   1e-77    
ref|XP_010924770.1|  PREDICTED: allene oxide cyclase 4, chloropla...    246   1e-77    Elaeis guineensis
ref|XP_002465087.1|  hypothetical protein SORBIDRAFT_01g031870          248   1e-77    Sorghum bicolor [broomcorn]
ref|XP_004983950.1|  PREDICTED: allene oxide cyclase 3, chloropla...    246   2e-77    Setaria italica
ref|XP_006650236.1|  PREDICTED: allene oxide cyclase 3, chloropla...    246   2e-77    Oryza brachyantha
ref|XP_006395626.1|  hypothetical protein EUTSA_v10004810mg             246   2e-77    Eutrema salsugineum [saltwater cress]
ref|XP_008388976.1|  PREDICTED: allene oxide cyclase 1, chloropla...    246   3e-77    
gb|AFH89625.1|  allene oxide cyclase                                    246   3e-77    Cymbidium ensifolium
ref|XP_008359967.1|  PREDICTED: allene oxide cyclase 1, chloropla...    246   3e-77    
gb|AGU41846.1|  allene oxide cyclase                                    245   3e-77    Triticum aestivum [Canadian hard winter wheat]
gb|AFP87304.1|  chloroplast allene oxide cyclase                        245   3e-77    Leymus mollis
ref|XP_003562362.1|  PREDICTED: allene oxide cyclase 3, chloropla...    244   1e-76    Brachypodium distachyon [annual false brome]
ref|XP_008792377.1|  PREDICTED: allene oxide cyclase 4, chloropla...    244   2e-76    Phoenix dactylifera
ref|NP_001105245.1|  allene oxide cyclase1                              243   3e-76    Zea mays [maize]
ref|XP_006292768.1|  hypothetical protein CARUB_v10019017mg             243   4e-76    Capsella rubella
ref|NP_001141267.1|  allene oxide cyclase 4                             242   5e-76    Zea mays [maize]
ref|XP_003637010.1|  Allene-oxide cyclase                               243   5e-76    
ref|XP_010502459.1|  PREDICTED: allene oxide cyclase 3, chloropla...    243   6e-76    Camelina sativa [gold-of-pleasure]
gb|ACG39242.1|  allene oxide cyclase 4                                  242   6e-76    Zea mays [maize]
ref|XP_010514199.1|  PREDICTED: allene oxide cyclase 3, chloropla...    243   7e-76    Camelina sativa [gold-of-pleasure]
ref|XP_010528046.1|  PREDICTED: allene oxide cyclase 3, chloropla...    240   7e-75    Tarenaya hassleriana [spider flower]
dbj|BAI58602.1|  mangrin                                                235   2e-74    Rhizophora mucronata
ref|NP_566777.1|  allene oxide cyclase 3                                239   3e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875279.1|  hypothetical protein ARALYDRAFT_484340             238   3e-74    
ref|XP_010554241.1|  PREDICTED: allene oxide cyclase 3, chloropla...    236   1e-73    Tarenaya hassleriana [spider flower]
ref|XP_010476324.1|  PREDICTED: allene oxide cyclase 4, chloropla...    236   3e-73    Camelina sativa [gold-of-pleasure]
gb|ACG32920.1|  allene oxide cyclase 4                                  234   1e-72    Zea mays [maize]
ref|NP_172786.1|  allene oxide cyclase 4                                234   2e-72    Arabidopsis thaliana [mouse-ear cress]
gb|ACN27052.1|  unknown                                                 234   2e-72    Zea mays [maize]
gb|AAG09557.1|AC011810_16  Unknown Protein                              231   2e-72    Arabidopsis thaliana [mouse-ear cress]
emb|CAN68566.1|  hypothetical protein VITISV_032173                     233   3e-72    Vitis vinifera
ref|XP_010458779.1|  PREDICTED: allene oxide cyclase 4, chloropla...    233   3e-72    Camelina sativa [gold-of-pleasure]
gb|AIR76995.1|  allene oxide cyclase                                    228   4e-72    Lilium longiflorum [Easter lily]
ref|XP_010495179.1|  PREDICTED: allene oxide cyclase 4, chloropla...    233   5e-72    Camelina sativa [gold-of-pleasure]
gb|ACU24579.1|  unknown                                                 231   8e-72    Glycine max [soybeans]
ref|XP_006291745.1|  hypothetical protein CARUB_v10017913mg             232   1e-71    Capsella rubella
ref|XP_010502458.1|  PREDICTED: allene oxide cyclase 3, chloropla...    231   2e-71    Camelina sativa [gold-of-pleasure]
ref|XP_006304140.1|  hypothetical protein CARUB_v10010123mg             231   2e-71    Capsella rubella
ref|XP_010692623.1|  PREDICTED: allene oxide cyclase 2, chloropla...    231   3e-71    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010514196.1|  PREDICTED: allene oxide cyclase 2, chloropla...    230   4e-71    
ref|XP_008370524.1|  PREDICTED: allene oxide cyclase 2, chloropla...    230   6e-71    
gb|KFK43593.1|  hypothetical protein AALP_AA1G146300                    229   7e-71    Arabis alpina [alpine rockcress]
ref|XP_010692616.1|  PREDICTED: allene oxide cyclase 2, chloropla...    229   8e-71    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010514195.1|  PREDICTED: allene oxide cyclase 2, chloropla...    229   1e-70    Camelina sativa [gold-of-pleasure]
ref|XP_010425227.1|  PREDICTED: allene oxide cyclase 2, chloropla...    228   2e-70    Camelina sativa [gold-of-pleasure]
ref|XP_002889998.1|  hypothetical protein ARALYDRAFT_334627             228   3e-70    
gb|EYU29946.1|  hypothetical protein MIMGU_mgv1a012460mg                228   3e-70    Erythranthe guttata [common monkey flower]
pdb|4H6B|A  Chain A, Structural Basis For Allene Oxide Cyclizatio...    226   3e-70    Physcomitrella patens
ref|XP_010425230.1|  PREDICTED: allene oxide cyclase 3, chloropla...    228   3e-70    Camelina sativa [gold-of-pleasure]
ref|XP_001783824.1|  predicted protein                                  226   3e-70    
ref|XP_010502446.1|  PREDICTED: allene oxide cyclase 2, chloropla...    228   4e-70    Camelina sativa [gold-of-pleasure]
ref|XP_006291721.1|  hypothetical protein CARUB_v10017888mg             227   7e-70    Capsella rubella
pdb|2GIN|A  Chain A, X-Ray Structure Of The Wt Allene Oxide Cycla...    224   2e-69    Arabidopsis thaliana [mouse-ear cress]
ref|NP_566776.1|  allene oxide cyclase 2                                226   2e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875278.1|  hypothetical protein ARALYDRAFT_484339             226   2e-69    
ref|XP_010502447.1|  PREDICTED: allene oxide cyclase 2, chloropla...    226   2e-69    Camelina sativa [gold-of-pleasure]
pdb|4CQ6|A  Chain A, The Crystal Structure Of The Allene Oxide Cy...    223   3e-69    Arabidopsis thaliana [mouse-ear cress]
pdb|1Z8K|A  Chain A, X-ray Structure Of Allene Oxide Cyclase From...    223   4e-69    Arabidopsis thaliana [mouse-ear cress]
emb|CDX83551.1|  BnaC07g22910D                                          224   5e-69    
pdb|2DIO|A  Chain A, Crystal Structure Of The Allene Oxide Cyclas...    223   6e-69    Arabidopsis thaliana [mouse-ear cress]
emb|CDX83550.1|  BnaC07g22900D                                          224   7e-69    
pdb|2BRJ|A  Chain A, X-Ray Structure Of The Allene Oxide Cyclase ...    222   8e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010425226.1|  PREDICTED: allene oxide cyclase 2, chloropla...    224   1e-68    Camelina sativa [gold-of-pleasure]
ref|XP_006395628.1|  hypothetical protein EUTSA_v10004824mg             224   1e-68    Eutrema salsugineum [saltwater cress]
emb|CDY59869.1|  BnaC09g52570D                                          223   2e-68    Brassica napus [oilseed rape]
ref|XP_009114115.1|  PREDICTED: allene oxide cyclase 2, chloropla...    223   2e-68    Brassica rapa
emb|CDY13582.1|  BnaA06g33410D                                          223   4e-68    Brassica napus [oilseed rape]
emb|CDY50180.1|  BnaC08g15790D                                          223   4e-68    Brassica napus [oilseed rape]
pdb|1ZVC|A  Chain A, X-Ray Structure Of Allene Oxide Cyclase From...    220   4e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001751254.1|  predicted protein                                  220   5e-68    
dbj|BAB63918.1|  ERD12 protein                                          222   5e-68    Arabidopsis thaliana [mouse-ear cress]
pdb|4H69|A  Chain A, Crystal Structure Of The Allene Oxide Cyclas...    220   5e-68    Physcomitrella patens
emb|CDY72244.1|  BnaCnng76690D                                          222   7e-68    Brassica napus [oilseed rape]
ref|NP_189204.1|  allene oxide cyclase 1                                222   8e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010554242.1|  PREDICTED: allene oxide cyclase 3, chloropla...    221   1e-67    Tarenaya hassleriana [spider flower]
emb|CAD48753.1|  allene oxide cyclase                                   218   3e-67    Physcomitrella patens
ref|XP_010425228.1|  PREDICTED: allene oxide cyclase 2, chloropla...    219   8e-67    Camelina sativa [gold-of-pleasure]
ref|XP_010430726.1|  PREDICTED: allene oxide cyclase 2, chloropla...    219   2e-66    Camelina sativa [gold-of-pleasure]
gb|KFK35075.1|  hypothetical protein AALP_AA5G232000                    229   4e-66    Arabis alpina [alpine rockcress]
ref|XP_002875277.1|  ERD12 protein                                      217   6e-66    Arabidopsis lyrata subsp. lyrata
ref|XP_010514198.1|  PREDICTED: allene oxide cyclase 2, chloropla...    217   8e-66    Camelina sativa [gold-of-pleasure]
ref|XP_009110591.1|  PREDICTED: allene oxide cyclase 4, chloropla...    213   1e-64    Brassica rapa
ref|XP_009152113.1|  PREDICTED: allene oxide cyclase 2, chloropla...    213   3e-64    Brassica rapa
gb|ABV89668.1|  ERD12 protein                                           212   5e-64    Brassica rapa
ref|XP_009152186.1|  PREDICTED: allene oxide cyclase 3, chloropla...    209   1e-63    Brassica rapa
ref|XP_002969526.1|  hypothetical protein SELMODRAFT_91887              207   5e-63    
emb|CDY13583.1|  BnaA06g33400D                                          204   1e-61    Brassica napus [oilseed rape]
ref|XP_006495473.1|  PREDICTED: allene oxide cyclase 4, chloropla...    197   1e-59    
ref|XP_004156234.1|  PREDICTED: allene oxide cyclase 2, chloropla...    194   1e-58    
gb|KJB50748.1|  hypothetical protein B456_008G185600                    191   2e-56    Gossypium raimondii
ref|XP_006373455.1|  hypothetical protein POPTR_0017s13940g             186   2e-55    
gb|AFW88168.1|  hypothetical protein ZEAMMB73_091885                    178   3e-52    
gb|ABO61151.1|  allene oxide cyclase                                    171   4e-50    Nicotiana attenuata
gb|EMS52587.1|  Allene oxide cyclase 3, chloroplastic                   172   4e-49    Triticum urartu
ref|XP_001760307.1|  predicted protein                                  157   2e-43    
dbj|BAO93687.1|  allene oxide cyclase                                   145   4e-38    Marchantia polymorpha
ref|XP_001779767.1|  predicted protein                                  138   3e-36    
ref|XP_006417137.1|  hypothetical protein EUTSA_v10008630mg             137   2e-35    
ref|XP_001771240.1|  predicted protein                                  135   2e-34    
gb|KJB22383.1|  hypothetical protein B456_004G0462002                   126   4e-32    Gossypium raimondii
ref|XP_007208176.1|  hypothetical protein PRUPE_ppa022035mg             117   3e-28    
gb|AGH14183.1|  putative allene oxide cyclase                         99.4    7e-23    Catharanthus roseus [chatas]
ref|XP_009394152.1|  PREDICTED: uncharacterized protein LOC103979...  82.4    2e-15    
ref|XP_009394153.1|  PREDICTED: uncharacterized protein LOC103979...  82.0    2e-15    
gb|KJB22356.1|  hypothetical protein B456_004G0462001                 73.2    2e-13    Gossypium raimondii
gb|AGL75607.1|  mangrin                                               68.9    4e-12    Rhizophora apiculata
ref|XP_003628626.1|  Allene-oxide cyclase                             67.4    8e-11    
tpg|DAA45889.1|  TPA: hypothetical protein ZEAMMB73_165754            66.6    1e-10    
ref|WP_002615122.1|  hypothetical protein                             54.7    5e-06    Stigmatella aurantiaca
emb|CDX83553.1|  BnaC07g22930D                                        53.9    5e-06    
ref|WP_044187159.1|  Allene oxide cyclase                             54.3    6e-06    
gb|ADO73769.1|  uncharacterized protein STAUR_6009                    54.7    6e-06    Stigmatella aurantiaca DW4/3-1
gb|KFE69350.1|  hypothetical protein DB31_6325                        54.3    6e-06    Hyalangium minutum
ref|WP_027862100.1|  hypothetical protein                             52.4    4e-05    Marmoricola sp. URHB0036
ref|WP_040448196.1|  Allene oxide cyclase                             52.0    5e-05    
gb|EFH82198.1|  Allene oxide cyclase                                  51.6    7e-05    Ktedonobacter racemifer DSM 44963
ref|WP_029117373.1|  hypothetical protein                             50.4    2e-04    Mycobacterium sp. URHB0044
dbj|BAN45359.1|  mangrin                                              47.4    5e-04    Bruguiera gymnorhiza [Burma mangrove]
ref|WP_008067140.1|  hypothetical protein                             48.9    5e-04    Novosphingobium nitrogenifigens



>gb|ABC40984.1| chloroplast allene oxide cyclase precursor [Ipomoea nil]
Length=245

 Score =   352 bits (903),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 187/187 (100%), Positives = 187/187 (100%), Gaps = 0/187 (0%)
 Frame = -1

Query  769  KRSVTVKSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDL  590
            KRSVTVKSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDL
Sbjct  59   KRSVTVKSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDL  118

Query  589  QKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSG  410
            QKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSG
Sbjct  119  QKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSG  178

Query  409  IFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGS  230
            IFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGAPVPPSPAVEPSPAAKACEPGS
Sbjct  179  IFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGAPVPPSPAVEPSPAAKACEPGS  238

Query  229  TIGNFTD  209
            TIGNFTD
Sbjct  239  TIGNFTD  245



>gb|ACD12705.1| AOC [Petunia x hybrida]
Length=243

 Score =   299 bits (765),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 169/190 (89%), Gaps = 4/190 (2%)
 Frame = -1

Query  766  RSVTVKSQSAPAG----KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYT  599
            +S   KSQS+       KVQEL VYE+NERDRGSPAYLRLSQK+VN+LGDLVPFSNKLYT
Sbjct  54   KSFYCKSQSSSTDSTNTKVQELSVYEMNERDRGSPAYLRLSQKTVNSLGDLVPFSNKLYT  113

Query  598  GDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTG  419
            GDL+KR+GITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDTYLAVTG
Sbjct  114  GDLKKRIGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGSYLTYEDTYLAVTG  173

Query  418  GSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACE  239
            GSGIF GVSGQVKLQQ+IFPFKLFYTFYLKGIPDLP+EL G  V PSP VEPSP AKACE
Sbjct  174  GSGIFAGVSGQVKLQQIIFPFKLFYTFYLKGIPDLPSELLGTAVAPSPTVEPSPEAKACE  233

Query  238  PGSTIGNFTD  209
             G+T+ NFT+
Sbjct  234  AGATVKNFTN  243



>ref|XP_010061864.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW68894.1| hypothetical protein EUGRSUZ_F02479 [Eucalyptus grandis]
Length=256

 Score =   299 bits (766),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 175/193 (91%), Gaps = 6/193 (3%)
 Frame = -1

Query  769  KRSVTVKSQSAPAG------KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNK  608
            +RS + KSQ+APAG      KVQELC+YEINERDRGSPA L+LSQK VN+LGDLVPFSNK
Sbjct  64   RRSFSCKSQAAPAGGDSAPGKVQELCIYEINERDRGSPAILKLSQKPVNSLGDLVPFSNK  123

Query  607  LYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  428
            LYTGDLQKRVGITAG+CILI+++ EKKGDRYEAI+SFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  124  LYTGDLQKRVGITAGICILIQNKPEKKGDRYEAIFSFYFGDYGHIAVQGPYLTYEDTYLA  183

Query  427  VTGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAK  248
            VTGGSGIFEG +GQVKLQQLIFPFKLFYTFYLKG+ DLPAEL G PVPP+P+VEPSPAA+
Sbjct  184  VTGGSGIFEGATGQVKLQQLIFPFKLFYTFYLKGVKDLPAELLGKPVPPNPSVEPSPAAR  243

Query  247  ACEPGSTIGNFTD  209
            ACEP +TI NFTD
Sbjct  244  ACEPNATIANFTD  256



>emb|CAC83765.1| allene oxide cyclase [Nicotiana tabacum]
Length=245

 Score =   295 bits (755),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 169/190 (89%), Gaps = 4/190 (2%)
 Frame = -1

Query  766  RSVTVKSQS----APAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYT  599
            +S   KSQS    +   KVQEL VYE+NERDRGSPAYLRLSQK+VN+LGDLVPFSNKLYT
Sbjct  56   KSFYCKSQSGSTDSSTTKVQELSVYELNERDRGSPAYLRLSQKNVNSLGDLVPFSNKLYT  115

Query  598  GDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTG  419
            GDL+KR+GITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDTYLAVTG
Sbjct  116  GDLKKRIGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGSYLTYEDTYLAVTG  175

Query  418  GSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACE  239
            GSGIF GVSGQVKLQQ+IFPFKLFYTFYLKGIPDLP+EL    VPPSP VEP+P AKACE
Sbjct  176  GSGIFAGVSGQVKLQQIIFPFKLFYTFYLKGIPDLPSELLVTAVPPSPTVEPAPEAKACE  235

Query  238  PGSTIGNFTD  209
             G+T+ NFT+
Sbjct  236  AGATLKNFTN  245



>ref|XP_009790745.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Nicotiana 
sylvestris]
Length=245

 Score =   294 bits (753),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQEL VYE+NERDRGSPAYLRLSQKSVN+LGDLVPFSNKLYTGDL+KR+GITAGLCILI
Sbjct  73   KVQELSVYELNERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYTGDLKKRIGITAGLCILI  132

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            KHEEEKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDTYLAVTGGSGIF GVSGQVKLQQ+
Sbjct  133  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGSYLTYEDTYLAVTGGSGIFAGVSGQVKLQQI  192

Query  367  IFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            IFPFKLFYTFYLKGIPDLP+EL    VPPSP VEP+P AKACE G+T+ NFT+
Sbjct  193  IFPFKLFYTFYLKGIPDLPSELMVTAVPPSPTVEPAPEAKACEAGATVKNFTN  245



>ref|NP_001289444.1| uncharacterized protein LOC104120106 [Nicotiana tomentosiformis]
 gb|AGR88649.1| allene oxide cyclase [Nicotiana tomentosiformis]
Length=245

 Score =   294 bits (753),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 168/190 (88%), Gaps = 4/190 (2%)
 Frame = -1

Query  766  RSVTVKSQSAPAG----KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYT  599
            +S   KSQS        KVQEL VYE+NERDRGSPAYLRLSQK+VN+LGDLVPFSNKLYT
Sbjct  56   KSFYCKSQSGSTDPSTTKVQELSVYELNERDRGSPAYLRLSQKNVNSLGDLVPFSNKLYT  115

Query  598  GDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTG  419
            GDL+KR+GITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDTYLAVTG
Sbjct  116  GDLKKRIGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGSYLTYEDTYLAVTG  175

Query  418  GSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACE  239
            GSGIF GVSGQVKLQQ+IFPFKLFYTFYLKGIPDLP+EL    VPPSP VEP+P AKACE
Sbjct  176  GSGIFAGVSGQVKLQQIIFPFKLFYTFYLKGIPDLPSELLVTAVPPSPTVEPAPEAKACE  235

Query  238  PGSTIGNFTD  209
             G+T+ NFT+
Sbjct  236  AGATLKNFTN  245



>gb|AFV68275.1| allene oxide cyclase [Catharanthus roseus]
Length=251

 Score =   294 bits (752),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 173/192 (90%), Gaps = 6/192 (3%)
 Frame = -1

Query  766  RSVTVKSQS------APAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKL  605
            RS T +SQS      + + K+QEL VYEINERDRGSPAYLRLSQK+ N+LGDLVPF+NK+
Sbjct  60   RSFTCRSQSTTTPSDSRSTKIQELHVYEINERDRGSPAYLRLSQKTANSLGDLVPFTNKV  119

Query  604  YTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAV  425
            Y+GDLQKR+GIT+G+CILIK+E EKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDTYLAV
Sbjct  120  YSGDLQKRLGITSGICILIKNEPEKKGDRYEAIYSFYFGDYGHIAVQGPYLTYEDTYLAV  179

Query  424  TGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKA  245
            TGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAEL G PVPPSP VEPSPAAKA
Sbjct  180  TGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELLGKPVPPSPTVEPSPAAKA  239

Query  244  CEPGSTIGNFTD  209
            CE G+TI NFT+
Sbjct  240  CEDGATITNFTN  251



>gb|EYU44656.1| hypothetical protein MIMGU_mgv1a012403mg [Erythranthe guttata]
Length=251

 Score =   290 bits (741),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  733  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCI  554
            + K+QEL VYEINERDRGSPAYLRLSQK+VN+LGDLVPFSNK+YTGD++KR GITAG+C+
Sbjct  77   SSKIQELNVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYTGDMKKRAGITAGICV  136

Query  553  LIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQ  374
            LIK+E EKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDT LAVTGGSGIFEG  GQVKLQ
Sbjct  137  LIKNEPEKKGDRYEAIYSFYFGDYGHIAVQGPYLTYEDTCLAVTGGSGIFEGAYGQVKLQ  196

Query  373  QLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            Q+IFPFKLFYTFYLKGIPDLP+EL G PVPPSPAVEPSPAAKACEPG+T+ NFTD
Sbjct  197  QIIFPFKLFYTFYLKGIPDLPSELLGEPVPPSPAVEPSPAAKACEPGATLANFTD  251



>gb|ADY38579.1| allene oxide cyclase [Camellia sinensis]
Length=245

 Score =   289 bits (739),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 170/188 (90%), Gaps = 5/188 (3%)
 Frame = -1

Query  757  TVKSQSAPA-----GKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGD  593
            T KSQS P+      KVQ+LCVYEINERDRGSPAYLRLSQKSVN+LGDLVPF+NK+YTGD
Sbjct  58   TCKSQSNPSDASRPSKVQQLCVYEINERDRGSPAYLRLSQKSVNSLGDLVPFTNKVYTGD  117

Query  592  LQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGS  413
            LQKR+GITAG+CILI++  EKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDT LAVTGGS
Sbjct  118  LQKRLGITAGICILIQNVPEKKGDRYEAIYSFYFGDYGHIAVQGSYLTYEDTCLAVTGGS  177

Query  412  GIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPG  233
            GIFEGV GQVKL Q+IFPFKLFYTFYLKGIPDLP EL GAPVPPSPAVEPSPAAKACE G
Sbjct  178  GIFEGVYGQVKLHQIIFPFKLFYTFYLKGIPDLPVELLGAPVPPSPAVEPSPAAKACEGG  237

Query  232  STIGNFTD  209
            +TI NFT+
Sbjct  238  ATISNFTN  245



>gb|ACZ06580.1| allene oxide cyclase [Jatropha curcas]
 gb|KDP32930.1| hypothetical protein JCGZ_12961 [Jatropha curcas]
Length=250

 Score =   288 bits (736),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 166/190 (87%), Gaps = 3/190 (2%)
 Frame = -1

Query  769  KRSVTVKSQSA---PAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYT  599
            KRS + KSQ++      K QEL VYEINERDRGSPAYLRLSQK VN+LGDLVPFSNKLYT
Sbjct  61   KRSFSCKSQASDDSTPSKFQELHVYEINERDRGSPAYLRLSQKEVNSLGDLVPFSNKLYT  120

Query  598  GDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTG  419
            GDLQKR+GITAG+CILI+H+ EKKGDRYEAIYSFYFGDYGHIAVQG YLTYED+YLAVTG
Sbjct  121  GDLQKRIGITAGICILIEHKAEKKGDRYEAIYSFYFGDYGHIAVQGAYLTYEDSYLAVTG  180

Query  418  GSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACE  239
            G+GIFEGVSGQVKL+QLIFPFKLFYTFYLKGI DLP EL G PV P PAVEP P AKAC+
Sbjct  181  GTGIFEGVSGQVKLRQLIFPFKLFYTFYLKGIKDLPEELVGKPVEPHPAVEPHPDAKACQ  240

Query  238  PGSTIGNFTD  209
            P + + NFTD
Sbjct  241  PHAALVNFTD  250



>ref|XP_004309482.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=249

 Score =   287 bits (735),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 169/194 (87%), Gaps = 7/194 (4%)
 Frame = -1

Query  769  KRSVTVKSQSAPAG------KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNK  608
            +RS T KSQS+P+       KVQEL VYEINERDRGSPA+L+LSQK VN+LGDLVPFSNK
Sbjct  56   QRSFTCKSQSSPSSETERSTKVQELNVYEINERDRGSPAFLKLSQKPVNSLGDLVPFSNK  115

Query  607  LYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  428
            LYTGDLQKR+GITAG+C+LI+++ EKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  116  LYTGDLQKRIGITAGICVLIENKPEKKGDRYEAIYSFYFGDYGHIAVQGSYLTYEDTYLA  175

Query  427  VTGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaA  251
            VTGGSG+FEG  GQVKLQQLIFPFKLFYTFYLKGI  DLP EL G PV P P VEPSPAA
Sbjct  176  VTGGSGVFEGAYGQVKLQQLIFPFKLFYTFYLKGIKEDLPNELLGKPVEPHPGVEPSPAA  235

Query  250  KACEPGSTIGNFTD  209
            KACEP +TI NFT+
Sbjct  236  KACEPHATIANFTN  249



>ref|XP_007033323.1| Allene oxide cyclase 4 isoform 1 [Theobroma cacao]
 gb|EOY04249.1| Allene oxide cyclase 4 isoform 1 [Theobroma cacao]
Length=253

 Score =   287 bits (735),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 169/192 (88%), Gaps = 5/192 (3%)
 Frame = -1

Query  769  KRSVTVKSQSAPA-----GKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKL  605
            KRS T KSQ+ P+      KVQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPFSNK+
Sbjct  62   KRSFTCKSQAIPSDNSTPNKVQELYVYEINERDRGSPAYLRLSQKPVNSLGDLVPFSNKI  121

Query  604  YTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAV  425
            YTGDLQKR+GIT+G+CILI+H+ EKKGDRYEAI+SFYFGDYGHIAVQG YLTYEDTYLAV
Sbjct  122  YTGDLQKRIGITSGICILIEHKPEKKGDRYEAIFSFYFGDYGHIAVQGPYLTYEDTYLAV  181

Query  424  TGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKA  245
            TGGSGIFEGV+GQVKLQQ++FPFK+FYTFYLKGI +LP EL   PV P+P VE +PAAKA
Sbjct  182  TGGSGIFEGVTGQVKLQQIVFPFKIFYTFYLKGIGELPEELVCKPVEPNPGVEAAPAAKA  241

Query  244  CEPGSTIGNFTD  209
            CEP +T+ NFT+
Sbjct  242  CEPHATVANFTN  253



>gb|ABK94763.1| unknown [Populus trichocarpa]
Length=251

 Score =   286 bits (732),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 169/193 (88%), Gaps = 6/193 (3%)
 Frame = -1

Query  769  KRSVTVKSQSAPA-----GKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKL  605
            KRS + KSQ+A        KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPFSNKL
Sbjct  59   KRSFSCKSQAASTEDSRPTKVQELSVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKL  118

Query  604  YTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAV  425
            YTGDLQKRVGITAGLC+LI+++ EKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDTYLAV
Sbjct  119  YTGDLQKRVGITAGLCVLIQNKPEKKGDRYEAIYSFYFGDYGHIAVQGSYLTYEDTYLAV  178

Query  424  TGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGI-PDLPAELCGapvppspavepspaAK  248
            TGGSGIFEGV GQVKLQQL+FPFKLFYTFYLKG+  DLP EL G  V PSPAVEPSPAAK
Sbjct  179  TGGSGIFEGVYGQVKLQQLVFPFKLFYTFYLKGLKADLPEELLGKAVEPSPAVEPSPAAK  238

Query  247  ACEPGSTIGNFTD  209
            ACEP + I N+T+
Sbjct  239  ACEPHAVIANYTN  251



>ref|XP_002305951.2| mangrin family protein [Populus trichocarpa]
 gb|ABK94126.1| unknown [Populus trichocarpa]
 gb|EEE86462.2| mangrin family protein [Populus trichocarpa]
Length=251

 Score =   286 bits (732),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 169/193 (88%), Gaps = 6/193 (3%)
 Frame = -1

Query  769  KRSVTVKSQSAPA-----GKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKL  605
            KRS + KSQ+A        KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPFSNKL
Sbjct  59   KRSFSCKSQAASTEDSRPTKVQELSVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKL  118

Query  604  YTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAV  425
            YTGDLQKRVGITAGLC+LI+++ EKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDTYLAV
Sbjct  119  YTGDLQKRVGITAGLCVLIQNKPEKKGDRYEAIYSFYFGDYGHIAVQGSYLTYEDTYLAV  178

Query  424  TGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGI-PDLPAELCGapvppspavepspaAK  248
            TGGSGIFEGV GQVKLQQL+FPFKLFYTFYLKG+  DLP EL G  V PSPAVEPSPAAK
Sbjct  179  TGGSGIFEGVYGQVKLQQLVFPFKLFYTFYLKGLKADLPEELLGKAVEPSPAVEPSPAAK  238

Query  247  ACEPGSTIGNFTD  209
            ACEP + I N+T+
Sbjct  239  ACEPHAVIANYTN  251



>ref|XP_006482294.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Citrus 
sinensis]
 gb|KDO36048.1| hypothetical protein CISIN_1g025525mg [Citrus sinensis]
Length=251

 Score =   286 bits (731),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 156/192 (81%), Positives = 167/192 (87%), Gaps = 5/192 (3%)
 Frame = -1

Query  769  KRSVTVKSQSAPAG-----KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKL  605
            KRS T +SQ+  +      KVQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPFSNKL
Sbjct  60   KRSFTCRSQANSSDDPRPTKVQELHVYEINERDRGSPAYLRLSQKPVNSLGDLVPFSNKL  119

Query  604  YTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAV  425
            YTGDLQKR+GITAGLCILI+++ EKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDTYLAV
Sbjct  120  YTGDLQKRLGITAGLCILIENKPEKKGDRYEAIYSFYFGDYGHIAVQGPYLTYEDTYLAV  179

Query  424  TGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKA  245
            TGGSGIFEGV GQVKLQQL+FPFKLFYTFYLKGI DLP  L G PV P P VEPSPAAKA
Sbjct  180  TGGSGIFEGVYGQVKLQQLVFPFKLFYTFYLKGIKDLPEVLLGKPVDPHPGVEPSPAAKA  239

Query  244  CEPGSTIGNFTD  209
            CEPG+ I NFT+
Sbjct  240  CEPGAAIDNFTN  251



>ref|XP_010265246.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Nelumbo 
nucifera]
Length=256

 Score =   285 bits (730),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 165/187 (88%), Gaps = 1/187 (1%)
 Frame = -1

Query  766  RSVTVKSQSAPAG-KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDL  590
            RS + K +  PA  KVQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPFSNK+Y+GDL
Sbjct  70   RSFSCKMEGEPASTKVQELHVYEINERDRGSPAYLRLSQKEVNSLGDLVPFSNKIYSGDL  129

Query  589  QKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSG  410
            QKR+GITAG+C+LI+H  EKKGDRYEAIYSFYFGDYGHI VQG YLTYEDTYLAVTGGSG
Sbjct  130  QKRLGITAGICVLIQHVPEKKGDRYEAIYSFYFGDYGHITVQGAYLTYEDTYLAVTGGSG  189

Query  409  IFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGS  230
            +FEG SGQVKLQQLIFPFKLFYTFYLKGIPDLP EL   PVPPSP VEPSPAAKA EP +
Sbjct  190  VFEGASGQVKLQQLIFPFKLFYTFYLKGIPDLPVELLCTPVPPSPTVEPSPAAKATEPHA  249

Query  229  TIGNFTD  209
            TI NFT+
Sbjct  250  TIRNFTN  256



>ref|XP_011004427.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Populus 
euphratica]
Length=251

 Score =   285 bits (728),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 169/193 (88%), Gaps = 6/193 (3%)
 Frame = -1

Query  769  KRSVTVKSQSAP-----AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKL  605
            KRS + KSQ+A        KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPFSNKL
Sbjct  59   KRSFSCKSQAASNEDSRPTKVQELSVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKL  118

Query  604  YTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAV  425
            YTGDLQKRVGITAGLC+LI+++ EKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDTYLAV
Sbjct  119  YTGDLQKRVGITAGLCVLIQNKPEKKGDRYEAIYSFYFGDYGHIAVQGSYLTYEDTYLAV  178

Query  424  TGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAK  248
            TGGSGIFEGV GQVKLQQL+FPFKLFYTFYLKG+  DLP EL G  V PSPAVEPSPAAK
Sbjct  179  TGGSGIFEGVYGQVKLQQLVFPFKLFYTFYLKGLKEDLPEELLGKAVEPSPAVEPSPAAK  238

Query  247  ACEPGSTIGNFTD  209
            ACEP + I N+++
Sbjct  239  ACEPHAVIANYSN  251



>ref|XP_006430815.1| hypothetical protein CICLE_v10012552mg [Citrus clementina]
 gb|ESR44055.1| hypothetical protein CICLE_v10012552mg [Citrus clementina]
Length=251

 Score =   285 bits (728),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 166/192 (86%), Gaps = 5/192 (3%)
 Frame = -1

Query  769  KRSVTVKSQSAPAG-----KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKL  605
            KRS T +SQ+  +      KVQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPFSNKL
Sbjct  60   KRSFTCRSQANSSDDPRPTKVQELHVYEINERDRGSPAYLRLSQKPVNSLGDLVPFSNKL  119

Query  604  YTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAV  425
            YTGDLQKRVGITAG+CILI+++ EKKGDRYEA YSFYFGDYGHIAVQG YLTYEDTYLAV
Sbjct  120  YTGDLQKRVGITAGICILIENKPEKKGDRYEATYSFYFGDYGHIAVQGPYLTYEDTYLAV  179

Query  424  TGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKA  245
            TGGSGIFEGV GQVKLQQL+FPFKLFYTFYLKGI DLP  L G PV P P VEPSPAAKA
Sbjct  180  TGGSGIFEGVYGQVKLQQLVFPFKLFYTFYLKGIKDLPEVLLGKPVDPHPGVEPSPAAKA  239

Query  244  CEPGSTIGNFTD  209
            CEPG+ I NFT+
Sbjct  240  CEPGAAIDNFTN  251



>ref|XP_006363132.1| PREDICTED: allene oxide cyclase 3, chloroplastic [Solanum tuberosum]
Length=244

 Score =   284 bits (727),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 165/190 (87%), Gaps = 4/190 (2%)
 Frame = -1

Query  766  RSVTVKSQSAPAG----KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYT  599
            RS + KSQ++       +VQEL VYE+NERDRGSPAYLRLSQK+VN+LGDLVPFSNKLYT
Sbjct  55   RSFSCKSQNSSTDSTNTEVQELSVYELNERDRGSPAYLRLSQKNVNSLGDLVPFSNKLYT  114

Query  598  GDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTG  419
             DL+KR+GITAGLCILIKHEEEKKGDRYEA+YSFYFGDYG IAVQG YLTYEDTYLAVTG
Sbjct  115  ADLKKRIGITAGLCILIKHEEEKKGDRYEAVYSFYFGDYGQIAVQGSYLTYEDTYLAVTG  174

Query  418  GSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACE  239
            GSGIF GVSGQVKL QLIFPFKLFY FYLKGIPDLP+EL    VPPSP VEP+P AKACE
Sbjct  175  GSGIFAGVSGQVKLHQLIFPFKLFYIFYLKGIPDLPSELLCTAVPPSPTVEPTPEAKACE  234

Query  238  PGSTIGNFTD  209
             G+ + N+T+
Sbjct  235  DGAALKNYTN  244



>gb|ABK96763.1| unknown [Populus trichocarpa x Populus deltoides]
Length=251

 Score =   284 bits (726),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 168/193 (87%), Gaps = 6/193 (3%)
 Frame = -1

Query  769  KRSVTVKSQSAPA-----GKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKL  605
             RS + KSQ+A        KVQEL VYEINERDRGSPAYLRLSQK+VN+LGDLVPFSNKL
Sbjct  59   NRSFSCKSQAASTEDSRPTKVQELSVYEINERDRGSPAYLRLSQKAVNSLGDLVPFSNKL  118

Query  604  YTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAV  425
            YTGDLQKRVGITAGLC+LI+++ EKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDTYLAV
Sbjct  119  YTGDLQKRVGITAGLCVLIQNKPEKKGDRYEAIYSFYFGDYGHIAVQGSYLTYEDTYLAV  178

Query  424  TGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGI-PDLPAELCGapvppspavepspaAK  248
            TGGSGIFEGV GQVKLQQL+FPFKLFYTFYLKG+  DLP EL G  V PSPAVEPSPAAK
Sbjct  179  TGGSGIFEGVYGQVKLQQLVFPFKLFYTFYLKGLKADLPEELLGKAVEPSPAVEPSPAAK  238

Query  247  ACEPGSTIGNFTD  209
            ACEP + I N+T+
Sbjct  239  ACEPHAVIANYTN  251



>ref|NP_001234019.1| allene oxide cyclase [Solanum lycopersicum]
 gb|AAK62358.1|AF384374_1 allene oxide cylase [Solanum lycopersicum]
 emb|CAB95731.1| allene oxide cyclase [Solanum lycopersicum]
 emb|CAC83759.1| allene oxide cyclase [Solanum lycopersicum]
 emb|CAC83760.1| allene oxide cyclase [Solanum lycopersicum]
Length=244

