BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF034O09

Length=713
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAA34096.1|  plasma membrane H+ ATPase                               209   7e-61   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AAA34052.1|  H+-translocating ATPase                                 213   6e-60   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009793289.1|  PREDICTED: plasma membrane ATPase 2                213   9e-60   Nicotiana sylvestris
ref|XP_009610426.1|  PREDICTED: plasma membrane ATPase 2                213   9e-60   
ref|NP_001234477.1|  plasma membrane H+-ATPase                          213   9e-60   Solanum lycopersicum
ref|XP_009798932.1|  PREDICTED: plasma membrane ATPase 1                212   2e-59   Nicotiana sylvestris
ref|XP_009607762.1|  PREDICTED: plasma membrane ATPase 1                212   2e-59   Nicotiana tomentosiformis
ref|XP_006354801.1|  PREDICTED: plasma membrane ATPase 1-like           211   2e-59   Solanum tuberosum [potatoes]
ref|NP_001274861.1|  plasma membrane ATPase 1-like                      211   2e-59   Solanum tuberosum [potatoes]
sp|Q08435.1|PMA1_NICPL  RecName: Full=Plasma membrane ATPase 1; A...    211   4e-59   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009626987.1|  PREDICTED: plasma membrane ATPase 3                209   1e-58   Nicotiana tomentosiformis
ref|XP_009799220.1|  PREDICTED: plasma membrane ATPase 3                209   2e-58   Nicotiana sylvestris
emb|CDP14881.1|  unnamed protein product                                208   3e-58   Coffea canephora [robusta coffee]
sp|P23980.1|PMA2_SOLLC  RecName: Full=Plasma membrane ATPase 2; A...    206   5e-58   Solanum lycopersicum
gb|EYU35892.1|  hypothetical protein MIMGU_mgv1a0008592mg               196   8e-58   Erythranthe guttata [common monkey flower]
ref|NP_001234775.1|  plasma membrane ATPase 1                           205   5e-57   Solanum lycopersicum
ref|XP_006367061.1|  PREDICTED: plasma membrane ATPase 1-like           205   5e-57   Solanum tuberosum [potatoes]
sp|Q08436.1|PMA3_NICPL  RecName: Full=Plasma membrane ATPase 3; A...    203   2e-56   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_011087207.1|  PREDICTED: plasma membrane ATPase 3                203   3e-56   Sesamum indicum [beniseed]
ref|XP_010112580.1|  ATPase 11, plasma membrane-type                    201   1e-55   
ref|XP_011071717.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    200   3e-55   Sesamum indicum [beniseed]
ref|XP_008239652.1|  PREDICTED: ATPase 11, plasma membrane-type         199   7e-55   Prunus mume [ume]
ref|XP_007210395.1|  hypothetical protein PRUPE_ppa000934mg             199   7e-55   Prunus persica
ref|XP_010550649.1|  PREDICTED: ATPase 11, plasma membrane-type         199   9e-55   Tarenaya hassleriana [spider flower]
ref|XP_002875872.1|  predicted protein                                  184   1e-54   
ref|XP_011042618.1|  PREDICTED: ATPase 11, plasma membrane-type         198   1e-54   Populus euphratica
ref|XP_002318614.1|  putative plasma membrane H+ ATPase family pr...    198   1e-54   
ref|NP_001183637.1|  uncharacterized protein LOC100502231               188   2e-54   
gb|KDP31195.1|  hypothetical protein JCGZ_11571                         198   2e-54   Jatropha curcas
ref|XP_002511508.1|  H(\+)-transporting atpase plant/fungi plasma...    196   4e-54   
emb|CDY30730.1|  BnaA02g33520D                                          196   4e-54   Brassica napus [oilseed rape]
dbj|BAD16686.1|  plasma membrane H+-ATPase                              196   6e-54   Daucus carota [carrots]
gb|EAZ21357.1|  hypothetical protein OsJ_37014                          196   9e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009130230.1|  PREDICTED: ATPase 11, plasma membrane-type i...    196   1e-53   Brassica rapa
ref|NP_001067382.1|  Os12g0638700                                       196   1e-53   
ref|XP_009130229.1|  PREDICTED: ATPase 11, plasma membrane-type i...    196   1e-53   Brassica rapa
gb|EEC69747.1|  hypothetical protein OsI_39279                          196   1e-53   Oryza sativa Indica Group [Indian rice]
emb|CDY45757.1|  BnaC02g42250D                                          196   1e-53   Brassica napus [oilseed rape]
gb|KJB19302.1|  hypothetical protein B456_003G094300                    196   1e-53   Gossypium raimondii
gb|KCW49372.1|  hypothetical protein EUGRSUZ_K02916                     195   1e-53   Eucalyptus grandis [rose gum]
ref|XP_009130228.1|  PREDICTED: ATPase 11, plasma membrane-type i...    196   1e-53   Brassica rapa
ref|XP_010037634.1|  PREDICTED: ATPase 11, plasma membrane-type         195   2e-53   Eucalyptus grandis [rose gum]
dbj|BAD16689.1|  plasma membrane H+-ATPase                              195   2e-53   Daucus carota [carrots]
ref|XP_010444121.1|  PREDICTED: ATPase 11, plasma membrane-type i...    195   2e-53   
ref|XP_010459221.1|  PREDICTED: ATPase 11, plasma membrane-type-like    195   2e-53   
ref|XP_006279959.1|  hypothetical protein CARUB_v10025825mg             195   2e-53   Capsella rubella
ref|NP_201073.1|  H(+)-ATPase 11                                        195   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864812.1|  AHA11-ATPASE 11                                    195   2e-53   Arabidopsis lyrata subsp. lyrata
ref|NP_190378.2|  H(+)-ATPase 4                                         195   2e-53   Arabidopsis thaliana [mouse-ear cress]
emb|CAB41144.1|  H+-transporting ATPase-like protein                    195   2e-53   Arabidopsis thaliana [mouse-ear cress]
emb|CAC29435.1|  P-type H+-ATPase                                       195   2e-53   Vicia faba [broad bean]
ref|XP_007032428.1|  H(+)-ATPase 4 isoform 2                            194   3e-53   
ref|XP_006394361.1|  hypothetical protein EUTSA_v10003603mg             194   3e-53   
ref|XP_007032427.1|  H(+)-ATPase 4 isoform 1                            194   4e-53   
gb|KDP45466.1|  hypothetical protein JCGZ_09715                         194   5e-53   Jatropha curcas
gb|KGN63646.1|  hypothetical protein Csa_1G008520                       193   5e-53   Cucumis sativus [cucumbers]
ref|XP_006664787.1|  PREDICTED: plasma membrane ATPase 1-like           194   5e-53   Oryza brachyantha
dbj|BAC77532.1|  plasma membrane H+-ATPase                              194   6e-53   Sesbania rostrata
ref|XP_008453171.1|  PREDICTED: plasma membrane ATPase 3                194   7e-53   Cucumis melo [Oriental melon]
ref|XP_004171391.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 4, pl...    194   7e-53   
ref|XP_004138147.1|  PREDICTED: ATPase 4, plasma membrane-type-like     194   7e-53   
ref|XP_004299601.1|  PREDICTED: ATPase 11, plasma membrane-type         193   8e-53   Fragaria vesca subsp. vesca
ref|XP_010923303.1|  PREDICTED: plasma membrane ATPase 3-like           193   1e-52   Elaeis guineensis
ref|XP_008796652.1|  PREDICTED: plasma membrane ATPase 3 isoform X1     193   1e-52   Phoenix dactylifera
ref|XP_010933786.1|  PREDICTED: plasma membrane ATPase 3                193   1e-52   Elaeis guineensis
ref|XP_008673350.1|  PREDICTED: uncharacterized protein LOC100502...    193   1e-52   
ref|XP_002442618.1|  hypothetical protein SORBIDRAFT_08g023070          193   1e-52   Sorghum bicolor [broomcorn]
ref|XP_004508789.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    192   1e-52   Cicer arietinum [garbanzo]
ref|XP_002322127.1|  putative plasma membrane H+ ATPase family pr...    192   2e-52   
gb|AAQ55291.1|  plasma membrane H+-ATPase                               192   2e-52   Juglans regia
gb|KHG12451.1|  ATPase 4, plasma membrane-type -like protein            191   2e-52   Gossypium arboreum [tree cotton]
ref|XP_007138219.1|  hypothetical protein PHAVU_009G190500g             192   2e-52   Phaseolus vulgaris [French bean]
ref|XP_003523043.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    192   2e-52   Glycine max [soybeans]
dbj|BAC77533.1|  plasma membrane H+-ATPase                              185   2e-52   Sesbania rostrata
ref|XP_004963335.1|  PREDICTED: plasma membrane ATPase 1-like           192   2e-52   Setaria italica
ref|XP_006290560.1|  hypothetical protein CARUB_v10016646mg             192   3e-52   Capsella rubella
ref|XP_006651704.1|  PREDICTED: plasma membrane ATPase 1-like           192   3e-52   
ref|XP_008437674.1|  PREDICTED: ATPase 11, plasma membrane-type         192   3e-52   Cucumis melo [Oriental melon]
ref|XP_004152442.1|  PREDICTED: ATPase 11, plasma membrane-type-like    192   3e-52   
ref|XP_011028703.1|  PREDICTED: ATPase 11, plasma membrane-type-like    192   3e-52   Populus euphratica
gb|KGN64262.1|  hypothetical protein Csa_1G045600                       190   3e-52   Cucumis sativus [cucumbers]
gb|AFC88896.1|  plasma membrane H+-ATPase                               192   3e-52   Melastoma malabathricum
ref|XP_010087815.1|  hypothetical protein L484_001526                   182   4e-52   
ref|XP_006431062.1|  hypothetical protein CICLE_v10011000mg             191   5e-52   Citrus clementina [clementine]
ref|XP_008807875.1|  PREDICTED: ATPase 11, plasma membrane-type         191   6e-52   Phoenix dactylifera
gb|KJB33641.1|  hypothetical protein B456_006G023600                    191   6e-52   Gossypium raimondii
ref|XP_006476664.1|  PREDICTED: ATPase 11, plasma membrane-type-like    191   7e-52   Citrus sinensis [apfelsine]
ref|XP_006439665.1|  hypothetical protein CICLE_v10018737mg             191   7e-52   Citrus clementina [clementine]
gb|KHG14131.1|  ATPase 4, plasma membrane-type -like protein            189   8e-52   Gossypium arboreum [tree cotton]
ref|XP_006482527.1|  PREDICTED: plasma membrane ATPase 1-like           191   9e-52   Citrus sinensis [apfelsine]
gb|KEH31901.1|  plasma membrane H+-ATPase                               191   1e-51   Medicago truncatula