 Score =   283 bits (724),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            +VQEL VYEINERDRGSPAYLRLSQK+VN+LGDLVPFSNKLYT DL+KR+GITAGLCILI
Sbjct  72   EVQELSVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKLYTADLKKRIGITAGLCILI  131

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            KHEEEKKGDRYEA+YSFYFGDYGHIAVQG YLTYE+TYLAVTGGSGIF GVSGQVKLQQL
Sbjct  132  KHEEEKKGDRYEAVYSFYFGDYGHIAVQGAYLTYEETYLAVTGGSGIFAGVSGQVKLQQL  191

Query  367  IFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            IFPFKLFYTFYLKGIP LP+EL    VPPSP VEP+P AKACE G+ + N+T+
Sbjct  192  IFPFKLFYTFYLKGIPGLPSELLCTAVPPSPTVEPTPEAKACEEGAALKNYTN  244



>gb|AAU11327.1| allene oxide cyclase [Hyoscyamus niger]
Length=248

 Score =   283 bits (723),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQEL VYE+NE DRGSPAYLRLSQK+VN+LGDLVPFSNKLYT DL+KR+GITAGLCIL 
Sbjct  76   KVQELSVYELNEHDRGSPAYLRLSQKNVNSLGDLVPFSNKLYTADLKKRIGITAGLCILT  135

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            KHEEEKKGDRYEAIYSFYFG+YGHIAVQG YLTYEDTYLAVTGGSGIF GVSGQVKLQQ+
Sbjct  136  KHEEEKKGDRYEAIYSFYFGEYGHIAVQGSYLTYEDTYLAVTGGSGIFAGVSGQVKLQQI  195

Query  367  IFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            IFPFKLFYTFYLKGIPDLP+EL    VPPSP VEP+P AKACE G+T+ +FT+
Sbjct  196  IFPFKLFYTFYLKGIPDLPSELLCTAVPPSPTVEPTPEAKACEAGATLKDFTN  248



>dbj|BAB21610.2| mangrin [Bruguiera sexangula]
Length=256

 Score =   283 bits (723),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 167/193 (87%), Gaps = 6/193 (3%)
 Frame = -1

Query  769  KRSVTVKSQSAPAG------KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNK  608
            KRS + +SQ+ P+       KVQELCVYE+NERDRGSPA LRLSQK VN+LGDLVPFSNK
Sbjct  64   KRSFSCRSQATPSDDASRPTKVQELCVYEMNERDRGSPAVLRLSQKPVNSLGDLVPFSNK  123

Query  607  LYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  428
            +Y+GDLQKR+G+TAG+CILI+++ EKKGDR+EAIYSFYFG YGHIAVQG YLTYEDT+LA
Sbjct  124  VYSGDLQKRIGVTAGICILIQNKPEKKGDRFEAIYSFYFGGYGHIAVQGAYLTYEDTHLA  183

Query  427  VTGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAK  248
            VTGGSGIFEGVSGQVKLQQL++PFKLFYTFYL+GI DLP EL   PV P P+VEP PAAK
Sbjct  184  VTGGSGIFEGVSGQVKLQQLVYPFKLFYTFYLRGIKDLPEELTKKPVEPHPSVEPMPAAK  243

Query  247  ACEPGSTIGNFTD  209
            ACEP + + NFTD
Sbjct  244  ACEPHAVVANFTD  256



>ref|XP_010103817.1| Allene oxide cyclase 4 [Morus notabilis]
 gb|EXB97179.1| Allene oxide cyclase 4 [Morus notabilis]
Length=247

 Score =   282 bits (721),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 168/196 (86%), Gaps = 9/196 (5%)
 Frame = -1

Query  769  KRSVTVKSQSA---------PAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPF  617
            KRS + KSQ A         P  KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPF
Sbjct  52   KRSFSCKSQLASTTPSDSERPPTKVQELYVYEINERDRGSPAYLRLSQKSVNSLGDLVPF  111

Query  616  SNKLYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDT  437
            SNKLYTGDLQKR+GITAG+C+LI+++ E KGDRYEAIYSFYFGDYGHI+VQG YLTYEDT
Sbjct  112  SNKLYTGDLQKRIGITAGICVLIQNKPETKGDRYEAIYSFYFGDYGHISVQGSYLTYEDT  171

Query  436  YLAVTGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepsp  257
            YLAVTGGSGIFEGV GQVKLQQ+IFPFKLFYTFYLKGI DLP EL   PV PSP+VEPSP
Sbjct  172  YLAVTGGSGIFEGVYGQVKLQQIIFPFKLFYTFYLKGIKDLPKELLVKPVEPSPSVEPSP  231

Query  256  aAKACEPGSTIGNFTD  209
            +AK+CE  +TI N+TD
Sbjct  232  SAKSCEAHATIANYTD  247



>gb|AAA80500.1| unknown, partial [Solanum lycopersicum]
Length=214

 Score =   281 bits (718),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            +VQEL VYEINERDRGSPAYLRLSQK+VN+LGDLVPFSNKLYT DL+KR+GITAGLCILI
Sbjct  42   EVQELSVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKLYTADLKKRIGITAGLCILI  101

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            KHEEEKKGDRYEA+YSFYFGDYGHIAVQG YLTYE+TYLAVTGGSGIF GVSGQVKLQQL
Sbjct  102  KHEEEKKGDRYEAVYSFYFGDYGHIAVQGAYLTYEETYLAVTGGSGIFAGVSGQVKLQQL  161

Query  367  IFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            IFPFKLFYTFYLKGIP LP+EL    VPPSP VEP+P AKACE G+ + N+T+
Sbjct  162  IFPFKLFYTFYLKGIPGLPSELLCTAVPPSPTVEPTPEAKACEEGAALKNYTN  214



>ref|XP_011021206.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Populus 
euphratica]
Length=254

 Score =   281 bits (720),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 169/194 (87%), Gaps = 7/194 (4%)
 Frame = -1

Query  769  KRSVTVKSQSA------PAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNK  608
            KRS + KSQ+A      PA KVQEL VYEINERDRGSPAYLRLS + VNTLGDLVPFSNK
Sbjct  61   KRSFSCKSQTASTEDSRPATKVQELNVYEINERDRGSPAYLRLSYRPVNTLGDLVPFSNK  120

Query  607  LYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  428
            LYTGDLQKR+GITAGLCILI+H+ EK+GDRYEA+YSFYFGDYGH++VQG YLTYEDTYLA
Sbjct  121  LYTGDLQKRIGITAGLCILIQHKTEKQGDRYEAVYSFYFGDYGHLSVQGAYLTYEDTYLA  180

Query  427  VTGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaA  251
            VTGGSGIFEG  GQVKL+QL+FPFKLFYTFYLKG+  DLP EL G PV P+PAVEP+PAA
Sbjct  181  VTGGSGIFEGAYGQVKLRQLVFPFKLFYTFYLKGLKNDLPEELVGKPVEPTPAVEPTPAA  240

Query  250  KACEPGSTIGNFTD  209
            KA EP +TI N++D
Sbjct  241  KAAEPHATIANYSD  254



>gb|AFK41265.1| unknown [Lotus japonicus]
Length=256

 Score =   281 bits (720),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 162/178 (91%), Gaps = 1/178 (1%)
 Frame = -1

Query  742  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAG  563
            S PA KVQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPFSNKLY+G+L+KR+GIT G
Sbjct  80   SRPA-KVQELSVYEINERDRGSPAYLRLSQKPVNSLGDLVPFSNKLYSGNLEKRLGITTG  138

Query  562  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQV  383
            LC+LI++  EKKGDRYEAIYSFYFGDYGHI+VQG YLTY+DTYLAVTGGSGIFEGV GQV
Sbjct  139  LCVLIQNVPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYQDTYLAVTGGSGIFEGVYGQV  198

Query  382  KLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            KLQQL+FPFKLFYTFYLKGIPDLPAEL G PV PSP VEPSPAAKA EP +T+ NFT+
Sbjct  199  KLQQLVFPFKLFYTFYLKGIPDLPAELLGKPVDPSPDVEPSPAAKATEPHATLPNFTN  256



>ref|NP_001275212.1| allene oxide cyclase [Solanum tuberosum]
 gb|AAN37418.1| allene oxide cyclase [Solanum tuberosum]
Length=246

 Score =   281 bits (719),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            +VQEL VYE+NERDRGSPAYLRLSQK+VN+LGDLVPFSNKLYT DL+KR+GITAGLCILI
Sbjct  76   EVQELSVYELNERDRGSPAYLRLSQKNVNSLGDLVPFSNKLYTADLKKRIGITAGLCILI  135

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            KHEEEKKGDRYEA+YSFYFGDYG IAVQG YLTYED+YLAVTGGSGIF GVSGQVKLQQL
Sbjct  136  KHEEEKKGDRYEAVYSFYFGDYGQIAVQGSYLTYEDSYLAVTGGSGIFAGVSGQVKLQQL  195

Query  367  IFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNF  215
            IFPFKLFYTFYLKGIPDLP+EL    VPPSP VEP+P AKACE G+ + N+
Sbjct  196  IFPFKLFYTFYLKGIPDLPSELLCTAVPPSPTVEPTPEAKACEDGAALKNY  246



>ref|XP_003614458.1| Allene oxide cyclase [Medicago truncatula]
 emb|CAC83767.1| allene oxide cyclase [Medicago truncatula]
 gb|ACJ84503.1| unknown [Medicago truncatula]
 gb|AES97416.1| allene oxide cyclase [Medicago truncatula]
 gb|AFK35723.1| unknown [Medicago truncatula]
Length=252

 Score =   280 bits (716),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  745  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  566
            +S+   KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPFSNKLY+G+L+KR+GIT+
Sbjct  74   ESSKPAKVQELFVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYSGNLEKRLGITS  133

Query  565  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQ  386
            GLCILI++E EKKGDRYEAIYSFYFGDYGHI+VQG YLTY+DTYLA+TGGSGIFEGV GQ
Sbjct  134  GLCILIQNEPEKKGDRYEAIYSFYFGDYGHISVQGPYLTYQDTYLAITGGSGIFEGVYGQ  193

Query  385  VKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            VKLQQL+FPFKLFYTFYLKG+ DLPA+L G PV PSP VEPS AAKA EP +++ NFT+
Sbjct  194  VKLQQLVFPFKLFYTFYLKGVADLPADLLGKPVDPSPHVEPSTAAKATEPHASLPNFTN  252



>ref|XP_002530384.1| Allene oxide cyclase 4, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF31990.1| Allene oxide cyclase 4, chloroplast precursor, putative [Ricinus 
communis]
Length=263

 Score =   280 bits (716),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 166/194 (86%), Gaps = 7/194 (4%)
 Frame = -1

Query  769  KRSVTVKSQSAPAG------KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNK  608
            KRS + K+Q+AP+       +VQELCVYEINERDRGSPAYLRLSQK VN+LGDLVPFSNK
Sbjct  70   KRSFSCKNQAAPSDDNSRPTEVQELCVYEINERDRGSPAYLRLSQKQVNSLGDLVPFSNK  129

Query  607  LYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  428
            LYTGDLQ+R+GITAG+CILI+++ E KGDRYEAIYSFYFGDYGH+AVQG YLT+EDTYLA
Sbjct  130  LYTGDLQQRIGITAGICILIQNKPEMKGDRYEAIYSFYFGDYGHLAVQGPYLTFEDTYLA  189

Query  427  VTGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGI-PDLPAELCGapvppspavepspaA  251
            VTGGSGIFEG  GQVKLQQ++FPFKLFYTFYLKG+  DLP EL   P  P PAVEP P A
Sbjct  190  VTGGSGIFEGAYGQVKLQQIVFPFKLFYTFYLKGLKTDLPDELLRKPTEPHPAVEPHPDA  249

Query  250  KACEPGSTIGNFTD  209
            KAC+P +T+ NFTD
Sbjct  250  KACQPHATVANFTD  263



>dbj|BAE45342.1| allene oxide cyclase [Pisum sativum]
Length=252

 Score =   279 bits (713),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  745  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  566
            QS+  GKVQEL VYE+NER RGSPAYL+LSQKS+N+LGDLVPFSNKLY+G+L+KR+GITA
Sbjct  74   QSSKPGKVQELFVYEMNERGRGSPAYLKLSQKSMNSLGDLVPFSNKLYSGNLEKRIGITA  133

Query  565  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQ  386
            GLCILI+H  EKKGDRYEAIYSFYFGDYGHI+VQG YLTY+DTYLAVTGGSGIFEGV G+
Sbjct  134  GLCILIQHVPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYQDTYLAVTGGSGIFEGVHGK  193

Query  385  VKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            VKLQQ++FPFKLFYTFYLKGIPDLP EL G PV PSP VEPSPAAKA +P +++ NFT+
Sbjct  194  VKLQQIVFPFKLFYTFYLKGIPDLPDELLGNPVEPSPNVEPSPAAKATQPHASLSNFTN  252



>gb|KJB22342.1| hypothetical protein B456_004G046100 [Gossypium raimondii]
Length=246

 Score =   278 bits (712),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 165/192 (86%), Gaps = 5/192 (3%)
 Frame = -1

Query  769  KRSVTVKSQSAPAG-----KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKL  605
            KR  T KSQ+ P+      KVQEL VYE+NERDRGSPAYLRLSQKSVN+LGDLVPFSNK+
Sbjct  55   KRGFTCKSQAIPSDNSAPEKVQELHVYELNERDRGSPAYLRLSQKSVNSLGDLVPFSNKI  114

Query  604  YTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAV  425
            Y GDL+KR+GIT+G+CILI+H+ E KGDRYEAI+SFYFGDYGHIAVQG YLTY+DTYLA+
Sbjct  115  YRGDLEKRIGITSGICILIEHKPEMKGDRYEAIFSFYFGDYGHIAVQGPYLTYQDTYLAI  174

Query  424  TGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKA  245
            TGGSGIFEGVSGQVKL Q++FPFK+FYTFYLKGI +LP EL   PV P PAVE  PAAKA
Sbjct  175  TGGSGIFEGVSGQVKLHQIVFPFKIFYTFYLKGIGELPEELLCKPVDPHPAVEAVPAAKA  234

Query  244  CEPGSTIGNFTD  209
            CEP +TI NFT+
Sbjct  235  CEPHATIANFTN  246



>gb|AFB69864.1| allene oxide cyclase [Salvia miltiorrhiza]
 gb|AFB69865.1| allene oxide cyclase [Salvia miltiorrhiza]
Length=239

 Score =   278 bits (711),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQEL VYEINERDRGSPAYLRLSQK+VN+LGDLVPFSNK+YTGDL+KR GITAG+CILI
Sbjct  67   KVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYTGDLKKRAGITAGICILI  126

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            K+E EKKGDRYEAIYSFY GDYGHIAVQG YLTY+DT LAVTGGSG+FEGV G VKL Q+
Sbjct  127  KNEAEKKGDRYEAIYSFYLGDYGHIAVQGPYLTYQDTELAVTGGSGVFEGVYGHVKLHQI  186

Query  367  IFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            IFPFKLFYTF+LKGIPDLP EL   PVPP+  VEP+PAAK CEPG+T+ NFT+
Sbjct  187  IFPFKLFYTFHLKGIPDLPPELLAQPVPPALHVEPTPAAKTCEPGATLPNFTN  239



>ref|XP_011099573.1| PREDICTED: LOW QUALITY PROTEIN: allene oxide cyclase 4, chloroplastic-like 
[Sesamum indicum]
Length=247

 Score =   278 bits (711),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 146/161 (91%), Gaps = 4/161 (2%)
 Frame = -1

Query  766  RSVTVKSQSAPA----GKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYT  599
            RS + +SQS P+     KVQ+L VYEINERDRGSPAYLRLSQK+VN+LGDLVPFSNK+YT
Sbjct  61   RSFSCRSQSDPSDSRSSKVQQLNVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYT  120

Query  598  GDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTG  419
            GDL+KR GITAG+C+LIK+E EKKGDRYEAIYSFYFGDYGHIAVQG YLTYEDTYLAVTG
Sbjct  121  GDLKKRAGITAGICVLIKNEPEKKGDRYEAIYSFYFGDYGHIAVQGPYLTYEDTYLAVTG  180

Query  418  GSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCG  296
            GSGIFEGV GQVKLQQ+IFPFKLFYTFYLKGIPDLP EL G
Sbjct  181  GSGIFEGVYGQVKLQQIIFPFKLFYTFYLKGIPDLPKELLG  221



>ref|NP_001240078.1| allene oxide cyclase 3, chloroplastic-like [Glycine max]
 gb|AEE99199.1| allene oxide cyclase 4 [Glycine max]
 gb|KHN47653.1| Allene oxide cyclase 3, chloroplastic [Glycine soja]
Length=253

 Score =   278 bits (712),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 165/189 (87%), Gaps = 3/189 (2%)
 Frame = -1

Query  766  RSVTVKSQSAPA---GKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTG  596
            +S T +SQ+ P+    KVQEL VYEINERDRGSPAYLRLSQK+VN+LGDLVPFSNKLY+G
Sbjct  65   KSFTCRSQAEPSSDSAKVQELSVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKLYSG  124

Query  595  DLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGG  416
             LQKRVGITAG+C+LI+++ EKKGDRYEAIYSFYFGDYGHI+VQG YLTYEDTYLAVTGG
Sbjct  125  CLQKRVGITAGICVLIQNKAEKKGDRYEAIYSFYFGDYGHISVQGSYLTYEDTYLAVTGG  184

Query  415  SGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEP  236
            SGIFEG  GQVKL Q++FPFKLFYTFYLKGI DLP EL   PV PSPA+EPSP+AKACEP
Sbjct  185  SGIFEGAYGQVKLHQIVFPFKLFYTFYLKGIKDLPQELLSQPVEPSPAIEPSPSAKACEP  244

Query  235  GSTIGNFTD  209
             + I  FTD
Sbjct  245  HAVIAGFTD  253



>ref|XP_007033324.1| Allene oxide cyclase isoform 2 [Theobroma cacao]
 gb|EOY04250.1| Allene oxide cyclase isoform 2 [Theobroma cacao]
Length=191

 Score =   276 bits (705),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPFSNK+YTGDLQKR+GIT+G+CILI
Sbjct  19   KVQELYVYEINERDRGSPAYLRLSQKPVNSLGDLVPFSNKIYTGDLQKRIGITSGICILI  78

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            +H+ EKKGDRYEAI+SFYFGDYGHIAVQG YLTYEDTYLAVTGGSGIFEGV+GQVKLQQ+
Sbjct  79   EHKPEKKGDRYEAIFSFYFGDYGHIAVQGPYLTYEDTYLAVTGGSGIFEGVTGQVKLQQI  138

Query  367  IFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            +FPFK+FYTFYLKGI +LP EL   PV P+P VE +PAAKACEP +T+ NFT+
Sbjct  139  VFPFKIFYTFYLKGIGELPEELVCKPVEPNPGVEAAPAAKACEPHATVANFTN  191



>ref|NP_001240200.1| membrane primary amine oxidase [Glycine max]
 gb|AEE99198.1| allene oxide cyclase 3 [Glycine max]
 gb|KHN28337.1| Allene oxide cyclase 3, chloroplastic [Glycine soja]
Length=257

 Score =   278 bits (711),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 164/190 (86%), Gaps = 3/190 (2%)
 Frame = -1

Query  769  KRSVTVKSQSAPA---GKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYT  599
             +S T +SQ+ P+    KVQEL VYEINERDRGSPAYLRLSQK+VN+LGDLVPFSNKLY+
Sbjct  68   NKSFTCRSQAEPSSDSAKVQELSVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKLYS  127

Query  598  GDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTG  419
            G LQKRVGITAG+C+LI+++ EKKGD YEAIYSFYFGDYGHI+VQG YLTYEDTYLAVTG
Sbjct  128  GCLQKRVGITAGICVLIQNKSEKKGDMYEAIYSFYFGDYGHISVQGSYLTYEDTYLAVTG  187

Query  418  GSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACE  239
            GSGIFEG  GQVKL Q++FPFKLFYTFYLKGI DLP EL   PV PSP+VEPSP+AKACE
Sbjct  188  GSGIFEGAYGQVKLHQIVFPFKLFYTFYLKGIKDLPQELLSKPVEPSPSVEPSPSAKACE  247

Query  238  PGSTIGNFTD  209
            P + I  FTD
Sbjct  248  PHAVIAGFTD  257



>ref|NP_001241361.1| allene oxide cyclase 4, chloroplastic-like [Glycine max]
 gb|AEE99196.1| allene oxide cyclase 1 [Glycine max]
 gb|KHN10797.1| Allene oxide cyclase 4, chloroplastic [Glycine soja]
Length=255

 Score =   278 bits (711),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -1

Query  742  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAG  563
            S+   KVQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPFSNK+Y+GDLQKR+GITAG
Sbjct  78   SSQPAKVQELFVYEINERDRGSPAYLRLSQKPVNSLGDLVPFSNKIYSGDLQKRLGITAG  137

Query  562  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQV  383
            LC+LI+HE EKKGDRYEAIYSFYFG+YGHI+VQG YLT++DTYLAVTGGSGIFEG SGQV
Sbjct  138  LCVLIQHEPEKKGDRYEAIYSFYFGNYGHISVQGAYLTFQDTYLAVTGGSGIFEGASGQV  197

Query  382  KLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            KL QL+FPFKLFYTFYLKG+PDLP EL G PV PSP+VEPSPAA A EP + + NFT+
Sbjct  198  KLHQLVFPFKLFYTFYLKGVPDLPPELLGKPVEPSPSVEPSPAAMATEPHACLPNFTN  255



>ref|XP_010660502.1| PREDICTED: allene oxide cyclase [Vitis vinifera]
 emb|CBI16856.3| unnamed protein product [Vitis vinifera]
Length=251

 Score =   278 bits (710),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 166/190 (87%), Gaps = 5/190 (3%)
 Frame = -1

Query  763  SVTVKSQSAPAG-----KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYT  599
            S + K+QS+P+      KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPFSNK+YT
Sbjct  62   SFSCKAQSSPSDPPRPTKVQELHVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKIYT  121

Query  598  GDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTG  419
            GDL+KR+G+TAGLC+LI++   KKGDRYEA YSFYFGDYGHI+VQG YLTYEDTYLA+TG
Sbjct  122  GDLEKRLGVTAGLCVLIQNVPGKKGDRYEATYSFYFGDYGHISVQGAYLTYEDTYLAITG  181

Query  418  GSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACE  239
            GSGIFEG  GQVKLQQ++FPFKLFYTFYLKGI +LPA+L G PV PSP VEP+P+AKACE
Sbjct  182  GSGIFEGAYGQVKLQQIVFPFKLFYTFYLKGIKELPADLLGKPVSPSPNVEPAPSAKACE  241

Query  238  PGSTIGNFTD  209
            P + I NFTD
Sbjct  242  PHACIANFTD  251



>ref|XP_004161644.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Cucumis 
sativus]
Length=250

 Score =   277 bits (708),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  733  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCI  554
            + +VQEL VYEINERDRGSPA+L+LS+K+ N+LGDLVPFSNKLY+GDLQKR+GIT GLC+
Sbjct  76   SARVQELFVYEINERDRGSPAFLKLSKKAENSLGDLVPFSNKLYSGDLQKRLGITTGLCV  135

Query  553  LIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQ  374
            LI+H  EKKGDRYEAIYSFYFGDYGHI VQG YLTY+DTYLAVTGGSGIFEGVSGQVKLQ
Sbjct  136  LIQHLPEKKGDRYEAIYSFYFGDYGHITVQGAYLTYQDTYLAVTGGSGIFEGVSGQVKLQ  195

Query  373  QLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            Q++FPFKLFYTFYLKGI DLPAEL G PVPPSP VEP+PAAKAC+P + I NFTD
Sbjct  196  QIVFPFKLFYTFYLKGIADLPAELLGKPVPPSPTVEPAPAAKACDPSAAIPNFTD  250



>ref|XP_004140337.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Cucumis 
sativus]
 gb|KGN50952.1| Allene oxide cyclase [Cucumis sativus]
Length=250

 Score =   277 bits (708),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  733  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCI  554
            + +VQEL VYEINERDRGSPA+L+LS+K+ N+LGDLVPFSNKLY+GDLQKR+GIT GLC+
Sbjct  76   SARVQELFVYEINERDRGSPAFLKLSKKAENSLGDLVPFSNKLYSGDLQKRLGITTGLCV  135

Query  553  LIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQ  374
            LI+H  EKKGDRYEAIYSFYFGDYGHI VQG YLTY+DTYLAVTGGSGIFEGVSGQVKLQ
Sbjct  136  LIQHLPEKKGDRYEAIYSFYFGDYGHITVQGAYLTYQDTYLAVTGGSGIFEGVSGQVKLQ  195

Query  373  QLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            Q++FPFKLFYTFYLKGI DLPAEL G PVPPSP VEP+PAAKAC+P + I NFTD
Sbjct  196  QIVFPFKLFYTFYLKGIADLPAELLGKPVPPSPTVEPAPAAKACDPSAAIPNFTD  250



>ref|XP_007154351.1| hypothetical protein PHAVU_003G111500g [Phaseolus vulgaris]
 gb|ESW26345.1| hypothetical protein PHAVU_003G111500g [Phaseolus vulgaris]
Length=254

 Score =   277 bits (708),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  730  GKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  551
             KVQEL VYEINERDRGSPA+LRLSQK VN+LGDLVPFSNK+Y+G+L+KR+GITAGLC+L
Sbjct  81   AKVQELFVYEINERDRGSPAFLRLSQKPVNSLGDLVPFSNKIYSGNLEKRLGITAGLCVL  140

Query  550  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQ  371
            I+H  EKKGDRYEAIYSFYFGDYGHI+VQG YLTY+DTYLAVTGGSGIFEGVSGQVKL Q
Sbjct  141  IQHVPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYQDTYLAVTGGSGIFEGVSGQVKLHQ  200

Query  370  LIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            L+FPFKLFYTFYL GIPDLPA+L G PV PSP VEPSPAAKA EP + I NFT+
Sbjct  201  LVFPFKLFYTFYLNGIPDLPADLLGKPVEPSPKVEPSPAAKAAEPQACIPNFTN  254



>ref|XP_003518680.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Glycine 
max]
Length=255

 Score =   276 bits (707),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -1

Query  742  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAG  563
            S+   KVQEL VYEINERDRGSPAYL+LSQK VN+LGDLVPFSNK+Y+GDLQKR+GITAG
Sbjct  78   SSQPTKVQELFVYEINERDRGSPAYLKLSQKQVNSLGDLVPFSNKIYSGDLQKRLGITAG  137

Query  562  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQV  383
            LC+LI+HE EKKGDRYEAIYSFYFGDYGHI+VQG YLTY+DTYLAV+GGSGIFEGV GQV
Sbjct  138  LCVLIQHEPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYQDTYLAVSGGSGIFEGVYGQV  197

Query  382  KLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            KL QL+FPFKLFYTFYLKG+PDLP EL G PV PSP+VEPSPAA A EP + + NFT+
Sbjct  198  KLHQLVFPFKLFYTFYLKGVPDLPPELLGKPVEPSPSVEPSPAAMATEPHACLPNFTN  255



>gb|AEE99197.1| allene oxide cyclase 2 [Glycine max]
 gb|KHN23766.1| Allene oxide cyclase 4, chloroplastic [Glycine soja]
Length=255

 Score =   276 bits (707),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -1

Query  742  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAG  563
            S+   KVQEL VYEINERDRGSPAYL+LSQK VN+LGDLVPFSNK+Y+GDLQKR+GITAG
Sbjct  78   SSQPTKVQELFVYEINERDRGSPAYLKLSQKQVNSLGDLVPFSNKIYSGDLQKRLGITAG  137

Query  562  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQV  383
            LC+LI+HE EKKGDRYEAIYSFYFGDYGHI+VQG YLTY+DTYLAV+GGSGIFEGV GQV
Sbjct  138  LCVLIQHEPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYQDTYLAVSGGSGIFEGVYGQV  197

Query  382  KLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            KL QL+FPFKLFYTFYLKG+PDLP EL G PV PSP+VEPSPAA A EP + + NFT+
Sbjct  198  KLHQLVFPFKLFYTFYLKGVPDLPPELLGKPVEPSPSVEPSPAAMATEPHACLPNFTN  255



>ref|XP_010044291.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Eucalyptus 
grandis]
Length=253

 Score =   276 bits (706),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 164/181 (91%), Gaps = 1/181 (1%)
 Frame = -1

Query  748  SQSAP-AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGI  572
            S  AP   KVQELCVYEINERDRGSPA+LRLS+K VN+LGDLVPF+NKLY+GDLQ+R+G+
Sbjct  73   SPEAPKPAKVQELCVYEINERDRGSPAFLRLSEKPVNSLGDLVPFTNKLYSGDLQRRLGV  132

Query  571  TAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVS  392
            T+GLC++I+H  +K GDRYEAIYSFYFGDYGHI+VQG YLTY+DT+LAVTGGSGIF+GVS
Sbjct  133  TSGLCVVIQHLPDKGGDRYEAIYSFYFGDYGHISVQGPYLTYQDTFLAVTGGSGIFQGVS  192

Query  391  GQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            G VKLQQ++FPFKLFYTFYLKGIP+LPAEL G PVPPSP VEPSPAAKACEP +T  NFT
Sbjct  193  GTVKLQQIVFPFKLFYTFYLKGIPNLPAELLGKPVPPSPGVEPSPAAKACEPHATAPNFT  252

Query  211  D  209
            +
Sbjct  253  N  253



>ref|XP_008339701.1| PREDICTED: allene oxide cyclase 4, chloroplastic [Malus domestica]
Length=253

 Score =   276 bits (706),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGIT  569
            S S    KVQEL VYEINERDRGSPAYLRLSQK VNTLGDLVPFSNK+Y+G+L+KR+GIT
Sbjct  74   SDSPRPTKVQELHVYEINERDRGSPAYLRLSQKQVNTLGDLVPFSNKIYSGBLEKRLGIT  133

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AGLC+LI++  EKKGDRYEAIYSFYFGDYGHI+VQG YLTYEDTYLAVTGGSGIFEGV G
Sbjct  134  AGLCVLIQNFPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYEDTYLAVTGGSGIFEGVYG  193

Query  388  QVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            QVKL+Q++FPFKLFYTFYLKGI DLP EL G PV P+P+VEPS AAKA EP +T+ NFT+
Sbjct  194  QVKLKQIVFPFKLFYTFYLKGIKDLPVELTGKPVAPTPSVEPSAAAKATEPSATVKNFTN  253



>ref|XP_008465778.1| PREDICTED: allene oxide cyclase 1, chloroplastic [Cucumis melo]
Length=250

 Score =   276 bits (705),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  733  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCI  554
            + KVQEL VYEINERDRGSPA+L+LS+K+ N+LGDLVPFSNKLY+GDLQKR+GITAGLC+
Sbjct  76   SAKVQELFVYEINERDRGSPAFLKLSKKAENSLGDLVPFSNKLYSGDLQKRLGITAGLCV  135

Query  553  LIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQ  374
            LI+H  EKKGDRYEAIYSFYFGDYGHIAVQG YLTY+DTYLAVTGGSGIFEGVSGQVKLQ
Sbjct  136  LIQHLPEKKGDRYEAIYSFYFGDYGHIAVQGAYLTYQDTYLAVTGGSGIFEGVSGQVKLQ  195

Query  373  QLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            Q++FPFKLFYTFYLKGI  LPAEL G PVPPSP VEP+PAAKAC+  + I NFTD
Sbjct  196  QIVFPFKLFYTFYLKGIAGLPAELLGKPVPPSPTVEPAPAAKACDSSAAISNFTD  250



>gb|AAT96852.1| allene oxide cyclase C4 [Humulus lupulus]
Length=254

 Score =   276 bits (705),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = -1

Query  766  RSVTVKSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQ  587
            RS    S+S    KVQEL VYEINERDR SPAYLRLS+K VN+LGDLVPFSNKLYTG LQ
Sbjct  69   RSQASPSESETPTKVQELHVYEINERDRSSPAYLRLSKKEVNSLGDLVPFSNKLYTGCLQ  128

Query  586  KRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGI  407
            KR+GITAG+CILI+++ E KGDRYEAIYSFYFGDYGH+AVQG YLTYEDTYLAVTGGSGI
Sbjct  129  KRIGITAGICILIQNKAENKGDRYEAIYSFYFGDYGHLAVQGSYLTYEDTYLAVTGGSGI  188

Query  406  FEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGST  227
            FEGVSGQVKL QLIFPFKLFYTFYLKGI DLP EL G  V PSPAVEPSPAAKACE  + 
Sbjct  189  FEGVSGQVKLHQLIFPFKLFYTFYLKGIKDLPEELLGVHVEPSPAVEPSPAAKACEDHAA  248

Query  226  IGNFTD  209
            I +FTD
Sbjct  249  IKSFTD  254



>ref|XP_009356280.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Pyrus 
x bretschneideri]
Length=253

 Score =   276 bits (705),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGIT  569
            S S    KVQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPFSNK+Y+GDL+KR+GIT
Sbjct  74   SDSPRPTKVQELHVYEINERDRGSPAYLRLSQKQVNSLGDLVPFSNKIYSGDLEKRLGIT  133

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AGLC+LI++  EKKGDRYEAIYSFYFGDYGHI+VQG YLTYEDTYLAVTGGSGIFEGV G
Sbjct  134  AGLCVLIQNFPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYEDTYLAVTGGSGIFEGVYG  193

Query  388  QVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            QVKL+Q++FPFKLFYTFYLKGI DLP EL G PV P+P+VEPS AAKA EP +T+ NFT+
Sbjct  194  QVKLKQIVFPFKLFYTFYLKGIKDLPVELTGKPVAPTPSVEPSAAAKATEPSATVKNFTN  253



>ref|NP_001240033.1| allene oxide cyclase 4, chloroplastic-like [Glycine max]
 gb|AEE99201.1| allene oxide cyclase 6 [Glycine max]
 gb|KHN13814.1| Allene oxide cyclase 4, chloroplastic [Glycine soja]
Length=255

 Score =   275 bits (704),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 164/189 (87%), Gaps = 2/189 (1%)
 Frame = -1

Query  769  KRSVTVKSQSAP--AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTG  596
            K+S T +SQ+ P  + KVQEL VYEINERDRGSP YLRLS KSVN+LGDLVPFSNKLYTG
Sbjct  67   KKSFTCRSQAEPVDSEKVQELSVYEINERDRGSPVYLRLSYKSVNSLGDLVPFSNKLYTG  126

Query  595  DLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGG  416
            DLQKR+GIT+G+CILI+++ EKKGDRYEAI+SFYFGDYGHIAVQG YLTYEDTYLAVTGG
Sbjct  127  DLQKRIGITSGICILIQNKAEKKGDRYEAIFSFYFGDYGHIAVQGPYLTYEDTYLAVTGG  186

Query  415  SGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEP  236
            SGIFEGV GQVKL+Q+++PFK+ YTFYLKGI DLP EL    V P P+VEPSPAAKA EP
Sbjct  187  SGIFEGVKGQVKLRQIVYPFKILYTFYLKGIKDLPQELLVKTVEPIPSVEPSPAAKALEP  246

Query  235  GSTIGNFTD  209
             +TI  FTD
Sbjct  247  NATIAGFTD  255



>emb|CDP00580.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   275 bits (704),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 152/173 (88%), Gaps = 0/173 (0%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQEL VYEINERDRGSPAYLRLS+K  N+LGDLVPFSNKLYTGDLQKR+GIT+GLC+LI
Sbjct  80   KVQELYVYEINERDRGSPAYLRLSKKDANSLGDLVPFSNKLYTGDLQKRLGITSGLCVLI  139

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            KH  EKKGDRYEAIYSFYFGDYGHI+VQG YLTYEDT+LAVT GSG+FEGV G VKLQQ+
Sbjct  140  KHVPEKKGDRYEAIYSFYFGDYGHISVQGPYLTYEDTHLAVTAGSGVFEGVQGVVKLQQI  199

Query  367  IFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            +FPFKLFYTFYLKGI DLPAEL   PV P+   EPS AAKA EP +TI NFTD
Sbjct  200  VFPFKLFYTFYLKGIKDLPAELVVKPVLPTATAEPSAAAKATEPQATIPNFTD  252



>ref|XP_008459463.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like isoform 
X2 [Cucumis melo]
Length=247

 Score =   275 bits (703),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -1

Query  760  VTVKSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKR  581
             +    S P+G+VQEL VYEINERDR SPAYLRLSQK+ N LGDLVPF+NKLYTGDLQKR
Sbjct  64   ASASDSSNPSGRVQELYVYEINERDRQSPAYLRLSQKNTNALGDLVPFTNKLYTGDLQKR  123

Query  580  VGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFE  401
            VGIT+GLCIL++++ EKKGD YEAIYSFYFGDYGHIAVQG YLTYEDTYLAVTGGSGIFE
Sbjct  124  VGITSGLCILVQNKPEKKGDHYEAIYSFYFGDYGHIAVQGPYLTYEDTYLAVTGGSGIFE  183

Query  400  GVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIG  221
            GV GQVKLQQ+IFPFKLFYTFYLK I DLP EL   P  P+PA EP+P AKAC P +TI 
Sbjct  184  GVRGQVKLQQIIFPFKLFYTFYLKDIGDLPPELVVKPTEPTPAAEPTPNAKACHPHATIS  243

Query  220  NFTD  209
             +TD
Sbjct  244  GYTD  247



>ref|XP_004297139.1| PREDICTED: allene oxide cyclase 3, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=250

 Score =   275 bits (702),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 160/173 (92%), Gaps = 0/173 (0%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQEL VYEINERDRGSPAYLRLS+K VN+LGDLVPFSNK+Y+GDL+KR+GIT+GLC+LI
Sbjct  78   KVQELNVYEINERDRGSPAYLRLSKKEVNSLGDLVPFSNKIYSGDLEKRLGITSGLCVLI  137

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            ++  EKKGDRYEAIYSFYFGDYGHI+VQG YLTYEDTYLAVTGGSGIFEGV GQVKL+Q+
Sbjct  138  QNVPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYEDTYLAVTGGSGIFEGVYGQVKLKQI  197