ref|XP_003578172.1|  PREDICTED: plasma membrane ATPase 1                191   1e-51   Brachypodium distachyon [annual false brome]
ref|XP_010256132.1|  PREDICTED: ATPase 11, plasma membrane-type i...    190   1e-51   Nelumbo nucifera [Indian lotus]
gb|AEQ27823.1|  PM H+-ATPase L                                          190   1e-51   Eichhornia crassipes
ref|XP_009343433.1|  PREDICTED: ATPase 11, plasma membrane-type-like    190   1e-51   Pyrus x bretschneideri [bai li]
ref|XP_010256122.1|  PREDICTED: ATPase 11, plasma membrane-type i...    190   1e-51   Nelumbo nucifera [Indian lotus]
ref|XP_009369365.1|  PREDICTED: ATPase 11, plasma membrane-type         190   1e-51   Pyrus x bretschneideri [bai li]
ref|XP_008374513.1|  PREDICTED: ATPase 11, plasma membrane-type         190   1e-51   
gb|KHN19372.1|  ATPase 11, plasma membrane-type                         190   1e-51   Glycine soja [wild soybean]
ref|XP_003527056.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    190   1e-51   Glycine max [soybeans]
ref|XP_010444120.1|  PREDICTED: ATPase 11, plasma membrane-type i...    190   2e-51   
ref|XP_006838797.1|  hypothetical protein AMTR_s00002p00260210          190   2e-51   Amborella trichopoda
ref|XP_008459294.1|  PREDICTED: ATPase 11, plasma membrane-type-like    189   2e-51   Cucumis melo [Oriental melon]
ref|XP_010548837.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 11, p...    178   2e-51   Tarenaya hassleriana [spider flower]
gb|KEH24965.1|  plasma membrane H+-ATPase                               189   3e-51   Medicago truncatula
gb|KEH24964.1|  plasma membrane H+-ATPase                               189   3e-51   Medicago truncatula
ref|XP_002517457.1|  H(\+)-transporting atpase plant/fungi plasma...    187   5e-51   
dbj|BAK04567.1|  predicted protein                                      188   5e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92653.1|  predicted protein                                      188   5e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007155353.1|  hypothetical protein PHAVU_003G193800g             187   9e-51   Phaseolus vulgaris [French bean]
ref|XP_004148685.1|  PREDICTED: ATPase 11, plasma membrane-type-like    187   1e-50   Cucumis sativus [cucumbers]
ref|XP_002270344.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     187   1e-50   Vitis vinifera
gb|KGN52442.1|  hypothetical protein Csa_5G635370                       186   1e-50   Cucumis sativus [cucumbers]
dbj|BAA01058.1|  H-ATPase                                               187   1e-50   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050947.1|  Os03g0689300                                       187   1e-50   
ref|NP_001169535.1|  uncharacterized protein LOC100383411               178   1e-50   
gb|EEC75974.1|  hypothetical protein OsI_13084                          187   1e-50   Oryza sativa Indica Group [Indian rice]
gb|EMT31912.1|  Plasma membrane ATPase 1                                187   2e-50   
gb|ACN49187.1|  plasma membrane ATPase 1-like protein                   184   3e-50   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003561110.1|  PREDICTED: plasma membrane ATPase 1-like           186   4e-50   Brachypodium distachyon [annual false brome]
ref|XP_009398401.1|  PREDICTED: plasma membrane ATPase 1 isoform X2     186   5e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398400.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     186   6e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS45119.1|  Plasma membrane ATPase 1                                185   7e-50   Triticum urartu
gb|EMT26085.1|  Plasma membrane ATPase 1                                185   9e-50   
ref|XP_009398402.1|  PREDICTED: plasma membrane ATPase 1-like           184   1e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003549657.1|  PREDICTED: ATPase 11, plasma membrane-type-like    184   2e-49   Glycine max [soybeans]
ref|XP_010272214.1|  PREDICTED: ATPase 11, plasma membrane-type-like    184   2e-49   Nelumbo nucifera [Indian lotus]
ref|XP_008644894.1|  PREDICTED: uncharacterized protein LOC100383...    184   3e-49   
ref|XP_006595243.1|  PREDICTED: plasma membrane ATPase 1-like           183   3e-49   
ref|XP_010029279.1|  PREDICTED: ATPase 11, plasma membrane-type-like    183   3e-49   Eucalyptus grandis [rose gum]
gb|KCW56159.1|  hypothetical protein EUGRSUZ_I01911                     183   4e-49   Eucalyptus grandis [rose gum]
gb|KHN13245.1|  Plasma membrane ATPase 1                                183   4e-49   Glycine soja [wild soybean]
tpg|DAA50741.1|  TPA: hypothetical protein ZEAMMB73_722190              184   5e-49   
ref|XP_009417143.1|  PREDICTED: plasma membrane ATPase 1-like           182   8e-49   
ref|XP_004982139.1|  PREDICTED: plasma membrane ATPase 1-like           182   8e-49   Setaria italica
gb|KHN34200.1|  ATPase 11, plasma membrane-type                         182   9e-49   Glycine soja [wild soybean]
ref|XP_003554288.1|  PREDICTED: plasma membrane ATPase 1-like           182   9e-49   Glycine max [soybeans]
ref|XP_003525017.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    182   1e-48   Glycine max [soybeans]
ref|XP_002282263.1|  PREDICTED: ATPase 4, plasma membrane-type          181   2e-48   Vitis vinifera
ref|XP_011082991.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    181   3e-48   
ref|XP_011098566.1|  PREDICTED: plasma membrane ATPase 1-like           181   3e-48   Sesamum indicum [beniseed]
ref|XP_010678593.1|  PREDICTED: plasma membrane ATPase 1                181   3e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004955721.1|  PREDICTED: plasma membrane ATPase 1-like           181   3e-48   Setaria italica
gb|KJB19306.1|  hypothetical protein B456_003G094300                    179   1e-47   Gossypium raimondii
ref|XP_007151191.1|  hypothetical protein PHAVU_004G025700g             179   1e-47   Phaseolus vulgaris [French bean]
ref|XP_002466646.1|  hypothetical protein SORBIDRAFT_01g011610          177   1e-47   
ref|XP_011466246.1|  PREDICTED: plasma membrane ATPase 1-like iso...    177   4e-47   Fragaria vesca subsp. vesca
ref|XP_009335819.1|  PREDICTED: plasma membrane ATPase 1-like           177   5e-47   Pyrus x bretschneideri [bai li]
ref|XP_007214948.1|  hypothetical protein PRUPE_ppa000931mg             177   6e-47   
ref|XP_008230721.1|  PREDICTED: plasma membrane ATPase 1-like           177   8e-47   Prunus mume [ume]
gb|EYU34115.1|  hypothetical protein MIMGU_mgv1a000867mg                176   9e-47   Erythranthe guttata [common monkey flower]
ref|XP_004302360.1|  PREDICTED: plasma membrane ATPase 1-like iso...    176   1e-46   Fragaria vesca subsp. vesca
ref|XP_010531800.1|  PREDICTED: ATPase 4, plasma membrane-type-like     176   1e-46   Tarenaya hassleriana [spider flower]
ref|XP_008341531.1|  PREDICTED: plasma membrane ATPase 1-like           174   4e-46   
gb|ACR38028.1|  unknown                                                 168   6e-46   Zea mays [maize]
ref|NP_001136587.1|  uncharacterized protein LOC100216710               167   2e-45   
tpg|DAA59899.1|  TPA: membrane H(+)-ATPase1                             167   3e-45   
tpg|DAA59901.1|  TPA: membrane H(+)-ATPase1                             167   3e-45   
ref|XP_002459489.1|  hypothetical protein SORBIDRAFT_02g005440          171   1e-44   Sorghum bicolor [broomcorn]
ref|XP_008650970.1|  PREDICTED: uncharacterized protein LOC100216...    170   2e-44   
gb|ACN34067.1|  unknown                                                 167   4e-44   Zea mays [maize]
emb|CAH58642.1|  plasma membrane H+-ATPase                              157   2e-43   Plantago major [cart-track plant]
ref|XP_007037195.1|  H(+)-transporting atpase plant/fungi plasma ...    167   3e-43   
ref|XP_010228254.1|  PREDICTED: plasma membrane ATPase 3-like iso...    165   1e-42   Brachypodium distachyon [annual false brome]
ref|XP_010228253.1|  PREDICTED: plasma membrane ATPase 3-like iso...    165   1e-42   Brachypodium distachyon [annual false brome]
gb|KGN62871.1|  hypothetical protein Csa_2G378530                       152   4e-42   Cucumis sativus [cucumbers]
gb|ABR18001.1|  unknown                                                 163   5e-42   Picea sitchensis
emb|CDP02191.1|  unnamed protein product                                162   8e-42   Coffea canephora [robusta coffee]
gb|AFK46374.1|  unknown                                                 154   1e-41   Lotus japonicus
ref|XP_006428674.1|  hypothetical protein CICLE_v10011040mg             160   4e-41   
ref|XP_006480481.1|  PREDICTED: ATPase 4, plasma membrane-type-like     160   5e-41   
ref|XP_006658357.1|  PREDICTED: plasma membrane ATPase 1-like           160   5e-41   Oryza brachyantha
gb|KDO67287.1|  hypothetical protein CISIN_1g002203mg                   159   1e-40   Citrus sinensis [apfelsine]
dbj|BAD16685.1|  plasma membrane H+-ATPase                              159   2e-40   Daucus carota [carrots]
ref|XP_006483568.1|  PREDICTED: plasma membrane ATPase-like             159   2e-40   Citrus sinensis [apfelsine]
ref|XP_006450166.1|  hypothetical protein CICLE_v10007367mg             159   2e-40   Citrus clementina [clementine]
ref|XP_007225350.1|  hypothetical protein PRUPE_ppa000977mg             157   5e-40   
gb|EEC81667.1|  hypothetical protein OsI_25220                          157   5e-40   Oryza sativa Indica Group [Indian rice]
emb|CAB69823.1|  plasma membrane H+ ATPase                              157   5e-40   Prunus persica
ref|NP_001059093.1|  Os07g0191200                                       157   5e-40   
dbj|BAA06629.1|  plasma membrane H+-ATPase                              157   5e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010265488.1|  PREDICTED: plasma membrane ATPase 4                157   5e-40   Nelumbo nucifera [Indian lotus]
dbj|BAM20990.1|  plasma membrane H+-ATPase                              157   9e-40   Marchantia polymorpha