Query  367  IFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            +FPFKLFYTFYLKGI DLPAEL G PV PSP+VEPSPAAKA EP +T+ NFT+
Sbjct  198  VFPFKLFYTFYLKGIADLPAELTGKPVAPSPSVEPSPAAKATEPQATLKNFTN  250



>gb|KHN47545.1| Allene oxide cyclase 4, chloroplastic [Glycine soja]
Length=257

 Score =   275 bits (702),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 164/189 (87%), Gaps = 2/189 (1%)
 Frame = -1

Query  769  KRSVTVKSQSAP--AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTG  596
            K+S T +SQ+ P  + KVQEL VYEINERDRGSP YLRLS KSVN+LGDLVPFSNKLYTG
Sbjct  69   KKSFTCRSQAEPVDSEKVQELTVYEINERDRGSPVYLRLSYKSVNSLGDLVPFSNKLYTG  128

Query  595  DLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGG  416
            DLQKR+GIT+G+CILI+++ EKKGDRYEAI+SFYFGDYGHIAVQG YLTYED+YLAVTGG
Sbjct  129  DLQKRIGITSGICILIQNKAEKKGDRYEAIFSFYFGDYGHIAVQGPYLTYEDSYLAVTGG  188

Query  415  SGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEP  236
            SGIFEGV GQVKL+Q+++PFK+ YTFYLKGI DLP EL    V P P+VEPSPAAKA EP
Sbjct  189  SGIFEGVKGQVKLRQIVYPFKILYTFYLKGIKDLPQELLVKTVEPIPSVEPSPAAKALEP  248

Query  235  GSTIGNFTD  209
             +TI  FTD
Sbjct  249  NATIAGFTD  257



>ref|XP_007139329.1| hypothetical protein PHAVU_008G020200g [Phaseolus vulgaris]
 gb|ESW11323.1| hypothetical protein PHAVU_008G020200g [Phaseolus vulgaris]
Length=250

 Score =   274 bits (701),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 160/189 (85%), Gaps = 2/189 (1%)
 Frame = -1

Query  769  KRSVTVKSQSAPAG--KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTG  596
            K S T +SQ+ P    KVQEL VYEINERDRGSP YLRLS K+VN+LGDLVPFSNKLYTG
Sbjct  62   KNSFTCRSQAQPVSSEKVQELSVYEINERDRGSPVYLRLSYKTVNSLGDLVPFSNKLYTG  121

Query  595  DLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGG  416
            DLQKR+GIT+G+CILI+++ EKKGDRYEAI+SFYFGDYGHIAVQG YLTYED+YLAVTGG
Sbjct  122  DLQKRIGITSGICILIQNKAEKKGDRYEAIFSFYFGDYGHIAVQGPYLTYEDSYLAVTGG  181

Query  415  SGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEP  236
            SGIFEGV GQVKL Q+++PFK+ YTFYLKGI DLP EL    V P P+VE SPAAKA EP
Sbjct  182  SGIFEGVKGQVKLHQIVYPFKILYTFYLKGIKDLPQELLVKTVEPIPSVEASPAAKALEP  241

Query  235  GSTIGNFTD  209
             +TI  FTD
Sbjct  242  NATIAGFTD  250



>ref|XP_011021732.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Populus 
euphratica]
Length=258

 Score =   275 bits (702),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -1

Query  742  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAG  563
            S    KVQEL VYEINERDRGSPA+L+LSQK  N+LGDLVPFSNKLY+GDLQKR+GIT+G
Sbjct  81   SPKPAKVQELHVYEINERDRGSPAFLKLSQKPQNSLGDLVPFSNKLYSGDLQKRLGITSG  140

Query  562  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQV  383
            LC+LI++  EKKGDRYEAIYSFYFGDYGHI+VQG YLTYEDTYLAVTGGSGIFEGV GQV
Sbjct  141  LCVLIQNVPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYEDTYLAVTGGSGIFEGVYGQV  200

Query  382  KLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            KLQQL+FPFKLFYTFYLKGIPDLPAEL G PV PSP+VEP+PAAKA EP   I NFT+
Sbjct  201  KLQQLVFPFKLFYTFYLKGIPDLPAELLGQPVTPSPSVEPAPAAKATEPLGIIQNFTN  258



>ref|NP_001242726.1| allene oxide cyclase 4, chloroplastic-like [Glycine max]
 gb|AEE99200.1| allene oxide cyclase 5 [Glycine max]
Length=257

 Score =   275 bits (702),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 163/189 (86%), Gaps = 2/189 (1%)
 Frame = -1

Query  769  KRSVTVKSQSAP--AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTG  596
            K+S T +SQ+ P  + KVQEL VYEINERDRGSP YLRLS KSVN+LGDLVPFSNKLYTG
Sbjct  69   KKSFTCRSQAEPVDSEKVQELTVYEINERDRGSPVYLRLSYKSVNSLGDLVPFSNKLYTG  128

Query  595  DLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGG  416
            DLQKR+GIT+G+CILI+++ EKKGDRYEAI+SFYFGDYGHIAVQG YLTYED+YLAVTGG
Sbjct  129  DLQKRIGITSGICILIQNKAEKKGDRYEAIFSFYFGDYGHIAVQGPYLTYEDSYLAVTGG  188

Query  415  SGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEP  236
            SGIFEGV GQVKL Q+++PFK+ YTFYLKGI DLP EL    V P P+VEPSPAAKA EP
Sbjct  189  SGIFEGVKGQVKLHQIVYPFKILYTFYLKGIKDLPQELLVKTVEPIPSVEPSPAAKALEP  248

Query  235  GSTIGNFTD  209
             +TI  FTD
Sbjct  249  NATIAGFTD  257



>gb|KJB22404.1| hypothetical protein B456_004G046400 [Gossypium raimondii]
Length=245

 Score =   274 bits (701),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 165/192 (86%), Gaps = 5/192 (3%)
 Frame = -1

Query  769  KRSVTVKSQSAPAG-----KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKL  605
            KR+ T KSQ+ P+      KVQEL +YE+NERDRGSPAYLRLSQKSVN+LGDLVPFSNK+
Sbjct  54   KRAFTCKSQAIPSDNSAPDKVQELHIYEMNERDRGSPAYLRLSQKSVNSLGDLVPFSNKI  113

Query  604  YTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAV  425
            Y GDL+KR+GITAG+CILI+H+ E KGDRYEAI+SFYFGDYGHIAVQG YLTY+DT+LA+
Sbjct  114  YRGDLEKRIGITAGICILIEHKPEMKGDRYEAIFSFYFGDYGHIAVQGPYLTYQDTFLAI  173

Query  424  TGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKA  245
             GGSGIFEGV+GQVKL+Q++FPFK+FYTFYLKGI +LP EL   PV P PAVE  PAAKA
Sbjct  174  KGGSGIFEGVTGQVKLRQIVFPFKIFYTFYLKGIGELPEELLCKPVEPHPAVEAFPAAKA  233

Query  244  CEPGSTIGNFTD  209
            CEP + I NFT+
Sbjct  234  CEPHAAIANFTN  245



>gb|KHG22804.1| Allene oxide cyclase 4, chloroplastic -like protein [Gossypium 
arboreum]
Length=246

 Score =   274 bits (700),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 164/192 (85%), Gaps = 5/192 (3%)
 Frame = -1

Query  769  KRSVTVKSQSAPAG-----KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKL  605
            KR  T KSQ+ P+      KVQEL VYE+NERDRGSPAYLRLSQKSVN+LGDLVPFSNK+
Sbjct  55   KRGFTCKSQAIPSDNSAPEKVQELHVYELNERDRGSPAYLRLSQKSVNSLGDLVPFSNKI  114

Query  604  YTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAV  425
            Y GDL+KR+GIT+G+CILI+H+ E KGDRYEAI+SFYFGDYGHIAVQG YLTY+D+YLA+
Sbjct  115  YRGDLEKRIGITSGICILIEHKPELKGDRYEAIFSFYFGDYGHIAVQGPYLTYQDSYLAI  174

Query  424  TGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKA  245
             GGSGIFEGVSGQVKL Q++FPFK+FYTFYLKGI +LP EL   PV P PAVE  PAAKA
Sbjct  175  KGGSGIFEGVSGQVKLHQIVFPFKIFYTFYLKGIGELPEELLCKPVDPHPAVEAVPAAKA  234

Query  244  CEPGSTIGNFTD  209
            CEP +TI NFT+
Sbjct  235  CEPHATIANFTN  246



>gb|AFK38605.1| unknown [Lotus japonicus]
Length=248

 Score =   274 bits (700),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 166/188 (88%), Gaps = 2/188 (1%)
 Frame = -1

Query  766  RSVTVKSQS--APAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGD  593
            RS T +SQ+  + + KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPFSNKLY+G 
Sbjct  61   RSFTCRSQAEQSDSVKVQELSVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYSGC  120

Query  592  LQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGS  413
            LQKRVGITAG+C+LI+++ EKKGDRYEAIYSFYFGDYGHI+VQG YLTYE++YLAVTGGS
Sbjct  121  LQKRVGITAGICVLIENKAEKKGDRYEAIYSFYFGDYGHISVQGPYLTYEESYLAVTGGS  180

Query  412  GIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPG  233
            GIFEGV GQVKL Q++FPFKLFYTFYLKGI DLP EL   PV PSPAVEPSPAAKACEP 
Sbjct  181  GIFEGVYGQVKLNQIVFPFKLFYTFYLKGIKDLPQELLAKPVEPSPAVEPSPAAKACEPH  240

Query  232  STIGNFTD  209
            + +  FTD
Sbjct  241  AVVAGFTD  248



>gb|KHG22803.1| Allene oxide cyclase 4, chloroplastic -like protein [Gossypium 
arboreum]
Length=246

 Score =   274 bits (700),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 164/192 (85%), Gaps = 5/192 (3%)
 Frame = -1

Query  769  KRSVTVKSQSAPAG-----KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKL  605
            KR  T KSQ+ P+      KVQEL VYE+NERDRGSPAYLRLSQKSVN+LGDLVPFSNK+
Sbjct  55   KRGFTCKSQAIPSDNSAPEKVQELHVYELNERDRGSPAYLRLSQKSVNSLGDLVPFSNKI  114

Query  604  YTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAV  425
            Y GDL+KR+GIT+G+CILI+H+ E KGDRYEAI+SFYFGDYGHIAVQG YLTY+D+YLA+
Sbjct  115  YRGDLEKRIGITSGICILIEHKPELKGDRYEAIFSFYFGDYGHIAVQGPYLTYQDSYLAI  174

Query  424  TGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKA  245
             GGSGIFEGVSGQVKL Q++FPFK+FYTFYLKGI +LP EL   PV P PAVE  PAAKA
Sbjct  175  KGGSGIFEGVSGQVKLHQIVFPFKIFYTFYLKGIGELPEELLCKPVDPHPAVEAVPAAKA  234

Query  244  CEPGSTIGNFTD  209
            CEP +TI NFT+
Sbjct  235  CEPHATIANFTN  246



>ref|XP_007046300.1| Allene oxide cyclase [Theobroma cacao]
 gb|EOY02132.1| Allene oxide cyclase [Theobroma cacao]
Length=256

 Score =   273 bits (699),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQELCVYEINERDR SPA L+LSQK VN+LGDLVPF+NKLYTGDLQKR+GITAGLC+LI
Sbjct  84   KVQELCVYEINERDRNSPAVLKLSQKPVNSLGDLVPFTNKLYTGDLQKRLGITAGLCVLI  143

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            +H  EK+GDR+EAIYSFYFG+YGHI+VQG YLTYED+YLAVTGGSGIF+GV GQVKLQQ+
Sbjct  144  QHVPEKQGDRFEAIYSFYFGEYGHISVQGPYLTYEDSYLAVTGGSGIFQGVYGQVKLQQI  203

Query  367  IFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            +FP KLFYTFYLKGIPDLPAE+ G PV PSPAVEPS AAKA EP  TI NFT+
Sbjct  204  VFPIKLFYTFYLKGIPDLPAEILGKPVAPSPAVEPSAAAKATEPHGTIPNFTN  256



>ref|XP_004514328.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Cicer 
arietinum]
Length=252

 Score =   273 bits (698),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGIT  569
            + S+   KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPFSNKLY+G+L+KR+GIT
Sbjct  73   TNSSKPAKVQELFVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYSGNLEKRLGIT  132

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            +GLCILI+HE EKKGDRYEAIYSFYFGDYGHI VQG YLTY+DTYLAVTGGSGIFEGV G
Sbjct  133  SGLCILIQHEPEKKGDRYEAIYSFYFGDYGHITVQGPYLTYQDTYLAVTGGSGIFEGVFG  192

Query  388  QVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            QVKLQQL+FPFKLFYTFYLKGI DLP +L G PV PSP VEPSPAAKA +  +++ NFT+
Sbjct  193  QVKLQQLVFPFKLFYTFYLKGIADLPQDLLGKPVDPSPNVEPSPAAKAADSHASLPNFTN  252



>ref|XP_009336614.1| PREDICTED: allene oxide cyclase 4, chloroplastic [Pyrus x bretschneideri]
Length=252

 Score =   273 bits (697),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  769  KRSVTVKSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDL  590
            K+     S S+   KVQEL VYEINERDRGSPAYLRLS+K VN+LGDLVPFSNK+Y+GDL
Sbjct  66   KKKEPADSDSSRPTKVQELNVYEINERDRGSPAYLRLSKKEVNSLGDLVPFSNKIYSGDL  125

Query  589  QKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSG  410
            +KR+GITAGLC+LI++  EKKGDRYEAIYSFYFGDYGHI+VQG YLTYEDTY+AVTGGSG
Sbjct  126  EKRLGITAGLCVLIQNFPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYEDTYMAVTGGSG  185

Query  409  IFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGS  230
            IFEGV GQVK++Q++FP KLFYTFYLKGI DLP EL G PV PSP+VEPS AAKA EP +
Sbjct  186  IFEGVYGQVKVKQIVFPIKLFYTFYLKGIKDLPVELTGKPVAPSPSVEPSAAAKATEPSA  245

Query  229  TIGNFTD  209
            T+ NFT+
Sbjct  246  TVKNFTN  252



>emb|CDP02799.1| unnamed protein product [Coffea canephora]
Length=246

 Score =   272 bits (696),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 168/190 (88%), Gaps = 4/190 (2%)
 Frame = -1

Query  766  RSVTVKSQSAPA----GKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYT  599
            RS T KSQSAP+     KVQEL VYEINERDRGSPA+L+LSQK VN+LGDL+PF+NK+Y+
Sbjct  57   RSFTCKSQSAPSDSTPAKVQELNVYEINERDRGSPAFLKLSQKDVNSLGDLIPFTNKIYS  116

Query  598  GDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTG  419
            G LQKR+GITAG+CILIKHE EKKGDRYEAI+SFYFG YGHIAVQG YLTYEDTYLAVTG
Sbjct  117  GCLQKRLGITAGICILIKHEPEKKGDRYEAIFSFYFGGYGHIAVQGPYLTYEDTYLAVTG  176

Query  418  GSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACE  239
            GSGIFEG  GQVKLQQL+FPFKLFYTFYLKGIPDLP+EL   PV PSPAVEPS AAKACE
Sbjct  177  GSGIFEGAYGQVKLQQLVFPFKLFYTFYLKGIPDLPSELLAPPVTPSPAVEPSAAAKACE  236

Query  238  PGSTIGNFTD  209
             G+T+ NFT+
Sbjct  237  AGATVSNFTN  246



>ref|XP_008389309.1| PREDICTED: allene oxide cyclase 4, chloroplastic [Malus domestica]
 ref|XP_008350872.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Malus 
domestica]
Length=252

 Score =   273 bits (697),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  769  KRSVTVKSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDL  590
            K+     S S+   KVQEL VYEINERDRGSPAYLRLS+K VN+LGDLVPFSNK+Y+GDL
Sbjct  66   KKKEPADSDSSRPTKVQELNVYEINERDRGSPAYLRLSKKEVNSLGDLVPFSNKIYSGDL  125

Query  589  QKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSG  410
            +KR+GITAGLC+LI++  EKKGDRYEAIYSFYFGDYGHI+VQG YLTYEDTY+AVTGGSG
Sbjct  126  EKRLGITAGLCVLIQNFPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYEDTYMAVTGGSG  185

Query  409  IFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGS  230
            IFEGV GQVK++Q++FP KLFYTFYLKGI DLP EL G PV PSP+VEPS AAKA EP +
Sbjct  186  IFEGVYGQVKVKQIVFPIKLFYTFYLKGIKDLPVELTGKPVAPSPSVEPSAAAKATEPSA  245

Query  229  TIGNFTD  209
            TI NFT+
Sbjct  246  TIKNFTN  252



>gb|KHG19305.1| Allene oxide cyclase 4, chloroplastic -like protein [Gossypium 
arboreum]
Length=245

 Score =   272 bits (696),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 162/192 (84%), Gaps = 5/192 (3%)
 Frame = -1

Query  769  KRSVTVKSQSAPAG-----KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKL  605
            KR+ T KSQ+ P+      KVQEL +YE+NERDRGSPAYLRLSQKSVN+LGDLVPFSNK+
Sbjct  54   KRAFTCKSQAIPSDNSAPDKVQELHIYEMNERDRGSPAYLRLSQKSVNSLGDLVPFSNKM  113

Query  604  YTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAV  425
            Y GDL+KR+GITAG+CILI+H+ E KGDRYEAI+SFYFGDYGHIAVQG YLTY+DT+LA+
Sbjct  114  YRGDLEKRIGITAGICILIEHKPEMKGDRYEAIFSFYFGDYGHIAVQGPYLTYQDTFLAI  173

Query  424  TGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKA  245
             GGSGIFEGV+GQVKL Q++FPFK+FYTFYLKGI +LP EL   PV P PAVE  P AKA
Sbjct  174  KGGSGIFEGVTGQVKLHQIVFPFKIFYTFYLKGIGELPEELLCKPVEPHPAVEAFPDAKA  233

Query  244  CEPGSTIGNFTD  209
            CEP +   NFT+
Sbjct  234  CEPHAAFANFTN  245



>gb|ACU19690.1| unknown [Glycine max]
Length=255

 Score =   272 bits (696),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -1

Query  742  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAG  563
            S+   KVQEL VYEINERDRGSPAYL+LSQK VN+LGDLVPFSNK+Y+GDLQKR+GITAG
Sbjct  78   SSQPTKVQELFVYEINERDRGSPAYLKLSQKQVNSLGDLVPFSNKIYSGDLQKRLGITAG  137

Query  562  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQV  383
            LC+LI+HE EKKGDRYEAI SFYFGDYGHI+VQG YLTY+DTYLAV+GGSGIFEGV GQV
Sbjct  138  LCVLIQHEPEKKGDRYEAICSFYFGDYGHISVQGAYLTYQDTYLAVSGGSGIFEGVYGQV  197

Query  382  KLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            KL QL+FPFKLFYTFYLKG+PDLP EL G PV PSP+VEPSPAA A EP + + NFT+
Sbjct  198  KLHQLVFPFKLFYTFYLKGVPDLPPELLGKPVEPSPSVEPSPAAMATEPHACLPNFTN  255



>gb|AGU09699.1| allene oxide cyclase [Gossypium hirsutum]
Length=246

 Score =   271 bits (692),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 163/192 (85%), Gaps = 5/192 (3%)
 Frame = -1

Query  769  KRSVTVKSQSAPAG-----KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKL  605
            KR  T KSQ+ P+      KVQEL VYE+NERDRGSPAYLRLSQKSVN+LGDLVPFSNK+
Sbjct  55   KRGFTCKSQAIPSDNSAPEKVQELHVYELNERDRGSPAYLRLSQKSVNSLGDLVPFSNKI  114

Query  604  YTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAV  425
            Y GDL+KR+GIT+G+CILI+H+ E KGDRYEAI+SFYFGD GHIAVQG YLTY+DTYLA+
Sbjct  115  YRGDLEKRIGITSGICILIEHKPEMKGDRYEAIFSFYFGDCGHIAVQGPYLTYQDTYLAI  174

Query  424  TGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKA  245
            TGGSGIFEGVSGQV+L Q++FPFK+FYTFYLKGI +LP EL   PV P PAVE  PAAKA
Sbjct  175  TGGSGIFEGVSGQVRLHQIVFPFKIFYTFYLKGIGELPEELLCKPVDPHPAVEAVPAAKA  234

Query  244  CEPGSTIGNFTD  209
            CEP +T  NFT+
Sbjct  235  CEPHATNANFTN  246



>ref|XP_008459464.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like isoform 
X3 [Cucumis melo]
Length=246

 Score =   271 bits (692),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGIT  569
            S S+   +VQEL VYEINERDR SPAYLRLSQK+ N LGDLVPF+NKLYTGDLQKRVGIT
Sbjct  67   SDSSNPSRVQELYVYEINERDRQSPAYLRLSQKNTNALGDLVPFTNKLYTGDLQKRVGIT  126

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            +GLCIL++++ EKKGD YEAIYSFYFGDYGHIAVQG YLTYEDTYLAVTGGSGIFEGV G
Sbjct  127  SGLCILVQNKPEKKGDHYEAIYSFYFGDYGHIAVQGPYLTYEDTYLAVTGGSGIFEGVRG  186

Query  388  QVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            QVKLQQ+IFPFKLFYTFYLK I DLP EL   P  P+PA EP+P AKAC P +TI  +TD
Sbjct  187  QVKLQQIIFPFKLFYTFYLKDIGDLPPELVVKPTEPTPAAEPTPNAKACHPHATISGYTD  246



>ref|XP_008459462.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like isoform 
X1 [Cucumis melo]
Length=251

 Score =   270 bits (690),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -1

Query  730  GKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  551
            G+VQEL VYEINERDR SPAYLRLSQK+ N LGDLVPF+NKLYTGDLQKRVGIT+GLCIL
Sbjct  78   GRVQELYVYEINERDRQSPAYLRLSQKNTNALGDLVPFTNKLYTGDLQKRVGITSGLCIL  137

Query  550  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQ  371
            ++++ EKKGD YEAIYSFYFGDYGHIAVQG YLTYEDTYLAVTGGSGIFEGV GQVKLQQ
Sbjct  138  VQNKPEKKGDHYEAIYSFYFGDYGHIAVQGPYLTYEDTYLAVTGGSGIFEGVRGQVKLQQ  197

Query  370  LIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            +IFPFKLFYTFYLK I DLP EL   P  P+PA EP+P AKAC P +TI  +TD
Sbjct  198  IIFPFKLFYTFYLKDIGDLPPELVVKPTEPTPAAEPTPNAKACHPHATISGYTD  251



>gb|KEH21777.1| allene oxide cyclase [Medicago truncatula]
Length=250

 Score =   270 bits (690),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 161/190 (85%), Gaps = 4/190 (2%)
 Frame = -1

Query  766  RSVTVKSQS---APAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTG  596
            +S T KSQ    A   KVQE+ VYE+NERDRGSPAYLRLS KSVN+LGDLVPFSNKLYTG
Sbjct  61   KSFTCKSQVTEYADTEKVQEMHVYELNERDRGSPAYLRLSNKSVNSLGDLVPFSNKLYTG  120

Query  595  DLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTY-EDTYLAVTG  419
            DLQKR+GIT G+CILI+H+ EKKGDRYEAIYSF+FGDYGH+AVQG YLTY EDTYLAVTG
Sbjct  121  DLQKRIGITTGICILIEHKAEKKGDRYEAIYSFHFGDYGHLAVQGPYLTYPEDTYLAVTG  180

Query  418  GSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACE  239
            GSGIFEGV GQVKL Q++FPFK+FYTFYL+GI DLP EL G  V PSPAVE SPAAKA E
Sbjct  181  GSGIFEGVKGQVKLHQIVFPFKIFYTFYLRGIKDLPQELLGKHVEPSPAVEASPAAKALE  240

Query  238  PGSTIGNFTD  209
            P + I  FT+
Sbjct  241  PHAVIAGFTN  250



>gb|AFK47606.1| unknown [Medicago truncatula]
Length=251

 Score =   270 bits (689),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 160/189 (85%), Gaps = 4/189 (2%)
 Frame = -1

Query  766  RSVTVKSQS---APAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTG  596
            +S T KSQ    A   KVQE+ VYE+NERDRGSPAYLRLS KSVN+LGDLVPFSNKLYTG
Sbjct  61   KSFTCKSQVTEYADTEKVQEMHVYELNERDRGSPAYLRLSNKSVNSLGDLVPFSNKLYTG  120

Query  595  DLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTY-EDTYLAVTG  419
            DLQKR+GIT G+CILI+H+ EKKGDRYEAIYSF+FGDYGH+AVQG YLTY EDTYLAVTG
Sbjct  121  DLQKRIGITTGICILIEHKAEKKGDRYEAIYSFHFGDYGHLAVQGPYLTYPEDTYLAVTG  180

Query  418  GSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACE  239
            GSGIFEGV GQVKL Q++FPFK+FYTFYL+GI DLP EL G  V PSPAVE SPAAKA E
Sbjct  181  GSGIFEGVKGQVKLHQIVFPFKIFYTFYLRGIKDLPQELLGKHVEPSPAVEASPAAKALE  240

Query  238  PGSTIGNFT  212
            P + I  FT
Sbjct  241  PHAVIAGFT  249



>ref|XP_010093405.1| Allene oxide cyclase 4 [Morus notabilis]
 gb|EXB53999.1| Allene oxide cyclase 4 [Morus notabilis]
Length=255

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = -1

Query  769  KRSVTVKSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDL  590
            K+      +S+   KVQEL VYEINERDRGSPA+L+LSQK VN+LGDLVPF+NK+YTGDL
Sbjct  69   KKKAPEAQESSRPTKVQELHVYEINERDRGSPAFLKLSQKQVNSLGDLVPFTNKIYTGDL  128

Query  589  QKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSG  410
            QKR+GIT+GLC+LI+H  +KKGDRYEAIYSFYFGDYGHI+VQG YLTY+DTYLAVTGGSG
Sbjct  129  QKRLGITSGLCVLIQHVPDKKGDRYEAIYSFYFGDYGHISVQGPYLTYQDTYLAVTGGSG  188

Query  409  IFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGS  230
            IFEG  GQVKLQQL+FPFK+FYTFYLKGI DLP EL G PV PSP VE SPAAKA E  +
Sbjct  189  IFEGAYGQVKLQQLVFPFKIFYTFYLKGIRDLPQELLGKPVEPSPNVEASPAAKATESHA  248

Query  229  TIGNFTD  209
             I NFTD
Sbjct  249  VIPNFTD  255



>gb|AET50928.1| allene oxide cylase [Lilium longiflorum]
Length=246

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = -1

Query  736  PAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLC  557
            PAGK+QEL VYEINE DR SPAYL+LS+K VN+LGDLVPFSNKLY G+LQ R+GIT+GLC
Sbjct  71   PAGKIQELRVYEINELDRSSPAYLKLSEKPVNSLGDLVPFSNKLYHGNLQMRLGITSGLC  130

Query  556  ILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKL  377
            ILI+H  EK GDRYEAIYSFYFGDYGHI+VQG YLTYED+YLAVTGGSG FEGV G VKL
Sbjct  131  ILIQHVPEKGGDRYEAIYSFYFGDYGHISVQGPYLTYEDSYLAVTGGSGAFEGVYGHVKL  190

Query  376  QQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            QQL+FPFKLFYTFYLKGIPDLP EL G  +PPSPAVEP P AK+CEP + + NFTD
Sbjct  191  QQLVFPFKLFYTFYLKGIPDLPLELLGDHIPPSPAVEPHPTAKSCEPQAVLKNFTD  246



>gb|AAT96851.1| allene oxide cyclase C1 [Humulus lupulus]
Length=255

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 164/193 (85%), Gaps = 6/193 (3%)
 Frame = -1

Query  769  KRSVTVKSQSAPAG-----KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKL  605
            K  +T +SQ++P+      KV EL VYEINERDR SPAYLRLSQK VN+LGDLVPFSNKL
Sbjct  63   KTYITCRSQASPSESEKPIKVHELRVYEINERDRSSPAYLRLSQKEVNSLGDLVPFSNKL  122

Query  604  YTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAV  425
            YTG LQKR+GITAG+CILI+++ EKKGDRYEAIYSFYFGDYGH++VQG Y+TYEDTYLAV
Sbjct  123  YTGCLQKRIGITAGICILIQNKAEKKGDRYEAIYSFYFGDYGHLSVQGSYMTYEDTYLAV  182

Query  424  TGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAK  248
            TGGSGIFEG  GQVKLQQLIFPFKLFYTFYLKGI  DLP EL G  V PSP+VEPSPAAK
Sbjct  183  TGGSGIFEGAYGQVKLQQLIFPFKLFYTFYLKGIKEDLPEELLGVHVEPSPSVEPSPAAK  242

Query  247  ACEPGSTIGNFTD  209
            ACE  + I +FTD
Sbjct  243  ACEAHAVIQSFTD  255



>gb|AEC11095.1| allene oxide cyclase [Torenia fournieri]
Length=240

 Score =   269 bits (687),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 155/174 (89%), Gaps = 1/174 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            +VQE+ VYEINE DRGSPAYLRLSQK+VN+LGDLVPFSNK+YTGDL+KR GIT+G+CILI
Sbjct  67   QVQEMHVYEINELDRGSPAYLRLSQKTVNSLGDLVPFSNKVYTGDLKKRCGITSGICILI  126

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYE-DTYLAVTGGSGIFEGVSGQVKLQQ  371
            KHEEEKKGDRYEAIYSFYFGDYGHIAVQG YLTY  DT+LAVTGGSG+FEGV G VKL Q
Sbjct  127  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGPYLTYPVDTHLAVTGGSGLFEGVYGTVKLHQ  186

Query  370  LIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++FPFK+FYTFYLKGIPDLP EL G PVPPS  VEP+  AKAC+PG T+  FTD
Sbjct  187  IVFPFKIFYTFYLKGIPDLPKELTGEPVPPSKEVEPTAEAKACQPGHTLPGFTD  240



>emb|CAI29046.1| allene-oxide cyclase [Medicago truncatula]
Length=250

 Score =   269 bits (688),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 160/189 (85%), Gaps = 4/189 (2%)
 Frame = -1

Query  766  RSVTVKSQS---APAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTG  596
            +S T KSQ    A   KVQE+ VYE+NERDRGSPAYLRLS KSVN+LGDLVPFSNKLYTG
Sbjct  61   KSFTCKSQVNEYADTEKVQEMHVYELNERDRGSPAYLRLSNKSVNSLGDLVPFSNKLYTG  120

Query  595  DLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTY-EDTYLAVTG  419
            DLQKR+GIT G+CILI+H+ EKKGDRYEAIYSF+FGDYGH+AVQG YLTY EDTYLAVTG
Sbjct  121  DLQKRIGITTGICILIEHKAEKKGDRYEAIYSFHFGDYGHLAVQGPYLTYPEDTYLAVTG  180

Query  418  GSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACE  239
            GSGIFEGV GQVKL Q++FPFK+FYTFYL+GI DLP EL G  V PSPAVE SPAAKA E
Sbjct  181  GSGIFEGVKGQVKLHQIVFPFKIFYTFYLRGIKDLPQELLGKHVEPSPAVEASPAAKALE  240

Query  238  PGSTIGNFT  212
            P + I  FT
Sbjct  241  PHAVIAGFT  249



>gb|AAX56078.1| allene oxide cyclase [Camptotheca acuminata]
Length=246

 Score =   269 bits (687),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 155/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPFSNK+Y+G L+KR+G+TAG+C+LI
Sbjct  74   KVQELHVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKIYSGCLKKRLGVTAGICVLI  133

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            ++  EKKGD YEAIYSFYFGDYGHIAVQG YLT++DTYLAVTGGSGIFEGV G VKL Q+
Sbjct  134  RNVPEKKGDVYEAIYSFYFGDYGHIAVQGAYLTHQDTYLAVTGGSGIFEGVYGSVKLHQI  193

Query  367  IFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            +FPFKL YTFYLKGIPDLP EL   PV PSP VEPSP AKACEPG+T+ NFTD
Sbjct  194  VFPFKLLYTFYLKGIPDLPEELLDTPVHPSPTVEPSPEAKACEPGATLPNFTD  246



>gb|AGR49302.1| allene oxide cyclase [Catharanthus roseus]
Length=254

 Score =   269 bits (688),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = -1

Query  745  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  566
            QS+   KVQEL VYEINERDRGSPA+L+LS+K VN+LGDLVPF+NKLYTGDLQKR+GITA
Sbjct  76   QSSVPTKVQELFVYEINERDRGSPAFLKLSKKEVNSLGDLVPFTNKLYTGDLQKRLGITA  135

Query  565  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQ  386
            GLC+LI+H  EKKGDRYEAIYSFYFGDYGHI+VQG YLTY+DT+LA+TGGSGIFEG  G 
Sbjct  136  GLCVLIQHLPEKKGDRYEAIYSFYFGDYGHISVQGPYLTYQDTFLAITGGSGIFEGARGV  195

Query  385  VKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            VKLQQ++FPFKLFYTFYLKGI DLP+EL   PV P+P+VEP+ AAKA +P +TI NFT+
Sbjct  196  VKLQQIVFPFKLFYTFYLKGIKDLPSELIVQPVTPTPSVEPTAAAKATQPNATIRNFTN  254



>gb|EYU29945.1| hypothetical protein MIMGU_mgv1a012640mg [Erythranthe guttata]
Length=244

 Score =   268 bits (686),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 155/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQEL VYEINERDR SPAYLRLSQK VN+LGDLVPFSNKLY+GDLQKR+GITAGLC+LI
Sbjct  72   KVQELYVYEINERDRSSPAYLRLSQKEVNSLGDLVPFSNKLYSGDLQKRLGITAGLCVLI  131

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            +H  +KKGDRYEA+YSFYFGDYGHI+VQG YLTY DT LAVTGGSG+FEGV G VKL+Q+
Sbjct  132  QHSPDKKGDRYEAMYSFYFGDYGHISVQGSYLTYADTVLAVTGGSGVFEGVYGSVKLKQI  191

Query  367  IFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            +FPFKLFYTFYLKGI DLPAEL   PV P+PAVEPSPAAKA EP +TI NFT+
Sbjct  192  VFPFKLFYTFYLKGIKDLPAELVVTPVEPTPAVEPSPAAKAAEPQATISNFTN  244



>gb|KHG12052.1| Allene oxide cyclase 3, chloroplastic -like protein [Gossypium 
arboreum]
Length=260

 Score =   268 bits (686),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = -1

Query  757  TVKSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRV  578
             + S ++   KVQEL VYE+NERDRGSPAYLRLSQKSVN+LGDLVPFSNK+Y GDL+KR+
Sbjct  78   AIPSDNSAPEKVQELHVYELNERDRGSPAYLRLSQKSVNSLGDLVPFSNKIYRGDLEKRI  137

Query  577  GITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEG  398
            GIT+G+CILI+H+ E KGDRYEAI+SFYFGDYGHIAVQG YLTY+D+YLA+ GGSGIFEG
Sbjct  138  GITSGICILIEHKPELKGDRYEAIFSFYFGDYGHIAVQGPYLTYQDSYLAIKGGSGIFEG  197

Query  397  VSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGN  218
            VSGQVKL Q++FPFK+FYTFYLKGI +LP EL   PV P PAVE  PAAKACEP +TI N
Sbjct  198  VSGQVKLHQIVFPFKIFYTFYLKGIGELPEELLCKPVDPHPAVEAVPAAKACEPHATIAN  257

Query  217  FTD  209
            FT+
Sbjct  258  FTN  260



>ref|XP_006430816.1| hypothetical protein CICLE_v10012528mg [Citrus clementina]
 gb|ESR44056.1| hypothetical protein CICLE_v10012528mg [Citrus clementina]
Length=256

 Score =   268 bits (685),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 165/195 (85%), Gaps = 9/195 (5%)
 Frame = -1

Query  769  KRSVTVKSQS---APA----GKVQELCVYEINERDRGSPAYLRLSQKS-VNTLGDLVPFS  614
            KRS T  SQS    P+     KVQEL VYEINE DRGSPAYLRLS+K  +N+LGDLVPFS
Sbjct  63   KRSFTCTSQSNNPIPSTNEPSKVQELYVYEINELDRGSPAYLRLSKKCFINSLGDLVPFS  122

Query  613  NKLYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTY  434
            NKLY+GDLQKRVGITAG+CILI+H+   KGDRYEA+YSFYFGDYGHI+VQG YLTY+DT 
Sbjct  123  NKLYSGDLQKRVGITAGICILIQHKP-MKGDRYEAVYSFYFGDYGHISVQGSYLTYKDTC  181

Query  433  LAVTGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspa  254
            LAVTGGSGIFEGVSGQVKL+QL+FPFKLFYTFYLKGI DLP EL G PV PSP V PSP 
Sbjct  182  LAVTGGSGIFEGVSGQVKLKQLVFPFKLFYTFYLKGIEDLPGELMGKPVRPSPFVHPSPM  241

Query  253  AKACEPGSTIGNFTD  209
            AKAC+PG+T+ NFTD
Sbjct  242  AKACKPGATVANFTD  256



>ref|XP_008243177.1| PREDICTED: allene oxide cyclase 3, chloroplastic [Prunus mume]
Length=274

 Score =   268 bits (686),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 157/174 (90%), Gaps = 1/174 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQEL VYEINERDRGSPAYLRLS+K VN+LGDLVPFSNK+Y+GDL+KR+G+TAGLC+LI
Sbjct  101  KVQELHVYEINERDRGSPAYLRLSKKEVNSLGDLVPFSNKIYSGDLEKRLGVTAGLCVLI  160

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            ++  EKKGDRYEAIYSFYFGDYGHI+VQG YLTYEDTYLAVTGGSGIFEGV GQVKL+Q+
Sbjct  161  QNVPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYEDTYLAVTGGSGIFEGVYGQVKLKQI  220

Query  367  IFPFKLFYTFYLKGIPDLPAELC-GapvppspavepspaAKACEPGSTIGNFTD  209
            +FP KLFYTFYLKGI DLP EL  G PV P+P +EPSPAAKA EP +TI NFT+
Sbjct  221  VFPIKLFYTFYLKGISDLPVELTGGTPVDPTPTIEPSPAAKATEPNATIPNFTN  274