ref|XP_002280201.1|  PREDICTED: plasma membrane ATPase-like             157   1e-39   Vitis vinifera
emb|CBI35956.3|  unnamed protein product                                157   1e-39   Vitis vinifera
emb|CAN78639.1|  hypothetical protein VITISV_031738                     157   1e-39   Vitis vinifera
gb|KCW83494.1|  hypothetical protein EUGRSUZ_B00400                     157   1e-39   Eucalyptus grandis [rose gum]
ref|XP_010028675.1|  PREDICTED: ATPase 11, plasma membrane-type         157   1e-39   Eucalyptus grandis [rose gum]
ref|XP_008219933.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    156   1e-39   Prunus mume [ume]
gb|KEH35952.1|  plasma membrane H+-ATPase                               156   2e-39   Medicago truncatula
ref|XP_003603532.1|  Plasma membrane H+ ATPase                          156   2e-39   Medicago truncatula
gb|AAB41898.1|  H+-transporting ATPase                                  155   2e-39   Mesembryanthemum crystallinum
ref|XP_007023380.1|  H(+)-ATPase 9                                      155   2e-39   
ref|XP_009334638.1|  PREDICTED: ATPase 9, plasma membrane-type          155   2e-39   Pyrus x bretschneideri [bai li]
ref|XP_008381054.1|  PREDICTED: ATPase 9, plasma membrane-type          155   2e-39   
ref|XP_009419963.1|  PREDICTED: plasma membrane ATPase-like             155   2e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABM68570.1|  plasma membrane H+ ATPase                               145   2e-39   Lilium longiflorum [Easter lily]
ref|XP_004303259.1|  PREDICTED: ATPase 9, plasma membrane-type          155   2e-39   Fragaria vesca subsp. vesca
gb|AAY42948.1|  plasma membrane H+ ATPase                               155   2e-39   Lupinus albus
ref|XP_004498582.1|  PREDICTED: plasma membrane ATPase 4-like           155   2e-39   Cicer arietinum [garbanzo]
ref|XP_003550136.1|  PREDICTED: plasma membrane ATPase 4-like iso...    155   3e-39   Glycine max [soybeans]
emb|CAC29436.1|  P-type H+-ATPase                                       155   3e-39   Vicia faba [broad bean]
gb|KGN65225.1|  hypothetical protein Csa_1G267210                       154   3e-39   Cucumis sativus [cucumbers]
gb|KHN22686.1|  Plasma membrane ATPase 4                                155   4e-39   Glycine soja [wild soybean]
gb|KHN35778.1|  Plasma membrane ATPase 4                                149   4e-39   Glycine soja [wild soybean]
ref|XP_008781833.1|  PREDICTED: plasma membrane ATPase 4                155   4e-39   Phoenix dactylifera
ref|XP_009396235.1|  PREDICTED: plasma membrane ATPase                  155   4e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007011592.1|  Plasma membrane ATPase 4 isoform 1                 155   4e-39   
ref|XP_007217150.1|  hypothetical protein PRUPE_ppa000945mg             155   4e-39   Prunus persica
ref|XP_004146701.1|  PREDICTED: ATPase 8, plasma membrane-type-like     154   5e-39   Cucumis sativus [cucumbers]
gb|EPS66977.1|  hypothetical protein M569_07799                         154   5e-39   Genlisea aurea
gb|EYU22075.1|  hypothetical protein MIMGU_mgv1a000872mg                154   5e-39   Erythranthe guttata [common monkey flower]
gb|KHN16462.1|  Plasma membrane ATPase 4                                154   5e-39   Glycine soja [wild soybean]
ref|XP_003526452.1|  PREDICTED: plasma membrane ATPase 4 isoform 1      154   5e-39   Glycine max [soybeans]
ref|XP_003522660.1|  PREDICTED: plasma membrane ATPase 4-like iso...    154   5e-39   Glycine max [soybeans]
ref|XP_007137116.1|  hypothetical protein PHAVU_009G100900g             154   5e-39   Phaseolus vulgaris [French bean]
ref|XP_008789658.1|  PREDICTED: plasma membrane ATPase 4-like           154   6e-39   Phoenix dactylifera
ref|XP_011043940.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    154   6e-39   Populus euphratica
gb|KJB82763.1|  hypothetical protein B456_013G212200                    154   6e-39   Gossypium raimondii
dbj|BAD16687.1|  plasma membrane H+-ATPase                              154   6e-39   Daucus carota [carrots]
gb|KJB55190.1|  hypothetical protein B456_009G068100                    154   6e-39   Gossypium raimondii
gb|KHN17608.1|  Plasma membrane ATPase 4                                154   7e-39   Glycine soja [wild soybean]
ref|XP_003549363.1|  PREDICTED: plasma membrane ATPase 4-like iso...    154   7e-39   Glycine max [soybeans]
ref|XP_006845683.1|  hypothetical protein AMTR_s00019p00234460          154   7e-39   Amborella trichopoda
emb|CAD29579.1|  proton-exporting ATPase                                147   7e-39   Zea mays [maize]
gb|KHN15309.1|  Plasma membrane ATPase 4                                154   7e-39   Glycine soja [wild soybean]
ref|XP_003546412.1|  PREDICTED: plasma membrane ATPase 4-like iso...    154   7e-39   Glycine max [soybeans]
ref|XP_009588974.1|  PREDICTED: plasma membrane ATPase 4                154   8e-39   Nicotiana tomentosiformis
emb|CAD62443.1|  proton-exporting ATPase                                147   8e-39   Zea mays [maize]
ref|XP_006848755.1|  hypothetical protein AMTR_s00026p00033380          154   8e-39   Amborella trichopoda
ref|XP_008445089.1|  PREDICTED: plasma membrane ATPase 4-like           154   8e-39   Cucumis melo [Oriental melon]
ref|XP_004160843.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    154   8e-39   
ref|XP_007138806.1|  hypothetical protein PHAVU_009G239000g             154   9e-39   Phaseolus vulgaris [French bean]
ref|XP_009399554.1|  PREDICTED: plasma membrane ATPase isoform X4       154   9e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004487948.1|  PREDICTED: plasma membrane ATPase 4-like           154   9e-39   Cicer arietinum [garbanzo]
ref|XP_010913679.1|  PREDICTED: plasma membrane ATPase                  154   9e-39   Elaeis guineensis
ref|XP_008228760.1|  PREDICTED: ATPase 9, plasma membrane-type          154   9e-39   Prunus mume [ume]
ref|XP_009399553.1|  PREDICTED: plasma membrane ATPase isoform X3       154   1e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399552.1|  PREDICTED: plasma membrane ATPase isoform X2       154   1e-38   
ref|XP_004138879.1|  PREDICTED: plasma membrane ATPase 4-like           154   1e-38   
gb|KHG19606.1|  ATPase 5, plasma membrane-type -like protein            152   1e-38   Gossypium arboreum [tree cotton]
gb|AAY42949.1|  plasma membrane H+ ATPase                               154   1e-38   Lupinus albus
ref|XP_009399551.1|  PREDICTED: plasma membrane ATPase isoform X1       154   1e-38   
gb|KHM99449.1|  ATPase 5, plasma membrane-type                          154   1e-38   Glycine soja [wild soybean]
ref|XP_010929115.1|  PREDICTED: plasma membrane ATPase 4-like           154   1e-38   Elaeis guineensis
ref|XP_011017965.1|  PREDICTED: ATPase 8, plasma membrane-type-like     154   1e-38   Populus euphratica
ref|XP_003544641.1|  PREDICTED: plasma membrane ATPase 4-like iso...    154   1e-38   Glycine max [soybeans]
dbj|BAC77530.1|  plasma membrane H+-ATPase                              154   1e-38   Sesbania rostrata
ref|XP_009798265.1|  PREDICTED: plasma membrane ATPase 4                154   1e-38   Nicotiana sylvestris
ref|XP_008372282.1|  PREDICTED: plasma membrane ATPase 4-like           154   1e-38   Malus domestica [apple tree]
ref|XP_007154742.1|  hypothetical protein PHAVU_003G143800g             153   1e-38   Phaseolus vulgaris [French bean]
gb|KEH39758.1|  plasma membrane H+-ATPase                               153   1e-38   Medicago truncatula
gb|AAY42950.1|  plasma membrane H+ ATPase                               153   1e-38   Lupinus albus
ref|XP_010928676.1|  PREDICTED: plasma membrane ATPase-like             153   1e-38   Elaeis guineensis
gb|ACN33231.1|  unknown                                                 150   1e-38   Zea mays [maize]
ref|XP_008666713.1|  PREDICTED: plasma membrane ATPase-like             142   2e-38   
ref|XP_006586984.1|  PREDICTED: plasma membrane ATPase 4-like           153   2e-38   Glycine max [soybeans]
ref|XP_002325038.1|  plasma membrane H+ ATPase family protein           153   2e-38   
ref|XP_006652940.1|  PREDICTED: plasma membrane ATPase-like             153   2e-38   Oryza brachyantha
ref|XP_010942146.1|  PREDICTED: plasma membrane ATPase 4-like           153   2e-38   Elaeis guineensis
gb|KJB70727.1|  hypothetical protein B456_011G089100                    153   2e-38   Gossypium raimondii
gb|KJB55189.1|  hypothetical protein B456_009G068100                    153   2e-38   Gossypium raimondii
gb|EPS59184.1|  hypothetical protein M569_15622                         150   2e-38   Genlisea aurea
ref|XP_007161308.1|  hypothetical protein PHAVU_001G058900g             152   2e-38   Phaseolus vulgaris [French bean]
emb|CAA59799.1|  H(+)-transporting ATPase                               152   2e-38   Phaseolus vulgaris [French bean]
dbj|BAD16684.1|  plasma membrane H+-ATPase                              152   2e-38   Daucus carota [carrots]
gb|KJB19303.1|  hypothetical protein B456_003G094300                    152   3e-38   Gossypium raimondii
emb|CDP14278.1|  unnamed protein product                                153   3e-38   Coffea canephora [robusta coffee]
gb|AFW04239.1|  plasma membrane H+-ATPase                               152   3e-38   Sesuvium portulacastrum [sea-purslane]
gb|KGN52915.1|  hypothetical protein Csa_4G006220                       152   3e-38   Cucumis sativus [cucumbers]
gb|AEQ27822.1|  PM H+-ATPase R                                          152   3e-38   Eichhornia crassipes
ref|XP_008784794.1|  PREDICTED: plasma membrane ATPase 4-like iso...    152   3e-38   Phoenix dactylifera
ref|XP_009390572.1|  PREDICTED: ATPase 9, plasma membrane-type          152   3e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008784793.1|  PREDICTED: plasma membrane ATPase 4-like iso...    152   3e-38   Phoenix dactylifera