>ref|XP_007151755.1| hypothetical protein PHAVU_004G072000g [Phaseolus vulgaris]
 gb|ESW23749.1| hypothetical protein PHAVU_004G072000g [Phaseolus vulgaris]
Length=253

 Score =   267 bits (683),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 160/189 (85%), Gaps = 3/189 (2%)
 Frame = -1

Query  766  RSVTVKSQ---SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTG  596
            +S T +SQ   ++ + KVQEL VYEINERDRGSPAYLRL QK+ N+LGDLVPFSNKLY+G
Sbjct  65   KSFTCRSQAERTSDSAKVQELSVYEINERDRGSPAYLRLGQKTTNSLGDLVPFSNKLYSG  124

Query  595  DLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGG  416
             LQKRVGITAG+C+LI+++ EKKGD YEAIYSFYFGDYGHI+VQG YLTYE+TYLAVTGG
Sbjct  125  CLQKRVGITAGICVLIQNKAEKKGDMYEAIYSFYFGDYGHISVQGSYLTYENTYLAVTGG  184

Query  415  SGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEP  236
            SGIFEGV GQVKL QL+FPFKLFYTFYLKGI DLP EL    V PSP VEPS AAKACEP
Sbjct  185  SGIFEGVYGQVKLHQLVFPFKLFYTFYLKGIKDLPQELLSKHVEPSPDVEPSQAAKACEP  244

Query  235  GSTIGNFTD  209
             + I  FT+
Sbjct  245  DAVISGFTN  253



>gb|AHZ21033.1| mangrin [Kandelia candel]
Length=256

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 161/193 (83%), Gaps = 6/193 (3%)
 Frame = -1

Query  769  KRSVTVKSQSAPAGK------VQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNK  608
            KRS + +SQ+ P+        VQE+CVYEINE DR SPA LRLSQK V +LGDLVPFSNK
Sbjct  64   KRSFSCRSQATPSDDASRPTGVQEMCVYEINEGDRESPAVLRLSQKPVLSLGDLVPFSNK  123

Query  607  LYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  428
            LYTGDLQKR+GITAG+ I I+H+ E+KG+R+EAIYSFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  124  LYTGDLQKRIGITAGIAIQIQHKPERKGNRFEAIYSFYFGDYGHIAVQGAYLTYEDTYLA  183

Query  427  VTGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAK  248
            VTGGSGIFEGV GQVKLQQL++PFKLFYTFYL+GI DLP EL   PV P P+VEP PAAK
Sbjct  184  VTGGSGIFEGVYGQVKLQQLVYPFKLFYTFYLRGIKDLPGELTKKPVEPHPSVEPIPAAK  243

Query  247  ACEPGSTIGNFTD  209
            ACEP + + NFT+
Sbjct  244  ACEPHAVVANFTN  256



>gb|KHG19308.1| Allene oxide cyclase 4, chloroplastic -like protein [Gossypium 
arboreum]
Length=178

 Score =   264 bits (674),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -1

Query  739  APAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGL  560
            A + KVQEL VYE+NERDRGSPAYLRLSQK VN+LGD+VPFSNK+Y GDL+KR+GITAG+
Sbjct  2    AASDKVQELHVYEMNERDRGSPAYLRLSQKPVNSLGDIVPFSNKIYRGDLEKRIGITAGM  61

Query  559  CILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVK  380
            CILI+H+ E KGDRYEAI+SFYFGDYGHIAVQG YLTY+D+YLA+TGGSGIFEGVSGQVK
Sbjct  62   CILIEHKPELKGDRYEAIFSFYFGDYGHIAVQGPYLTYQDSYLAITGGSGIFEGVSGQVK  121

Query  379  LQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            L Q++FPFKLFYTFYLKGI +LP EL   PV P PAVE  PAAKACEP + I +FT+
Sbjct  122  LHQIVFPFKLFYTFYLKGIGELPEELLCKPVDPHPAVEAVPAAKACEPHAAIASFTN  178



>ref|XP_004141500.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Cucumis 
sativus]
 gb|KGN52574.1| hypothetical protein Csa_5G644020 [Cucumis sativus]
Length=247

 Score =   266 bits (681),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 137/173 (79%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            +VQEL VYEINERDR SPAYLRLSQK+ N LGDLVPF+NKLY+GDLQKRVGITAGLCIL+
Sbjct  75   RVQELYVYEINERDRQSPAYLRLSQKNTNALGDLVPFTNKLYSGDLQKRVGITAGLCILV  134

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            +++ EKKGD YEAIYSFYFGDYGHIAVQG YLTYEDTYLAVTGGSGIFEGV GQVKLQQ+
Sbjct  135  QNKPEKKGDHYEAIYSFYFGDYGHIAVQGPYLTYEDTYLAVTGGSGIFEGVRGQVKLQQI  194

Query  367  IFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            IFPFKLFYTFYLK I DLP EL   P  P+ A EP+P AKAC P +TI  +TD
Sbjct  195  IFPFKLFYTFYLKDIGDLPLELVVKPTEPTLAAEPTPDAKACHPHATISGYTD  247



>gb|EPS67695.1| allene oxide cyclase, partial [Genlisea aurea]
Length=175

 Score =   264 bits (674),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 155/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQEL VYEINERDRGSPAYLRLS K+VN++GDLVPFSNK+YTGDL+KR GITAG+C+L+
Sbjct  3    KVQELNVYEINERDRGSPAYLRLSNKTVNSIGDLVPFSNKIYTGDLKKRAGITAGICLLV  62

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            ++E EKKGDR+EA+YSFYFGDYGHI+VQG Y+TY DT LAVTGGSG+FEGV G VKL Q+
Sbjct  63   RNEAEKKGDRFEAMYSFYFGDYGHISVQGPYITYADTDLAVTGGSGVFEGVYGHVKLHQI  122

Query  367  IFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            +FPFK+FYTFYLKGIP+LP +L GA VPP+  V+P+  AKACEPG+T+ N+TD
Sbjct  123  VFPFKIFYTFYLKGIPELPEDLLGAAVPPAVDVQPTAEAKACEPGATLPNYTD  175



>gb|KEH30395.1| allene oxide cyclase [Medicago truncatula]
Length=257

 Score =   266 bits (681),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 161/190 (85%), Gaps = 3/190 (2%)
 Frame = -1

Query  769  KRSVTVKSQ---SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYT  599
            K++ T KSQ   ++   KVQEL VYEINERDRGSPAYLRL  KSVN+LGDLVPFSNKLYT
Sbjct  68   KKAFTCKSQVDQNSDIEKVQELNVYEINERDRGSPAYLRLGFKSVNSLGDLVPFSNKLYT  127

Query  598  GDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTG  419
            GDLQKR+GITAG+CILI+H+ EK GDRYEAIYSF+ GDYG IAVQG YLTYEDTYL VTG
Sbjct  128  GDLQKRIGITAGICILIQHKAEKYGDRYEAIYSFHVGDYGQIAVQGPYLTYEDTYLTVTG  187

Query  418  GSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACE  239
            G+GIFEGV+GQVKL Q++FPFK+FYTFYLKGI DLP EL G PV P+P VE SPAAKA E
Sbjct  188  GTGIFEGVTGQVKLNQIVFPFKIFYTFYLKGIKDLPQELLGKPVEPNPNVEASPAAKALE  247

Query  238  PGSTIGNFTD  209
            P +TI  FT+
Sbjct  248  PHATIAGFTN  257



>ref|XP_006482293.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Citrus 
sinensis]
Length=255

 Score =   266 bits (681),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 165/195 (85%), Gaps = 9/195 (5%)
 Frame = -1

Query  769  KRSVTVKSQS---APA----GKVQELCVYEINERDRGSPAYLRLSQKS-VNTLGDLVPFS  614
            KRS T  SQS    P+     KVQEL VYEINE DRGSPAYLRLS+K  +N+LGDLVPFS
Sbjct  62   KRSFTCTSQSNNPIPSTNEPSKVQELYVYEINELDRGSPAYLRLSKKFFINSLGDLVPFS  121

Query  613  NKLYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTY  434
            NKLY+GDLQKRVGITAG+CILI+H+   KGDRYEA+YSFYFGDYGHI+VQG YLTY+DT 
Sbjct  122  NKLYSGDLQKRVGITAGICILIQHKP-MKGDRYEAVYSFYFGDYGHISVQGSYLTYKDTC  180

Query  433  LAVTGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspa  254
            LAVTGGSGIFEGVSGQVKL+QL+FPFKLFYTFYLKGI DLP EL G PV PSP V PSP 
Sbjct  181  LAVTGGSGIFEGVSGQVKLKQLVFPFKLFYTFYLKGIKDLPGELMGKPVRPSPFVHPSPM  240

Query  253  AKACEPGSTIGNFTD  209
            AKAC+PG+T+ NFTD
Sbjct  241  AKACKPGATVANFTD  255



>gb|ADL60034.1| allene oxide cyclase [Salvia miltiorrhiza]
Length=245

 Score =   266 bits (680),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  751  KSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGI  572
            K + +   KVQEL VYE+NERDRGSPAYLRL QK  NTLGDLVPFSNKLY+GDLQKR+GI
Sbjct  65   KPEPSTPSKVQELYVYEMNERDRGSPAYLRLGQKQQNTLGDLVPFSNKLYSGDLQKRLGI  124

Query  571  TAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVS  392
            TAGLC+LI+H  ++  DRYEAIYSFYFGDYGHI+VQG YLT  DTYLAVTGGSG+FEGVS
Sbjct  125  TAGLCVLIQHFPDQNADRYEAIYSFYFGDYGHISVQGAYLTRSDTYLAVTGGSGVFEGVS  184

Query  391  GQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            G VKLQQ++FPFKLFYTFYLKGI DLPAEL   PV PSP+VEPSPAAKA EP +TI NFT
Sbjct  185  GTVKLQQIVFPFKLFYTFYLKGIKDLPAELVVTPVAPSPSVEPSPAAKATEPQATIANFT  244

Query  211  D  209
            +
Sbjct  245  N  245



>gb|KJB50746.1| hypothetical protein B456_008G185600 [Gossypium raimondii]
 gb|KJB50747.1| hypothetical protein B456_008G185600 [Gossypium raimondii]
Length=253

 Score =   266 bits (680),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 159/185 (86%), Gaps = 4/185 (2%)
 Frame = -1

Query  751  KSQSAP----AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQK  584
            K ++AP      KVQEL VYE+NERDR SPA L+LSQK VN+LGDLVPF+NKLY+GDLQK
Sbjct  69   KQEAAPHTPKPTKVQELHVYEMNERDRSSPAVLKLSQKPVNSLGDLVPFTNKLYSGDLQK  128

Query  583  RVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIF  404
            RVGITAGLC+LI+H  EKKGDRYEAIYSFYFGDYGH++VQG YLTYEDTYLAVTGGSGIF
Sbjct  129  RVGITAGLCVLIQHVPEKKGDRYEAIYSFYFGDYGHLSVQGPYLTYEDTYLAVTGGSGIF  188

Query  403  EGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTI  224
            EG  GQVKL Q++FP KL+YTFYLKGI DLPAEL G PVPPSPAVEPS AAKA EP  +I
Sbjct  189  EGAYGQVKLHQIVFPMKLYYTFYLKGIGDLPAELLGKPVPPSPAVEPSAAAKATEPHGSI  248

Query  223  GNFTD  209
             NFT+
Sbjct  249  PNFTN  253



>ref|XP_007223720.1| hypothetical protein PRUPE_ppa010397mg [Prunus persica]
 gb|EMJ24919.1| hypothetical protein PRUPE_ppa010397mg [Prunus persica]
Length=251

 Score =   266 bits (679),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 160/181 (88%), Gaps = 1/181 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGIT  569
            + S+   KVQEL VYEINERDRGSPAYLRLS+K VN+LGDLVPF+NK+Y+GDL+KR+G+T
Sbjct  71   ADSSRPTKVQELHVYEINERDRGSPAYLRLSKKEVNSLGDLVPFTNKIYSGDLEKRLGVT  130

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AGLC+LI++  EKKGDRYEAIYSFYFGDYGHI+VQG YLTYEDTYLAVTGGSGIFEGV G
Sbjct  131  AGLCVLIQNVPEKKGDRYEAIYSFYFGDYGHISVQGAYLTYEDTYLAVTGGSGIFEGVYG  190

Query  388  QVKLQQLIFPFKLFYTFYLKGIPDLPAELC-GapvppspavepspaAKACEPGSTIGNFT  212
            QVKL+Q++FP KLFYTFYLKGI DLP EL  G PV PSP +EPSPAAKA EP +TI NFT
Sbjct  191  QVKLKQIVFPIKLFYTFYLKGISDLPVELTGGKPVVPSPTIEPSPAAKATEPNATIPNFT  250

Query  211  D  209
            +
Sbjct  251  N  251



>ref|XP_007215041.1| hypothetical protein PRUPE_ppa012079mg [Prunus persica]
 gb|EMJ16240.1| hypothetical protein PRUPE_ppa012079mg [Prunus persica]
Length=184

 Score =   263 bits (673),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGIT  569
            S ++   KVQEL VYEINERDR SPAYL LSQK VN+LGDLVPF+NK+YTGDLQKR+G+T
Sbjct  4    SSASRPTKVQELHVYEINERDRASPAYLSLSQKPVNSLGDLVPFTNKIYTGDLQKRLGVT  63

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AG+CILI+++ EKKGDRYEAIYSFYFGDYGHI+VQG YLTYEDTYLAVTGGSGIFEGV G
Sbjct  64   AGICILIENKPEKKGDRYEAIYSFYFGDYGHISVQGPYLTYEDTYLAVTGGSGIFEGVYG  123

Query  388  QVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvpp-spavepspaAKACEPGSTIGNFT  212
            QVKL Q++FPFK+ YTFYLKGI DLP EL    +   SPAVEPSPAAKACEP +TI NFT
Sbjct  124  QVKLHQIVFPFKILYTFYLKGIEDLPEELTAVKLVEPSPAVEPSPAAKACEPQATISNFT  183

Query  211  D  209
            +
Sbjct  184  N  184



>ref|XP_009394846.1| PREDICTED: allene oxide cyclase 1, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=249

 Score =   265 bits (678),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 139/151 (92%), Gaps = 1/151 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGIT  569
            S S P  KVQELCVYEINERDRGSPAYLRLSQK VN+LGDLVPFSNKLY+G+L+KRVGIT
Sbjct  71   SDSGP-NKVQELCVYEINERDRGSPAYLRLSQKEVNSLGDLVPFSNKLYSGNLEKRVGIT  129

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AG+C+LI+H  E+ GDRYEAIYSFYFGDYGH++VQG YLTYED+YLAVTGGSGIFEGV G
Sbjct  130  AGICVLIQHVPERGGDRYEAIYSFYFGDYGHVSVQGAYLTYEDSYLAVTGGSGIFEGVYG  189

Query  388  QVKLQQLIFPFKLFYTFYLKGIPDLPAELCG  296
            QVKLQQ++FPFK+FYTFYLKGIP+LP EL G
Sbjct  190  QVKLQQIVFPFKIFYTFYLKGIPNLPKELLG  220



>ref|XP_008230384.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Prunus 
mume]
Length=184

 Score =   263 bits (671),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGIT  569
            S ++   KVQEL VYEINERDR SPAYL LSQK VN+LGDLVPF+NK+YTGDLQKR+G+T
Sbjct  4    SSASRPTKVQELHVYEINERDRASPAYLSLSQKPVNSLGDLVPFTNKIYTGDLQKRLGVT  63

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AG+CILI+++ EKKGDRYEAIYSFYFGDYGHI+VQG YLTYEDTYLAVTGGSGIFEGV G
Sbjct  64   AGICILIENKPEKKGDRYEAIYSFYFGDYGHISVQGPYLTYEDTYLAVTGGSGIFEGVFG  123

Query  388  QVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvpp-spavepspaAKACEPGSTIGNFT  212
            QVKL Q++FPFK+ YTFYLKGI DLP EL    +   SPAVEPSPAAKACEP +T+ NFT
Sbjct  124  QVKLHQIVFPFKILYTFYLKGIEDLPEELTAVKLVEPSPAVEPSPAAKACEPQATVSNFT  183

Query  211  D  209
            +
Sbjct  184  N  184



>gb|AAT66741.1| plastid allene oxide cyclase [Humulus lupulus]
Length=255

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 162/193 (84%), Gaps = 6/193 (3%)
 Frame = -1

Query  769  KRSVTVKSQSAPAG-----KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKL  605
            K  +T +SQ++P+      KV EL VYEINERDR SPAYLRLSQK VN+LGDLVPFSNKL
Sbjct  63   KTYITCRSQASPSESEKPIKVHELRVYEINERDRSSPAYLRLSQKEVNSLGDLVPFSNKL  122

Query  604  YTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAV  425
            YTG LQKR+GITAG+C LI+++ EKKGDRYEAIYSFYFGDYGH++VQG Y+TYEDTYL V
Sbjct  123  YTGCLQKRIGITAGICTLIQNKAEKKGDRYEAIYSFYFGDYGHLSVQGSYMTYEDTYLVV  182

Query  424  TGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAK  248
            TGGSGIFEG  GQVKLQQLIFPFKLFYTFYLKGI  DLP EL G  V PSP+VEPSPAAK
Sbjct  183  TGGSGIFEGAYGQVKLQQLIFPFKLFYTFYLKGIKEDLPEELLGVHVEPSPSVEPSPAAK  242

Query  247  ACEPGSTIGNFTD  209
            ACE  + I +FTD
Sbjct  243  ACEAHAVIQSFTD  255



>gb|KHG03969.1| Allene oxide cyclase 4, chloroplastic -like protein [Gossypium 
arboreum]
Length=253

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 159/185 (86%), Gaps = 4/185 (2%)
 Frame = -1

Query  751  KSQSAP----AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQK  584
            K ++AP      KVQEL VYE+NERDR SPA L+LSQK VN+LGDLVPF+NKLY+GDLQK
Sbjct  69   KQEAAPHTPKPTKVQELHVYEMNERDRSSPAVLKLSQKPVNSLGDLVPFTNKLYSGDLQK  128

Query  583  RVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIF  404
            RVGITAGLC+LI+H  EKKGDRYEAIYSFYFGDYGH++VQG YLTYED+YLAVTGGSGIF
Sbjct  129  RVGITAGLCVLIQHVPEKKGDRYEAIYSFYFGDYGHLSVQGPYLTYEDSYLAVTGGSGIF  188

Query  403  EGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTI  224
            EG  GQVKL Q++FP KL+YTFYLKGI DLPAEL G PVPPSPAVEPS AAKA EP  +I
Sbjct  189  EGAYGQVKLHQIVFPMKLYYTFYLKGIGDLPAELLGKPVPPSPAVEPSAAAKATEPHGSI  248

Query  223  GNFTD  209
             NFT+
Sbjct  249  PNFTN  253



>ref|XP_006437732.1| hypothetical protein CICLE_v10032510mg [Citrus clementina]
 ref|XP_006484415.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Citrus 
sinensis]
 gb|ESR50972.1| hypothetical protein CICLE_v10032510mg [Citrus clementina]
 gb|KDO70085.1| hypothetical protein CISIN_1g025155mg [Citrus sinensis]
Length=257

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 155/180 (86%), Gaps = 2/180 (1%)
 Frame = -1

Query  742  SAPAG-KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGIT  569
            S PA  KVQEL VYEINERDR SPA L+LSQK  + T+GDLVPF+NKLYTGDLQKR+GIT
Sbjct  78   SRPANNKVQELFVYEINERDRNSPAILKLSQKPEHLTIGDLVPFTNKLYTGDLQKRIGIT  137

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AGLC+LIKHE EKKGDR+EAIYSFYFGDYGHI+VQG YLTYEDTYLAVTGGSGIFEGV G
Sbjct  138  AGLCVLIKHEPEKKGDRFEAIYSFYFGDYGHISVQGAYLTYEDTYLAVTGGSGIFEGVYG  197

Query  388  QVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            QVKL Q++FP+KLFYTFYLKG+ DLP EL   PV PSP VE +PAAKA EP + I NFT+
Sbjct  198  QVKLHQIVFPYKLFYTFYLKGVADLPQELLVKPVEPSPTVEAAPAAKATEPHAAISNFTN  257



>ref|XP_004508556.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Cicer 
arietinum]
Length=260

 Score =   264 bits (675),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 161/197 (82%), Gaps = 11/197 (6%)
 Frame = -1

Query  766  RSVTVKSQSAPAG-----------KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVP  620
            +SV+V+SQ+               +VQEL +YE+NERDRGSPAYLRLS KSVNTLGDLVP
Sbjct  63   KSVSVQSQTENHSGVEKVQEKVEERVQELHLYELNERDRGSPAYLRLSNKSVNTLGDLVP  122

Query  619  FSNKLYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYED  440
            FSNKLYTGDLQKR+GITAG+CILI+H  E+ GDRYEA+YSF+FG YG +AVQG YLTYED
Sbjct  123  FSNKLYTGDLQKRIGITAGICILIQHNAERNGDRYEAVYSFHFGKYGSLAVQGAYLTYED  182

Query  439  TYLAVTGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspaveps  260
            TYL+VTGGSGIFEGVSGQVKL QL+FPFK+FYTFYLKGI DLP EL G PV PSPAVE S
Sbjct  183  TYLSVTGGSGIFEGVSGQVKLNQLVFPFKIFYTFYLKGIKDLPEELLGKPVDPSPAVEAS  242

Query  259  paAKACEPGSTIGNFTD  209
            PAAKA EP + I  F +
Sbjct  243  PAAKALEPHAVIEGFIN  259



>ref|XP_002278768.1| PREDICTED: allene oxide cyclase 4, chloroplastic [Vitis vinifera]
 emb|CBI27060.3| unnamed protein product [Vitis vinifera]
Length=254

 Score =   263 bits (673),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -1

Query  724  VQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIK  545
            VQEL VYEINERDR SPA+L+LSQK  N+LGDLVPF+NK+YTGDL+KR+G+TAG+C+LI+
Sbjct  83   VQELYVYEINERDRDSPAFLKLSQKPANSLGDLVPFTNKIYTGDLEKRLGVTAGICVLIQ  142

Query  544  HEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQLI  365
            H  E+KGDRYEAIYSFYFGDYGH++VQG YLTYEDTYLAVTGGSGIFEGV G+VKLQQ++
Sbjct  143  HVRERKGDRYEAIYSFYFGDYGHVSVQGPYLTYEDTYLAVTGGSGIFEGVYGEVKLQQIV  202

Query  364  FPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            FPFKLFYTFYLKGIPDLP +L G PV PSP VEPSPAAKA  P +++ NFT
Sbjct  203  FPFKLFYTFYLKGIPDLPHDLMGKPVTPSPTVEPSPAAKATLPHASVKNFT  253



>gb|ACS96438.1| allene oxide cyclase [Jatropha curcas]
 gb|KDP29368.1| hypothetical protein JCGZ_18289 [Jatropha curcas]
Length=258

 Score =   263 bits (673),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 154/175 (88%), Gaps = 0/175 (0%)
 Frame = -1

Query  736  PAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLC  557
            PAGKVQ+L VYEINERDR SPA L+LS+K    LGDLVPF+NKLY+GDLQKR GITAGLC
Sbjct  83   PAGKVQQLNVYEINERDRDSPAILKLSKKPELALGDLVPFTNKLYSGDLQKRFGITAGLC  142

Query  556  ILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKL  377
            +LI+H  EK GDRYEA YSFYFGDYGHI+VQG YLTY+DT+LAVTGGSGIFEGV GQVKL
Sbjct  143  VLIQHVPEKNGDRYEANYSFYFGDYGHISVQGAYLTYQDTFLAVTGGSGIFEGVYGQVKL  202

Query  376  QQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            QQ++FP+KLFYTFYLKGIPDLPAEL G PV PSP VEPSPAAKA +P +TI NFT
Sbjct  203  QQIVFPYKLFYTFYLKGIPDLPAELLGKPVTPSPEVEPSPAAKAAQPNATILNFT  257



>gb|KJB22328.1| hypothetical protein B456_004G046300 [Gossypium raimondii]
Length=178

 Score =   259 bits (661),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = -1

Query  739  APAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGL  560
            A + KVQEL VYE+NERDRGSPAYLRLSQK VN+LGD+VPFSNK+Y GDL+KR+GITAG+
Sbjct  2    AASDKVQELHVYEMNERDRGSPAYLRLSQKPVNSLGDIVPFSNKIYRGDLEKRIGITAGM  61

Query  559  CILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVK  380
            CILI+H+ E KGDRYEAI+SFYFGDYGHIAVQG YLTY+D+YLA+TGGSGIFEGVSGQVK
Sbjct  62   CILIEHKPELKGDRYEAIFSFYFGDYGHIAVQGPYLTYQDSYLAITGGSGIFEGVSGQVK  121

Query  379  LQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            L Q++FPFK+FYTFYLKGI +LP EL   PV P PAVE +PAAKACEP + I NFT+
Sbjct  122  LHQIVFPFKIFYTFYLKGIGELPEELLCKPVDPHPAVEAAPAAKACEPHAAIANFTN  178



>ref|XP_009392456.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=250

 Score =   258 bits (659),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -1

Query  757  TVKSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRV  578
            +++S   PA  VQE+CVYEINE DR SPAYLRLSQK VN+LGDLVPFSNK+Y+GDLQKR+
Sbjct  68   SLESGGGPATDVQEMCVYEINELDRNSPAYLRLSQKDVNSLGDLVPFSNKVYSGDLQKRL  127

Query  577  GITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEG  398
            GITAGLC+LI+H  E+ GDRYEAIYSFYFG+YGHI+VQG YLTYEDTYLAVTGGSG+F G
Sbjct  128  GITAGLCVLIQHVPERVGDRYEAIYSFYFGEYGHISVQGAYLTYEDTYLAVTGGSGVFAG  187

Query  397  VSGQVKLQQLIFPFKLFYTFYLKGIPDLPAEL  302
            V GQVKL+QL+FPFK+FYTFYL+GIPDLP EL
Sbjct  188  VRGQVKLRQLVFPFKIFYTFYLEGIPDLPEEL  219



>ref|NP_001267900.1| allene oxide cyclase [Vitis vinifera]
 gb|ABD64688.1| allene oxide cyclase [Vitis vinifera]
Length=254

 Score =   258 bits (659),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 159/192 (83%), Gaps = 5/192 (3%)
 Frame = -1

Query  769  KRSVTVKSQSAPA-----GKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKL  605
            K  +T +SQ++P+      +         + RDRGSPAYLRLSQKSVN+LGDLVPFSNK+
Sbjct  63   KTYITCRSQASPSESENLSRFMNFAFMRYSIRDRGSPAYLRLSQKSVNSLGDLVPFSNKI  122

Query  604  YTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAV  425
            YTGDL+KR+G+TAG+C+LI++   KKGDRYEAIYSFYFGDYGHI+VQG YLTYEDTYLA+
Sbjct  123  YTGDLEKRLGVTAGICVLIQNVPGKKGDRYEAIYSFYFGDYGHISVQGAYLTYEDTYLAI  182

Query  424  TGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKA  245
            TGGSGIFEG  GQVKLQQ++FPFKLFYTFYLKGI +LPA+L G PV PSP VEP+PAAKA
Sbjct  183  TGGSGIFEGAYGQVKLQQIVFPFKLFYTFYLKGINELPADLLGKPVSPSPNVEPAPAAKA  242

Query  244  CEPGSTIGNFTD  209
            CEP + I NFTD
Sbjct  243  CEPHACIANFTD  254



>ref|XP_009357038.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Pyrus 
x bretschneideri]
Length=184

 Score =   255 bits (652),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 153/181 (85%), Gaps = 1/181 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGIT  569
            S S+   KVQEL VYEINERDR SPAYL LSQK V+ LGDLVPF+NK+YTGDLQKR+GIT
Sbjct  4    SSSSRPTKVQELNVYEINERDRSSPAYLSLSQKPVHALGDLVPFTNKIYTGDLQKRLGIT  63

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AG+CILI+++ EKKGDRYEAIYSFYFG+YGH+AVQG YLTYEDTYLAVTGGSGIFEGV G
Sbjct  64   AGICILIENKPEKKGDRYEAIYSFYFGNYGHVAVQGPYLTYEDTYLAVTGGSGIFEGVYG  123

Query  388  QVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvpps-pavepspaAKACEPGSTIGNFT  212
            QVKL Q++FPFK+ YTFYLKGI DLP EL    V    P VEPSPAAKACE  +T+ NFT
Sbjct  124  QVKLHQILFPFKILYTFYLKGIEDLPEELTNVKVVEPGPGVEPSPAAKACEAHATVSNFT  183

Query  211  D  209
            +
Sbjct  184  N  184



>ref|XP_008810937.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Phoenix 
dactylifera]
Length=245

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 135/151 (89%), Gaps = 1/151 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGIT  569
            S S P  KVQE+CVYEINERDR SPAYLRLSQK VN+LGDLVPFSNK+Y G+L+KR+GIT
Sbjct  67   SDSRPT-KVQEMCVYEINERDRNSPAYLRLSQKEVNSLGDLVPFSNKVYHGNLEKRLGIT  125

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AG+ ILI+H  E+ GDRYEAIYSFYFGDYGHI+VQG YLTYEDTYLAVTGGSGIF GV G
Sbjct  126  AGITILIQHVPERNGDRYEAIYSFYFGDYGHISVQGAYLTYEDTYLAVTGGSGIFTGVYG  185

Query  388  QVKLQQLIFPFKLFYTFYLKGIPDLPAELCG  296
            +VKLQQ++FPFKLFYTFYL+GIPDLP EL G
Sbjct  186  KVKLQQIVFPFKLFYTFYLQGIPDLPKELLG  216



>ref|XP_004304145.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=184

 Score =   253 bits (647),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 153/181 (85%), Gaps = 1/181 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGIT  569
            S S    KVQE  VYEINERDR SPAYL LSQK  ++LGDLVPF+NK+YTGDL+KR+GIT
Sbjct  4    SSSPRPTKVQEFHVYEINERDRSSPAYLSLSQKPAHSLGDLVPFTNKIYTGDLEKRLGIT  63

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AGLCILI+ + EKKGDRYEA+YSFYFGDYGHI+VQG YLTYEDT LAVTGGSGIFEGV G
Sbjct  64   AGLCILIESKPEKKGDRYEAMYSFYFGDYGHISVQGPYLTYEDTSLAVTGGSGIFEGVYG  123

Query  388  QVKLQQLIFPFKLFYTFYLKGIPDLPAEL-CGapvppspavepspaAKACEPGSTIGNFT  212
             VKL Q++FPFK+ YTFYLKGI DLP EL  G  V PSP+V+PSPAAKACEP +T+ NFT
Sbjct  124  HVKLHQIVFPFKILYTFYLKGIEDLPEELTAGKLVEPSPSVQPSPAAKACEPQATVSNFT  183

Query  211  D  209
            +
Sbjct  184  N  184



>ref|XP_008348108.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Malus 
domestica]
Length=184

 Score =   253 bits (646),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 152/181 (84%), Gaps = 1/181 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGIT  569
            S S+   KVQEL VYEINERDR SPAYL LSQK V+ LGDLVPF+NK+YTGDLQKR+GIT
Sbjct  4    SSSSRPTKVQELNVYEINERDRSSPAYLSLSQKPVHALGDLVPFTNKIYTGDLQKRLGIT  63

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AG+CILI+++ EKKGDRYEAIYSFYFG+YGH+AVQG YLTYEDTYLAVTGGSGIFEG  G
Sbjct  64   AGICILIENKPEKKGDRYEAIYSFYFGNYGHVAVQGPYLTYEDTYLAVTGGSGIFEGXYG  123

Query  388  QVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvpps-pavepspaAKACEPGSTIGNFT  212
            QVKL Q++FPFK+ YTFYLKGI DLP EL    V    P VEPSPAAKACE  +T+ NFT
Sbjct  124  QVKLHQILFPFKILYTFYLKGIEDLPEELTNVKVVEPGPGVEPSPAAKACEAHATVSNFT  183

Query  211  D  209
            +
Sbjct  184  N  184



>ref|XP_009394154.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=259

 Score =   256 bits (653),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQELCVYEINERDRGSPAYLRLSQK VN LGDLVPFSNKLY+G+L+KR+GIT+G+C+LI
Sbjct  87   KVQELCVYEINERDRGSPAYLRLSQKQVNFLGDLVPFSNKLYSGNLEKRLGITSGICVLI  146

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            +H  E+ GDRYEAIYSFYFGDYGHI+VQG YLTYE+++LAVTGGSG+FEG  GQVKLQQ+
Sbjct  147  QHVPERDGDRYEAIYSFYFGDYGHISVQGAYLTYEESHLAVTGGSGVFEGAYGQVKLQQI  206

Query  367  IFPFKLFYTFYLKGIPDLPAELCG  296
            +FPFK+FYTFYL+GIPDLP EL G
Sbjct  207  VFPFKIFYTFYLRGIPDLPKELLG  230



>ref|XP_006857130.1| hypothetical protein AMTR_s00065p00146710 [Amborella trichopoda]
 gb|ERN18597.1| hypothetical protein AMTR_s00065p00146710 [Amborella trichopoda]
Length=256

 Score =   254 bits (649),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 153/172 (89%), Gaps = 0/172 (0%)
 Frame = -1

Query  724  VQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIK  545
            VQE+ VYEINE DRGSPAYL LSQK +N+LGDLVPFSNKLY G+L+KR GITAG+C+LIK
Sbjct  85   VQEMHVYEINELDRGSPAYLPLSQKPINSLGDLVPFSNKLYHGNLKKRAGITAGICVLIK  144

Query  544  HEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQLI  365
            H  EKKGDRYEAI+SFYFGDYGHI+VQG+YLTY+DTYLAVTGGSG+F GV G+VKLQQL+
Sbjct  145  HVPEKKGDRYEAIFSFYFGDYGHISVQGEYLTYQDTYLAVTGGSGVFTGVYGKVKLQQLV  204

Query  364  FPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            FPFKLFYTFYL+GI +LPAEL G PVPP+P VEPSPAAKA EP + I N+ D
Sbjct  205  FPFKLFYTFYLQGIGELPAELLGEPVPPNPDVEPSPAAKAAEPHACIPNYHD  256



>gb|ADE76918.1| unknown [Picea sitchensis]
Length=274

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = -1

Query  745  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  566
            Q  P+G VQEL VYE+NE DRGSPAYLRLSQK VN LGD+VPFSNKLY+G+LQKR+GITA
Sbjct  96   QGPPSGSVQELYVYEMNELDRGSPAYLRLSQKPVNHLGDIVPFSNKLYSGNLQKRLGITA  155

Query  565  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQ  386
            G+CILI+H  EK GDRYEAIYSFYFGDYGHI+VQG YLTYE++YL +TGGSGIF GV GQ
Sbjct  156  GICILIQHFPEKNGDRYEAIYSFYFGDYGHISVQGPYLTYEESYLTITGGSGIFSGVHGQ  215

Query  385  VKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            VKL+Q++FPFKLFYTFYL+GIP LP +L G PV P+P VEPSP+AK  EP + + N+T
Sbjct  216  VKLKQIVFPFKLFYTFYLEGIPSLPEDLLGEPVSPTPDVEPSPSAKNEEPHACLPNYT  273



>ref|XP_008379524.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Malus 
domestica]
Length=184

 Score =   251 bits (641),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 151/181 (83%), Gaps = 1/181 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGIT  569
            S S+   KVQEL VYEINERDR SPAYL LSQK V+ LGDLVPF+NK+YTGDLQKR+GIT
Sbjct  4    SSSSRPTKVQELNVYEINERDRSSPAYLSLSQKPVHALGDLVPFTNKIYTGDLQKRLGIT  63

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AG+CILI+++ EKKGDRYEAIYSFYFG+YGH+AVQG YLTYEDTYLAVTGGSGIFEG  G
Sbjct  64   AGICILIENKPEKKGDRYEAIYSFYFGNYGHVAVQGPYLTYEDTYLAVTGGSGIFEGXYG  123

Query  388  QVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvpps-pavepspaAKACEPGSTIGNFT  212
            QVKL Q++FPFK+ YTFYLKGI DLP EL    V    P VEPSPAA ACE  +T+ NFT
Sbjct  124  QVKLHQILFPFKILYTFYLKGIEDLPEELTNVKVVEPGPGVEPSPAAXACEAHATVSNFT  183

Query  211  D  209
            +
Sbjct  184  N  184



>gb|ABK21165.1| unknown [Picea sitchensis]
Length=276

 Score =   254 bits (649),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 154/181 (85%), Gaps = 2/181 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGIT  569
            +Q  P+G VQEL VYEINE DRGSPAYLRLSQK VN LGDLVPFSNKLYTG+LQKR+GIT
Sbjct  95   AQGPPSGSVQELHVYEINELDRGSPAYLRLSQKPVNHLGDLVPFSNKLYTGNLQKRIGIT  154

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYED--TYLAVTGGSGIFEGV  395
            AG+CILI+   EKKGDRYEAIYSFYFGDYGHIAVQG YLT+ED  +YLA+TGGSGIF GV
Sbjct  155  AGICILIQQFPEKKGDRYEAIYSFYFGDYGHIAVQGPYLTFEDEESYLAITGGSGIFNGV  214

Query  394  SGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNF  215
             GQV L+QL+FPFK+FYTFYL+GIP LP +L G PV P+P VEPSPAAK  EP + + N+
Sbjct  215  RGQVMLKQLVFPFKIFYTFYLEGIPSLPEDLLGEPVAPTPDVEPSPAAKNKEPHACVPNY  274

Query  214  T  212
            T
Sbjct  275  T  275



>emb|CDY59866.1| BnaC09g52550D [Brassica napus]
Length=253

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = -1

Query  751  KSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGI  572
            KS++A   KVQEL VYE+NE DR SPA L+L +K    LGDLVPF+NKLYTGDL+KRVGI
Sbjct  73   KSENARPSKVQELNVYELNEGDRNSPAVLKLGKKPELCLGDLVPFTNKLYTGDLKKRVGI  132

Query  571  TAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVS  392
            TAGLC+LI+H  EK GDR+EA YSFYFGDYGH++VQG YLTYEDT+LAVTGGSGIFEG  
Sbjct  133  TAGLCVLIQHVPEKNGDRFEATYSFYFGDYGHLSVQGPYLTYEDTFLAVTGGSGIFEGAY  192

Query  391  GQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            GQVKL+QL++P KLFYTFYLKGI DLP EL G  V PS  V+ +P AKA EPG+TI NFT
Sbjct  193  GQVKLRQLVYPTKLFYTFYLKGIADLPLELTGTAVTPSKDVKTAPEAKATEPGATIKNFT  252

Query  211  D  209
            +
Sbjct  253  N  253



>ref|XP_009395977.1| PREDICTED: allene oxide cyclase 1, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=312

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQEL VYEINERDRGSP YLRLSQK VN LGDLVPFSNKLY+G+L+KR+GITAG+C+LI
Sbjct  140  KVQELSVYEINERDRGSPVYLRLSQKEVNCLGDLVPFSNKLYSGNLEKRLGITAGICVLI  199

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            +H  E+ GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLAVTGGSG+FEG  GQVKLQQ+
Sbjct  200  QHVPERGGDRYEAIYSFYFGDYGHISVQGMYLTYEESYLAVTGGSGVFEGAYGQVKLQQI  259

Query  367  IFPFKLFYTFYLKGIPDLPAELCG  296
            +FPFKLFYTFYLKGIPDLP EL G
Sbjct  260  VFPFKLFYTFYLKGIPDLPKELLG  283



>dbj|BAI58542.1| mangrin [Rhizophora apiculata]
 dbj|BAI58543.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58544.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58545.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58546.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58547.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58548.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58549.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58550.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58551.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58552.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58553.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58554.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58555.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58556.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58557.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58558.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58559.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58560.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58561.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58562.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58563.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58564.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58565.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58566.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58567.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58568.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58569.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58570.1| mangrin [Rhizophora apiculata]
 dbj|BAI58571.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58572.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58573.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58574.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58575.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58576.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58577.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58578.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58579.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58580.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58581.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58582.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58583.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58584.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58585.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58586.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58587.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58588.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58589.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58590.1| mangrin [Rhizophora apiculata]
 dbj|BAI58591.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58592.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58593.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58594.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58595.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58596.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58597.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58598.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58599.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58600.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58601.1| mangrin, partial [Rhizophora apiculata]
Length=178

 Score =   249 bits (635),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 140/163 (86%), Gaps = 6/163 (4%)
 Frame = -1

Query  769  KRSVTVKSQSAPAG------KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNK  608
            KR  + +SQ+ P+       KVQEL VYEINERDR SPA LRLSQK V +LGDLVPFSNK
Sbjct  16   KRPFSCRSQATPSDDASRPTKVQELFVYEINERDRESPAILRLSQKPVLSLGDLVPFSNK  75

Query  607  LYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  428
            +Y+GDLQKR+GITAG+C+ I+H+ +KKG+R+EAIYSFYFGDYGHIAVQG YLTYEDTYLA
Sbjct  76   VYSGDLQKRIGITAGICVQIQHKPDKKGERFEAIYSFYFGDYGHIAVQGAYLTYEDTYLA  135

Query  427  VTGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELC  299
            VTGGSGIFEGV GQVKLQQL++PFKLFYTFYL+GI DLP EL 
Sbjct  136  VTGGSGIFEGVYGQVKLQQLVYPFKLFYTFYLRGIKDLPEELT  178



>ref|XP_007042039.1| Allene oxide cyclase, putative [Theobroma cacao]
 gb|EOX97870.1| Allene oxide cyclase, putative [Theobroma cacao]
Length=251

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 159/193 (82%), Gaps = 6/193 (3%)
 Frame = -1

Query  769  KRSVTVKSQSAPAG------KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNK  608
            K S T KS + P+       KVQEL VYEINERDRGSPAYL LSQKSV +LGDLV FSNK
Sbjct  59   KTSFTFKSHAIPSNNNSTPCKVQELYVYEINERDRGSPAYLSLSQKSVKSLGDLVCFSNK  118

Query  607  LYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  428
            LYTGD+QKR+GIT+G+CIL++H+ EK G+RYEA+ SFYFGDYGH+ VQG Y+TYED+YLA
Sbjct  119  LYTGDMQKRIGITSGMCILVQHKPEKNGERYEALSSFYFGDYGHMTVQGPYMTYEDSYLA  178

Query  427  VTGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAK  248
            VTGG+GIF GV G+V+L Q++FP KL+++FYL+GI DLP EL G PV P+  VEPSPAA+
Sbjct  179  VTGGTGIFLGVIGRVRLHQILFPLKLYHSFYLEGIADLPEELLGEPVEPNLEVEPSPAAQ  238

Query  247  ACEPGSTIGNFTD  209
            ACEP +TI +FT+
Sbjct  239  ACEPHATIASFTE  251



>ref|XP_002524412.1| Allene oxide cyclase 3, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF38023.1| Allene oxide cyclase 3, chloroplast precursor, putative [Ricinus 
communis]
Length=259

 Score =   251 bits (641),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 149/180 (83%), Gaps = 1/180 (1%)
 Frame = -1

Query  745  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGIT  569
            +S    K+QEL VYEINERDR SPA L+LS+K     LGDLVPF+NKLY+GDL+KR+GIT
Sbjct  80   ESPRPTKIQELNVYEINERDRESPAILKLSKKPDQLALGDLVPFTNKLYSGDLKKRLGIT  139

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AGL +LIKH  EK GDRYEAIYSFYFGDYGHI+VQG YLTY+DTYLAVTGG+GIFEGV G
Sbjct  140  AGLSVLIKHVPEKNGDRYEAIYSFYFGDYGHISVQGAYLTYDDTYLAVTGGTGIFEGVYG  199

Query  388  QVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            QVKL Q++FP+KLFYTFYLKGIPDLP EL G PV PS  VEP+  AKA +P  TI +FTD
Sbjct  200  QVKLHQIVFPYKLFYTFYLKGIPDLPDELLGTPVTPSLTVEPASTAKAAQPSGTILHFTD  259



>gb|AEO13839.1| allene oxide cyclase [Gladiolus hybrid cultivar]
Length=244

 Score =   251 bits (640),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGIT  569
            + S+   K+Q+L VYEINERDRGSPAYLRLSQKSVN+LGDLVPFSNKLY G+L+KR+GIT
Sbjct  65   ADSSRPTKIQKLYVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYHGNLEKRLGIT  124

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AGLC LI+H  E+ GDRYEA+YSFYFGDYGHI+VQG YLTYED+YLAVTGGSGIFEGV G
Sbjct  125  AGLCTLIQHVPERNGDRYEAMYSFYFGDYGHISVQGAYLTYEDSYLAVTGGSGIFEGVYG  184

Query  388  QVKLQQLIFPFKLFYTFYLKGIPDLPAELCG  296
            QVKLQQ+IFPFKLFYTF LKGI DLP E+ G
Sbjct  185  QVKLQQIIFPFKLFYTFELKGIQDLPREILG  215



>ref|XP_003637011.1| Allene oxide cyclase C4 [Medicago truncatula]
 gb|KEH25317.1| allene oxide cyclase [Medicago truncatula]
Length=234

 Score =   250 bits (638),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -1

Query  745  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  566
            QS+ + KVQEL VYEINE+DRGSPAYLRLSQK+VNTL DLVPFSNKLY+G LQKRVGITA
Sbjct  71   QSSNSVKVQELSVYEINEKDRGSPAYLRLSQKNVNTLNDLVPFSNKLYSGCLQKRVGITA  130

Query  565  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQ  386
            G+C+LI+++ EKKGD YEAIYSFYFGDYGHI VQG YLTYEDTYL VTGG+GIFEGV GQ
Sbjct  131  GICVLIQNKAEKKGDIYEAIYSFYFGDYGHIYVQGSYLTYEDTYLVVTGGTGIFEGVYGQ  190

Query  385  VKLQQLIFPFKLFYTFYLKGIPDLPAEL  302
            VKL Q++FPFKLFYTFYL GI DLP E 
Sbjct  191  VKLHQIVFPFKLFYTFYLMGIKDLPHEF  218



>gb|AHZ35333.1| allene oxide cyclase [Picrorhiza kurrooa]
Length=254

 Score =   250 bits (639),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  751  KSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGI  572
            K + + A +VQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPF+NKLY+GDLQKR+GI
Sbjct  74   KPEPSRATRVQELYVYEINERDRGSPAYLRLSQKEVNSLGDLVPFTNKLYSGDLQKRLGI  133

Query  571  TAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVS  392
            TAGL +LI+H  +K GDRYEA YSFYFGDYGHI+VQG YLTYE+T+LAVTGGSG+FEGV 
Sbjct  134  TAGLTVLIQHVPDKNGDRYEATYSFYFGDYGHISVQGAYLTYEETHLAVTGGSGVFEGVY  193

Query  391  GQVKLQQLIFPFKLFYTFYLKGIPDLPAELC  299
            G VKLQQ++FPFK+FYTFYLKGI DLPAEL 
Sbjct  194  GTVKLQQIVFPFKIFYTFYLKGIRDLPAELV  224



>gb|EMT08815.1| Allene oxide cyclase 3, chloroplastic [Aegilops tauschii]
Length=239

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQK-SVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  551
            KVQEL VYE+NERDR SPAYLRLS K S N LGDLVPF+NK+Y G L KR+GITAG+CIL
Sbjct  65   KVQELHVYELNERDRESPAYLRLSAKQSQNALGDLVPFTNKVYNGSLDKRIGITAGICIL  124

Query  550  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQ  371
            I+H  E+ GDRYEAIYS YFGDYGHIAVQG YLTYE++YLAVTGGSG+FEG  GQVKL Q
Sbjct  125  IQHVPERNGDRYEAIYSIYFGDYGHIAVQGPYLTYEESYLAVTGGSGVFEGAYGQVKLNQ  184

Query  370  LIFPFKLFYTFYLKGIPDLPAE-LCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++FPFK+FYTFYLKGIPDLP E LC APVPPSP VEP+PAAKA EP + + NFTD
Sbjct  185  IVFPFKIFYTFYLKGIPDLPKELLCAAPVPPSPTVEPTPAAKATEPHACLSNFTD  239



>ref|XP_009114114.1| PREDICTED: allene oxide cyclase 3, chloroplastic [Brassica rapa]
 gb|ACY74379.1| allene oxidase cyclase [Brassica napus]
 emb|CDY04179.1| BnaA09g19570D [Brassica napus]
Length=253

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = -1

Query  751  KSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGI  572
            KS++A   KVQEL VYE+NE DR SPA L+L +K    LGDLVPF+NKLYTGDL+KRVGI
Sbjct  73   KSENARPSKVQELNVYELNEGDRNSPAVLKLGKKPELCLGDLVPFTNKLYTGDLKKRVGI  132

Query  571  TAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVS  392
            TAGLC+LI+H  EK GDR+EA YSFY GDYGH++VQG YLTYEDT+LAVTGGSGIFEG  
Sbjct  133  TAGLCVLIQHVPEKNGDRFEATYSFYLGDYGHLSVQGPYLTYEDTFLAVTGGSGIFEGAY  192

Query  391  GQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            GQVKL+QL++P KLFYTFYLKGI DLP EL G  V PS  V+P+P AKA EPG+TI NFT
Sbjct  193  GQVKLRQLVYPTKLFYTFYLKGIADLPLELTGTAVSPSKDVKPAPEAKATEPGATIKNFT  252

Query  211  D  209
            +
Sbjct  253  N  253



>ref|XP_010556382.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Tarenaya 
hassleriana]
Length=250

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 151/181 (83%), Gaps = 1/181 (1%)
 Frame = -1

Query  751  KSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGI  572
            + +S P  KVQEL +YE+NE DR SPA L+L  K    LGDLVPF+NKLYTGDL KRVGI
Sbjct  71   REKSTPP-KVQELHIYELNEGDRNSPAVLKLGNKQELCLGDLVPFTNKLYTGDLTKRVGI  129

Query  571  TAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVS  392
            TAGLC+LI+H  EK GDR+EAIYSFYFGDYGH+AVQG YLTYEDT+L+VTGGSGIFEG  
Sbjct  130  TAGLCVLIQHVPEKNGDRFEAIYSFYFGDYGHLAVQGPYLTYEDTFLSVTGGSGIFEGAY  189

Query  391  GQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            GQVKL+QL++P KLFYTFYLKGI DLPAEL G PV PS  V+PSPAA+A EPG+TI NFT
Sbjct  190  GQVKLRQLVYPTKLFYTFYLKGIADLPAELTGKPVEPSTDVKPSPAAQATEPGATIRNFT  249

Query  211  D  209
            D
Sbjct  250  D  250



>gb|ACY74378.1| allene oxidase cyclase [Brassica napus]
Length=253

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = -1

Query  751  KSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGI  572
            KS++A   KVQEL VYE+NE DR SPA L+L +K    LGDLVPF+NKLYTGDL+KRVGI
Sbjct  73   KSENARPSKVQELNVYELNEGDRNSPAVLKLGKKPELCLGDLVPFTNKLYTGDLKKRVGI  132

Query  571  TAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVS  392
            TAGLC+LI+H  EK GDR+EA YSFY GDYGH++VQG YLTYEDT+LAVTGGSGIFEG  
Sbjct  133  TAGLCVLIQHVPEKNGDRFEATYSFYLGDYGHLSVQGPYLTYEDTFLAVTGGSGIFEGAY  192

Query  391  GQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            GQVKL+QL++P KLFYTFYLKGI DLP EL G  V PS  V+P+P AKA EPG+TI NFT
Sbjct  193  GQVKLRQLVYPTKLFYTFYLKGIADLPLELTGTAVSPSKDVKPAPEAKATEPGATIKNFT  252

Query  211  D  209
            +
Sbjct  253  N  253



>gb|KFK35078.1| hypothetical protein AALP_AA5G232400 [Arabis alpina]
Length=254

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = -1

Query  751  KSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGI  572
            K++++   KVQEL VYE+NE DR SPA L+L +K    LGDLVPF+NKLYTGDL+KRVGI
Sbjct  74   KTENSRPSKVQELNVYELNEGDRNSPAVLKLGKKPELCLGDLVPFTNKLYTGDLKKRVGI  133

Query  571  TAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVS  392
            TAGLC+LI+H  EK GDR+EA YSFYFGDYGH++VQGQYLTYEDT+LAVTGGSGIFEG  
Sbjct  134  TAGLCVLIQHVPEKNGDRFEANYSFYFGDYGHLSVQGQYLTYEDTFLAVTGGSGIFEGAY  193

Query  391  GQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            GQ KL+QL++P KLFYTFYLKGI DLP EL G  V PS  V+P+P AKA EPG+TI NFT
Sbjct  194  GQAKLRQLVYPTKLFYTFYLKGIADLPLELTGTAVTPSKDVKPAPEAKATEPGATIRNFT  253

Query  211  D  209
            +
Sbjct  254  N  254



>gb|ACY74377.1| allene oxidase cyclase [Brassica napus]
Length=247

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = -1

Query  751  KSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGI  572
            KS++A   KVQEL VYE+NE DR SPA L+L +K    LGDLVPF+NKLYTGDL+KRVGI
Sbjct  67   KSENARPSKVQELNVYELNEGDRNSPAVLKLGKKPELCLGDLVPFTNKLYTGDLKKRVGI  126

Query  571  TAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVS  392
            TAGLC+LI+H  EK GDR+EA YSFY GDYGH++VQG YLTYEDT+LAVTGGSGIFEG  
Sbjct  127  TAGLCVLIQHVPEKNGDRFEATYSFYLGDYGHLSVQGPYLTYEDTFLAVTGGSGIFEGAY  186

Query  391  GQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            GQVKL+QL++P KLFYTFYLKGI DLP EL G  V PS  V+P+P AKA EPG+TI NFT
Sbjct  187  GQVKLRQLVYPTKLFYTFYLKGIADLPLELTGTAVSPSKDVKPAPEAKATEPGATIKNFT  246

Query  211  D  209
            +
Sbjct  247  N  247



>gb|AFP87550.1| allene oxide cyclase 4 [Oryza sativa Indica Group]
Length=240

 Score =   248 bits (633),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -1

Query  745  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFSNKLYTGDLQKRVGIT  569
            + A   KVQE+ VYEINERDR SPAYLRLS K   N LGDLVPF+NKLY+G L KR+GI+
Sbjct  61   KDARPAKVQEMFVYEINERDRESPAYLRLSAKQTENALGDLVPFTNKLYSGSLDKRLGIS  120

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AG+CILI+H  E+ GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLAVTGGSG+FEG  G
Sbjct  121  AGICILIQHVPERNGDRYEAIYSFYFGDYGHISVQGPYLTYEESYLAVTGGSGVFEGAYG  180

Query  388  QVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            QVKL Q++FPFK+FYTFYLKGIPDLP EL   PVPPSP VEP+PAAKA EP + + NFT+
Sbjct  181  QVKLNQIVFPFKIFYTFYLKGIPDLPRELLCTPVPPSPTVEPTPAAKATEPHACLNNFTN  240



>gb|AHA93095.1| allene oxide cyclase 1 [Triticum aestivum]
Length=239

 Score =   248 bits (633),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQK-SVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  551
            KVQEL VYE+NERDR SPAYLRLS K S N LGDLVPF+NK+Y G L KR+GITAG+CIL
Sbjct  65   KVQELHVYELNERDRESPAYLRLSAKQSQNALGDLVPFTNKVYNGSLDKRIGITAGICIL  124

Query  550  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQ  371
            I+H  E+ GDRYEAIYS YFGDYGHI VQG YLTYE++YLAVTGGSG+FEGV GQVKL Q
Sbjct  125  IQHVPERNGDRYEAIYSIYFGDYGHITVQGPYLTYEESYLAVTGGSGVFEGVYGQVKLNQ  184

Query  370  LIFPFKLFYTFYLKGIPDLPAE-LCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++FPFK+FYTFYLKGIPDLP E LC APVPPSP VEP+PAAKA EP + + NFTD
Sbjct  185  IVFPFKIFYTFYLKGIPDLPKELLCTAPVPPSPTVEPTPAAKATEPHACLNNFTD  239



>ref|NP_001050447.1| Os03g0438100 [Oryza sativa Japonica Group]
 emb|CAD38519.1| allene oxide cyclase [Oryza sativa Japonica Group]
 gb|AAR89017.1| allene oxide cyclase [Oryza sativa Japonica Group]
 gb|ABF96821.1| Allene oxide cyclase 3, chloroplast precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF12361.1| Os03g0438100 [Oryza sativa Japonica Group]
 gb|EAY90593.1| hypothetical protein OsI_12194 [Oryza sativa Indica Group]
 gb|ABV03555.1| AOC [Oryza sativa Japonica Group]
 gb|ABV45432.1| AOC [Oryza sativa Japonica Group]
 dbj|BAG87277.1| unnamed protein product [Oryza sativa Japonica Group]
Length=240

 Score =   248 bits (632),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -1

Query  745  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFSNKLYTGDLQKRVGIT  569
            + A   KVQE+ VYEINERDR SPAYLRLS K   N LGDLVPF+NKLY+G L KR+GI+
Sbjct  61   KDARPAKVQEMFVYEINERDRESPAYLRLSAKQTENALGDLVPFTNKLYSGSLDKRLGIS  120

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AG+CILI+H  E+ GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLAVTGGSG+FEG  G
Sbjct  121  AGICILIQHVPERNGDRYEAIYSFYFGDYGHISVQGPYLTYEESYLAVTGGSGVFEGAYG  180

Query  388  QVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            QVKL Q++FPFK+FYTFYLKGIPDLP EL   PVPPSP VEP+PAAKA EP + + NFT+
Sbjct  181  QVKLNQIVFPFKIFYTFYLKGIPDLPRELLCTPVPPSPTVEPTPAAKATEPHACLNNFTN  240



>gb|EAZ27451.1| hypothetical protein OsJ_11399 [Oryza sativa Japonica Group]
Length=241

 Score =   248 bits (632),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 152/187 (81%), Gaps = 1/187 (1%)
 Frame = -1

Query  766  RSVTVKSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFSNKLYTGDL  590
            R      + A   KVQE+ VYEINERDR SPAYLRLS K   N LGDLVPF+NKLY+G L
Sbjct  55   RPKPATPKDARPAKVQEMFVYEINERDRESPAYLRLSAKQTENALGDLVPFTNKLYSGSL  114

Query  589  QKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSG  410
             KR+GI+AG+CILI+H  E+ GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLAVTGGSG
Sbjct  115  DKRLGISAGICILIQHVPERNGDRYEAIYSFYFGDYGHISVQGPYLTYEESYLAVTGGSG  174

Query  409  IFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGS  230
            +FEG  GQVKL Q++FPFK+FYTFYLKGIPDLP EL   PVPPSP VEP+PAAKA EP +
Sbjct  175  VFEGAYGQVKLNQIVFPFKIFYTFYLKGIPDLPRELLCTPVPPSPTVEPTPAAKATEPHA  234

Query  229  TIGNFTD  209
             + NFT+
Sbjct  235  CLNNFTN  241



>gb|ADL16493.1| allene oxide cyclase [Artemisia annua]
Length=249

 Score =   248 bits (632),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KV ELCVYEINERDRGSPAYLRL QK VN+LGDLVPF+NK+Y+ DL+ R+GITAG+CILI
Sbjct  76   KVHELCVYEINERDRGSPAYLRLGQKPVNSLGDLVPFTNKIYSADLKTRLGITAGICILI  135

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            K+  E KGDRYEAIYSF+ GDYG I+ QG Y+T EDTYLAVTGG+GIF GV GQVKLQQL
Sbjct  136  KNMPEVKGDRYEAIYSFHLGDYGQISAQGAYITTEDTYLAVTGGTGIFAGVYGQVKLQQL  195

Query  367  IFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            +FPFKLFYTFYL+G+  DLPAEL   PV PSPAVE SP AKAC+PG+T  NF+D
Sbjct  196  VFPFKLFYTFYLQGLANDLPAELLVTPVTPSPAVEASPDAKACKPGATGPNFSD  249



>dbj|BAJ96870.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=238

 Score =   247 bits (630),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLS-QKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  551
            KVQEL VYE+NERDR SPAYLRLS  +S N LGDLVPF+NK+Y G L KR+GITAG+CIL
Sbjct  65   KVQELHVYELNERDRESPAYLRLSANQSQNALGDLVPFTNKVYNGSLDKRIGITAGICIL  124

Query  550  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQ  371
            I+H  E+ GDRYEAIYS YFGDYGHI++QG YLTYE++YLAVTGGSG+FEGV GQVKL Q
Sbjct  125  IQHVPERNGDRYEAIYSMYFGDYGHISLQGPYLTYEESYLAVTGGSGVFEGVYGQVKLNQ  184

Query  370  LIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++FPFK+FYTFYLKGIPDLP EL   PVPPSP VEP+PAAKA EP + + NFTD
Sbjct  185  IVFPFKIFYTFYLKGIPDLPKELLCTPVPPSPTVEPTPAAKATEPHACLNNFTD  238



>emb|CAC83766.1| allene oxide cyclase [Hordeum vulgare subsp. vulgare]
Length=238

 Score =   246 bits (629),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 151/181 (83%), Gaps = 1/181 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLS-QKSVNTLGDLVPFSNKLYTGDLQKRVGI  572
            +  A   KVQEL VYE+NERDR SPAYLRLS  +S N LGDLVPF+NK+Y G L KR+GI
Sbjct  58   AMDARPSKVQELHVYELNERDRESPAYLRLSANQSQNALGDLVPFTNKVYNGSLDKRIGI  117

Query  571  TAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVS  392
            TAG+CILI+H  E+ GDRYEAIYS YFGDYGHI++QG YLTYE++YLAVTGGSG+FEGV 
Sbjct  118  TAGICILIQHVPERNGDRYEAIYSMYFGDYGHISLQGPYLTYEESYLAVTGGSGVFEGVY  177

Query  391  GQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            GQVKL Q++FPFK+FYTFYLKGIPDLP EL   PVPPSP VEP+PAAKA EP + + NFT
Sbjct  178  GQVKLNQIVFPFKIFYTFYLKGIPDLPKELLCTPVPPSPTVEPTPAAKATEPHACLNNFT  237

Query  211  D  209
            D
Sbjct  238  D  238



>ref|XP_010916944.1| PREDICTED: allene oxide cyclase 1, chloroplastic-like [Elaeis 
guineensis]
Length=245

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGIT  569
            S  + + KVQE+ VYEINERDRGSP YLRLSQK VN+LGDLVP +NK+Y G+L+KR+GIT
Sbjct  66   SSDSRSSKVQEMYVYEINERDRGSPVYLRLSQKEVNSLGDLVPLTNKVYHGNLEKRLGIT  125

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AG+C+L++H  E+ GDRYEAIYSFYFGDYGHI+VQG YLTYEDTYLAVTGGSG+F GV G
Sbjct  126  AGICVLVQHVPERGGDRYEAIYSFYFGDYGHISVQGPYLTYEDTYLAVTGGSGVFAGVYG  185

Query  388  QVKLQQLIFPFKLFYTFYLKGIPDLPAELCG  296
             VKLQQ+++PFK+FYTFYL+GIPDLP EL G
Sbjct  186  TVKLQQIVYPFKIFYTFYLQGIPDLPRELLG  216



>ref|XP_011078449.1| PREDICTED: allene oxide cyclase 3, chloroplastic [Sesamum indicum]
Length=248

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = -1

Query  745  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  566
            QS+   KVQEL VYE+NERDRGSPAYL+LSQK    LGDLVPFSNKLY+GDLQKR+GITA
Sbjct  79   QSSRPTKVQELYVYEMNERDRGSPAYLKLSQKEGKFLGDLVPFSNKLYSGDLQKRLGITA  138

Query  565  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQ  386
            GLC+LI++  EK GDRYEA+YSFYFGDYGH+ VQG YLTYEDTYLAVTGGSG+FEGV GQ
Sbjct  139  GLCMLIQNFPEK-GDRYEAVYSFYFGDYGHVTVQGAYLTYEDTYLAVTGGSGVFEGVYGQ  197

Query  385  VKLQQLIFPFKLFYTFYLKGIPDLPAELC  299
            VKLQQ++FPFKLFYTFYLKGI DLPAEL 
Sbjct  198  VKLQQIVFPFKLFYTFYLKGIKDLPAELV  226



>ref|XP_010924770.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Elaeis 
guineensis]
Length=245

 Score =   246 bits (629),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  733  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCI  554
            + KVQEL VYEINERDR SPAYL LSQK VN+LGDLVPFSNK+Y G+L+KR+GITAG+CI
Sbjct  71   STKVQELYVYEINERDRNSPAYLSLSQKEVNSLGDLVPFSNKVYHGNLEKRLGITAGICI  130

Query  553  LIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQ  374
            LI+H  E+ GDRYEAIYSFYFGDYGHI+VQG YLTYEDTYL++TGGSG+F GV G+VKL 
Sbjct  131  LIQHVPERNGDRYEAIYSFYFGDYGHISVQGGYLTYEDTYLSITGGSGVFTGVYGKVKLH  190

Query  373  QLIFPFKLFYTFYLKGIPDLPAELCG  296
            Q++FPFKLFYTFYL+GIPD+P EL G
Sbjct  191  QIVFPFKLFYTFYLEGIPDIPKELLG  216



>ref|XP_002465087.1| hypothetical protein SORBIDRAFT_01g031870 [Sorghum bicolor]
 gb|EER92085.1| hypothetical protein SORBIDRAFT_01g031870 [Sorghum bicolor]
Length=274

 Score =   248 bits (632),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 151/174 (87%), Gaps = 1/174 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQK-SVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  551
            KVQEL VYEINERDR SPAYLRLS K S N LGDLVPF+NK+Y+G L KR+GITAG+C+L
Sbjct  101  KVQELYVYEINERDRESPAYLRLSAKQSENALGDLVPFTNKVYSGSLDKRLGITAGICVL  160

Query  550  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQ  371
            I+H  ++ GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLAVTGGSG+FEG  GQVKL Q
Sbjct  161  IQHVPDRNGDRYEAIYSFYFGDYGHISVQGPYLTYEESYLAVTGGSGVFEGAYGQVKLNQ  220

Query  370  LIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++FPFK+FYTFYLKGIPDLP +L   PVPPSP VEP+PAAKA EP ++I N+T+
Sbjct  221  IVFPFKIFYTFYLKGIPDLPRDLLCTPVPPSPTVEPTPAAKAAEPHASINNYTN  274



>ref|XP_004983950.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Setaria 
italica]
Length=245

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 151/181 (83%), Gaps = 1/181 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFSNKLYTGDLQKRVGI  572
            ++ A   KVQEL VYE+NERDR SPAYLRLS K   N LGDLVPF+NK+Y+G L KR+GI
Sbjct  65   AKDARPTKVQELYVYELNERDRESPAYLRLSAKQTENALGDLVPFTNKVYSGSLDKRLGI  124

Query  571  TAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVS  392
            TAG+CILI+H  E+ GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLAVTGGSG+FEG  
Sbjct  125  TAGICILIQHVPERNGDRYEAIYSFYFGDYGHISVQGPYLTYEESYLAVTGGSGVFEGAY  184

Query  391  GQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            GQVKL Q++FPFK+FYTFYLKGIPDLP EL   PVPPSP VE +PAAKA EP + + NFT
Sbjct  185  GQVKLNQIVFPFKIFYTFYLKGIPDLPRELLCTPVPPSPTVEATPAAKAGEPHACVKNFT  244

Query  211  D  209
            +
Sbjct  245  N  245



>ref|XP_006650236.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Oryza 
brachyantha]
Length=242

 Score =   246 bits (628),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -1

Query  745  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFSNKLYTGDLQKRVGIT  569
            + A   KVQE+ VYEINERDR SPAYLRLS K   N LGDLVPF+NK+Y+G L KR+GIT
Sbjct  63   KDARPAKVQEMYVYEINERDRESPAYLRLSAKQTENALGDLVPFTNKVYSGSLDKRLGIT  122

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AG+C+L++H  E+ GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLAVTGGSG+FEG  G
Sbjct  123  AGICVLVQHVPERNGDRYEAIYSFYFGDYGHISVQGPYLTYEESYLAVTGGSGVFEGAYG  182

Query  388  QVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            QVKL Q++FPFK+FYTFYLKGIPDLP EL   PVPPSP VEP+PAAKA EP + + NFT+
Sbjct  183  QVKLNQIVFPFKIFYTFYLKGIPDLPRELLCTPVPPSPTVEPTPAAKATEPHACLNNFTN  242



>ref|XP_006395626.1| hypothetical protein EUTSA_v10004810mg [Eutrema salsugineum]
 gb|ESQ32912.1| hypothetical protein EUTSA_v10004810mg [Eutrema salsugineum]
Length=252

 Score =   246 bits (628),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = -1

Query  751  KSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGI  572
            KS+++   K+QEL VYE+NE DR SPA L+L +K    LGDLVPF+NKLYTGDL+KRVGI
Sbjct  72   KSENSRPSKIQELNVYELNEGDRNSPAVLKLGKKPELCLGDLVPFTNKLYTGDLKKRVGI  131

Query  571  TAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVS  392
            TAGLC+LI+H  EK GDR+EA YSFYFG+YGH+AVQG YLTY+DT+LAVTGGSGIFEG  
Sbjct  132  TAGLCVLIQHVPEKNGDRFEANYSFYFGEYGHLAVQGPYLTYQDTFLAVTGGSGIFEGAY  191

Query  391  GQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            GQVKL+QL++P KLFYTFYLKGI DLP EL G  V PS  V+P+P AKA EPG+TI NFT
Sbjct  192  GQVKLRQLVYPTKLFYTFYLKGIADLPLELTGTAVTPSKDVKPAPEAKATEPGATIKNFT  251

Query  211  D  209
            +
Sbjct  252  N  252



>ref|XP_008388976.1| PREDICTED: allene oxide cyclase 1, chloroplastic-like [Malus 
domestica]
Length=260

 Score =   246 bits (629),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 157/197 (80%), Gaps = 12/197 (6%)
 Frame = -1

Query  763  SVTVKSQSAPAGKVQE---------LCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSN  611
            S T +SQ+ P+ +  E         L VYEINERDRGSP YLRLS K V++LGDLVP +N
Sbjct  64   SFTCESQANPSTETDERPGSEVPQVLHVYEINERDRGSPVYLRLSGKEVHSLGDLVPLTN  123

Query  610  KLYTGDLQKRVGITAGLCILIKHEEEK--KGDRYEAIYSFYFGDYGHIAVQGQYLTYEDT  437
            KLYTGDLQKR+GITAG+ ILI+H  EK   GDRYEAIYSFYFGDYGHI+VQG YLTYEDT
Sbjct  124  KLYTGDLQKRIGITAGITILIQHYPEKINSGDRYEAIYSFYFGDYGHISVQGPYLTYEDT  183

Query  436  YLAVTGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGI-PDLPAELCGapvppspaveps  260
            YL+V GGSGIFEGV GQVKLQQL++PFKLFYTFYLKGI  +LP EL G PV P+P VEP+
Sbjct  184  YLSVKGGSGIFEGVYGQVKLQQLVYPFKLFYTFYLKGICKNLPEELLGKPVEPTPDVEPT  243

Query  259  paAKACEPGSTIGNFTD  209
            PAA+ACEP +TI  F D
Sbjct  244  PAARACEPHATIAGFND  260



>gb|AFH89625.1| allene oxide cyclase [Cymbidium ensifolium]
Length=256

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 135/152 (89%), Gaps = 1/152 (1%)
 Frame = -1

Query  757  TVKSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRV  578
            T +  S P+  VQEL VYEINERDRGSP YLRLSQK VN+LGDLVPFSNK+Y+GDL+KR+
Sbjct  75   THRDSSRPSN-VQELHVYEINERDRGSPVYLRLSQKEVNSLGDLVPFSNKVYSGDLEKRL  133

Query  577  GITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEG  398
            GITAG+ ILI++E EKKGDRYEAIYSFYFG+YGHI++QG YLTYED+YLAVTGGSG+F G
Sbjct  134  GITAGITILIQNEPEKKGDRYEAIYSFYFGEYGHISIQGSYLTYEDSYLAVTGGSGVFAG  193

Query  397  VSGQVKLQQLIFPFKLFYTFYLKGIPDLPAEL  302
            V GQV L Q++FPFK++YTFYL+GIPDLP EL
Sbjct  194  VYGQVLLHQIVFPFKIYYTFYLQGIPDLPVEL  225



>ref|XP_008359967.1| PREDICTED: allene oxide cyclase 1, chloroplastic-like [Malus 
domestica]
Length=260

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 157/197 (80%), Gaps = 12/197 (6%)
 Frame = -1

Query  763  SVTVKSQSAPAGKVQE---------LCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSN  611
            S T +SQ+ P+ +  E         L VYEINERDRGSP YLRLS K V++LGDLVP +N
Sbjct  64   SFTCESQANPSTETDERPGSEVPQVLHVYEINERDRGSPVYLRLSGKEVHSLGDLVPLTN  123

Query  610  KLYTGDLQKRVGITAGLCILIKHEEEK--KGDRYEAIYSFYFGDYGHIAVQGQYLTYEDT  437
            KLYTGDLQKR+GITAG+ ILI+H  EK   GDRYEAIYSFYFGDYGHI+VQG YLTYEDT
Sbjct  124  KLYTGDLQKRIGITAGITILIQHYPEKLNSGDRYEAIYSFYFGDYGHISVQGPYLTYEDT  183

Query  436  YLAVTGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGI-PDLPAELCGapvppspaveps  260
            YL+V GGSGIFEGV GQVKLQQL++PFKLFYTFYLKGI  +LP EL G PV P+P VEP+
Sbjct  184  YLSVKGGSGIFEGVYGQVKLQQLVYPFKLFYTFYLKGICKNLPEELLGKPVEPTPDVEPT  243

Query  259  paAKACEPGSTIGNFTD  209
            PAA+ACEP +TI  F D
Sbjct  244  PAARACEPHATIAGFND  260



>gb|AGU41846.1| allene oxide cyclase [Triticum aestivum]
Length=238

 Score =   245 bits (626),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 147/174 (84%), Gaps = 1/174 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQK-SVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  551
            KVQEL VYE+NE DR SPAYLRLS K S N LGDLVPF+NK+Y G L KR+GITAG+CIL
Sbjct  65   KVQELHVYELNEHDRESPAYLRLSAKQSQNALGDLVPFTNKVYNGSLDKRIGITAGICIL  124

Query  550  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQ  371
            I+H  E+ GDRYEAIYS YFGDYGHI VQG YLTYE++YLAVTGGSG+FEGV GQVKL Q
Sbjct  125  IQHVPERNGDRYEAIYSIYFGDYGHITVQGPYLTYEESYLAVTGGSGVFEGVYGQVKLNQ  184

Query  370  LIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++FPFK+FYTFYLKGIPDLP EL   PVPPSP VEP+PAAKA EP + + NFTD
Sbjct  185  IVFPFKIFYTFYLKGIPDLPKELLCTPVPPSPTVEPTPAAKATEPHACLNNFTD  238



>gb|AFP87304.1| chloroplast allene oxide cyclase [Leymus mollis]
Length=238

 Score =   245 bits (626),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 147/174 (84%), Gaps = 1/174 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQK-SVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  551
            KVQEL VYE+NERDR SPAYLRLS K S N LGDLVPF+NK+Y G L KR+GITAG+CIL
Sbjct  65   KVQELHVYELNERDRESPAYLRLSAKQSQNALGDLVPFTNKVYNGSLDKRIGITAGICIL  124

Query  550  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQ  371
            I+H  E+ GDRYEAIYS YFGDYGH+ VQG YLTYE++YLAVTGGSG+FEG  GQVKL Q
Sbjct  125  IQHVPERNGDRYEAIYSIYFGDYGHLTVQGPYLTYEESYLAVTGGSGVFEGAYGQVKLHQ  184

Query  370  LIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++FPFK+FYTFYLKGIPDLP EL   PVPPSP VEP+PAAKA EP + + NFTD
Sbjct  185  IVFPFKIFYTFYLKGIPDLPRELLCTPVPPSPTVEPTPAAKATEPHACLNNFTD  238



>ref|XP_003562362.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Brachypodium 
distachyon]
Length=243

 Score =   244 bits (622),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 147/174 (84%), Gaps = 1/174 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQK-SVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  551
            KVQEL VYE+NERDR SPAYLRLS K S N LGDLVPF+NK+Y G L KR+GITAG+CIL
Sbjct  70   KVQELYVYELNERDRESPAYLRLSAKQSENALGDLVPFTNKVYNGSLDKRIGITAGICIL  129