dbj|BAA37150.1|  p-type H+-ATPase                                       152   4e-38   Vicia faba [broad bean]
ref|XP_003610080.1|  Plasma membrane H+-ATPase                          152   4e-38   Medicago truncatula
ref|XP_009338825.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     152   4e-38   Pyrus x bretschneideri [bai li]
ref|XP_008454207.1|  PREDICTED: ATPase 9, plasma membrane-type          152   4e-38   Cucumis melo [Oriental melon]
ref|XP_004171153.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    152   4e-38   
ref|XP_004152192.1|  PREDICTED: ATPase 9, plasma membrane-type-like     152   4e-38   
ref|XP_002447249.1|  hypothetical protein SORBIDRAFT_06g031240          152   4e-38   
ref|XP_002515334.1|  H(\+)-transporting atpase plant/fungi plasma...    150   5e-38   
dbj|BAD16688.1|  plasma membrane H+-ATPase                              152   5e-38   
ref|XP_009347012.1|  PREDICTED: plasma membrane ATPase 4-like           152   5e-38   
ref|XP_009417440.1|  PREDICTED: plasma membrane ATPase-like             152   5e-38   
gb|ABO15469.2|  plasma membrane H+-ATPase LilHA2                        152   5e-38   
ref|XP_002324564.1|  ATPase 6 family protein                            152   5e-38   
ref|XP_003594954.1|  Plasma membrane ATPase                             151   6e-38   
gb|AAK31799.2|  plasma membrane H+ ATPase                               151   6e-38   
dbj|BAG94605.1|  unnamed protein product                                151   6e-38   
ref|XP_008663681.1|  PREDICTED: plasma membrane ATPase isoform X2       151   6e-38   
gb|AFW59711.1|  plasma membrane H+-transporting ATPase-like protein     151   7e-38   
ref|XP_008360343.1|  PREDICTED: plasma membrane ATPase 4                151   7e-38   
ref|XP_008663679.1|  PREDICTED: plasma membrane ATPase isoform X1       151   7e-38   
emb|CAD29313.1|  plasma membrane H+-ATPase                              151   7e-38   
ref|NP_001054118.1|  Os04g0656100                                       151   7e-38   
gb|EAZ32257.1|  hypothetical protein OsJ_16461                          151   7e-38   
ref|XP_010688454.1|  PREDICTED: plasma membrane ATPase 4                151   8e-38   
emb|CDP02997.1|  unnamed protein product                                151   8e-38   
gb|ACL54575.1|  unknown                                                 151   8e-38   
ref|XP_008668762.1|  PREDICTED: plasma membrane ATPase                  151   8e-38   
sp|Q03194.1|PMA4_NICPL  RecName: Full=Plasma membrane ATPase 4; A...    151   8e-38   
ref|XP_011079289.1|  PREDICTED: plasma membrane ATPase 4-like           151   8e-38   
emb|CDP14275.1|  unnamed protein product                                149   8e-38   
ref|XP_010276726.1|  PREDICTED: plasma membrane ATPase 4-like           151   8e-38   
gb|AAO72564.1|  plasma membrane H+-ATPase-like protein                  148   8e-38   
ref|XP_009394581.1|  PREDICTED: plasma membrane ATPase-like             151   9e-38   
emb|CBW30173.1|  Plasma membrane ATPase 4                               151   9e-38   
ref|XP_004501246.1|  PREDICTED: plasma membrane ATPase 4-like           151   9e-38   
ref|XP_002263241.1|  PREDICTED: ATPase 8, plasma membrane-type          151   9e-38   
emb|CAN61424.1|  hypothetical protein VITISV_027272                     151   1e-37   
ref|XP_011082086.1|  PREDICTED: plasma membrane ATPase 4-like           151   1e-37   
ref|XP_009368031.1|  PREDICTED: plasma membrane ATPase 4-like           150   1e-37   
ref|XP_009363612.1|  PREDICTED: plasma membrane ATPase 4-like           150   1e-37   
ref|XP_004507873.1|  PREDICTED: plasma membrane ATPase 4-like           150   1e-37   
gb|AAB17186.1|  plasma membrane H+-ATPase                               150   1e-37   
ref|XP_004242908.1|  PREDICTED: plasma membrane ATPase 4                150   1e-37   
ref|NP_001274848.1|  plasma membrane ATPase 4-like                      150   1e-37   
gb|KCW49373.1|  hypothetical protein EUGRSUZ_K02916                     150   1e-37   
gb|KDP42000.1|  hypothetical protein JCGZ_27018                         150   1e-37   
ref|XP_006837363.1|  hypothetical protein AMTR_s00111p00107570          150   1e-37   
emb|CBW30211.1|  Plasma membrane ATPase                                 150   1e-37   
ref|XP_002267501.1|  PREDICTED: plasma membrane ATPase 4                150   1e-37   
gb|KDP35383.1|  hypothetical protein JCGZ_10367                         150   2e-37   
ref|XP_011033475.1|  PREDICTED: ATPase 8, plasma membrane-type          150   2e-37   
ref|XP_002309321.1|  ATPase 6 family protein                            150   2e-37   
ref|XP_004960134.1|  PREDICTED: plasma membrane ATPase-like             150   2e-37   
emb|CAG28306.1|  proton-exporting ATPase                                144   2e-37   
gb|KHN22411.1|  ATPase 9, plasma membrane-type                          150   2e-37   
gb|KEH39623.1|  plasma membrane H+-ATPase                               150   2e-37   
gb|KDP33445.1|  hypothetical protein JCGZ_07016                         150   2e-37   
ref|XP_003547446.1|  PREDICTED: ATPase 9, plasma membrane-type-like     150   2e-37   
ref|XP_009384769.1|  PREDICTED: plasma membrane ATPase-like             150   2e-37   
ref|XP_010094202.1|  Plasma membrane ATPase 4                           150   2e-37   
ref|XP_006453323.1|  hypothetical protein CICLE_v10007368mg             150   2e-37   
ref|XP_008810004.1|  PREDICTED: plasma membrane ATPase                  150   2e-37   
emb|CAN64375.1|  hypothetical protein VITISV_014422                     150   2e-37   
ref|XP_009381583.1|  PREDICTED: plasma membrane ATPase-like             150   2e-37   
gb|AEO22063.1|  plasma membrane H+-ATPase                               150   2e-37   
ref|XP_006404985.1|  hypothetical protein EUTSA_v10000729mg             140   2e-37   
gb|EMS63640.1|  Plasma membrane ATPase 1                                150   2e-37   
ref|XP_002532086.1|  H(\+)-transporting atpase plant/fungi plasma...    150   2e-37   
ref|XP_006293643.1|  hypothetical protein CARUB_v10022598mg             150   2e-37   
ref|XP_006453324.1|  hypothetical protein CICLE_v10007368mg             150   2e-37   
emb|CDP04837.1|  unnamed protein product                                141   2e-37   
ref|XP_011031360.1|  PREDICTED: plasma membrane ATPase 4-like           150   3e-37   
ref|XP_006382164.1|  H+-ATPase family protein                           150   3e-37   
ref|XP_006381782.1|  hypothetical protein POPTR_0006s17960g             149   3e-37   
ref|XP_004486623.1|  PREDICTED: plasma membrane ATPase 4-like           149   3e-37   
ref|XP_008443886.1|  PREDICTED: ATPase 8, plasma membrane-type          149   3e-37   
gb|KJB65971.1|  hypothetical protein B456_010G123000                    149   3e-37   
gb|KHN01287.1|  Plasma membrane ATPase 4                                149   3e-37   
ref|XP_007014223.1|  Plasma membrane ATPase 4 isoform 3                 149   3e-37   
gb|KDO72462.1|  hypothetical protein CISIN_1g0021762mg                  149   3e-37   
ref|XP_004291218.1|  PREDICTED: plasma membrane ATPase 4-like iso...    149   3e-37   
gb|KHF98166.1|  Plasma membrane ATPase 4                                147   3e-37   
ref|XP_010097155.1|  ATPase 9, plasma membrane-type                     149   3e-37   
ref|XP_011459045.1|  PREDICTED: plasma membrane ATPase 4-like iso...    149   3e-37   
ref|XP_006465284.1|  PREDICTED: ATPase 9, plasma membrane-type-like     149   3e-37   
ref|XP_003529784.1|  PREDICTED: plasma membrane ATPase 4-like           149   3e-37   
gb|KDO45595.1|  hypothetical protein CISIN_1g044543mg                   149   3e-37   
ref|XP_006427547.1|  hypothetical protein CICLE_v10027127mg             149   3e-37   
ref|XP_009338824.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     149   4e-37   
ref|XP_007014221.1|  Plasma membrane ATPase 4 isoform 1                 149   4e-37   
gb|KHN31888.1|  ATPase 9, plasma membrane-type                          149   4e-37   
gb|KJB33642.1|  hypothetical protein B456_006G023600                    149   4e-37   
ref|XP_010914190.1|  PREDICTED: plasma membrane ATPase-like             149   4e-37   
ref|NP_001105470.1|  plasma-membrane H+ATPase2                          149   4e-37   
ref|XP_008393957.1|  PREDICTED: plasma membrane ATPase 4                149   4e-37   
ref|XP_008367709.1|  PREDICTED: plasma membrane ATPase 4                149   5e-37   
dbj|BAO45902.1|  plasma membrane H+-ATPase                              149   5e-37   
ref|XP_003543699.1|  PREDICTED: ATPase 9, plasma membrane-type-like     149   5e-37   
ref|XP_006428675.1|  hypothetical protein CICLE_v10013498mg             149   6e-37   
ref|XP_008223752.1|  PREDICTED: plasma membrane ATPase 4                149   6e-37   
gb|AHK23067.1|  plasma membrane ATPase 4                                149   7e-37   
gb|KDO61837.1|  hypothetical protein CISIN_1g002208mg                   149   7e-37   
ref|XP_010526269.1|  PREDICTED: ATPase 5, plasma membrane-type is...    148   7e-37   
dbj|BAC77531.1|  plasma membrane H+-ATPase                              148   7e-37   
ref|XP_010526268.1|  PREDICTED: ATPase 5, plasma membrane-type is...    148   7e-37   
ref|XP_007225493.1|  hypothetical protein PRUPE_ppa000937mg             148   8e-37   
ref|XP_002991931.1|  hypothetical protein SELMODRAFT_430150             148   9e-37   
ref|XP_002527322.1|  H(\+)-transporting atpase plant/fungi plasma...    147   9e-37   
gb|KJB53771.1|  hypothetical protein B456_009G004200                    147   9e-37   
gb|AAB84202.2|  plasma membrane proton ATPase                           148   1e-36   
gb|EYU31795.1|  hypothetical protein MIMGU_mgv1a000883mg                148   1e-36   
gb|KJB56561.1|  hypothetical protein B456_009G125200                    148   1e-36   
ref|XP_009401466.1|  PREDICTED: plasma membrane ATPase-like             148   1e-36   