Query  550  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQ  371
            I+H  E+ GDRYEAIYS YFGDYGHI VQG YLTYE++YLAVTGGSG+FEG  GQVKL Q
Sbjct  130  IQHVPERNGDRYEAIYSLYFGDYGHITVQGPYLTYEESYLAVTGGSGVFEGAYGQVKLHQ  189

Query  370  LIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++FPFK+FYTFYLKGIPDLP EL   PVPPSP VEP+PAAKA EP + + NFT+
Sbjct  190  IVFPFKIFYTFYLKGIPDLPRELLCTPVPPSPTVEPTPAAKAAEPHACLNNFTN  243



>ref|XP_008792377.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Phoenix 
dactylifera]
Length=245

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQE+ VYEINERDR SPAYLRLSQK  N+LGDLVPFSNK+Y G L+KR+GITAG+CILI
Sbjct  73   KVQEMYVYEINERDRSSPAYLRLSQKEHNSLGDLVPFSNKVYHGTLEKRLGITAGICILI  132

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            +H  E+ GDRYEAIYSFYFGDYGHI+VQG YLTYEDTYL++TGGSG+F GV G+VKL Q+
Sbjct  133  QHVPERNGDRYEAIYSFYFGDYGHISVQGAYLTYEDTYLSITGGSGVFTGVYGKVKLHQI  192

Query  367  IFPFKLFYTFYLKGIPDLPAELCG  296
            +FPFK+FYTFYL+GIPD+P EL G
Sbjct  193  VFPFKVFYTFYLEGIPDIPEELLG  216



>ref|NP_001105245.1| allene oxide cyclase1 [Zea mays]
 gb|AAR33049.1| allene oxide cyclase [Zea mays]
 gb|ACF80011.1| unknown [Zea mays]
 tpg|DAA45890.1| TPA: allene oxide cyclase 4 [Zea mays]
Length=238

 Score =   243 bits (620),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  551
            KVQEL VYEINERDR SPAYLRLS K   N LGDLVPF+NK+Y G L KR+G+TAG+C+L
Sbjct  65   KVQELYVYEINERDRESPAYLRLSAKQTENALGDLVPFTNKVYNGSLDKRLGVTAGICVL  124

Query  550  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQ  371
            I+H  ++ GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLAVTGGSG+FEGV GQVKL Q
Sbjct  125  IQHVPDRNGDRYEAIYSFYFGDYGHISVQGPYLTYEESYLAVTGGSGVFEGVYGQVKLNQ  184

Query  370  LIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++FPFK+FYTFYL+GIPDLP +L   PVPPSP VEP+PAA+A EP +++ N+T+
Sbjct  185  IVFPFKIFYTFYLRGIPDLPRDLLCTPVPPSPTVEPTPAARAAEPHASLDNYTN  238



>ref|XP_006292768.1| hypothetical protein CARUB_v10019017mg [Capsella rubella]
 gb|EOA25666.1| hypothetical protein CARUB_v10019017mg [Capsella rubella]
Length=257

 Score =   243 bits (621),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 151/183 (83%), Gaps = 2/183 (1%)
 Frame = -1

Query  751  KSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNT-LGDLVPFSNKLYTGDLQKRVG  575
            K++++   K+QEL VYE+NE DR SPA L+L +K     LGDLVPF+NKLYTGDL+KRVG
Sbjct  75   KTETSRPSKIQELNVYELNEGDRNSPAVLKLGKKPTELCLGDLVPFTNKLYTGDLKKRVG  134

Query  574  ITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGV  395
            ITAGLC+LI+H  EK GDR+EA YSFYFGDYGH++VQGQYLTY+DT+LAVTGGSGIFEG 
Sbjct  135  ITAGLCVLIQHVPEKSGDRFEANYSFYFGDYGHLSVQGQYLTYQDTFLAVTGGSGIFEGA  194

Query  394  SGQVKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGN  218
             GQVKLQQL++P KLFYTFYLKG+  DLP EL G  V PS  V+PSP AKA EPG+TI N
Sbjct  195  YGQVKLQQLVYPTKLFYTFYLKGLAKDLPLELTGTAVTPSKDVKPSPEAKATEPGATIRN  254

Query  217  FTD  209
            FT+
Sbjct  255  FTN  257



>ref|NP_001141267.1| allene oxide cyclase 4 [Zea mays]
 gb|ACF85913.1| unknown [Zea mays]
 gb|AFW88169.1| allene oxide cyclase 4 [Zea mays]
Length=238

 Score =   242 bits (618),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 148/174 (85%), Gaps = 1/174 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  551
            KVQEL VYE+NERDR SPAYLRLS K   N LGDLVPF+NK+Y G L KR+GITAG+C+L
Sbjct  65   KVQELYVYEMNERDRESPAYLRLSAKQTENALGDLVPFTNKVYNGSLDKRLGITAGICVL  124

Query  550  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQ  371
            I+H  ++ GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLAVTGGSG+FEG  GQVKL Q
Sbjct  125  IQHVPDRNGDRYEAIYSFYFGDYGHISVQGAYLTYEESYLAVTGGSGVFEGAYGQVKLHQ  184

Query  370  LIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++FPFK+FYTFYL+GIPDLP +L   PVPPSP VEP+PAA+A EP + + N+T+
Sbjct  185  IVFPFKIFYTFYLRGIPDLPRDLLCTPVPPSPTVEPTPAARAAEPHACVNNYTN  238



>ref|XP_003637010.1| Allene-oxide cyclase [Medicago truncatula]
 gb|KEH25316.1| allene oxide cyclase [Medicago truncatula]
Length=249

 Score =   243 bits (619),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -1

Query  751  KSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGI  572
            + QS+ + KVQEL VYEINE+DRGSP YLRLSQK+VN L DL+ FSNKLY+G LQKRVGI
Sbjct  68   QDQSSNSVKVQELSVYEINEKDRGSPVYLRLSQKNVNILDDLISFSNKLYSGCLQKRVGI  127

Query  571  TAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTY-EDTYLAVTGGSGIFEGV  395
            TAG+C+LI+++ EKKGD YEAIYSFYFG+YGHI+VQG YLTY EDTYLAVTGG+GIFEGV
Sbjct  128  TAGICVLIQNKAEKKGDIYEAIYSFYFGEYGHISVQGSYLTYEEDTYLAVTGGTGIFEGV  187

Query  394  SGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNF  215
             GQVKL Q++FPFK+FYTFYLKGI DLP E    P+ P+ AV+PS  AK  EP + I  F
Sbjct  188  YGQVKLHQIVFPFKIFYTFYLKGIKDLPHEFLVNPIEPNLAVKPSLDAKDYEPHAVIAGF  247

Query  214  TD  209
            T+
Sbjct  248  TN  249



>ref|XP_010502459.1| PREDICTED: allene oxide cyclase 3, chloroplastic isoform X2 [Camelina 
sativa]
Length=257

 Score =   243 bits (619),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 148/183 (81%), Gaps = 2/183 (1%)
 Frame = -1

Query  751  KSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNT-LGDLVPFSNKLYTGDLQKRVG  575
            K++ +   K+QEL VYE+NE DR SPA L+L +K     LGDLVPF+NKLYTGDL+KRVG
Sbjct  75   KTELSRPSKIQELNVYELNEGDRNSPAVLKLGKKPTELCLGDLVPFTNKLYTGDLKKRVG  134

Query  574  ITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGV  395
            ITAGLC+LI+H  EK GDR+EA YSFYFGDYGH++VQG YLTYEDT+LAVTGGSGIFEG 
Sbjct  135  ITAGLCVLIQHVPEKSGDRFEASYSFYFGDYGHLSVQGPYLTYEDTFLAVTGGSGIFEGA  194

Query  394  SGQVKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGN  218
             GQVKLQQL++P KLFYTFYLKGI  DLP EL G  V PS  V+ SP AKA EPG+TI N
Sbjct  195  YGQVKLQQLVYPTKLFYTFYLKGIANDLPLELTGTAVTPSKDVKSSPEAKATEPGATISN  254

Query  217  FTD  209
            FT+
Sbjct  255  FTN  257



>gb|ACG39242.1| allene oxide cyclase 4 [Zea mays]
Length=238

 Score =   242 bits (618),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 148/174 (85%), Gaps = 1/174 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  551
            KVQEL VYE+NERDR SPAYLRLS K   N LGDLVPF+NK+Y G L KR+GITAG+C+L
Sbjct  65   KVQELYVYEMNERDRESPAYLRLSAKQTENALGDLVPFTNKVYNGSLDKRLGITAGICVL  124

Query  550  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQ  371
            I+H  ++ GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLAVTGGSG+FEG  GQVKL Q
Sbjct  125  IQHVPDRNGDRYEAIYSFYFGDYGHISVQGAYLTYEESYLAVTGGSGVFEGAYGQVKLHQ  184

Query  370  LIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++FPFK+FYTFYL+GIPDLP +L   PVPPSP VEP+PAA+A EP + + N+T+
Sbjct  185  IVFPFKIFYTFYLRGIPDLPRDLLCTPVPPSPTVEPTPAARAAEPHACVNNYTN  238



>ref|XP_010514199.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Camelina 
sativa]
Length=257

 Score =   243 bits (619),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 149/183 (81%), Gaps = 2/183 (1%)
 Frame = -1

Query  751  KSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNT-LGDLVPFSNKLYTGDLQKRVG  575
            KS+ +   K+QEL VYE+NE DR SPA L+L +K     LGDLVPF+NKLYTGDL+KRVG
Sbjct  75   KSELSRPNKIQELNVYELNEGDRNSPAVLKLGKKPTELCLGDLVPFTNKLYTGDLKKRVG  134

Query  574  ITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGV  395
            ITAGLC+LI+H  EK GDR+EA YSFYFGDYGH++VQG YLTYEDT+LA+TGGSGIFEG 
Sbjct  135  ITAGLCVLIQHVPEKSGDRFEASYSFYFGDYGHLSVQGPYLTYEDTFLAITGGSGIFEGA  194

Query  394  SGQVKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGN  218
             GQVKLQQL++P KLFYTFYLKGI  DLP EL G  V PS  V+PSP AKA EPG+TI N
Sbjct  195  YGQVKLQQLVYPTKLFYTFYLKGIANDLPLELTGTAVTPSKDVKPSPEAKATEPGATISN  254

Query  217  FTD  209
            FT+
Sbjct  255  FTN  257



>ref|XP_010528046.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Tarenaya 
hassleriana]
Length=249

 Score =   240 bits (612),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 147/179 (82%), Gaps = 1/179 (1%)
 Frame = -1

Query  745  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  566
            +S P  KVQEL VYE+NE DR SPA L+L +K    LGDL+PF+NKLY+GDL KRVGITA
Sbjct  72   ESTPP-KVQELHVYELNEGDRNSPAVLKLGKKQELCLGDLIPFTNKLYSGDLTKRVGITA  130

Query  565  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQ  386
            GLC+LI+H  EK GDR+EA YSFYFGDYGH++VQG YLTYEDT+LA+TGGSGIFEG  GQ
Sbjct  131  GLCVLIQHVPEKNGDRFEATYSFYFGDYGHLSVQGPYLTYEDTHLAITGGSGIFEGAYGQ  190

Query  385  VKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            VKL+QL++P KLFYTFYLKGI DLPAEL G PV PSP V+PSP A A EP  +I NFTD
Sbjct  191  VKLRQLVYPTKLFYTFYLKGIKDLPAELTGKPVEPSPDVKPSPEALAAEPSGSIRNFTD  249



>dbj|BAI58602.1| mangrin [Rhizophora mucronata]
 dbj|BAI58603.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58604.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58605.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58606.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58607.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58608.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58609.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58610.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58611.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58612.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58613.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58614.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58615.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58616.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58617.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58618.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58619.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58620.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58621.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58622.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58623.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58624.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58625.1| mangrin [Rhizophora mucronata]
 dbj|BAI58626.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58627.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58628.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58629.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58630.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58631.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58632.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58633.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58634.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58635.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58636.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58637.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58638.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58639.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58640.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58641.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58642.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58643.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58644.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58645.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58646.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58647.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58648.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58649.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58650.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58651.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58652.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58653.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58654.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58655.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58656.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58657.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58658.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58659.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58660.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58661.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58662.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58663.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58664.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58665.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58666.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58667.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58668.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58669.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58670.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58671.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58672.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58673.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58674.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58675.1| mangrin, partial [Rhizophora mucronata]
Length=142

 Score =   235 bits (599),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 130/143 (91%), Gaps = 1/143 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQEL VYEINERDR SPA LRLSQK V +LGDLVPFSNK+Y+GDLQKR+GITAG+C+ I
Sbjct  1    KVQELFVYEINERDRESPAILRLSQKPVLSLGDLVPFSNKVYSGDLQKRIGITAGICVQI  60

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            +H+ +K G+R+EAIYSFYFGDYGHIAVQG YLTYEDTYLAVTGGSGIFEGV GQVKL+QL
Sbjct  61   QHKPDK-GERFEAIYSFYFGDYGHIAVQGAYLTYEDTYLAVTGGSGIFEGVYGQVKLKQL  119

Query  367  IFPFKLFYTFYLKGIPDLPAELC  299
            ++PFKLFYTFYL+GI DLP EL 
Sbjct  120  VYPFKLFYTFYLRGIKDLPEELT  142



>ref|NP_566777.1| allene oxide cyclase 3 [Arabidopsis thaliana]
 sp|Q9LS01.1|AOC3_ARATH RecName: Full=Allene oxide cyclase 3, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA95765.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM64909.1| allene oxide cyclase, putative [Arabidopsis thaliana]
 emb|CAC83763.1| allene oxide cyclase [Arabidopsis thaliana]
 dbj|BAF01112.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE77067.1| allene oxide cyclase 3 [Arabidopsis thaliana]
Length=258

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 148/183 (81%), Gaps = 2/183 (1%)
 Frame = -1

Query  751  KSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNT-LGDLVPFSNKLYTGDLQKRVG  575
            K++++   K+QEL VYE+NE DR SPA L+L +K     LGDLVPF+NKLYTGDL+KRVG
Sbjct  76   KTENSRPSKIQELNVYELNEGDRNSPAVLKLGKKPTELCLGDLVPFTNKLYTGDLKKRVG  135

Query  574  ITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGV  395
            ITAGLC+LI+H  EK GDR+EA YSFYFGDYGH++VQGQYLTYEDT+LAVTGGSGIFEG 
Sbjct  136  ITAGLCVLIQHVPEKSGDRFEASYSFYFGDYGHLSVQGQYLTYEDTFLAVTGGSGIFEGA  195

Query  394  SGQVKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGN  218
             GQVKL+QL++P KLFYTFYLKG+  DLP EL G  V PS  V+P+P AKA EP   I N
Sbjct  196  YGQVKLRQLVYPTKLFYTFYLKGLANDLPLELTGTAVTPSKDVKPAPEAKAMEPSGVISN  255

Query  217  FTD  209
            FT+
Sbjct  256  FTN  258



>ref|XP_002875279.1| hypothetical protein ARALYDRAFT_484340 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51538.1| hypothetical protein ARALYDRAFT_484340 [Arabidopsis lyrata subsp. 
lyrata]
Length=258

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 148/183 (81%), Gaps = 2/183 (1%)
 Frame = -1

Query  751  KSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNT-LGDLVPFSNKLYTGDLQKRVG  575
            K++++   K+QEL VYE+NE DR SPA L+L +K     LGDLVPF+NKLYTGDL+KRVG
Sbjct  76   KTENSRPSKIQELNVYELNEGDRNSPAVLKLGKKPTELCLGDLVPFTNKLYTGDLKKRVG  135

Query  574  ITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGV  395
            ITAGLC+LI+H  EK GDR+EA YSFYFGDYGH++VQGQYLTYEDT+LA+TGGSGIFEG 
Sbjct  136  ITAGLCVLIQHVPEKNGDRFEANYSFYFGDYGHLSVQGQYLTYEDTFLAITGGSGIFEGA  195

Query  394  SGQVKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGN  218
             GQVKL+QL++P KLFYTFYLKG+  DLP EL G  V PS  V+P+P AKA EP   I N
Sbjct  196  YGQVKLRQLVYPTKLFYTFYLKGLANDLPLELTGTAVTPSKDVKPAPEAKATEPSGVISN  255

Query  217  FTD  209
            FT+
Sbjct  256  FTN  258



>ref|XP_010554241.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like isoform 
X1 [Tarenaya hassleriana]
Length=254

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 144/173 (83%), Gaps = 0/173 (0%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQEL VYE+NE DR SPA L+L +K    LGDLVPF+NKLY+GDL KR+GITAGLC+LI
Sbjct  82   KVQELHVYELNEGDRNSPAVLKLGKKPELCLGDLVPFTNKLYSGDLTKRLGITAGLCVLI  141

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            +H  E+ GDR+EA YSFYFGDYGH++VQG YLTYEDTYL++TGG+G+FEG  GQVKL+QL
Sbjct  142  QHVPERNGDRFEATYSFYFGDYGHLSVQGPYLTYEDTYLSITGGAGVFEGAYGQVKLRQL  201

Query  367  IFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++P KLFYTFYLKGI DLPAEL G PV PSP V+PSP A A EP  TI NFTD
Sbjct  202  VYPTKLFYTFYLKGIKDLPAELTGKPVEPSPDVKPSPEALATEPTGTIRNFTD  254



>ref|XP_010476324.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Camelina 
sativa]
Length=254

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 147/182 (81%), Gaps = 2/182 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGI  572
            ++++   KVQEL VYE NE DR SPA L+L +K     LGDLVPF+NKLYTGDL KR+GI
Sbjct  73   TENSRPTKVQELNVYEFNEGDRNSPAVLKLGKKPDQLCLGDLVPFTNKLYTGDLTKRIGI  132

Query  571  TAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVS  392
            TAGLC+LI+H  EKKGDR+EA YSFYFGDYGHI+VQG YLTYEDT+LA+TGGSG+FEG  
Sbjct  133  TAGLCVLIQHVSEKKGDRFEASYSFYFGDYGHISVQGPYLTYEDTFLAITGGSGVFEGAY  192

Query  391  GQVKLQQLIFPFKLFYTFYLKG-IPDLPAELCGapvppspavepspaAKACEPGSTIGNF  215
            GQVKL+QL++P KLFYTFYLKG + DLP EL G  V PS  V+P+  A+A +PG+TI NF
Sbjct  193  GQVKLRQLVYPTKLFYTFYLKGVVADLPVELTGKHVEPSKDVKPAAEAQATQPGATISNF  252

Query  214  TD  209
            TD
Sbjct  253  TD  254



>gb|ACG32920.1| allene oxide cyclase 4 [Zea mays]
Length=240

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 129/150 (86%), Gaps = 1/150 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFSNKLYTGDLQKRVGI  572
            ++ A   KVQEL VYEINERDR SPAYLRLS K   N LGDLVPF+NK+Y G L KR+G+
Sbjct  58   AKDARPTKVQELYVYEINERDRESPAYLRLSAKQTENALGDLVPFTNKVYNGSLDKRLGV  117

Query  571  TAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVS  392
            TAG+C+LI+H  ++ GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLAVTGGSG+FEGV 
Sbjct  118  TAGICVLIQHVPDRNGDRYEAIYSFYFGDYGHISVQGPYLTYEESYLAVTGGSGVFEGVY  177

Query  391  GQVKLQQLIFPFKLFYTFYLKGIPDLPAEL  302
            GQVKL Q++FPFK+FYTFYL+GIPDLP +L
Sbjct  178  GQVKLNQIVFPFKIFYTFYLRGIPDLPRDL  207



>ref|NP_172786.1| allene oxide cyclase 4 [Arabidopsis thaliana]
 sp|Q93ZC5.1|AOC4_ARATH RecName: Full=Allene oxide cyclase 4, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL15267.1| At1g13280/T6J4_23 [Arabidopsis thaliana]
 gb|AAM98257.1| At1g13280/T6J4_23 [Arabidopsis thaliana]
 emb|CAC83764.1| allene oxide cyclase [Arabidopsis thaliana]
 gb|AEE28994.1| allene oxide cyclase 4 [Arabidopsis thaliana]
Length=254

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 143/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGITAGLCIL  551
            K+QEL VYE NE DR SPA L+L +K     LGDLVPF+NKLYTGDL KR+GITAGLC+L
Sbjct  80   KIQELNVYEFNEGDRNSPAVLKLGKKPDQLCLGDLVPFTNKLYTGDLTKRIGITAGLCVL  139

Query  550  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQ  371
            I+H  EKKGDR+EA YSFYFGDYGHI+VQG YLTYEDT+LA+TGGSG+FEG  GQVKL+Q
Sbjct  140  IQHVPEKKGDRFEASYSFYFGDYGHISVQGPYLTYEDTFLAITGGSGVFEGAYGQVKLRQ  199

Query  370  LIFPFKLFYTFYLKGI-PDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            L++P KLFYTFYLKG+  DLP EL G  V PS  V+P+  A+A +PG+TI NFT+
Sbjct  200  LVYPTKLFYTFYLKGVAADLPVELTGKHVEPSKEVKPAAEAQATQPGATIANFTN  254



>gb|ACN27052.1| unknown [Zea mays]
 gb|AFW88170.1| hypothetical protein ZEAMMB73_091885 [Zea mays]
Length=249

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 148/185 (80%), Gaps = 12/185 (6%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFSNK-----------LYTGDLQK  584
            KVQEL VYE+NERDR SPAYLRLS K   N LGDLVPF+NK           +Y G L K
Sbjct  65   KVQELYVYEMNERDRESPAYLRLSAKQTENALGDLVPFTNKPLFLPTHPCTQVYNGSLDK  124

Query  583  RVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIF  404
            R+GITAG+C+LI+H  ++ GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLAVTGGSG+F
Sbjct  125  RLGITAGICVLIQHVPDRNGDRYEAIYSFYFGDYGHISVQGAYLTYEESYLAVTGGSGVF  184

Query  403  EGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTI  224
            EG  GQVKL Q++FPFK+FYTFYL+GIPDLP +L   PVPPSP VEP+PAA+A EP + +
Sbjct  185  EGAYGQVKLHQIVFPFKIFYTFYLRGIPDLPRDLLCTPVPPSPTVEPTPAARAAEPHACV  244

Query  223  GNFTD  209
             N+T+
Sbjct  245  NNYTN  249



>gb|AAG09557.1|AC011810_16 Unknown Protein [Arabidopsis thaliana]
Length=180

 Score =   231 bits (588),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 143/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGITAGLCIL  551
            ++QEL VYE NE DR SPA L+L +K     LGDLVPF+NKLYTGDL KR+GITAGLC+L
Sbjct  6    QIQELNVYEFNEGDRNSPAVLKLGKKPDQLCLGDLVPFTNKLYTGDLTKRIGITAGLCVL  65

Query  550  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQ  371
            I+H  EKKGDR+EA YSFYFGDYGHI+VQG YLTYEDT+LA+TGGSG+FEG  GQVKL+Q
Sbjct  66   IQHVPEKKGDRFEASYSFYFGDYGHISVQGPYLTYEDTFLAITGGSGVFEGAYGQVKLRQ  125

Query  370  LIFPFKLFYTFYLKGI-PDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            L++P KLFYTFYLKG+  DLP EL G  V PS  V+P+  A+A +PG+TI NFT+
Sbjct  126  LVYPTKLFYTFYLKGVAADLPVELTGKHVEPSKEVKPAAEAQATQPGATIANFTN  180



>emb|CAN68566.1| hypothetical protein VITISV_032173 [Vitis vinifera]
Length=244

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 142/171 (83%), Gaps = 10/171 (6%)
 Frame = -1

Query  724  VQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIK  545
            VQEL VYEINERDR SPA+L+LSQK  N+LGDL            +KR+G+TAG+C+LI+
Sbjct  83   VQELYVYEINERDRDSPAFLKLSQKPANSLGDLT----------WEKRLGVTAGICVLIQ  132

Query  544  HEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQLI  365
            H  E+KGDRYEAIYSFYFGDYGH++VQG YLTYEDTYLAVTGGSGIFEGV G+VKLQQ++
Sbjct  133  HVRERKGDRYEAIYSFYFGDYGHVSVQGPYLTYEDTYLAVTGGSGIFEGVYGEVKLQQIV  192

Query  364  FPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            FPFKLFYTFYLKGIPDLP +L G PV PSP VEPSPAAKA  P +++ NFT
Sbjct  193  FPFKLFYTFYLKGIPDLPHDLMGKPVTPSPTVEPSPAAKATLPHASVKNFT  243



>ref|XP_010458779.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Camelina 
sativa]
Length=255

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 147/182 (81%), Gaps = 2/182 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGI  572
            ++++   K+QEL VYE NE DR SPA ++L +K     LGDLVPF+NKLYTGDL KR+GI
Sbjct  74   TENSRPTKIQELNVYEFNEGDRNSPALIKLGKKPDQLCLGDLVPFTNKLYTGDLTKRIGI  133

Query  571  TAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVS  392
            TAGLC+LI+H  EKKGDR+EA YSFYFGDYGHI+VQG YLTYEDT+LA+TGGSG+FEG  
Sbjct  134  TAGLCVLIQHVPEKKGDRFEASYSFYFGDYGHISVQGPYLTYEDTFLAITGGSGVFEGAY  193

Query  391  GQVKLQQLIFPFKLFYTFYLKG-IPDLPAELCGapvppspavepspaAKACEPGSTIGNF  215
            GQVKL+QL++P KLFYTFYLKG + DLP EL G  V PS  V+P+  A+A +PG+TI NF
Sbjct  194  GQVKLRQLVYPTKLFYTFYLKGVVADLPVELTGKHVEPSKDVKPAAEAQATQPGATISNF  253

Query  214  TD  209
            TD
Sbjct  254  TD  255



>gb|AIR76995.1| allene oxide cyclase, partial [Lilium longiflorum]
Length=133

 Score =   228 bits (582),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = -1

Query  724  VQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIK  545
            VQEL VYEINE DR SPAYL+LS+K +N+LGDLVPFSNKLY G+LQKR+GITAGLCILI+
Sbjct  1    VQELSVYEINELDRSSPAYLKLSEKPINSLGDLVPFSNKLYHGNLQKRLGITAGLCILIQ  60

Query  544  HEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQLI  365
            H  EK GDRYEAIYSFYFGDYGHI+VQG YLTYE++YLAVTGGSG+FEGV G VKLQQL+
Sbjct  61   HVPEKGGDRYEAIYSFYFGDYGHISVQGSYLTYEESYLAVTGGSGVFEGVYGHVKLQQLV  120

Query  364  FPFKLFYTFYLKG  326
            FPFKLFYTFYL+G
Sbjct  121  FPFKLFYTFYLEG  133



>ref|XP_010495179.1| PREDICTED: allene oxide cyclase 4, chloroplastic [Camelina sativa]
Length=252

 Score =   233 bits (593),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 147/183 (80%), Gaps = 2/183 (1%)
 Frame = -1

Query  751  KSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVG  575
             ++++   K+QEL VYE NE DR SPA ++L +K     LGDLVPF+NKLYTGDL KR+G
Sbjct  70   NTENSRPTKIQELNVYEFNEGDRNSPALIKLGKKPDQLCLGDLVPFTNKLYTGDLTKRIG  129

Query  574  ITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGV  395
            ITAGLC+LI+H  EKKGDR+EA YSFYFGDYGHI+VQG YLTYEDT+LA+TGGSG+FEG 
Sbjct  130  ITAGLCVLIQHVPEKKGDRFEASYSFYFGDYGHISVQGPYLTYEDTFLAITGGSGVFEGA  189

Query  394  SGQVKLQQLIFPFKLFYTFYLKG-IPDLPAELCGapvppspavepspaAKACEPGSTIGN  218
             GQVKL+QL++P KLFYTFYLKG + DLP EL G  V PS  V+P+  A+A +PG+TI N
Sbjct  190  YGQVKLRQLVYPTKLFYTFYLKGVVADLPVELTGKHVEPSKDVKPAAEAQATQPGATISN  249

Query  217  FTD  209
            FT+
Sbjct  250  FTN  252



>gb|ACU24579.1| unknown [Glycine max]
Length=213

 Score =   231 bits (588),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 127/147 (86%), Gaps = 4/147 (3%)
 Frame = -1

Query  769  KRSVTVKSQSAPA---GKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYT  599
             +S T +SQ+ P+    KVQEL VYEINERDRGSPAYLRLSQK+VN+LGDLVPFSNKLY+
Sbjct  68   NKSFTCRSQAEPSSDSAKVQELSVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKLYS  127

Query  598  GDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTG  419
            G LQKRVGITAG+C+LI+++ EKKGD YEAIYSFYFGDYGHI+VQG YLTYEDTYLAVTG
Sbjct  128  GCLQKRVGITAGICVLIQNKSEKKGDMYEAIYSFYFGDYGHISVQGSYLTYEDTYLAVTG  187

Query  418  GSGIFEGVSGQVKLQQLIFPFKLFYTF  338
            GSGIFE   GQVKL Q++FP  + YTF
Sbjct  188  GSGIFERAYGQVKLHQIVFPLNI-YTF  213



>ref|XP_006291745.1| hypothetical protein CARUB_v10017913mg [Capsella rubella]
 gb|EOA24643.1| hypothetical protein CARUB_v10017913mg [Capsella rubella]
Length=248

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 146/181 (81%), Gaps = 1/181 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGIT  569
            SQ +   K+QEL VYE+NE DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGIT
Sbjct  68   SQDSRPSKIQELSVYELNELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGIT  127

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AGLC++I+H  EK GDR+EA YSFYFGDYGH+AVQG YLTYED++LA+TGGSG+FEG  G
Sbjct  128  AGLCVVIEHVPEKNGDRFEATYSFYFGDYGHLAVQGPYLTYEDSFLAITGGSGVFEGAYG  187

Query  388  QVKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            QVKLQQL++P KLFYTFYLKG+  DLPAEL G PVPP+  V+P+P AKA EP   I N+T
Sbjct  188  QVKLQQLVYPTKLFYTFYLKGLANDLPAELTGTPVPPTKDVKPAPEAKALEPSGVISNYT  247

Query  211  D  209
            +
Sbjct  248  N  248



>ref|XP_010502458.1| PREDICTED: allene oxide cyclase 3, chloroplastic isoform X1 [Camelina 
sativa]
Length=263

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 144/189 (76%), Gaps = 8/189 (4%)
 Frame = -1

Query  751  KSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDL-------VPFSNKLYTGD  593
            K++ +   K+QEL VYE+NE DR SPA L+L +K               VPF+NKLYTGD
Sbjct  75   KTELSRPSKIQELNVYELNEGDRNSPAVLKLGKKPTELCLGDLLCLGDLVPFTNKLYTGD  134

Query  592  LQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGS  413
            L+KRVGITAGLC+LI+H  EK GDR+EA YSFYFGDYGH++VQG YLTYEDT+LAVTGGS
Sbjct  135  LKKRVGITAGLCVLIQHVPEKSGDRFEASYSFYFGDYGHLSVQGPYLTYEDTFLAVTGGS  194

Query  412  GIFEGVSGQVKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEP  236
            GIFEG  GQVKLQQL++P KLFYTFYLKGI  DLP EL G  V PS  V+ SP AKA EP
Sbjct  195  GIFEGAYGQVKLQQLVYPTKLFYTFYLKGIANDLPLELTGTAVTPSKDVKSSPEAKATEP  254

Query  235  GSTIGNFTD  209
            G+TI NFT+
Sbjct  255  GATISNFTN  263



>ref|XP_006304140.1| hypothetical protein CARUB_v10010123mg [Capsella rubella]
 gb|EOA37038.1| hypothetical protein CARUB_v10010123mg [Capsella rubella]
Length=245

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 142/175 (81%), Gaps = 2/175 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGITAGLCIL  551
            K+QEL VYE NE DR SP  L+L +K     LGDLVPF+NKLYTGDL KR+GITAGLC+L
Sbjct  71   KIQELNVYEFNEGDRNSPTVLKLGKKPDQLCLGDLVPFTNKLYTGDLTKRIGITAGLCVL  130

Query  550  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQ  371
            I+H  EKKGDR+EA YSFYFGDYGHI+VQG YLTYEDT+LA+TGGSG+FEG  GQVKL+Q
Sbjct  131  IQHVPEKKGDRFEASYSFYFGDYGHISVQGPYLTYEDTFLAITGGSGVFEGAYGQVKLRQ  190

Query  370  LIFPFKLFYTFYLKG-IPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            L++P KLFYTFYLKG + DLP EL G  V PS  V+P+  A+A +PG+TI NFT+
Sbjct  191  LVYPTKLFYTFYLKGVVADLPVELTGKHVEPSKDVKPAAEAQATQPGATIANFTN  245



>ref|XP_010692623.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=248

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 150/190 (79%), Gaps = 3/190 (2%)
 Frame = -1

Query  769  KRSVTVKSQ--SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTG  596
             RS T ++   S+   K+ E CVYEINERDR SPA L+LSQK V +LGDL+PF+NKLYT 
Sbjct  59   NRSFTCRTSADSSENVKIHEFCVYEINERDRASPAVLKLSQKPVFSLGDLIPFTNKLYTA  118

Query  595  DLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGG  416
            DL+ R+GI+AG+CILI+++ EKKGDRYEA +S YFGDYGHI++QG YLTY+++YLA+TGG
Sbjct  119  DLKTRLGISAGICILIQNKPEKKGDRYEANFSLYFGDYGHISIQGPYLTYDESYLAITGG  178

Query  415  SGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACE  239
            SGIFEG  GQVKLQQ+++PFK+FYTFYLKGI  DLP  L   PV P P VEP P AKA  
Sbjct  179  SGIFEGAYGQVKLQQIVYPFKIFYTFYLKGIKGDLPELLLCKPVEPHPDVEPHPDAKATL  238

Query  238  PGSTIGNFTD  209
            P + I NFTD
Sbjct  239  PEAVIPNFTD  248



>ref|XP_010514196.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=248

 Score =   230 bits (587),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 143/181 (79%), Gaps = 1/181 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGIT  569
            SQ A   KVQEL VYE+NE DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGIT
Sbjct  68   SQDARPSKVQELSVYELNELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGIT  127

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AGLC++I+H  EK GDR+EA YSFYFGDYGH+AVQG YLTYED++LA+TGGSGIFEG  G
Sbjct  128  AGLCVVIEHVPEKNGDRFEATYSFYFGDYGHLAVQGPYLTYEDSFLAITGGSGIFEGAYG  187

Query  388  QVKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            QVKLQQL++P KLFY+FYLKG+  DLP EL G PVPPS  V P+  AKA EP   I N+T
Sbjct  188  QVKLQQLVYPTKLFYSFYLKGLANDLPEELTGTPVPPSKDVMPAAEAKALEPTGVISNYT  247

Query  211  D  209
            +
Sbjct  248  N  248



>ref|XP_008370524.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Malus 
domestica]
Length=258

 Score =   230 bits (586),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 149/196 (76%), Gaps = 11/196 (6%)
 Frame = -1

Query  763  SVTVKSQSAPAGKV---------QELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSN  611
            S T K+Q++P+            Q L VYE+NE DRGSPAYL LS K V++LGD+V F N
Sbjct  63   SFTCKTQASPSADTDQRPASEVPQVLHVYELNELDRGSPAYLXLSGKEVHSLGDVVXFXN  122

Query  610  KLYTGDLQKRVGITAGLCILIKHEEEK--KGDRYEAIYSFYFGDYGHIAVQGQYLTYEDT  437
            KLYTGDLQKR GIT G+ +LI+H  EK   GDRYE IYSF FGDYGHI+VQG YLTYED+
Sbjct  123  KLYTGDLQKRXGITTGITLLIQHYPEKINSGDRYEGIYSFNFGDYGHISVQGAYLTYEDS  182

Query  436  YLAVTGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepsp  257
            YLAVTGGSGIF GV GQVKLQQL++PFK+FYTFYLKGI +LP EL G  V P+P VE SP
Sbjct  183  YLAVTGGSGIFXGVYGQVKLQQLVYPFKIFYTFYLKGIKNLPEELLGKHVEPNPXVEGSP  242

Query  256  aAKACEPGSTIGNFTD  209
            AAKA EP +TI  FT+
Sbjct  243  AAKALEPHATIAGFTN  258



>gb|KFK43593.1| hypothetical protein AALP_AA1G146300 [Arabis alpina]
Length=253

 Score =   229 bits (585),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 140/175 (80%), Gaps = 2/175 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGITAGLCIL  551
            K+QEL VYE NE DR SPA L+L +      LGD VPF+NKLYTGDL KRVGITAGLC+L
Sbjct  79   KIQELNVYEFNEGDRNSPAVLKLGKNPTQLCLGDFVPFTNKLYTGDLTKRVGITAGLCVL  138

Query  550  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQ  371
            I+H  EKKGDR+EA YSFYFGDYGHI+VQG YLTYEDT+LA+TGGSG+FEG  GQVKL+Q
Sbjct  139  IQHVPEKKGDRFEASYSFYFGDYGHISVQGPYLTYEDTFLAITGGSGVFEGAYGQVKLRQ  198

Query  370  LIFPFKLFYTFYLKG-IPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            L++P KLFYTFYLKG + DLP EL G  V PS  V+P+P A+A  PG TI NFTD
Sbjct  199  LVYPTKLFYTFYLKGVVSDLPVELTGKHVEPSKDVKPAPEAQATLPGGTIPNFTD  253



>ref|XP_010692616.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=249

 Score =   229 bits (585),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 143/174 (82%), Gaps = 1/174 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            K+ E CVYEINERDR SPA L+LSQK V +LGDL+PF+NKLYT DL+ R+GI+AG+CILI
Sbjct  76   KIHEFCVYEINERDRASPAVLKLSQKPVFSLGDLIPFTNKLYTADLKTRLGISAGICILI  135

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            +++ EKKGDRYEA +S YFGDYGHI++QG YLTY+++YLA+TGGSGIFEG  GQVKLQQ+
Sbjct  136  QNKPEKKGDRYEANFSLYFGDYGHISIQGPYLTYDESYLAITGGSGIFEGAYGQVKLQQI  195

Query  367  IFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++PFK+FYTFYLKGI  DLP  L   PV P P VEP P AKA  P + I NFTD
Sbjct  196  VYPFKIFYTFYLKGIKGDLPELLLCKPVEPHPDVEPHPDAKATLPEAVIPNFTD  249



>ref|XP_010514195.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=248

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 143/181 (79%), Gaps = 1/181 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGIT  569
            SQ A   +VQEL VYE+NE DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGIT
Sbjct  68   SQDARPSRVQELSVYELNELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGIT  127

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AGLC++I+H  EK GDR+EA YSFYFGDYGH+AVQG YLTYED++LA+TGGSGIFEG  G
Sbjct  128  AGLCVVIEHVPEKNGDRFEATYSFYFGDYGHLAVQGPYLTYEDSFLAITGGSGIFEGAYG  187

Query  388  QVKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            QVKLQQL++P KLFY+FYLKG+  DLP EL G PVPPS  V P+  AKA EP   I N+T
Sbjct  188  QVKLQQLVYPTKLFYSFYLKGLANDLPEELTGTPVPPSKDVMPAAEAKALEPTGVISNYT  247

Query  211  D  209
            +
Sbjct  248  N  248



>ref|XP_010425227.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Camelina 
sativa]
Length=249

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGIT  569
            SQ +   KVQEL VYE+NE DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGIT
Sbjct  69   SQDSRPSKVQELSVYELNELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGIT  128

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AGLC++I+H  E+ GDR+EA YSFYFGDYGH+AVQG YLTYED++LA+TGGSGIFEG  G
Sbjct  129  AGLCVVIEHVPERNGDRFEATYSFYFGDYGHLAVQGPYLTYEDSFLAITGGSGIFEGAYG  188

Query  388  QVKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            QVKLQQL++P KLFYTFYLKG+  DLP EL G PVPPS  V+P+  AKA EP   I N+T
Sbjct  189  QVKLQQLVYPTKLFYTFYLKGLANDLPEELTGTPVPPSKDVKPAAEAKALEPSGVISNYT  248



>ref|XP_002889998.1| hypothetical protein ARALYDRAFT_334627 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66257.1| hypothetical protein ARALYDRAFT_334627 [Arabidopsis lyrata subsp. 
lyrata]
Length=252

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 141/175 (81%), Gaps = 2/175 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGITAGLCIL  551
            K+QEL VYE NE DR SPA L+L +K     LGDLVPF+NKLYTGDL KR+GITAGLC+L
Sbjct  78   KIQELNVYEFNEGDRNSPAVLKLGKKPDQLCLGDLVPFTNKLYTGDLTKRIGITAGLCVL  137

Query  550  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQ  371
            I+H  +  GDR+EA YSFYFGDYGHI+VQG YLTYEDT+LA+TGGSG+FEG  GQVKL+Q
Sbjct  138  IQHVPKMNGDRFEASYSFYFGDYGHISVQGPYLTYEDTFLAITGGSGVFEGAYGQVKLRQ  197

Query  370  LIFPFKLFYTFYLKG-IPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            L++P KLFYTFYLKG + DLP EL G  V PS  V+P+  A+A +PG+TI NFT+
Sbjct  198  LVYPTKLFYTFYLKGVVADLPVELTGKHVEPSKDVKPAAEAQATQPGATIANFTN  252



>gb|EYU29946.1| hypothetical protein MIMGU_mgv1a012460mg [Erythranthe guttata]
Length=250

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 149/181 (82%), Gaps = 1/181 (1%)
 Frame = -1

Query  751  KSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGI  572
            K  S P+ KVQE+CVYEINE+DRGSP YL+LS K  N+LGDL PF+NKLY+G+LQKR+GI
Sbjct  71   KEYSRPS-KVQEMCVYEINEQDRGSPVYLKLSPKKENSLGDLGPFTNKLYSGNLQKRLGI  129

Query  571  TAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVS  392
            TAGLC+LI+H  E   DR+EAIYS YFGDYGHI++QG Y+ ++DT LAVTGGSG+FEGV 
Sbjct  130  TAGLCVLIQHSPETGNDRFEAIYSMYFGDYGHISIQGAYVLHQDTILAVTGGSGVFEGVY  189

Query  391  GQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            G VKLQQ+  PFK FYTFYLKGI DLPAEL G PVPP+ AVEPS AAKA EP + + NFT
Sbjct  190  GTVKLQQISLPFKFFYTFYLKGIEDLPAELMGKPVPPTAAVEPSAAAKAAEPHAAVCNFT  249

Query  211  D  209
            D
Sbjct  250  D  250



>pdb|4H6B|A Chain A, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|D Chain D, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|C Chain C, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|B Chain B, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|E Chain E, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|F Chain F, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|G Chain G, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|H Chain H, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|I Chain I, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|J Chain J, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|K Chain K, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|L Chain L, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6C|A Chain A, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|D Chain D, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|C Chain C, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|B Chain B, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|E Chain E, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|F Chain F, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|G Chain G, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|H Chain H, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|I Chain I, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|J Chain J, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|K Chain K, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|L Chain L, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
Length=195

 Score =   226 bits (576),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 140/189 (74%), Gaps = 7/189 (4%)
 Frame = -1

Query  757  TVKSQSAPAGKVQELCVYEINERDRGSPAYLRLSQK-------SVNTLGDLVPFSNKLYT  599
            ++ ++ A  G VQEL VYEINERDRGSP +L    K        VN+LGDLVPFSNK+Y 
Sbjct  6    SMAARGASPGHVQELFVYEINERDRGSPVFLPFGGKKQPGTDAHVNSLGDLVPFSNKIYD  65

Query  598  GDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTG  419
            G L+ R+GITAGLC LI H ++K GDRYEA+YSFYFGDYGHI+VQG Y+TYED+YLA+TG
Sbjct  66   GSLKTRLGITAGLCTLISHSDQKNGDRYEALYSFYFGDYGHISVQGPYITYEDSYLAITG  125

Query  418  GSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACE  239
            GSGIF G  GQ KL Q+IFPFKLFYTFYL+GI  LP  LC   VPPSP+V P+  AK C 
Sbjct  126  GSGIFAGCYGQAKLHQIIFPFKLFYTFYLQGIKKLPEALCAPCVPPSPSVAPADEAKQCL  185

Query  238  PGSTIGNFT  212
            P     NFT
Sbjct  186  PNHVAPNFT  194



>ref|XP_010425230.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like, partial 
[Camelina sativa]
Length=250

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 141/175 (81%), Gaps = 2/175 (1%)
 Frame = -1

Query  751  KSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNT-LGDLVPFSNKLYTGDLQKRVG  575
            K++     K+QEL V+E+NE DR SPA L+L +K     LGDLVPF+NKLYTGDL+KRVG
Sbjct  76   KTEIPRPSKIQELNVHELNEGDRNSPAVLKLGKKPTELCLGDLVPFTNKLYTGDLKKRVG  135

Query  574  ITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGV  395
            ITAGLC+LI+H  EK GDR+EA YSFYFGDYGH++VQG YLTYEDT+LAVTGGSGIFEG 
Sbjct  136  ITAGLCVLIQHVPEKSGDRFEASYSFYFGDYGHLSVQGPYLTYEDTFLAVTGGSGIFEGA  195

Query  394  SGQVKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPG  233
             GQVKLQQL++P KLFYTFYLKGI  DLP EL G  V PS  V+PSP AKA EPG
Sbjct  196  YGQVKLQQLVYPTKLFYTFYLKGIANDLPLELTGTAVTPSKDVKPSPEAKATEPG  250



>ref|XP_001783824.1| predicted protein [Physcomitrella patens]
 emb|CAD48752.1| allene oxide cyclase [Physcomitrella patens]
 gb|AAN39877.1| allene oxide cyclase [Physcomitrella patens]
 gb|EDQ51364.1| predicted protein [Physcomitrella patens]
Length=189

 Score =   226 bits (575),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 139/188 (74%), Gaps = 7/188 (4%)
 Frame = -1

Query  754  VKSQSAPAGKVQELCVYEINERDRGSPAYLRLSQK-------SVNTLGDLVPFSNKLYTG  596
            + ++ A  G VQEL VYEINERDRGSP +L    K        VN+LGDLVPFSNK+Y G
Sbjct  1    MAARGASPGHVQELFVYEINERDRGSPVFLPFGGKKQPGTDAHVNSLGDLVPFSNKIYDG  60

Query  595  DLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGG  416
             L+ R+GITAGLC LI H ++K GDRYEA+YSFYFGDYGHI+VQG Y+TYED+YLA+TGG
Sbjct  61   SLKTRLGITAGLCTLISHSDQKNGDRYEALYSFYFGDYGHISVQGPYITYEDSYLAITGG  120

Query  415  SGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEP  236
            SGIF G  GQ KL Q+IFPFKLFYTFYL+GI  LP  LC   VPPSP+V P+  AK C P
Sbjct  121  SGIFAGCYGQAKLHQIIFPFKLFYTFYLQGIKKLPEALCAPCVPPSPSVAPADEAKQCLP  180

Query  235  GSTIGNFT  212
                 NFT
Sbjct  181  NHVAPNFT  188



>ref|XP_010502446.1| PREDICTED: allene oxide cyclase 2, chloroplastic [Camelina sativa]
Length=248

 Score =   228 bits (580),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = -1

Query  745  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  566
            +++   KVQEL VYE+NE DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGITA
Sbjct  69   ENSRKSKVQELSVYELNELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITA  128

Query  565  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQ  386
            GLC++I+H  EK GDR+EA YSFYFGDYGH++VQG YLTYED++LA+TGG+G+FEG  GQ
Sbjct  129  GLCVVIEHVPEKNGDRFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGTGVFEGAYGQ  188

Query  385  VKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            VKLQQL++P KLFYTFYLKG+  DLP EL G PV PS  V+P+  AKA EP   I N+TD
Sbjct  189  VKLQQLVYPTKLFYTFYLKGLANDLPEELTGTPVTPSKDVKPASEAKALEPSGVISNYTD  248



>ref|XP_006291721.1| hypothetical protein CARUB_v10017888mg [Capsella rubella]
 gb|EOA24619.1| hypothetical protein CARUB_v10017888mg [Capsella rubella]
Length=254

 Score =   227 bits (579),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 144/180 (80%), Gaps = 1/180 (1%)
 Frame = -1

Query  745  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  566
            +++   KVQEL VYE+NE DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGITA
Sbjct  75   ENSRPSKVQELSVYELNELDRHSPKILKNAMSLMFGLGDLVPFTNKLYTGDLKKRVGITA  134

Query  565  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQ  386
            GLC++I+H  EK GDR+EA YSFYFGDYGH++VQG YLTYED++LA+TGG+GIFEG  GQ
Sbjct  135  GLCVVIEHVPEKNGDRFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGTGIFEGAYGQ  194

Query  385  VKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            VKLQQL++P KLFYTFYLKG+  DLP EL G PV PS  V+P+P AKA +P   I NFT+
Sbjct  195  VKLQQLVYPTKLFYTFYLKGLANDLPEELTGTPVTPSKDVKPAPEAKALKPSGVISNFTN  254



>pdb|2GIN|A Chain A, X-Ray Structure Of The Wt Allene Oxide Cyclase 2 From 
Arabidopsis Thaliana
 pdb|2GIN|B Chain B, X-Ray Structure Of The Wt Allene Oxide Cyclase 2 From 
Arabidopsis Thaliana
 pdb|2GIN|C Chain C, X-Ray Structure Of The Wt Allene Oxide Cyclase 2 From 
Arabidopsis Thaliana
 pdb|2GIN|D Chain D, X-Ray Structure Of The Wt Allene Oxide Cyclase 2 From 
Arabidopsis Thaliana
 pdb|2GIN|E Chain E, X-Ray Structure Of The Wt Allene Oxide Cyclase 2 From 
Arabidopsis Thaliana
 pdb|2GIN|F Chain F, X-Ray Structure Of The Wt Allene Oxide Cyclase 2 From 
Arabidopsis Thaliana
Length=188

 Score =   224 bits (570),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 143/174 (82%), Gaps = 1/174 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQEL VYEINE DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  15   KVQELSVYEINELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  74

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            +H  EKKG+R+EA YSFYFGDYGH++VQG YLTYED++LA+TGG+GIFEG  GQVKLQQL
Sbjct  75   EHVPEKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGAGIFEGAYGQVKLQQL  134

Query  367  IFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++P KLFYTFYLKG+  DLP EL G PVPPS  +EP+P AKA EP   I N+T+
Sbjct  135  VYPTKLFYTFYLKGLANDLPLELTGTPVPPSKDIEPAPEAKALEPSGVISNYTN  188



>ref|NP_566776.1| allene oxide cyclase 2 [Arabidopsis thaliana]
 sp|Q9LS02.1|AOC2_ARATH RecName: Full=Allene oxide cyclase 2, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK55711.1|AF380630_1 AT3g25770/K13N2_9 [Arabidopsis thaliana]
 dbj|BAA95764.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL06792.1| AT3g25770/K13N2_9 [Arabidopsis thaliana]
 emb|CAC83762.1| allene oxide cyclase [Arabidopsis thaliana]
 gb|AEE77066.1| allene oxide cyclase 2 [Arabidopsis thaliana]
Length=253

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 143/174 (82%), Gaps = 1/174 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQEL VYEINE DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  80   KVQELSVYEINELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  139

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            +H  EKKG+R+EA YSFYFGDYGH++VQG YLTYED++LA+TGG+GIFEG  GQVKLQQL
Sbjct  140  EHVPEKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGAGIFEGAYGQVKLQQL  199

Query  367  IFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++P KLFYTFYLKG+  DLP EL G PVPPS  +EP+P AKA EP   I N+T+
Sbjct  200  VYPTKLFYTFYLKGLANDLPLELTGTPVPPSKDIEPAPEAKALEPSGVISNYTN  253



>ref|XP_002875278.1| hypothetical protein ARALYDRAFT_484339 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51537.1| hypothetical protein ARALYDRAFT_484339 [Arabidopsis lyrata subsp. 
lyrata]
Length=254

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 142/174 (82%), Gaps = 1/174 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQEL VYEINE DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  81   KVQELSVYEINELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  140

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            +H  EK GDR+EA YSFYFGDYGH++VQG YLTYED++LA+TGG+GIFEG  GQVKLQQL
Sbjct  141  EHVPEKNGDRFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGAGIFEGAYGQVKLQQL  200

Query  367  IFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++P KLFYTFYLKG+  DLP EL G PVPPS  VEP+P AKA EP   I N+T+
Sbjct  201  VYPTKLFYTFYLKGLANDLPLELTGTPVPPSKDVEPAPEAKALEPSGVISNYTN  254



>ref|XP_010502447.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Camelina 
sativa]
Length=248

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 143/181 (79%), Gaps = 1/181 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGIT  569
            SQ +   KVQEL VYE+NE DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGIT
Sbjct  68   SQDSRPSKVQELSVYELNELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGIT  127

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AGLC++I+H  EK GDR+EA YSFYFGDYGH+AVQG YLTYED++LA+TGGSGIFEG  G
Sbjct  128  AGLCVVIEHVPEKNGDRFEATYSFYFGDYGHLAVQGPYLTYEDSFLAITGGSGIFEGAYG  187

Query  388  QVKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            QVKLQQL++P KLFYTF+LKG+  DLP EL G PVPPS  V+P+  AKA E    I N+T
Sbjct  188  QVKLQQLVYPTKLFYTFHLKGLANDLPKELTGTPVPPSKDVKPAAEAKALETSGVISNYT  247

Query  211  D  209
            +
Sbjct  248  N  248



>pdb|4CQ6|A Chain A, The Crystal Structure Of The Allene Oxide Cyclase 2 
From Arabidopsis Thaliana With Bound Inhibitor - Vernolic Acid
 pdb|4CQ6|B Chain B, The Crystal Structure Of The Allene Oxide Cyclase 2 
From Arabidopsis Thaliana With Bound Inhibitor - Vernolic Acid
 pdb|4CQ6|C Chain C, The Crystal Structure Of The Allene Oxide Cyclase 2 
From Arabidopsis Thaliana With Bound Inhibitor - Vernolic Acid
 pdb|4CQ7|A Chain A, The Crystal Structure Of The Allene Oxide Cyclase 2 
From Arabidopsis Thaliana With Bound Product - Opda
 pdb|4CQ7|B Chain B, The Crystal Structure Of The Allene Oxide Cyclase 2 
From Arabidopsis Thaliana With Bound Product - Opda
 pdb|4CQ7|C Chain C, The Crystal Structure Of The Allene Oxide Cyclase 2 
From Arabidopsis Thaliana With Bound Product - Opda
Length=188

 Score =   223 bits (569),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 143/174 (82%), Gaps = 1/174 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQEL VYEINE DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  15   KVQELSVYEINELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  74

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            +H  EKKG+R+EA YSFYFGDYGH++VQG YLTYED++LA+TGG+GIFEG  GQVKLQQL
Sbjct  75   EHVPEKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGAGIFEGAYGQVKLQQL  134

Query  367  IFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++P KLFYTFYLKG+  DLP EL G PVPPS  +EP+P AKA EP   I N+T+
Sbjct  135  VYPTKLFYTFYLKGLANDLPLELTGTPVPPSKDIEPAPEAKALEPSGVISNYTN  188



>pdb|1Z8K|A Chain A, X-ray Structure Of Allene Oxide Cyclase From Arabidopsis 
Thaliana At3g25770
 pdb|1Z8K|B Chain B, X-ray Structure Of Allene Oxide Cyclase From Arabidopsis 
Thaliana At3g25770
 pdb|1Z8K|C Chain C, X-ray Structure Of Allene Oxide Cyclase From Arabidopsis 
Thaliana At3g25770
 pdb|2Q4I|A Chain A, Ensemble Refinement Of The Protein Crystal Structure 
Of Allene Oxide Cyclase From Arabidopsis Thaliana At3g25770
 pdb|2Q4I|B Chain B, Ensemble Refinement Of The Protein Crystal Structure 
Of Allene Oxide Cyclase From Arabidopsis Thaliana At3g25770
 pdb|2Q4I|C Chain C, Ensemble Refinement Of The Protein Crystal Structure 
Of Allene Oxide Cyclase From Arabidopsis Thaliana At3g25770
Length=193

 Score =   223 bits (568),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 142/174 (82%), Gaps = 1/174 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQEL VYEINE DR SP  L+ +      LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  20   KVQELSVYEINELDRHSPKILKNAFSLXFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  79

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            +H  EKKG+R+EA YSFYFGDYGH++VQG YLTYED++LA+TGG+GIFEG  GQVKLQQL
Sbjct  80   EHVPEKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGAGIFEGAYGQVKLQQL  139

Query  367  IFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++P KLFYTFYLKG+  DLP EL G PVPPS  +EP+P AKA EP   I N+T+
Sbjct  140  VYPTKLFYTFYLKGLANDLPLELTGTPVPPSKDIEPAPEAKALEPSGVISNYTN  193



>emb|CDX83551.1| BnaC07g22910D [Brassica napus]
Length=247

 Score =   224 bits (572),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 145/180 (81%), Gaps = 1/180 (1%)
 Frame = -1

Query  745  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  566
            +++   ++QEL VYE+NE DR SP  L+ +      LGDLVPF+NKLYTGDL+KRVGITA
Sbjct  68   ENSRPSRIQELSVYELNELDRHSPKILKNAISLTFGLGDLVPFTNKLYTGDLKKRVGITA  127

Query  565  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQ  386
            GLC++I H  EKKGDR+EA YSFYFGDYGH++VQG YLTYED++LA+TGG+GIFEG  GQ
Sbjct  128  GLCVVIAHVPEKKGDRFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGTGIFEGAYGQ  187

Query  385  VKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            VKLQQL++P KLFYTFYLKG+  DLPAEL G PVPPS  V+P+P +KA EP   I ++T+
Sbjct  188  VKLQQLVYPTKLFYTFYLKGLAGDLPAELTGTPVPPSKDVKPAPESKALEPSGVISHYTN  247



>pdb|2DIO|A Chain A, Crystal Structure Of The Allene Oxide Cyclase 2 With 
Bound Inhibitor Vernolic Acid
 pdb|2DIO|B Chain B, Crystal Structure Of The Allene Oxide Cyclase 2 With 
Bound Inhibitor Vernolic Acid
 pdb|2DIO|C Chain C, Crystal Structure Of The Allene Oxide Cyclase 2 With 
Bound Inhibitor Vernolic Acid
Length=188

 Score =   223 bits (567),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 142/174 (82%), Gaps = 1/174 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQEL VYEINE DR SP  L+ +      LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  15   KVQELSVYEINELDRHSPKILKNAFSLXFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  74

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            +H  EKKG+R+EA YSFYFGDYGH++VQG YLTYED++LA+TGG+GIFEG  GQVKLQQL
Sbjct  75   EHVPEKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGAGIFEGAYGQVKLQQL  134

Query  367  IFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++P KLFYTFYLKG+  DLP EL G PVPPS  +EP+P AKA EP   I N+T+
Sbjct  135  VYPTKLFYTFYLKGLANDLPLELTGTPVPPSKDIEPAPEAKALEPSGVISNYTN  188



>emb|CDX83550.1| BnaC07g22900D [Brassica napus]
Length=252

 Score =   224 bits (572),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = -1

Query  745  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  566
            +++   ++QEL VYE+NE DR SP  L+ +      LGDLVPF+NKLYTGDL+KRVGITA
Sbjct  73   ENSRPSRIQELSVYELNELDRHSPKILKNAACLTFGLGDLVPFTNKLYTGDLKKRVGITA  132

Query  565  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQ  386
            GLC++I H  EKKGDR+EA YSFYFGDYGH++VQG YLTYED++LA+TGG+GIFEG  GQ
Sbjct  133  GLCVVIAHVPEKKGDRFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGTGIFEGAYGQ  192

Query  385  VKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            VKLQQL++P KLFYTFYLKG+  DLPAEL G PV PS  V+P+P AK  EP   I NFT+
Sbjct  193  VKLQQLVYPTKLFYTFYLKGLAGDLPAELTGTPVSPSKDVKPAPEAKTLEPSGVICNFTN  252



>pdb|2BRJ|A Chain A, X-Ray Structure Of The Allene Oxide Cyclase From Arabidopsis 
Thaliana
 pdb|2BRJ|B Chain B, X-Ray Structure Of The Allene Oxide Cyclase From Arabidopsis 
Thaliana
 pdb|2BRJ|C Chain C, X-Ray Structure Of The Allene Oxide Cyclase From Arabidopsis 
Thaliana
Length=188

 Score =   222 bits (566),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 142/174 (82%), Gaps = 1/174 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQEL VYEINE DR SP  L+ +      LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  15   KVQELSVYEINELDRHSPKILKNAFSLXFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  74

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            +H  EKKG+R+EA YSFYFGDYGH++VQG YLTYED++LA+TGG+GIFEG  GQVKLQQL
Sbjct  75   EHVPEKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGAGIFEGAYGQVKLQQL  134

Query  367  IFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++P KLFYTFYLKG+  DLP EL G PVPPS  +EP+P AKA EP   I N+T+
Sbjct  135  VYPTKLFYTFYLKGLANDLPLELTGTPVPPSKDIEPAPEAKALEPSGVISNYTN  188



>ref|XP_010425226.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Camelina 
sativa]
Length=243

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 141/181 (78%), Gaps = 1/181 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGIT  569
            SQ +   K+ +L VYE+NE DR  P  L+ +   +  LGDLVPF+NKLYTGDL+KRVGIT
Sbjct  63   SQDSRPSKLSKLSVYELNELDRHRPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGIT  122

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AGLC++I+H  EK GDR+EA YSFYFGDYGH+AVQG YLTYED++LA+TGGSGIFEG  G
Sbjct  123  AGLCVVIEHVPEKNGDRFEATYSFYFGDYGHLAVQGPYLTYEDSFLAITGGSGIFEGAYG  182

Query  388  QVKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            QVKLQQL++P KLFYTFYLKG+  DLP EL G PV PS  V+P+  AKA EP   I N+T
Sbjct  183  QVKLQQLVYPTKLFYTFYLKGLANDLPEELTGTPVTPSKDVKPASEAKALEPSGVISNYT  242

Query  211  D  209
            +
Sbjct  243  N  243



>ref|XP_006395628.1| hypothetical protein EUTSA_v10004824mg [Eutrema salsugineum]
 gb|ESQ32914.1| hypothetical protein EUTSA_v10004824mg [Eutrema salsugineum]
Length=249

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 139/173 (80%), Gaps = 1/173 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQEL VYE+NE DR SP  L+ +      LGDLVPF+NKLYTGDL+K VGITAGLC++I
Sbjct  76   KVQELNVYELNELDRDSPKILKNAMSLTFGLGDLVPFTNKLYTGDLKKCVGITAGLCVVI  135

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            +H  EK GDRYEA YSFYFG+YGH++VQG YLTYED++LA+TGG+GIFEG  GQVKLQQL
Sbjct  136  EHVPEKNGDRYEATYSFYFGEYGHLSVQGPYLTYEDSFLAITGGTGIFEGAYGQVKLQQL  195

Query  367  IFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            +FP KLFYTFYLKGI  DLPAEL G PVPPS  V+P+  AK+ EP   I +FT
Sbjct  196  VFPTKLFYTFYLKGIAGDLPAELTGTPVPPSKDVKPAAEAKSLEPNGVISSFT  248



>emb|CDY59869.1| BnaC09g52570D [Brassica napus]
Length=253

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 140/175 (80%), Gaps = 1/175 (1%)
 Frame = -1

Query  730  GKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  551
             KVQEL VYEINE DR SP  L+        LGDLVPF+NKLYT DL+KRVGITAGLC++
Sbjct  79   SKVQELNVYEINELDRHSPKILKNVMSLKFRLGDLVPFTNKLYTADLKKRVGITAGLCVV  138

Query  550  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQ  371
            I+H  EKKGDR+EA YSFYFGDYGH++VQG YLTYE+++LA+TGG+GIFEG  GQVKLQQ
Sbjct  139  IQHVPEKKGDRFEATYSFYFGDYGHLSVQGPYLTYEESFLAITGGTGIFEGAYGQVKLQQ  198

Query  370  LIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            L++P KLFYTFYLKG+  DLP EL G PVPPS  V+P+P AKA +P   I NFT+
Sbjct  199  LVYPTKLFYTFYLKGLACDLPVELTGTPVPPSKDVKPAPEAKALKPSGIISNFTN  253



>ref|XP_009114115.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Brassica 
rapa]
 emb|CDY04177.1| BnaA09g19550D [Brassica napus]
Length=253

 Score =   223 bits (568),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 140/175 (80%), Gaps = 1/175 (1%)
 Frame = -1

Query  730  GKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  551
             KVQEL VYEINE DR SP  L+        LGDLVPF+NKLYT DL+KRVGITAGLC++
Sbjct  79   SKVQELNVYEINELDRHSPKILKNVMSLKFRLGDLVPFTNKLYTADLKKRVGITAGLCVV  138

Query  550  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQ  371
            I+H  EKKGDR+EA YSFYFGDYGH++VQG YLTYE+++LA+TGG+GIFEG  GQVKLQQ
Sbjct  139  IQHVPEKKGDRFEATYSFYFGDYGHLSVQGPYLTYEESFLAITGGTGIFEGAYGQVKLQQ  198

Query  370  LIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            L++P KLFYTFYLKG+  DLP EL G PVPPS  V+P+P AKA +P   I NFT+
Sbjct  199  LVYPTKLFYTFYLKGLACDLPVELTGTPVPPSKDVKPAPEAKALKPSGIISNFTN  253



>emb|CDY13582.1| BnaA06g33410D [Brassica napus]
Length=252

 Score =   223 bits (567),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 141/174 (81%), Gaps = 1/174 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            ++QEL VYE+NE DR SP  L+ +      LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  79   RIQELSVYELNELDRHSPKILKNAACLTFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  138

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
             H  EKKG+R+EA YSFYFGDYGH++VQG YLTYED++LA+TGG+GIFEG  GQVKLQQL
Sbjct  139  AHVPEKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGTGIFEGAYGQVKLQQL  198

Query  367  IFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++P KLFYTFYLKG+  DLPAEL G PVPPS  V+P+P AK  EP   I NFT+
Sbjct  199  VYPTKLFYTFYLKGLAGDLPAELTGTPVPPSKDVKPAPEAKTLEPSGVICNFTN  252



>emb|CDY50180.1| BnaC08g15790D [Brassica napus]
Length=250

 Score =   223 bits (567),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 144/182 (79%), Gaps = 2/182 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGI  572
            S+++   K+QEL VYE NE DR SPA L+L +      +GDLVPF+NKLYTGDL+KRVGI
Sbjct  69   SENSRPTKIQELNVYEFNEGDRHSPAVLKLGKNPQQLCIGDLVPFTNKLYTGDLKKRVGI  128

Query  571  TAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVS  392
            TAGLC+LI+H  EKKG+R+EA YSFYFGDYGHI+VQG YLTYEDT LA+TGG+G+FEG  
Sbjct  129  TAGLCVLIQHVPEKKGERFEASYSFYFGDYGHISVQGPYLTYEDTLLAITGGTGVFEGAY  188

Query  391  GQVKLQQLIFPFKLFYTFYLKG-IPDLPAELCGapvppspavepspaAKACEPGSTIGNF  215
            GQVKL QL++P KLFYTFYLKG + DLP EL G  V PS  V+P+  A+A + G+TI NF
Sbjct  189  GQVKLHQLVYPTKLFYTFYLKGVVADLPVELTGKHVEPSKDVKPAAEAQATQLGATILNF  248

Query  214  TD  209
            T+
Sbjct  249  TE  250



>pdb|1ZVC|A Chain A, X-Ray Structure Of Allene Oxide Cyclase From Arabidopsis 
Thaliana At3g25760
Length=189

 Score =   220 bits (561),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 144/182 (79%), Gaps = 1/182 (1%)
 Frame = -1

Query  751  KSQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGI  572
             +++    KVQEL VYEIN+ DR SP  L+ +      LGDLVPF+NKLYTGDL+KRVGI
Sbjct  8    NTENPRPSKVQELSVYEINDLDRHSPKILKNAFSFRFGLGDLVPFTNKLYTGDLKKRVGI  67

Query  571  TAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVS  392
            TAGLC++I+H  EK GDR+EA YSFYFGDYGH++VQG YLTYED++LA+TGG+GIFEG  
Sbjct  68   TAGLCVVIEHVPEKNGDRFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGAGIFEGAY  127

Query  391  GQVKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNF  215
            GQVKLQQL++P KLFYTFYLKG+  DLP EL G PVPPS  VEP+P AKA +P   + NF
Sbjct  128  GQVKLQQLVYPTKLFYTFYLKGLANDLPLELIGTPVPPSKDVEPAPEAKALKPSGVVSNF  187

Query  214  TD  209
            T+
Sbjct  188  TN  189



>ref|XP_001751254.1| predicted protein [Physcomitrella patens]
 gb|EDQ83571.1| predicted protein [Physcomitrella patens]
Length=188

 Score =   220 bits (561),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 132/178 (74%), Gaps = 6/178 (3%)
 Frame = -1

Query  724  VQELCVYEINERDRGSPAYLRLSQKS------VNTLGDLVPFSNKLYTGDLQKRVGITAG  563
            VQEL VYEINERDRGSP  L    K        N+LGDLVPFSNK+Y G LQ+R+GITAG
Sbjct  11   VQELSVYEINERDRGSPVILPFGGKKDENGAHANSLGDLVPFSNKVYDGSLQRRLGITAG  70

Query  562  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQV  383
            +C LI H  EKKGDRYEA YSFYFGDYGHI+VQG Y+TYEDT L VTGG+GIF G  G  
Sbjct  71   ICTLISHNAEKKGDRYEAQYSFYFGDYGHISVQGPYITYEDTELVVTGGTGIFAGCHGVA  130

Query  382  KLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            KL Q+IFP KLFYTFYL+GI  LP ELC + VPPSP+ EPS  AK C P S   NFT+
Sbjct  131  KLHQIIFPVKLFYTFYLQGIKKLPEELCASVVPPSPSAEPSEQAKKCHPSSVAPNFTN  188



>dbj|BAB63918.1| ERD12 protein [Arabidopsis thaliana]
Length=252

 Score =   222 bits (566),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 141/174 (81%), Gaps = 1/174 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQEL VYEIN+ DR SP  L+ +      LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  79   KVQELSVYEINDLDRHSPKILKNAFSFRFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  138

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            +H  EK GDR+EA YSFYFGDYGH++VQG YLTYED++LA+TGG+GIFEG  GQVKLQQL
Sbjct  139  EHVPEKNGDRFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGAGIFEGAYGQVKLQQL  198

Query  367  IFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++P KLFYTFYLKG+  DLP EL G PVPPS  VEP+P AKA +P   + NFT+
Sbjct  199  VYPTKLFYTFYLKGLANDLPLELIGTPVPPSKDVEPAPEAKALKPSGVVSNFTN  252



>pdb|4H69|A Chain A, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens Complexed With Substrate Analog
 pdb|4H69|B Chain B, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens Complexed With Substrate Analog
 pdb|4H69|C Chain C, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens Complexed With Substrate Analog
 pdb|4H69|D Chain D, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens Complexed With Substrate Analog
 pdb|4H69|E Chain E, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens Complexed With Substrate Analog
 pdb|4H69|F Chain F, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens Complexed With Substrate Analog
 pdb|4H6A|A Chain A, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens
 pdb|4H6A|B Chain B, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens
 pdb|4H6A|C Chain C, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens
 pdb|4H6A|D Chain D, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens
 pdb|4H6A|E Chain E, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens
 pdb|4H6A|F Chain F, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens
Length=194

 Score =   220 bits (561),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 132/178 (74%), Gaps = 6/178 (3%)
 Frame = -1

Query  724  VQELCVYEINERDRGSPAYLRLSQKS------VNTLGDLVPFSNKLYTGDLQKRVGITAG  563
            VQEL VYEINERDRGSP  L    K        N+LGDLVPFSNK+Y G LQ+R+GITAG
Sbjct  17   VQELSVYEINERDRGSPVILPFGGKKDENGAHANSLGDLVPFSNKVYDGSLQRRLGITAG  76

Query  562  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQV  383
            +C LI H  EKKGDRYEA YSFYFGDYGHI+VQG Y+TYEDT L VTGG+GIF G  G  
Sbjct  77   ICTLISHNAEKKGDRYEAQYSFYFGDYGHISVQGPYITYEDTELVVTGGTGIFAGCHGVA  136

Query  382  KLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            KL Q+IFP KLFYTFYL+GI  LP ELC + VPPSP+ EPS  AK C P S   NFT+
Sbjct  137  KLHQIIFPVKLFYTFYLQGIKKLPEELCASVVPPSPSAEPSEQAKKCHPSSVAPNFTN  194



>emb|CDY72244.1| BnaCnng76690D [Brassica napus]
Length=252

 Score =   222 bits (565),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -1

Query  745  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  566
            +++   ++QEL VYE+NE DR SP  L+        LGDLVPF+NKLYTGDL+KRVGITA
Sbjct  73   ENSRPSRIQELSVYELNELDRHSPKILKNVISLTFGLGDLVPFTNKLYTGDLKKRVGITA  132

Query  565  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQ  386
            GLC++I H  EKKGDR+EA YSFYFGDYGH++VQG Y+TYED++LA+TGG+GIFEG  GQ
Sbjct  133  GLCVVIAHVPEKKGDRFEATYSFYFGDYGHLSVQGPYMTYEDSFLAITGGTGIFEGAYGQ  192

Query  385  VKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            VKLQQL++P KLFYTFYLKG+  DLPAEL G PV PS  V+P+P AK  EP   I ++T+
Sbjct  193  VKLQQLVYPTKLFYTFYLKGLAGDLPAELTGTPVSPSKDVKPAPEAKTLEPSGVISHYTN  252



>ref|NP_189204.1| allene oxide cyclase 1 [Arabidopsis thaliana]
 sp|Q9LS03.1|AOC1_ARATH RecName: Full=Allene oxide cyclase 1, chloroplastic; AltName: 
Full=Early-responsive to dehydration 12 protein; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA95763.1| unnamed protein product [Arabidopsis thaliana]
 emb|CAC83761.1| allene oxide cyclase [Arabidopsis thaliana]
 dbj|BAD43155.1| ERD12 protein [Arabidopsis thaliana]
 dbj|BAD44540.1| ERD12 protein [Arabidopsis thaliana]
 gb|ABD19660.1| At3g25760 [Arabidopsis thaliana]
 gb|AEE77065.1| allene oxide cyclase 1 [Arabidopsis thaliana]
Length=254

 Score =   222 bits (565),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 141/174 (81%), Gaps = 1/174 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQEL VYEIN+ DR SP  L+ +      LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  81   KVQELSVYEINDLDRHSPKILKNAFSFRFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  140

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            +H  EK GDR+EA YSFYFGDYGH++VQG YLTYED++LA+TGG+GIFEG  GQVKLQQL
Sbjct  141  EHVPEKNGDRFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGAGIFEGAYGQVKLQQL  200

Query  367  IFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++P KLFYTFYLKG+  DLP EL G PVPPS  VEP+P AKA +P   + NFT+
Sbjct  201  VYPTKLFYTFYLKGLANDLPLELIGTPVPPSKDVEPAPEAKALKPSGVVSNFTN  254



>ref|XP_010554242.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like isoform 
X2 [Tarenaya hassleriana]
Length=241

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = -1

Query  757  TVKSQSAPAGKVQELCVYE-INERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKR  581
            T K+ +A    +  L   E    RDR SPA L+L +K    LGDLVPF+NKLY+GDL KR
Sbjct  58   TSKNSTATGAFIWNLFSGEKFTPRDRNSPAVLKLGKKPELCLGDLVPFTNKLYSGDLTKR  117

Query  580  VGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFE  401
            +GITAGLC+LI+H  E+ GDR+EA YSFYFGDYGH++VQG YLTYEDTYL++TGG+G+FE
Sbjct  118  LGITAGLCVLIQHVPERNGDRFEATYSFYFGDYGHLSVQGPYLTYEDTYLSITGGAGVFE  177

Query  400  GVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIG  221
            G  GQVKL+QL++P KLFYTFYLKGI DLPAEL G PV PSP V+PSP A A EP  TI 
Sbjct  178  GAYGQVKLRQLVYPTKLFYTFYLKGIKDLPAELTGKPVEPSPDVKPSPEALATEPTGTIR  237