gb|KJB22047.1|  hypothetical protein B456_004G027300                    147   1e-36   
ref|XP_011002373.1|  PREDICTED: ATPase 8, plasma membrane-type-like     147   1e-36   
ref|XP_002307856.1|  ATPase 6 family protein                            147   1e-36   
ref|XP_010691622.1|  PREDICTED: plasma membrane ATPase isoform X1       147   2e-36   
ref|XP_009397034.1|  PREDICTED: plasma membrane ATPase-like             147   2e-36   
gb|KJB22048.1|  hypothetical protein B456_004G027300                    147   2e-36   
ref|XP_009398632.1|  PREDICTED: plasma membrane ATPase-like             147   2e-36   
dbj|BAL41366.1|  plasma membrane H+-ATPase                              147   2e-36   
ref|XP_008451563.1|  PREDICTED: plasma membrane ATPase 4                147   2e-36   
ref|XP_002979990.1|  hypothetical protein SELMODRAFT_419690             147   2e-36   
ref|XP_008386550.1|  PREDICTED: ATPase 9, plasma membrane-type-like     147   2e-36   
ref|XP_004296457.1|  PREDICTED: plasma membrane ATPase 4                147   2e-36   
gb|AAD46186.1|  plasma membrane proton ATPase                           147   2e-36   
ref|XP_006389820.1|  hypothetical protein EUTSA_v10018080mg             147   3e-36   
gb|ACE77057.1|  plasma membrane proton pump                             147   3e-36   
ref|XP_004148326.1|  PREDICTED: plasma membrane ATPase 4-like           147   3e-36   
ref|XP_007023381.1|  H(+)-ATPase 9                                      147   3e-36   
ref|XP_007150788.1|  hypothetical protein PHAVU_005G180700g             147   3e-36   
gb|EYU37313.1|  hypothetical protein MIMGU_mgv1a000870mg                147   3e-36   
ref|XP_011069930.1|  PREDICTED: plasma membrane ATPase 4                147   3e-36   
dbj|BAM20989.1|  plasma membrane H+-ATPase                              147   3e-36   
ref|XP_011078614.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    146   3e-36   
ref|XP_006341374.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    146   4e-36   
gb|EPS65442.1|  hypothetical protein M569_09334                         146   4e-36   
gb|KFK42449.1|  hypothetical protein AALP_AA2G258100                    146   5e-36   
gb|KCW81010.1|  hypothetical protein EUGRSUZ_C023861                    146   5e-36   
gb|KHG26452.1|  Plasma membrane ATPase 4                                144   5e-36   
ref|XP_010048663.1|  PREDICTED: plasma membrane ATPase 4                146   5e-36   
ref|XP_009381563.1|  PREDICTED: plasma membrane ATPase 4-like           146   5e-36   
ref|XP_010047150.1|  PREDICTED: ATPase 8, plasma membrane-type-like     146   5e-36   
ref|XP_009773901.1|  PREDICTED: plasma membrane ATPase 4-like           146   5e-36   
ref|XP_010259861.1|  PREDICTED: plasma membrane ATPase                  146   6e-36   
gb|KHG28536.1|  Plasma membrane ATPase 4                                144   6e-36   
gb|AAB35314.2|  plasma membrane H(+)-ATPase precursor                   146   6e-36   
ref|XP_010929278.1|  PREDICTED: plasma membrane ATPase-like             146   6e-36   
ref|XP_007135798.1|  hypothetical protein PHAVU_010G159400g             145   6e-36   
ref|XP_010669283.1|  PREDICTED: plasma membrane ATPase 4-like           145   8e-36   
gb|KJB22049.1|  hypothetical protein B456_004G027300                    144   8e-36   
ref|XP_008804905.1|  PREDICTED: plasma membrane ATPase-like             145   9e-36   
ref|XP_008378243.1|  PREDICTED: plasma membrane ATPase 4-like           145   1e-35   
gb|AFM52333.1|  plasma membrane H+-ATPase                               145   1e-35   
ref|XP_010046967.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     145   1e-35   
gb|AAK60570.1|  H+-ATPase                                               134   1e-35   
ref|XP_010046966.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     145   1e-35   
ref|XP_010472461.1|  PREDICTED: ATPase 5, plasma membrane-type          145   1e-35   
ref|XP_010429928.1|  PREDICTED: ATPase 9, plasma membrane-type-like     138   1e-35   
dbj|BAA08134.1|  putative plasma membrane H+-ATPase                     145   1e-35   
ref|XP_010537896.1|  PREDICTED: ATPase 9, plasma membrane-type          145   1e-35   
ref|XP_002324397.1|  H+-ATPase family protein                           144   2e-35   
ref|XP_010533093.1|  PREDICTED: ATPase 6, plasma membrane-type          144   2e-35   
emb|CBI20766.3|  unnamed protein product                                144   2e-35   
ref|NP_180028.1|  H(+)-ATPase 5                                         144   3e-35   
sp|Q9SJB3.3|PMA5_ARATH  RecName: Full=ATPase 5, plasma membrane-t...    144   3e-35   
ref|XP_002282619.1|  PREDICTED: plasma membrane ATPase 4                144   3e-35   
ref|XP_011082157.1|  PREDICTED: plasma membrane ATPase 4-like           144   3e-35   
ref|XP_004235922.1|  PREDICTED: plasma membrane ATPase 4                144   3e-35   
ref|XP_010049874.1|  PREDICTED: ATPase 8, plasma membrane-type is...    144   3e-35   
ref|XP_010049873.1|  PREDICTED: ATPase 8, plasma membrane-type is...    144   3e-35   
ref|XP_011084026.1|  PREDICTED: ATPase 8, plasma membrane-type-like     144   3e-35   
ref|XP_009104474.1|  PREDICTED: ATPase 9, plasma membrane-type          144   4e-35   
ref|XP_011045011.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     143   5e-35   
gb|KCW80694.1|  hypothetical protein EUGRSUZ_C02092                     142   5e-35   
ref|XP_011084023.1|  PREDICTED: ATPase 8, plasma membrane-type-like     143   5e-35   
ref|XP_004973040.1|  PREDICTED: plasma membrane ATPase-like             143   6e-35   
ref|XP_003580730.1|  PREDICTED: plasma membrane ATPase                  143   7e-35   
ref|XP_010048446.1|  PREDICTED: plasma membrane ATPase 4                142   7e-35   
emb|CDY39956.1|  BnaC06g40340D                                          142   8e-35   
ref|XP_009410182.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    142   8e-35   
ref|XP_009410181.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    142   8e-35   
ref|NP_001185450.1|  H(+)-ATPase 9                                      142   8e-35   
gb|KJB66333.1|  hypothetical protein B456_010G136300                    142   8e-35   
ref|NP_178181.1|  H(+)-ATPase 9                                         142   8e-35   
ref|XP_007012006.1|  H(+)-ATPase 8                                      142   9e-35   
emb|CDX87330.1|  BnaA07g35430D                                          142   1e-34   
ref|XP_006300372.1|  hypothetical protein CARUB_v10022427mg             142   1e-34   
ref|XP_010467151.1|  PREDICTED: ATPase 6, plasma membrane-type-like     136   1e-34   
gb|KFK39922.1|  hypothetical protein AALP_AA3G306500                    142   1e-34   
ref|XP_009106729.1|  PREDICTED: ATPase 9, plasma membrane-type          142   1e-34   
gb|KHN38020.1|  Plasma membrane ATPase                                  142   1e-34   
emb|CDO98206.1|  unnamed protein product                                142   1e-34   
ref|XP_011084027.1|  PREDICTED: ATPase 8, plasma membrane-type-like     142   1e-34   
gb|KDO37765.1|  hypothetical protein CISIN_1g048662mg                   134   2e-34   
ref|XP_010932230.1|  PREDICTED: plasma membrane ATPase 4                142   2e-34   
gb|KFK27866.1|  hypothetical protein AALP_AA8G439300                    142   2e-34   
dbj|BAF03589.1|  P-type H+-ATPase                                       142   2e-34   
gb|EYU20899.1|  hypothetical protein MIMGU_mgv1a000880mg                142   2e-34   
ref|XP_002523524.1|  H(\+)-transporting atpase plant/fungi plasma...    140   2e-34   
gb|AAO22672.1|  putative plasma membrane proton ATPase                  136   2e-34   
gb|EYU25317.1|  hypothetical protein MIMGU_mgv1a000893mg                141   2e-34   
ref|XP_010919703.1|  PREDICTED: plasma membrane ATPase 1-like iso...    140   2e-34   
gb|AAF27113.1|AC018849_1  aha9, 5' partial; 1-2403                      139   2e-34   
ref|XP_010919702.1|  PREDICTED: plasma membrane ATPase 1-like iso...    140   2e-34   
ref|XP_008232467.1|  PREDICTED: plasma membrane ATPase 1-like iso...    141   2e-34   
ref|XP_008232466.1|  PREDICTED: plasma membrane ATPase 1-like iso...    141   2e-34   
ref|XP_010919701.1|  PREDICTED: plasma membrane ATPase 1-like iso...    140   3e-34   
ref|XP_010919699.1|  PREDICTED: plasma membrane ATPase 1-like iso...    140   3e-34   
ref|NP_189850.1|  H(+)-ATPase 8                                         141   3e-34   
ref|XP_009607951.1|  PREDICTED: plasma membrane ATPase 4-like           140   3e-34   
ref|XP_011010708.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    140   4e-34   
ref|XP_010496144.1|  PREDICTED: ATPase 6, plasma membrane-type-like     140   4e-34   
ref|XP_010488815.1|  PREDICTED: ATPase 6, plasma membrane-type          140   4e-34   
ref|XP_006279406.1|  hypothetical protein CARUB_v10007959mg             140   4e-34   
ref|NP_178762.1|  H(+)-ATPase 6                                         140   4e-34   
ref|XP_006343689.1|  PREDICTED: ATPase 8, plasma membrane-type-like     140   4e-34   
ref|XP_010687728.1|  PREDICTED: ATPase 8, plasma membrane-type-like     140   4e-34   
ref|XP_010472896.1|  PREDICTED: ATPase 9, plasma membrane-type is...    140   5e-34   
ref|XP_010417678.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    140   5e-34   
ref|XP_011031934.1|  PREDICTED: plasma membrane ATPase 1                140   5e-34   
ref|XP_010472893.1|  PREDICTED: ATPase 9, plasma membrane-type is...    140   5e-34   
ref|XP_004253510.2|  PREDICTED: ATPase 8, plasma membrane-type-like     140   5e-34   
ref|XP_004242977.2|  PREDICTED: ATPase 8, plasma membrane-type-like     140   5e-34   
ref|XP_006343688.1|  PREDICTED: ATPase 8, plasma membrane-type-like     140   5e-34   
gb|ABA18112.1|  putative plasma membrane ATPase                         140   5e-34   