Query  220  NFTD  209
            NFTD
Sbjct  238  NFTD  241



>emb|CAD48753.1| allene oxide cyclase [Physcomitrella patens]
Length=188

 Score =   218 bits (556),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 132/178 (74%), Gaps = 6/178 (3%)
 Frame = -1

Query  724  VQELCVYEINERDRGSPAYLRLSQKS------VNTLGDLVPFSNKLYTGDLQKRVGITAG  563
            VQEL VYEINERDRGSP  L    K        N+LGDLVPFSNK+Y G LQ+R+GITAG
Sbjct  11   VQELSVYEINERDRGSPVILPFGGKKDENGAHANSLGDLVPFSNKVYDGSLQRRLGITAG  70

Query  562  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQV  383
            +C LI H  EKKGDRYEA YSFYFGDYGHI+VQG Y+TYEDT L VTGG+GIF G  G  
Sbjct  71   ICTLISHNAEKKGDRYEAQYSFYFGDYGHISVQGPYITYEDTELVVTGGTGIFAGCHGVA  130

Query  382  KLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            KL Q+IFP KLFYTFYL+GI  LP ELC + VPPSP+ EPS  AK C P S   NFT+
Sbjct  131  KLHQIIFPVKLFYTFYLQGIKKLPEELCASVVPPSPSXEPSEQAKKCHPSSVAPNFTN  188



>ref|XP_010425228.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Camelina 
sativa]
Length=246

 Score =   219 bits (558),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = -1

Query  745  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  566
            +++   KVQEL VYE+NE DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGITA
Sbjct  73   ENSRPSKVQELSVYELNELDRHSPKILKNAMSLMFGLGDLVPFTNKLYTGDLKKRVGITA  132

Query  565  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQ  386
            GLC++I+H  EKKG+R+EA YSFYFGDYGH++VQGQYLTYED++LA+TGG+G+FEG  GQ
Sbjct  133  GLCVVIEHVPEKKGERFEATYSFYFGDYGHLSVQGQYLTYEDSFLAITGGTGVFEGAYGQ  192

Query  385  VKLQQLIFPFKLFYTFYLKGIP-DLPAELCG  296
            VKLQQL++P KLFYTFYLKG+  DLP EL G
Sbjct  193  VKLQQLVYPTKLFYTFYLKGLANDLPEELTG  223



>ref|XP_010430726.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Camelina 
sativa]
Length=296

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 140/179 (78%), Gaps = 1/179 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGIT  569
            SQ +   KVQEL VYE+NE DR SP  L+ +      LGDLVPF+NKLYTGDL+KRVGIT
Sbjct  67   SQDSRPSKVQELSVYELNELDRHSPKILKNAFSLTFGLGDLVPFTNKLYTGDLKKRVGIT  126

Query  568  AGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSG  389
            AGLC++I+H  EK G+R+EAIYSFYFGDYGH+AVQG YLTYED++LA+ GGSGIFEG  G
Sbjct  127  AGLCVVIEHVPEKNGERFEAIYSFYFGDYGHLAVQGPYLTYEDSFLAIKGGSGIFEGAYG  186

Query  388  QVKLQQLIFPFKLFYTFYLKGI-PDLPAELCGapvppspavepspaAKACEPGSTIGNF  215
            QVKLQQL++P KLFYTFYLKG+  +LP EL G PVPPS  V+P+  AKA EP   I  +
Sbjct  187  QVKLQQLVYPTKLFYTFYLKGLGKNLPEELTGTPVPPSKDVKPAVEAKALEPSGVISKY  245



>gb|KFK35075.1| hypothetical protein AALP_AA5G232000 [Arabis alpina]
Length=732

 Score =   229 bits (585),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 141/171 (82%), Gaps = 1/171 (1%)
 Frame = -1

Query  733  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCI  554
            +GKVQEL VYE+NE DR SP  L+     + +LGDLVPF+NKLYTGDL+KRVGITAGLC+
Sbjct  73   SGKVQELSVYELNEGDRESPKILKHGLSLMFSLGDLVPFTNKLYTGDLKKRVGITAGLCV  132

Query  553  LIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQ  374
            +I+H  EK GDR+EA YSFYFGDYGH++VQG YLTYED++LA+TGGSGIFEG  GQVKLQ
Sbjct  133  VIEHVHEKNGDRFEASYSFYFGDYGHLSVQGPYLTYEDSFLAITGGSGIFEGAYGQVKLQ  192

Query  373  QLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTI  224
            QL+FP KLFYTFYLKGI  DLP EL G PVPPS  V+P+P AKA EP  TI
Sbjct  193  QLVFPTKLFYTFYLKGIADDLPEELTGTPVPPSKDVKPAPEAKALEPSGTI  243



>ref|XP_002875277.1| ERD12 protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51536.1| ERD12 protein [Arabidopsis lyrata subsp. lyrata]
Length=253

 Score =   217 bits (553),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 141/174 (81%), Gaps = 2/174 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            KVQEL VYEIN+ DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  81   KVQELSVYEINDLDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  140

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            +H   KKG+R+EA YSFYFGDYGH++VQG YLTYED++LA+TGG+GIFEG  GQVKLQQ+
Sbjct  141  EHVP-KKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGAGIFEGAYGQVKLQQI  199

Query  367  IFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++P KLFYTF+LKG+  DLP EL G PVPPS   EP+P AKA EP   + NFT+
Sbjct  200  VYPTKLFYTFFLKGLANDLPLELTGTPVPPSKDAEPAPEAKALEPSGVVSNFTN  253



>ref|XP_010514198.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Camelina 
sativa]
Length=252

 Score =   217 bits (552),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -1

Query  745  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  566
            +++   KVQEL +YE+NE DR SP  L+ +   +  LGDLVPF+NKLY GDL+KRVGITA
Sbjct  73   ENSRPSKVQELSMYELNELDRHSPKILKNAMSLIFGLGDLVPFTNKLYIGDLKKRVGITA  132

Query  565  GLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQ  386
            GLC++I+H  EK GDR+EA Y+FYFGDYGH++VQG YLTYED++LA+TGG+G+FEG  GQ
Sbjct  133  GLCVVIEHVPEKNGDRFEATYNFYFGDYGHLSVQGPYLTYEDSFLAITGGTGVFEGAHGQ  192

Query  385  VKLQQLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            VKLQQL++P KLFYTFYL+G+  DLP EL G PVPPS  V+P+  AKA E    I N+T+
Sbjct  193  VKLQQLVYPTKLFYTFYLRGLANDLPDELTGTPVPPSKDVKPAAEAKALELSRVICNYTN  252



>ref|XP_009110591.1| PREDICTED: allene oxide cyclase 4, chloroplastic [Brassica rapa]
 emb|CDY21090.1| BnaA08g24350D [Brassica napus]
Length=249

 Score =   213 bits (543),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 146/182 (80%), Gaps = 2/182 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGI  572
            S+++   K+QEL VYE NE DR SPA L+L +      +GDLVPF+NKLYTGDL+KRVGI
Sbjct  68   SENSRPTKIQELNVYEFNEGDRHSPAVLKLGKNPQQLCIGDLVPFTNKLYTGDLKKRVGI  127

Query  571  TAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVS  392
            TAGLC+LI+H  EKKG+R+EA YSFYFG+YGHI+VQG YLTYEDT LA+TGGSG+FEG  
Sbjct  128  TAGLCVLIQHVPEKKGERFEASYSFYFGEYGHISVQGPYLTYEDTLLAITGGSGVFEGAY  187

Query  391  GQVKLQQLIFPFKLFYTFYLKG-IPDLPAELCGapvppspavepspaAKACEPGSTIGNF  215
            GQVKL+QL++P KLFYTFYLKG + DLP EL G  V PS  V+P+  A+A +PG+TI NF
Sbjct  188  GQVKLRQLVYPTKLFYTFYLKGVVSDLPVELTGKHVEPSKDVKPAAEAQAAQPGATIINF  247

Query  214  TD  209
            T+
Sbjct  248  TE  249



>ref|XP_009152113.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Brassica 
rapa]
Length=252

 Score =   213 bits (541),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 137/174 (79%), Gaps = 1/174 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            ++QEL VYE+NE DR SP  L+ +      LGDLVPF+NK+YTGDL+KRVGITAGLC+ +
Sbjct  79   RIQELSVYELNELDRHSPKILKNAASLTFGLGDLVPFTNKIYTGDLKKRVGITAGLCVGV  138

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
                 KKG+R+EA YSFYFGDYGH++VQG YLTYED++LA+TGG+GIFEG  GQVKLQQL
Sbjct  139  AQVPVKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGTGIFEGAYGQVKLQQL  198

Query  367  IFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++P KL YTFYLKG+  DLPAEL G PVPPS  V+P+P AK  EP   I NFT+
Sbjct  199  VYPTKLLYTFYLKGLAGDLPAELTGTPVPPSKDVKPAPEAKTLEPSGVICNFTN  252



>gb|ABV89668.1| ERD12 protein [Brassica rapa]
Length=264

 Score =   212 bits (540),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 126/153 (82%), Gaps = 2/153 (1%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGI  572
            S+++   K+QEL VYE NE DR SPA L+L +      +GDLVPF+NKLYTGDL+KRVGI
Sbjct  68   SENSRPTKIQELNVYEFNEGDRHSPAVLKLGKNPQQLCIGDLVPFTNKLYTGDLKKRVGI  127

Query  571  TAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVS  392
            TAGLC+LI+H  EKKG+R+EA YSFYFG+YGHI+VQG YLTYEDT LA+TGGSG+FEG  
Sbjct  128  TAGLCVLIQHVPEKKGERFEASYSFYFGEYGHISVQGPYLTYEDTLLAITGGSGVFEGAY  187

Query  391  GQVKLQQLIFPFKLFYTFYLKG-IPDLPAELCG  296
            GQVKL+QL++P KLFYTFYLKG + DLP EL G
Sbjct  188  GQVKLRQLVYPTKLFYTFYLKGVVSDLPVELTG  220



>ref|XP_009152186.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Brassica 
rapa]
Length=205

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = -1

Query  733  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCI  554
            +GK QEL VYE+NERDR SPA L+L +K    LGDLVPF+NKLYTGDL+KRVGITAGL +
Sbjct  31   SGKTQELNVYELNERDRNSPAVLKLGKKPELCLGDLVPFTNKLYTGDLKKRVGITAGLYV  90

Query  553  LIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQ  374
            LI+H  EK GDR+EA YSFYFG  G ++V+GQYLTYEDT+LAVTGG+GIFEG  GQVKL+
Sbjct  91   LIQHVPEKNGDRFEANYSFYFGHCGQLSVEGQYLTYEDTFLAVTGGTGIFEGAYGQVKLR  150

Query  373  QLIFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            QL++  KLFYTFYLKG+  D PA        P   V+P+P AK  EPG+TI NFT
Sbjct  151  QLVYRTKLFYTFYLKGLAGDCPAAFT-ETPVPPKDVKPAPEAKVTEPGATINNFT  204



>ref|XP_002969526.1| hypothetical protein SELMODRAFT_91887, partial [Selaginella moellendorffii]
 ref|XP_002986761.1| hypothetical protein SELMODRAFT_124720, partial [Selaginella 
moellendorffii]
 gb|EFJ12091.1| hypothetical protein SELMODRAFT_124720, partial [Selaginella 
moellendorffii]
 gb|EFJ29614.1| hypothetical protein SELMODRAFT_91887, partial [Selaginella moellendorffii]
Length=176

 Score =   207 bits (526),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 117/144 (81%), Gaps = 2/144 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQ-KSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  551
            +VQ L VYEINE DRGSP  L+  + K  N LGDLVPFSNKLY G L+ R+GITAGLC+L
Sbjct  6    EVQTLSVYEINELDRGSPVLLKGDKAKPTNALGDLVPFSNKLYDGCLETRLGITAGLCVL  65

Query  550  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQ  371
            IKH    KGDRYEA YSFYFGDYGHI+VQG Y+TY+DTY+A+TGGSGIF G  GQVKLQQ
Sbjct  66   IKHVP-GKGDRYEATYSFYFGDYGHISVQGAYITYQDTYMAITGGSGIFNGARGQVKLQQ  124

Query  370  LIFPFKLFYTFYLKGIPDLPAELC  299
            +IFP KLFYTFYL+GI  LPA+L 
Sbjct  125  IIFPTKLFYTFYLEGIAKLPAQLT  148



>emb|CDY13583.1| BnaA06g33400D [Brassica napus]
Length=181

 Score =   204 bits (518),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 131/173 (76%), Gaps = 2/173 (1%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  548
            K QEL VYE+NE DR SPA L+L +K    LGDLVPF+NKLY  DL+KRVGITAGL +LI
Sbjct  9    KTQELNVYELNEGDRNSPAVLKLGKKPELCLGDLVPFTNKLYPDDLKKRVGITAGLYVLI  68

Query  547  KHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQL  368
            +H  EK GDR EA YSFYFG  G ++V+GQYLTYEDT+LAVTGG+GIFEG  GQVKL+QL
Sbjct  69   QHVPEKNGDRLEANYSFYFGHCGQLSVEGQYLTYEDTFLAVTGGTGIFEGAYGQVKLRQL  128

Query  367  IFPFKLFYTFYLKGIP-DLPAELCGapvppspavepspaAKACEPGSTIGNFT  212
            ++P KLFYTFYLKG+  D P         P   V+P+P AKA EPG+TI NFT
Sbjct  129  VYPTKLFYTFYLKGLASDFPVAFT-ETPVPRKDVKPAPEAKATEPGATINNFT  180



>ref|XP_006495473.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like, partial 
[Citrus sinensis]
Length=157

 Score =   197 bits (502),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 120/134 (90%), Gaps = 1/134 (1%)
 Frame = -1

Query  610  KLYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYL  431
            +LY+GDLQKRVGITAG+CILI+H+   KGDRYEA+YSFYFGDYGHI+VQG YLTY+DT L
Sbjct  25   QLYSGDLQKRVGITAGICILIQHKP-MKGDRYEAVYSFYFGDYGHISVQGSYLTYKDTCL  83

Query  430  AVTGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaA  251
            AVTGGSGIFEGVSGQVKL+QL+FPFKLFYTFYLKGI DLP EL G PV PSP V PSP A
Sbjct  84   AVTGGSGIFEGVSGQVKLKQLVFPFKLFYTFYLKGIKDLPGELMGKPVRPSPFVHPSPMA  143

Query  250  KACEPGSTIGNFTD  209
            KAC+PG+T+ NFTD
Sbjct  144  KACKPGATVANFTD  157



>ref|XP_004156234.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Cucumis 
sativus]
Length=141

 Score =   194 bits (494),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = -1

Query  616  SNKLYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDT  437
            S  LY+GDLQKRVGITAGLCIL++++ EKKGD YEAIYSFYFGDYGHIAVQG YLTYEDT
Sbjct  6    SWLLYSGDLQKRVGITAGLCILVQNKPEKKGDHYEAIYSFYFGDYGHIAVQGPYLTYEDT  65

Query  436  YLAVTGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepsp  257
            YLAVTGGSGIFEGV GQVKLQQ+IFPFKLFYTFYLK I DLP EL   P  P+ A EP+P
Sbjct  66   YLAVTGGSGIFEGVRGQVKLQQIIFPFKLFYTFYLKDIGDLPLELVVKPTEPTLAAEPTP  125

Query  256  aAKACEPGSTIGNFTD  209
             AKAC P +TI  +TD
Sbjct  126  NAKACHPHATISGYTD  141



>gb|KJB50748.1| hypothetical protein B456_008G185600 [Gossypium raimondii]
Length=208

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  595  DLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGG  416
            +LQKRVGITAGLC+LI+H  EKKGDRYEAIYSFYFGDYGH++VQG YLTYEDTYLAVTGG
Sbjct  80   NLQKRVGITAGLCVLIQHVPEKKGDRYEAIYSFYFGDYGHLSVQGPYLTYEDTYLAVTGG  139

Query  415  SGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEP  236
            SGIFEG  GQVKL Q++FP KL+YTFYLKGI DLPAEL G PVPPSPAVEPS AAKA EP
Sbjct  140  SGIFEGAYGQVKLHQIVFPMKLYYTFYLKGIGDLPAELLGKPVPPSPAVEPSAAAKATEP  199

Query  235  GSTIGNFTD  209
              +I NFT+
Sbjct  200  HGSIPNFTN  208



>ref|XP_006373455.1| hypothetical protein POPTR_0017s13940g, partial [Populus trichocarpa]
 gb|ERP51252.1| hypothetical protein POPTR_0017s13940g, partial [Populus trichocarpa]
Length=135

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 121/147 (82%), Gaps = 14/147 (10%)
 Frame = -1

Query  646  VNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAV  467
            VNTLGDLVPFSNKLYTGDLQKR+GITAG+CILI+H+ EK+GDRYEA+YSFYFGDYGH++V
Sbjct  2    VNTLGDLVPFSNKLYTGDLQKRIGITAGICILIQHKTEKQGDRYEAVYSFYFGDYGHLSV  61

Query  466  QGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIP-DLPAELCGap  290
            QG Y+TYEDT               GQVKL+QL+FPFKLFYTFYLKG+  DLP EL G P
Sbjct  62   QGAYITYEDT-------------AYGQVKLRQLVFPFKLFYTFYLKGLKNDLPEELVGKP  108

Query  289  vppspavepspaAKACEPGSTIGNFTD  209
            V P+PAV+P+PAAKA EP +TI N++D
Sbjct  109  VEPTPAVDPTPAAKAAEPHATIANYSD  135



>gb|AFW88168.1| hypothetical protein ZEAMMB73_091885, partial [Zea mays]
Length=144

 Score =   178 bits (451),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -1

Query  613  NKLYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTY  434
             ++Y G L KR+GITAG+C+LI+H  ++ GDRYEAIYSFYFGDYGHI+VQG YLTYE++Y
Sbjct  10   TQVYNGSLDKRLGITAGICVLIQHVPDRNGDRYEAIYSFYFGDYGHISVQGAYLTYEESY  69

Query  433  LAVTGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspa  254
            LAVTGGSG+FEG  GQVKL Q++FPFK+FYTFYL+GIPDLP +L   PVPPSP VEP+PA
Sbjct  70   LAVTGGSGVFEGAYGQVKLHQIVFPFKIFYTFYLRGIPDLPRDLLCTPVPPSPTVEPTPA  129

Query  253  AKACEPGSTIGNFTD  209
            A+A EP + + N+T+
Sbjct  130  ARAAEPHACVNNYTN  144



>gb|ABO61151.1| allene oxide cyclase, partial [Nicotiana attenuata]
Length=86

 Score =   171 bits (432),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/86 (94%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = -1

Query  676  PAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSF  497
            PAYLRLSQK+VN+LGDLVPFSNKLYTGDL+KR+GITAGLCILIKHEEEKKGDRYEAIYSF
Sbjct  1    PAYLRLSQKTVNSLGDLVPFSNKLYTGDLKKRIGITAGLCILIKHEEEKKGDRYEAIYSF  60

Query  496  YFGDYGHIAVQGQYLTYEDTYLAVTG  419
            YFGDYGHIAVQG YLTYEDTYLAVTG
Sbjct  61   YFGDYGHIAVQGSYLTYEDTYLAVTG  86



>gb|EMS52587.1| Allene oxide cyclase 3, chloroplastic [Triticum urartu]
Length=204

 Score =   172 bits (436),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 118/174 (68%), Gaps = 35/174 (20%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQK-SVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  551
            KVQEL VYE+NERDR SPAYLRLS K S N LGDLVPF+NK+Y G L KR+GITAG+CIL
Sbjct  65   KVQELHVYELNERDRESPAYLRLSAKQSQNALGDLVPFTNKVYNGSLDKRIGITAGICIL  124

Query  550  IKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQ  371
            I+H                                    LAVTGGSG+FEGV GQVKL Q
Sbjct  125  IQHSS----------------------------------LAVTGGSGVFEGVYGQVKLNQ  150

Query  370  LIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGNFTD  209
            ++FPFK+FYTFYLKGIPDLP EL   PVPPSP VEP+PAAKA EP + + NFTD
Sbjct  151  IVFPFKIFYTFYLKGIPDLPRELLCTPVPPSPTVEPTPAAKATEPHACLNNFTD  204



>ref|XP_001760307.1| predicted protein [Physcomitrella patens]
 gb|EDQ75063.1| predicted protein, partial [Physcomitrella patens]
Length=184

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 119/185 (64%), Gaps = 13/185 (7%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYL-RLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  551
            +VQ   VYEINERDR SPA+L  LS    + LGDLVPFSNKLY   LQ R+G+TAG+ ++
Sbjct  1    EVQLFSVYEINERDRNSPAFLPTLSGDHEHGLGDLVPFSNKLYDSSLQVRLGVTAGMAMV  60

Query  550  IK--------HEEEKK---GDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIF  404
            +K        H  +      D YEA Y+FY GD GH++ QG + T++DT L +TGG+G+F
Sbjct  61   VKAFPGKGQKHHTKHNFFFPDCYEATYTFYLGDMGHVSAQGPFSTFDDTLLTITGGAGLF  120

Query  403  EGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTI  224
                G + L   I PFKLFYTF+++G+P+LP  L   PV P+  V+P   A AC+PG  +
Sbjct  121  REARGVIHLHN-ITPFKLFYTFHVRGVPELPRILTSKPVEPNEHVQPRREAVACKPGFAL  179

Query  223  GNFTD  209
             N+TD
Sbjct  180  PNYTD  184



>dbj|BAO93687.1| allene oxide cyclase [Marchantia polymorpha]
Length=257

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 96/147 (65%), Gaps = 1/147 (1%)
 Frame = -1

Query  739  APAGKVQELCVYEINERDRGSPAYLRLSQK-SVNTLGDLVPFSNKLYTGDLQKRVGITAG  563
            AP  + Q + V+E NE DR SP  ++ + K  V  +GD VP+SNK+Y    +K +GI++G
Sbjct  86   APEDQEQVMGVFEFNEGDRNSPFVVKNNAKLPVLCIGDFVPYSNKVYDCTGKKYLGISSG  145

Query  562  LCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQV  383
            LC +++H  E  GD YE + S Y G YGH++ QG Y TY DT + VTGG+GIF+G  G V
Sbjct  146  LCTVVEHHYESGGDLYETVMSHYMGSYGHLSCQGPYKTYGDTEMVVTGGTGIFKGARGYV  205

Query  382  KLQQLIFPFKLFYTFYLKGIPDLPAEL  302
            K   +  P KL YT+YL GIP LP+EL
Sbjct  206  KCHNIAGPLKLLYTYYLTGIPKLPSEL  232



>ref|XP_001779767.1| predicted protein [Physcomitrella patens]
 gb|EDQ55451.1| predicted protein [Physcomitrella patens]
Length=200

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 109/193 (56%), Gaps = 23/193 (12%)
 Frame = -1

Query  721  QELCVYEINERDRGSPAYLRLSQKSVN-----------TLGDLVPFSNKLYTGDLQKRVG  575
            Q   VYE+NE DR SPA+L LS+++VN            LGD VPF+NKLY   L+ R+G
Sbjct  9    QTFTVYELNEFDRDSPAFLELSRQTVNRVDPNTGDHIKALGDQVPFTNKLYNSALEMRLG  68

Query  574  ITAGLCILIKHEEEK-----------KGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  428
            IT G+C+ +K+   +             D YE I S+YFGD GHI+  G ++ ++DT + 
Sbjct  69   ITTGICLHMKNYPGRGAPELHSLPFFTSDHYETIMSWYFGDMGHISGMGPFINFQDTLMG  128

Query  427  VTGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAK  248
            +TGG+G F    G V+L   I PFK  YTF L GIP+LP  L     PP   VE  P A 
Sbjct  129  ITGGTGFFAEARGVVRLHP-ITPFKFMYTFTLSGIPELPGFLTKELAPPHFEVESHPDAL  187

Query  247  ACEPGSTIGNFTD  209
             C+  S + N+TD
Sbjct  188  KCKSESVLPNYTD  200



>ref|XP_006417137.1| hypothetical protein EUTSA_v10008630mg [Eutrema salsugineum]
 gb|ESQ35490.1| hypothetical protein EUTSA_v10008630mg [Eutrema salsugineum]
Length=241

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 116/182 (64%), Gaps = 14/182 (8%)
 Frame = -1

Query  748  SQSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGIT  569
            ++++   K+QEL VYE NE DR SPA L+L +            S   +   L +R   T
Sbjct  72   TENSRPTKIQELNVYEFNEGDRNSPAVLKLGKNPQQ-------LSRSFHKQTLHRRSQET  124

Query  568  AGLCILIKHEEEKKGDRYEAI-YSFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVS  392
                    H    + D   +   SFYFGDYGHI+VQG YLTYEDT+LA+TGGSG+FEG  
Sbjct  125  RR-----NHRGTLRFDPTRSREESFYFGDYGHISVQGPYLTYEDTFLAITGGSGVFEGAY  179

Query  391  GQVKLQQLIFPFKLFYTFYLKGI-PDLPAELCGapvppspavepspaAKACEPGSTIGNF  215
            GQVKL+QL++P KLFYTFYLKG+  DLP EL G PV PS  V+P+  A+A +PG+TI NF
Sbjct  180  GQVKLRQLVYPTKLFYTFYLKGVAADLPVELTGKPVEPSKDVKPAAEAQAAQPGATIQNF  239

Query  214  TD  209
            TD
Sbjct  240  TD  241



>ref|XP_001771240.1| predicted protein [Physcomitrella patens]
 gb|EDQ63951.1| predicted protein [Physcomitrella patens]
Length=254

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 107/193 (55%), Gaps = 23/193 (12%)
 Frame = -1

Query  721  QELCVYEINERDRGSPAYLRLSQKSVN-----------TLGDLVPFSNKLYTGDLQKRVG  575
            Q   VYE+NE DR SPA+L LS++SVN            LGD VPF+NKLY   L+ R+G
Sbjct  63   QTFTVYELNEFDRDSPAFLELSRQSVNRTDPVTGEHVKALGDQVPFTNKLYDSSLRTRLG  122

Query  574  ITAGLCILIKH-----EEEKKG------DRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLA  428
            IT G+C+ +K        E  G      D YE I S++ GD GHI+  G ++ ++DT + 
Sbjct  123  ITTGICLHMKQYPGRGAPELHGLPFFTPDHYETIMSWHLGDMGHISGMGPFINFQDTLMG  182

Query  427  VTGGSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAK  248
            VTGG+G F    G V+L   I PFK  YTF L GIP LP  L    V P   VE    A 
Sbjct  183  VTGGTGFFAEARGVVRLHP-ITPFKFMYTFTLTGIPKLPEVLTKELVVPGFGVEAHADAV  241

Query  247  ACEPGSTIGNFTD  209
              +P ST+ NFT+
Sbjct  242  QGKPESTLANFTN  254



>gb|KJB22383.1| hypothetical protein B456_004G0462002, partial [Gossypium raimondii]
Length=140

 Score =   126 bits (316),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 72/86 (84%), Gaps = 5/86 (6%)
 Frame = -1

Query  769  KRSVTVKSQSAPAG-----KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKL  605
            KR  T KSQ+ P+      KVQEL VYE+NERDRGSPAYLRLSQKSVN+LGDLVPFSNK+
Sbjct  55   KRGFTCKSQAIPSDNSAPEKVQELHVYELNERDRGSPAYLRLSQKSVNSLGDLVPFSNKI  114

Query  604  YTGDLQKRVGITAGLCILIKHEEEKK  527
            Y GDL+KR+GIT+G+CILI+H+ E K
Sbjct  115  YRGDLEKRIGITSGICILIEHKPEMK  140



>ref|XP_007208176.1| hypothetical protein PRUPE_ppa022035mg [Prunus persica]
 gb|EMJ09375.1| hypothetical protein PRUPE_ppa022035mg [Prunus persica]
Length=197

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 64/78 (82%), Gaps = 2/78 (3%)
 Frame = -1

Query  523  DRYEAIY-SFYFGDYGHIAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQQLIF-PFKL  350
            DR    Y SFYFGDYGHI+ QG YLTYED+YLAVTGGSGIFEGV GQVKL QL++ PFK+
Sbjct  97   DRASPAYLSFYFGDYGHISAQGAYLTYEDSYLAVTGGSGIFEGVYGQVKLHQLVYHPFKI  156

Query  349  FYTFYLKGIPDLPAELCG  296
             YTFYLKGI DLP +L G
Sbjct  157  LYTFYLKGIKDLPEQLLG  174



>gb|AGH14183.1| putative allene oxide cyclase, partial [Catharanthus roseus]
Length=70

 Score = 99.4 bits (246),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -1

Query  418  GSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACE  239
            GSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAEL G PVPPSP VEPSPAAKACE
Sbjct  1    GSGIFEGVSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELLGKPVPPSPTVEPSPAAKACE  60

Query  238  PGSTIGNFTD  209
             G+TI NFT+
Sbjct  61   DGATITNFTN  70



>ref|XP_009394152.1| PREDICTED: uncharacterized protein LOC103979699 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=307

 Score = 82.4 bits (202),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -1

Query  733  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNK  608
            + KVQELCVYEINERDRGSPAYLRLSQK VN LGDLVPFSNK
Sbjct  87   SAKVQELCVYEINERDRGSPAYLRLSQKQVNFLGDLVPFSNK  128


 Score = 27.7 bits (60),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 50/87 (57%), Gaps = 0/87 (0%)
 Frame = -3

Query  629  SSAVQQQAVHWGFAEAGGDNGRTLHSDQARRGEErrplrgdlqlllrrlrphrRSGTIPH  450
            S+ +   AV     EA G +   L +D AR GE RRP+RG LQLLLR LR H  +G +P 
Sbjct  157  STCMTTIAVLGESGEAAGHHVGDLRADPARAGEGRRPVRGHLQLLLRGLRAHLGAGGVPD  216

Query  449  LRGHLFGGHRRIWDLRRSLRSGQAPAA  369
            +RG   G  RR+  +R  LR GQA A 
Sbjct  217  VRGVPPGRDRRLRSVRGCLRPGQAAAD  243



>ref|XP_009394153.1| PREDICTED: uncharacterized protein LOC103979699 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=305

 Score = 82.0 bits (201),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNK  608
            KVQELCVYEINERDRGSPAYLRLSQK VN LGDLVPFSNK
Sbjct  87   KVQELCVYEINERDRGSPAYLRLSQKQVNFLGDLVPFSNK  126


 Score = 27.7 bits (60),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 50/87 (57%), Gaps = 0/87 (0%)
 Frame = -3

Query  629  SSAVQQQAVHWGFAEAGGDNGRTLHSDQARRGEErrplrgdlqlllrrlrphrRSGTIPH  450
            S+ +   AV     EA G +   L +D AR GE RRP+RG LQLLLR LR H  +G +P 
Sbjct  155  STCMTTIAVLGESGEAAGHHVGDLRADPARAGEGRRPVRGHLQLLLRGLRAHLGAGGVPD  214

Query  449  LRGHLFGGHRRIWDLRRSLRSGQAPAA  369
            +RG   G  RR+  +R  LR GQA A 
Sbjct  215  VRGVPPGRDRRLRSVRGCLRPGQAAAD  241



>gb|KJB22356.1| hypothetical protein B456_004G0462001, partial [Gossypium raimondii]
Length=63

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  397  VSGQVKLQQLIFPFKLFYTFYLKGIPDLPAELCGapvppspavepspaAKACEPGSTIGN  218
            VSGQVKL Q++FPFK+FYTFYLKGI +LP EL   PV P PAVE  PAAKACEP +TI N
Sbjct  1    VSGQVKLHQIVFPFKIFYTFYLKGIGELPEELLCKPVDPHPAVEAVPAAKACEPHATIAN  60

Query  217  FTD  209
            FT+
Sbjct  61   FTN  63



>gb|AGL75607.1| mangrin, partial [Rhizophora apiculata]
 gb|AGL75608.1| mangrin, partial [Rhizophora apiculata]
 gb|AGL75609.1| mangrin, partial [Rhizophora apiculata]
 gb|AGL75610.1| mangrin, partial [Rhizophora apiculata]
 gb|AGL75611.1| mangrin, partial [Rhizophora mucronata x Rhizophora stylosa]
 gb|AGL75612.1| mangrin, partial [Rhizophora mucronata]
 gb|AGL75613.1| mangrin, partial [Rhizophora mucronata]
 gb|AGL75614.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75615.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75616.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75617.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75618.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75619.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75620.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75621.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75622.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75623.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75624.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75625.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75626.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75627.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75628.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75629.1| mangrin, partial [Rhizophora apiculata]
 gb|AGL75630.1| mangrin, partial [Rhizophora apiculata]
 gb|AGL75631.1| mangrin, partial [Rhizophora mucronata x Rhizophora stylosa]
 gb|AGL75632.1| mangrin, partial [Rhizophora mucronata x Rhizophora stylosa]
 gb|AGL75633.1| mangrin, partial [Rhizophora mucronata x Rhizophora stylosa]
 gb|AGL75634.1| mangrin, partial [Rhizophora mucronata x Rhizophora stylosa]
 gb|AGL75635.1| mangrin, partial [Rhizophora mucronata x Rhizophora stylosa]
 gb|AGL75636.1| mangrin, partial [Rhizophora mucronata x Rhizophora stylosa]
 gb|AGL75637.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75638.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75639.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75640.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75641.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75642.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75643.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75644.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75645.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75646.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75647.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75648.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75649.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75650.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75651.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75652.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75653.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75654.1| mangrin, partial [Rhizophora x lamarckii]
Length=40

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNK  608
            KVQEL VYEINERDR SPA LRLSQK V +LGDLVPFSNK
Sbjct  1    KVQELFVYEINERDRESPAILRLSQKPVLSLGDLVPFSNK  40



>ref|XP_003628626.1| Allene-oxide cyclase [Medicago truncatula]
 gb|AET03102.1| allene oxide cyclase [Medicago truncatula]
Length=119

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 39/53 (74%), Gaps = 3/53 (6%)
 Frame = -1

Query  766  RSVTVKSQS---APAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPF  617
            +S T KSQ+   A   KVQE+ VYE NE DRGSPAY RLS KSVN+LGDLV F
Sbjct  56   KSFTCKSQANEHADTEKVQEMHVYEFNESDRGSPAYSRLSNKSVNSLGDLVSF  108



>tpg|DAA45889.1| TPA: hypothetical protein ZEAMMB73_165754 [Zea mays]
Length=117

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = -1

Query  727  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFSNKL  605
            KVQEL VYEINERDR SPAYLRLS K   N LGDLVPF+NK+
Sbjct  65   KVQELYVYEINERDRESPAYLRLSAKQTENALGDLVPFTNKV  106



>ref|WP_002615122.1| hypothetical protein [Stigmatella aurantiaca]
 gb|EAU65547.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
Length=156

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 51/94 (54%), Gaps = 6/94 (6%)
 Frame = -1

Query  655  QKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGH  476
            + S ++ GD++ F N L+      +VG   G C+ ++      G  +E  ++ +  D G 
Sbjct  50   EPSGDSAGDVLTFVNPLFDEANTAQVGTDQGYCVRVQ-----AGASWECTWTAFLDD-GQ  103

Query  475  IAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQ  374
            + V G +    D+ LA+TGG+G F+G  GQ++L+
Sbjct  104  LTVAGPFYDTRDSTLAITGGTGAFQGAHGQMRLE  137



>emb|CDX83553.1| BnaC07g22930D [Brassica napus]
Length=115

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 40/64 (63%), Gaps = 2/64 (3%)
 Frame = -1

Query  538  EEKKGDRYEAIYSFYFGDYGHIAVQGQYLTYEDTYLAVT-GGSGIFEGVSGQVKLQQLIF  362
            E  +GDR  +      G    + +   YLTYEDT+LA+T GG+GIFEG   QVKL+Q ++
Sbjct  30   ELNEGDRNSSAV-LKIGKKPELCLGDLYLTYEDTFLAITAGGTGIFEGAYRQVKLRQPVY  88

Query  361  PFKL  350
            P KL
Sbjct  89   PTKL  92



>ref|WP_044187159.1| Allene oxide cyclase [Hyalangium minutum]
Length=143

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 54/90 (60%), Gaps = 6/90 (7%)
 Frame = -1

Query  643  NTLGDLVPFSNKLYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQ  464
            +++GD++ F+N+LY     ++VG   G C+ +       G  +E +++ +  + G I+V+
Sbjct  41   DSVGDVLTFANELYDETNTRKVGTNQGYCVRVV-----AGQAWECLWTAFL-EGGQISVE  94

Query  463  GQYLTYEDTYLAVTGGSGIFEGVSGQVKLQ  374
            G +   + + L++TGG+G F G  GQ++L+
Sbjct  95   GPFYDVKGSTLSITGGTGNFNGARGQMQLE  124



>gb|ADO73769.1| uncharacterized protein STAUR_6009 [Stigmatella aurantiaca DW4/3-1]
Length=165

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 51/94 (54%), Gaps = 6/94 (6%)
 Frame = -1

Query  655  QKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGH  476
            + S ++ GD++ F N L+      +VG   G C+ ++      G  +E  ++ +  D G 
Sbjct  59   EPSGDSAGDVLTFVNPLFDEANTAQVGTDQGYCVRVQ-----AGASWECTWTAFLDD-GQ  112

Query  475  IAVQGQYLTYEDTYLAVTGGSGIFEGVSGQVKLQ  374
            + V G +    D+ LA+TGG+G F+G  GQ++L+
Sbjct  113  LTVAGPFYDTRDSTLAITGGTGAFQGAHGQMRLE  146



>gb|KFE69350.1| hypothetical protein DB31_6325 [Hyalangium minutum]
Length=155

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 54/90 (60%), Gaps = 6/90 (7%)
 Frame = -1

Query  643  NTLGDLVPFSNKLYTGDLQKRVGITAGLCILIKHEEEKKGDRYEAIYSFYFGDYGHIAVQ  464
            +++GD++ F+N+LY     ++VG   G C+ +       G  +E +++ +  + G I+V+
Sbjct  53   DSVGDVLTFANELYDETNTRKVGTNQGYCVRVV-----AGQAWECLWTAFL-EGGQISVE  106

Query  463  GQYLTYEDTYLAVTGGSGIFEGVSGQVKLQ  374
            G +   + + L++TGG+G F G  GQ++L+
Sbjct  107  GPFYDVKGSTLSITGGTGNFNGARGQMQLE  136



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1467725733100