>gb|AAA34096.1| plasma membrane H+ ATPase, partial [Nicotiana plumbaginifolia]
Length=440

 Score =   209 bits (531),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN +FAAIEGIGWGWAGVIWLYNLV YFPLD+IKF  RYALSG+AWDLVLEQRIAFTRK
Sbjct  296  YANWAFAAIEGIGWGWAGVIWLYNLVFYFPLDIIKFLIRYALSGRAWDLVLEQRIAFTRK  355

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFN+LNQLAEEAKRRAEIAR RELHT
Sbjct  356  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNELNQLAEEAKRRAEIARQRELHT  415

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  416  LKGHVESVVKLKGLDIETIQQSYTV  440



>gb|AAA34052.1| H+-translocating ATPase [Nicotiana plumbaginifolia]
Length=956

 Score =   213 bits (542),  Expect = 6e-60, Method: Composition-based stats.
 Identities = 135/145 (93%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN +FAAIEGIGWGWAGVIWLYNLV YFPLD+IKF  RYALSG+AWDLVLEQRIAFTRK
Sbjct  812  YANWAFAAIEGIGWGWAGVIWLYNLVFYFPLDIIKFLIRYALSGRAWDLVLEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFN+LNQLAEEAKRRAEIAR RELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNELNQLAEEAKRRAEIARQRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  932  LKGHVESVVKLKGLDIETIQQSYTV  956



>ref|XP_009793289.1| PREDICTED: plasma membrane ATPase 2 [Nicotiana sylvestris]
Length=956

 Score =   213 bits (541),  Expect = 9e-60, Method: Composition-based stats.
 Identities = 116/124 (94%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYNLV YFPLD+IKF  RYALSG+AWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG
Sbjct  833  LYNLVFYFPLDIIKFLIRYALSGRAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQVPDTKLFSEATNFN+LNQLAEEAKRRAEIAR RELHTLKGHVESVVKLKGLDIETIQQ
Sbjct  893  LQVPDTKLFSEATNFNELNQLAEEAKRRAEIARQRELHTLKGHVESVVKLKGLDIETIQQ  952

Query  288  AYTV  277
            +YTV
Sbjct  953  SYTV  956



>ref|XP_009610426.1| PREDICTED: plasma membrane ATPase 2 [Nicotiana tomentosiformis]
Length=956

 Score =   213 bits (541),  Expect = 9e-60, Method: Composition-based stats.
 Identities = 116/124 (94%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYNLV YFPLD+IKF  RYALSG+AWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG
Sbjct  833  LYNLVFYFPLDIIKFLIRYALSGRAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQVPDTKLFSEATNFN+LNQLAEEAKRRAEIAR RELHTLKGHVESVVKLKGLDIETIQQ
Sbjct  893  LQVPDTKLFSEATNFNELNQLAEEAKRRAEIARQRELHTLKGHVESVVKLKGLDIETIQQ  952

Query  288  AYTV  277
            +YTV
Sbjct  953  SYTV  956



>ref|NP_001234477.1| plasma membrane H+-ATPase [Solanum lycopersicum]
 gb|AAD55399.1|AF179442_1 plasma membrane H+-ATPase isoform LHA2 [Solanum lycopersicum]
 gb|AAF98344.1|AF275745_1 plasma membrane H+-ATPase [Solanum lycopersicum]
Length=956

 Score =   213 bits (541),  Expect = 9e-60, Method: Composition-based stats.
 Identities = 116/124 (94%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYNLV YFPLD+IKF  RYALSG+AWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG
Sbjct  833  LYNLVFYFPLDIIKFLIRYALSGRAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQVPDTKLFSEATNFN+LNQLAEEAKRRAEIAR RELHTLKGHVESVVKLKGLDIETIQQ
Sbjct  893  LQVPDTKLFSEATNFNELNQLAEEAKRRAEIARQRELHTLKGHVESVVKLKGLDIETIQQ  952

Query  288  AYTV  277
            +YTV
Sbjct  953  SYTV  956



>ref|XP_009798932.1| PREDICTED: plasma membrane ATPase 1 [Nicotiana sylvestris]
Length=957

 Score =   212 bits (539),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 136/145 (94%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYNLV Y PLD+IKFF RYALSG+AWDLV E+RIAFTRK
Sbjct  813  YANWSFAAIEGIGWGWAGVIWLYNLVFYIPLDIIKFFIRYALSGRAWDLVFERRIAFTRK  872

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFN+LNQLAEEAKRRAEIARLRELHT
Sbjct  873  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNELNQLAEEAKRRAEIARLRELHT  932

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVVKLKGLDIETIQQAYTV
Sbjct  933  LKGHVESVVKLKGLDIETIQQAYTV  957



>ref|XP_009607762.1| PREDICTED: plasma membrane ATPase 1 [Nicotiana tomentosiformis]
Length=957

 Score =   212 bits (539),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 136/145 (94%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYNLV Y PLD+IKFF RYALSG+AWDLV E+RIAFTRK
Sbjct  813  YANWSFAAIEGIGWGWAGVIWLYNLVFYIPLDIIKFFIRYALSGRAWDLVFERRIAFTRK  872

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFN+LNQLAEEAKRRAEIARLRELHT
Sbjct  873  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNELNQLAEEAKRRAEIARLRELHT  932

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVVKLKGLDIETIQQAYTV
Sbjct  933  LKGHVESVVKLKGLDIETIQQAYTV  957



>ref|XP_006354801.1| PREDICTED: plasma membrane ATPase 1-like [Solanum tuberosum]
Length=956

 Score =   211 bits (538),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 115/124 (93%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYNLV YFPLD+IKF  RYALSG+AWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG
Sbjct  833  LYNLVFYFPLDIIKFLIRYALSGRAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQVPDTKLFSE+TNFN+LNQLAEEAKRRAEIAR RELHTLKGHVESVVKLKGLDIETIQQ
Sbjct  893  LQVPDTKLFSESTNFNELNQLAEEAKRRAEIARQRELHTLKGHVESVVKLKGLDIETIQQ  952

Query  288  AYTV  277
            +YTV
Sbjct  953  SYTV  956



>ref|NP_001274861.1| plasma membrane ATPase 1-like [Solanum tuberosum]
 emb|CAA54046.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=956

 Score =   211 bits (538),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 115/124 (93%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYNLV YFPLD+IKF  RYALSG+AWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG
Sbjct  833  LYNLVFYFPLDIIKFLIRYALSGRAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQVPDTKLFSE+TNFN+LNQLAEEAKRRAEIAR RELHTLKGHVESVVKLKGLDIETIQQ
Sbjct  893  LQVPDTKLFSESTNFNELNQLAEEAKRRAEIARQRELHTLKGHVESVVKLKGLDIETIQQ  952

Query  288  AYTV  277
            +YTV
Sbjct  953  SYTV  956



>sp|Q08435.1|PMA1_NICPL RecName: Full=Plasma membrane ATPase 1; AltName: Full=Proton 
pump 1 [Nicotiana plumbaginifolia]
 gb|AAA34094.1| plasma membrane H+ ATPase [Nicotiana plumbaginifolia]
Length=957

 Score =   211 bits (536),  Expect = 4e-59, Method: Composition-based stats.
 Identities = 135/145 (93%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIW+YNLV Y PLD+IKFF RYALSG+AWDLV E+RIAFTRK
Sbjct  813  YANWSFAAIEGIGWGWAGVIWIYNLVFYIPLDIIKFFIRYALSGRAWDLVFERRIAFTRK  872

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFN+LNQLAEEAKRRAEIARLRELHT
Sbjct  873  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNELNQLAEEAKRRAEIARLRELHT  932

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVVKLKGLDIETIQQAYTV
Sbjct  933  LKGHVESVVKLKGLDIETIQQAYTV  957



>ref|XP_009626987.1| PREDICTED: plasma membrane ATPase 3 [Nicotiana tomentosiformis]
Length=956

 Score =   209 bits (533),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 134/145 (92%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN+V Y PLDL+KFF RYALSGKAWDLV+EQRIAFTRK
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDLVKFFIRYALSGKAWDLVIEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQVPD K+FSE TNFN+LNQLAEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQVPDPKIFSETTNFNELNQLAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVVKLKGLDIETIQQAYTV
Sbjct  932  LKGHVESVVKLKGLDIETIQQAYTV  956



>ref|XP_009799220.1| PREDICTED: plasma membrane ATPase 3 [Nicotiana sylvestris]
Length=956

 Score =   209 bits (531),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 134/145 (92%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN+V Y PLDLIKFF RYALSGKAWDLV+EQRIAFTRK
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDLIKFFIRYALSGKAWDLVIEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQVPD K+FSE TNFN+LNQLAEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQVPDPKIFSETTNFNELNQLAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  932  LKGHVESVVKLKGLDIETIQQSYTV  956



>emb|CDP14881.1| unnamed protein product [Coffea canephora]
Length=950

 Score =   208 bits (530),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 133/145 (92%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYNL+ Y PLD IKFFTRYALSG+AWDLVLEQRIAFTR+
Sbjct  806  YANWSFAAIEGIGWGWAGVIWLYNLIFYIPLDFIKFFTRYALSGRAWDLVLEQRIAFTRQ  865

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQREL+WAHAQRTLHGLQVPDTKLFSEATNF +LNQLAEEAKRRAEIARLRELHT
Sbjct  866  KDFGKEQRELKWAHAQRTLHGLQVPDTKLFSEATNFTELNQLAEEAKRRAEIARLRELHT  925

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  926  LKGHVESVVRLKGLDIDTIQQAYTV  950



>sp|P23980.1|PMA2_SOLLC RecName: Full=Plasma membrane ATPase 2; AltName: Full=Proton 
pump 2, partial [Solanum lycopersicum]
Length=704

 Score =   206 bits (524),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YA+ SFAAIEGIGWGWAGVIWLYNLV YFPLD+IKF  RYALSG+AWDLVLEQRIAFTRK
Sbjct  560  YASWSFAAIEGIGWGWAGVIWLYNLVFYFPLDIIKFLIRYALSGRAWDLVLEQRIAFTRK  619

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQVPD KLFSEATNFN+LNQLAEEAKRRAEIAR RELHT
Sbjct  620  KDFGKEQRELQWAHAQRTLHGLQVPDIKLFSEATNFNELNQLAEEAKRRAEIARQRELHT  679

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  680  LKGHVESVVKLKGLDIETIQQSYTV  704



>gb|EYU35892.1| hypothetical protein MIMGU_mgv1a0008592mg, partial [Erythranthe 
guttata]
Length=267

 Score =   196 bits (497),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN++ Y PLD+IKF TRYALSG+AWDLVLEQRIAFTR+
Sbjct  123  YANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDIIKFLTRYALSGRAWDLVLEQRIAFTRQ  182

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQREL+WAHAQRTLHGLQVPDTKLF+E  NF++LNQLAEEAKRRAEIARLRELHT
Sbjct  183  KDFGKEQRELKWAHAQRTLHGLQVPDTKLFNENNNFSELNQLAEEAKRRAEIARLRELHT  242

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  243  LKGHVESVVRLKGLDIDTIQQAYTV  267



>ref|NP_001234775.1| plasma membrane ATPase 1 [Solanum lycopersicum]
 sp|P22180.1|PMA1_SOLLC RecName: Full=Plasma membrane ATPase 1; AltName: Full=Proton 
pump 1 [Solanum lycopersicum]
 gb|AAA34173.1| H+-ATPase [Solanum lycopersicum]
 prf||1803518A H ATPase
Length=956

 Score =   205 bits (521),  Expect = 5e-57, Method: Composition-based stats.
 Identities = 133/145 (92%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN+V Y PLDLIKF  RYALSGKAWDLVLEQRIAFTRK
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIVTYIPLDLIKFLIRYALSGKAWDLVLEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE RELQWAHAQRTLHGLQVPD K+FSE TNFN+LNQLAEEAKRRAEIARLRELHT
Sbjct  872  KDFGKELRELQWAHAQRTLHGLQVPDPKIFSETTNFNELNQLAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  932  LKGHVESVVKLKGLDIETIQQSYTV  956



>ref|XP_006367061.1| PREDICTED: plasma membrane ATPase 1-like [Solanum tuberosum]
Length=956

 Score =   205 bits (521),  Expect = 5e-57, Method: Composition-based stats.
 Identities = 133/145 (92%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN+V Y PLDLIKF  RYALSGKAWDLVLEQRIAFTRK
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIVTYIPLDLIKFLIRYALSGKAWDLVLEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE RELQWAHAQRTLHGLQVPD K+FSE TNFN+LNQLAEEAKRRAEIARLRELHT
Sbjct  872  KDFGKELRELQWAHAQRTLHGLQVPDPKIFSETTNFNELNQLAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  932  LKGHVESVVKLKGLDIETIQQSYTV  956



>sp|Q08436.1|PMA3_NICPL RecName: Full=Plasma membrane ATPase 3; AltName: Full=Proton 
pump 3 [Nicotiana plumbaginifolia]
 gb|AAA34098.1| plasma membrane H+ ATPase [Nicotiana plumbaginifolia]
Length=956

 Score =   203 bits (517),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 132/145 (91%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN+V Y PLDL  F  RYALSGKAWDLV+EQRIAFTRK
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDLXXFLIRYALSGKAWDLVIEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQVPD K+FSE TNFN+LNQLAEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQVPDPKIFSETTNFNELNQLAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVVKLKGLDIETIQQAYTV
Sbjct  932  LKGHVESVVKLKGLDIETIQQAYTV  956



>ref|XP_011087207.1| PREDICTED: plasma membrane ATPase 3 [Sesamum indicum]
Length=956

 Score =   203 bits (516),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 129/145 (89%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN++ Y PLD+IKFF RYALSG+AWDLVLEQRIAFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDIIKFFIRYALSGRAWDLVLEQRIAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQREL+WAHAQRTLHGLQVPDTKLF+E TNF++LNQLAEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELKWAHAQRTLHGLQVPDTKLFNETTNFSELNQLAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  932  LKGHVESVVRLKGLDIDTIQQAYTV  956



>ref|XP_010112580.1| ATPase 11, plasma membrane-type [Morus notabilis]
 gb|EXC34215.1| ATPase 11, plasma membrane-type [Morus notabilis]
Length=950

 Score =   201 bits (511),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 126/145 (87%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGV+WLYN++ Y PLDLIKFF RYALSG+AWDLV+EQRIAFTR+
Sbjct  806  YANWSFAAIEGIGWGWAGVVWLYNIIFYIPLDLIKFFIRYALSGRAWDLVIEQRIAFTRQ  865

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+FN+LNQ+AEEAKRRAEIARLRELHT
Sbjct  866  KDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFNELNQMAEEAKRRAEIARLRELHT  925

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  926  LKGHVESVVRLKGLDIDTIQQAYTV  950



>ref|XP_011071717.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 3 [Sesamum 
indicum]
Length=952

 Score =   200 bits (508),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 128/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN++ Y PLD+IKF  RYALSG+AWDLVLEQRIAFTRK
Sbjct  808  YANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDIIKFLIRYALSGRAWDLVLEQRIAFTRK  867

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQREL+WAHAQRTLHGLQVPDTKLF+E  NF++LNQLAEEAKRRAEIARLRELHT
Sbjct  868  KDFGKEQRELKWAHAQRTLHGLQVPDTKLFNETNNFSELNQLAEEAKRRAEIARLRELHT  927

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  928  LKGHVESVVRLKGLDIDTIQQAYTV  952



>ref|XP_008239652.1| PREDICTED: ATPase 11, plasma membrane-type [Prunus mume]
Length=956

 Score =   199 bits (506),  Expect = 7e-55, Method: Composition-based stats.
 Identities = 127/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYNLV YFPLD+IKF  RYALSGKAWDL++EQRIAFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNLVFYFPLDIIKFMIRYALSGKAWDLLIEQRIAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFTELNQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  932  LKGHVESVVRLKGLDIDTIQQAYTV  956



>ref|XP_007210395.1| hypothetical protein PRUPE_ppa000934mg [Prunus persica]
 emb|CAB69824.1| plasma membrane H+ ATPase [Prunus persica]
 gb|EMJ11594.1| hypothetical protein PRUPE_ppa000934mg [Prunus persica]
Length=956

 Score =   199 bits (506),  Expect = 7e-55, Method: Composition-based stats.
 Identities = 127/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYNLV YFPLD+IKF  RYALSGKAWDL++EQRIAFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNLVFYFPLDIIKFMIRYALSGKAWDLLIEQRIAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFTELNQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  932  LKGHVESVVRLKGLDIDTIQQAYTV  956



>ref|XP_010550649.1| PREDICTED: ATPase 11, plasma membrane-type [Tarenaya hassleriana]
Length=956

 Score =   199 bits (505),  Expect = 9e-55, Method: Composition-based stats.
 Identities = 127/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN++ Y PLDLIKFF RYALSG+AWDLV+EQRIAFTRK
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDLIKFFIRYALSGRAWDLVIEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+ ++LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHVHELNQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDIETIQQAYTV
Sbjct  932  LKGHVESVVRLKGLDIETIQQAYTV  956



>ref|XP_002875872.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52131.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=154

 Score =   184 bits (466),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN++ Y PLD IKFF  Y LSG+AWDLV+EQR+AFTR+
Sbjct  10   YANWSFAAIEGIGWGWAGVIWLYNIIFYVPLDFIKFFICYTLSGRAWDLVIEQRVAFTRQ  69

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F++ T+  +LNQ+AEEAKRRAEIARLRELHT
Sbjct  70   KDFGKEQRELQWAHAQRTLHGLQAPDTKMFTDRTHVCELNQMAEEAKRRAEIARLRELHT  129

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDIETIQQAYTV
Sbjct  130  LKGHVESVVRLKGLDIETIQQAYTV  154



>ref|XP_011042618.1| PREDICTED: ATPase 11, plasma membrane-type [Populus euphratica]
 ref|XP_011042619.1| PREDICTED: ATPase 11, plasma membrane-type [Populus euphratica]
Length=956

 Score =   198 bits (504),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 125/145 (86%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN++ YFPLD IKFF RYALSG+AWDLV+EQRIAFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIIFYFPLDFIKFFIRYALSGRAWDLVIEQRIAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGL +PDTK+F+E T+F +LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLPLPDTKMFTERTHFTELNQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  932  LKGHVESVVRLKGLDIDTIQQAYTV  956



>ref|XP_002318614.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEE96834.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=966

 Score =   198 bits (504),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 124/145 (86%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAI+GIGWGWAGVIWLYN++ YFPLD IKFF RYALSG+AWDLV+EQRIAFTR+
Sbjct  822  YANWSFAAIKGIGWGWAGVIWLYNIIFYFPLDFIKFFIRYALSGRAWDLVIEQRIAFTRQ  881

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGL +PDTK+F+E T+F +LNQ+AEEAKRRAEIARLRELHT
Sbjct  882  KDFGKEQRELQWAHAQRTLHGLPLPDTKMFTERTHFTELNQMAEEAKRRAEIARLRELHT  941

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  942  LKGHVESVVRLKGLDIDTIQQAYTV  966



>ref|NP_001183637.1| uncharacterized protein LOC100502231 [Zea mays]
 gb|ACR37835.1| unknown [Zea mays]
Length=311

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YA+ +F +I+GIGWGWAG++WLYN++ YFPLD+IKF  RYALSGKAWDLV+EQRIAFTRK
Sbjct  167  YADWAFTSIKGIGWGWAGIVWLYNIIFYFPLDIIKFLIRYALSGKAWDLVIEQRIAFTRK  226

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFG+E+REL+WAHAQRTLHGLQ PD K+F E   +N+LNQ+AEEAKRRAEIARLRELHT
Sbjct  227  KDFGREERELKWAHAQRTLHGLQAPDAKMFPEKAGYNELNQMAEEAKRRAEIARLRELHT  286

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  287  LKGHVESVVKLKGLDIETIQQSYTV  311



>gb|KDP31195.1| hypothetical protein JCGZ_11571 [Jatropha curcas]
Length=956

 Score =   198 bits (503),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 126/145 (87%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN+V Y PLD IKFF RYALSG+AWDLV+EQRIAFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDFIKFFIRYALSGRAWDLVIEQRIAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFTELNQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  932  LKGHVESVVRLKGLDIDTIQQAYTV  956



>ref|XP_002511508.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF52110.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=801

 Score =   196 bits (498),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 106/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYNL+ YFPLD IKFF RYALSG+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHG
Sbjct  678  LYNLIFYFPLDFIKFFIRYALSGRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHG  737

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PDTK+F+E T+F +LN +AEEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQ
Sbjct  738  LQPPDTKMFTERTHFTELNNMAEEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQ  797

Query  288  AYTV  277
            AYTV
Sbjct  798  AYTV  801



>emb|CDY30730.1| BnaA02g33520D [Brassica napus]
Length=787

 Score =   196 bits (497),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 125/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALSG+AWDLV+EQRIAFTRK
Sbjct  643  YANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFLIRYALSGRAWDLVIEQRIAFTRK  702

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PD K+F E T+FN+L+Q+AEEAKRRAEIARLRELHT
Sbjct  703  KDFGKEQRELQWAHAQRTLHGLQAPDAKMFPERTHFNELSQMAEEAKRRAEIARLRELHT  762

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDIETIQQ+YTV
Sbjct  763  LKGHVESVVRLKGLDIETIQQSYTV  787



>dbj|BAD16686.1| plasma membrane H+-ATPase [Daucus carota]
Length=956

 Score =   196 bits (499),  Expect = 6e-54, Method: Composition-based stats.
 Identities = 123/145 (85%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN +FAAIEGIGWGWAGVIWLYN++ YFPLD+IKF TRYALSG+AWDLVLE+RIAFTR+
Sbjct  812  YANWNFAAIEGIGWGWAGVIWLYNIIFYFPLDIIKFLTRYALSGRAWDLVLERRIAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQREL+WAHAQRTLHGL+VPDTK+F++ TNF +LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELRWAHAQRTLHGLEVPDTKMFNDRTNFTELNQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQ+YTV
Sbjct  932  LKGHVESVVRLKGLDIDTIQQSYTV  956



>gb|EAZ21357.1| hypothetical protein OsJ_37014 [Oryza sativa Japonica Group]
Length=931

 Score =   196 bits (498),  Expect = 9e-54, Method: Composition-based stats.
 Identities = 106/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYNL+ YFPLD+IKF  RYALSGKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHG
Sbjct  808  LYNLIFYFPLDIIKFLIRYALSGKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHG  867

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD K+FSE   +N+LNQ+AEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ
Sbjct  868  LQPPDAKMFSEKAGYNELNQMAEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ  927

Query  288  AYTV  277
            +YTV
Sbjct  928  SYTV  931



>ref|XP_009130230.1| PREDICTED: ATPase 11, plasma membrane-type isoform X3 [Brassica 
rapa]
Length=939

 Score =   196 bits (497),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 125/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALSG+AWDLV+EQRIAFTRK
Sbjct  795  YANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFLIRYALSGRAWDLVIEQRIAFTRK  854

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PD K+F E T+FN+L+Q+AEEAKRRAEIARLRELHT
Sbjct  855  KDFGKEQRELQWAHAQRTLHGLQAPDAKMFPERTHFNELSQMAEEAKRRAEIARLRELHT  914

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDIETIQQ+YTV
Sbjct  915  LKGHVESVVRLKGLDIETIQQSYTV  939



>ref|NP_001067382.1| Os12g0638700 [Oryza sativa Japonica Group]
 emb|CAD29296.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 gb|ABA99607.1| Plasma membrane ATPase 1, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF30401.1| Os12g0638700 [Oryza sativa Japonica Group]
Length=956

 Score =   196 bits (498),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 106/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYNL+ YFPLD+IKF  RYALSGKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHG
Sbjct  833  LYNLIFYFPLDIIKFLIRYALSGKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD K+FSE   +N+LNQ+AEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ
Sbjct  893  LQPPDAKMFSEKAGYNELNQMAEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ  952

Query  288  AYTV  277
            +YTV
Sbjct  953  SYTV  956



>ref|XP_009130229.1| PREDICTED: ATPase 11, plasma membrane-type isoform X2 [Brassica 
rapa]
Length=956

 Score =   196 bits (497),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 125/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALSG+AWDLV+EQRIAFTRK
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFLIRYALSGRAWDLVIEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PD K+F E T+FN+L+Q+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQAPDAKMFPERTHFNELSQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDIETIQQ+YTV
Sbjct  932  LKGHVESVVRLKGLDIETIQQSYTV  956



>gb|EEC69747.1| hypothetical protein OsI_39279 [Oryza sativa Indica Group]
Length=931

 Score =   196 bits (497),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 106/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYNL+ YFPLD+IKF  RYALSGKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHG
Sbjct  808  LYNLIFYFPLDIIKFLIRYALSGKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHG  867

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD K+FSE   +N+LNQ+AEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ
Sbjct  868  LQPPDAKMFSEKAGYNELNQMAEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ  927

Query  288  AYTV  277
            +YTV
Sbjct  928  SYTV  931



>emb|CDY45757.1| BnaC02g42250D [Brassica napus]
Length=962

 Score =   196 bits (497),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 125/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALSG+AWDLV+EQRIAFTRK
Sbjct  818  YANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFLIRYALSGRAWDLVIEQRIAFTRK  877

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PD K+F E T+FN+L+Q+AEEAKRRAEIARLRELHT
Sbjct  878  KDFGKEQRELQWAHAQRTLHGLQAPDAKMFPERTHFNELSQMAEEAKRRAEIARLRELHT  937

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDIETIQQ+YTV
Sbjct  938  LKGHVESVVRLKGLDIETIQQSYTV  962



>gb|KJB19302.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=956

 Score =   196 bits (497),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN++ Y PLD IKFF RYALSG+AWDLV+EQRIAFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDFIKFFIRYALSGRAWDLVIEQRIAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQAPDTKMFTERTHFTELNQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LK LDI+TIQQAYTV
Sbjct  932  LKGHVESVVRLKNLDIDTIQQAYTV  956



>gb|KCW49372.1| hypothetical protein EUGRSUZ_K02916 [Eucalyptus grandis]
Length=920

 Score =   195 bits (496),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 105/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ Y PLDLIKFFTRYALSG+AWDLVLEQRIAFTR+KDFGKEQRELQWAHAQRTLHG
Sbjct  797  LYNIIFYIPLDLIKFFTRYALSGRAWDLVLEQRIAFTRQKDFGKEQRELQWAHAQRTLHG  856

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PDTK+F+E  +F +LN +AEEAKRRAEIARLRELHTLKGHVESV+++KGLDIETIQQ
Sbjct  857  LQPPDTKMFTERAHFTELNHIAEEAKRRAEIARLRELHTLKGHVESVLRIKGLDIETIQQ  916

Query  288  AYTV  277
            AYTV
Sbjct  917  AYTV  920



>ref|XP_009130228.1| PREDICTED: ATPase 11, plasma membrane-type isoform X1 [Brassica 
rapa]
Length=979

 Score =   196 bits (497),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 125/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALSG+AWDLV+EQRIAFTRK
Sbjct  835  YANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFLIRYALSGRAWDLVIEQRIAFTRK  894

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PD K+F E T+FN+L+Q+AEEAKRRAEIARLRELHT
Sbjct  895  KDFGKEQRELQWAHAQRTLHGLQAPDAKMFPERTHFNELSQMAEEAKRRAEIARLRELHT  954

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDIETIQQ+YTV
Sbjct  955  LKGHVESVVRLKGLDIETIQQSYTV  979



>ref|XP_010037634.1| PREDICTED: ATPase 11, plasma membrane-type [Eucalyptus grandis]
 gb|KCW49371.1| hypothetical protein EUGRSUZ_K02916 [Eucalyptus grandis]
Length=956

 Score =   195 bits (496),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 105/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ Y PLDLIKFFTRYALSG+AWDLVLEQRIAFTR+KDFGKEQRELQWAHAQRTLHG
Sbjct  833  LYNIIFYIPLDLIKFFTRYALSGRAWDLVLEQRIAFTRQKDFGKEQRELQWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PDTK+F+E  +F +LN +AEEAKRRAEIARLRELHTLKGHVESV+++KGLDIETIQQ
Sbjct  893  LQPPDTKMFTERAHFTELNHIAEEAKRRAEIARLRELHTLKGHVESVLRIKGLDIETIQQ  952

Query  288  AYTV  277
            AYTV
Sbjct  953  AYTV  956



>dbj|BAD16689.1| plasma membrane H+-ATPase [Daucus carota]
Length=956

 Score =   195 bits (496),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 121/145 (83%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN +FAAIEGIGWGWAGVIWLYN++ YFPLD+IKFF RYALSG+AWDLVLE+R+AFTR+
Sbjct  812  YANWNFAAIEGIGWGWAGVIWLYNIIFYFPLDIIKFFIRYALSGRAWDLVLERRVAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQREL+WAHAQRTLHGL+VPDTK+F++ +NF +LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELKWAHAQRTLHGLEVPDTKMFNDKSNFTELNQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQ+YTV
Sbjct  932  LKGHVESVVRLKGLDIDTIQQSYTV  956



>ref|XP_010444121.1| PREDICTED: ATPase 11, plasma membrane-type isoform X2 [Camelina 
sativa]
Length=956

 Score =   195 bits (495),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALSG+AWDLV+EQR+AFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFLIRYALSGRAWDLVIEQRVAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PD K+F E T+FN+L+Q+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQAPDAKMFPERTHFNELSQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDIETIQQAYTV
Sbjct  932  LKGHVESVVRLKGLDIETIQQAYTV  956



>ref|XP_010459221.1| PREDICTED: ATPase 11, plasma membrane-type-like [Camelina sativa]
Length=956

 Score =   195 bits (495),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALSG+AWDLV+EQR+AFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFLIRYALSGRAWDLVIEQRVAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PD K+F E T+FN+L+Q+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQAPDAKMFPERTHFNELSQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDIETIQQAYTV
Sbjct  932  LKGHVESVVRLKGLDIETIQQAYTV  956



>ref|XP_006279959.1| hypothetical protein CARUB_v10025825mg [Capsella rubella]
 gb|EOA12857.1| hypothetical protein CARUB_v10025825mg [Capsella rubella]
Length=956

 Score =   195 bits (495),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALSG+AWDLV+EQR+AFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFLIRYALSGRAWDLVIEQRVAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PD K+F E T+FN+L+Q+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQAPDAKMFPERTHFNELSQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDIETIQQAYTV
Sbjct  932  LKGHVESVVRLKGLDIETIQQAYTV  956



>ref|NP_201073.1| H(+)-ATPase 11 [Arabidopsis thaliana]
 sp|Q9LV11.1|PMA11_ARATH RecName: Full=ATPase 11, plasma membrane-type; AltName: Full=Proton 
pump 11 [Arabidopsis thaliana]
 dbj|BAA97214.1| plasma membrane proton ATPase-like [Arabidopsis thaliana]
 gb|AAM78085.1| AT5g62670/MRG21_9 [Arabidopsis thaliana]
 gb|AAR23718.1| At5g62670/MRG21_9 [Arabidopsis thaliana]
 gb|AED97641.1| H(+)-ATPase 11 [Arabidopsis thaliana]
Length=956

 Score =   195 bits (495),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALSG+AWDLV+EQR+AFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFLIRYALSGRAWDLVIEQRVAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PD K+F E T+FN+L+Q+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQAPDAKMFPERTHFNELSQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDIETIQQAYTV
Sbjct  932  LKGHVESVVRLKGLDIETIQQAYTV  956



>ref|XP_002864812.1| AHA11-ATPASE 11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41071.1| AHA11-ATPASE 11 [Arabidopsis lyrata subsp. lyrata]
Length=956

 Score =   195 bits (495),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALSG+AWDLV+EQR+AFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFLIRYALSGRAWDLVIEQRVAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PD K+F E T+FN+L+Q+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQAPDAKMFPERTHFNELSQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDIETIQQAYTV
Sbjct  932  LKGHVESVVRLKGLDIETIQQAYTV  956



>ref|NP_190378.2| H(+)-ATPase 4 [Arabidopsis thaliana]
 sp|Q9SU58.2|PMA4_ARATH RecName: Full=ATPase 4, plasma membrane-type; AltName: Full=Proton 
pump 4 [Arabidopsis thaliana]
 dbj|BAC42716.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AEE78350.1| H(+)-ATPase 4 [Arabidopsis thaliana]
Length=960

 Score =   195 bits (495),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 123/145 (85%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN++ Y PLD IKFF RYALSG+AWDLV+EQR+AFTR+
Sbjct  816  YANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDFIKFFIRYALSGRAWDLVIEQRVAFTRQ  875

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F++ T+ ++LNQ+AEEAKRRAEIARLRELHT
Sbjct  876  KDFGKEQRELQWAHAQRTLHGLQAPDTKMFTDRTHVSELNQMAEEAKRRAEIARLRELHT  935

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDIETIQQAYTV
Sbjct  936  LKGHVESVVRLKGLDIETIQQAYTV  960



>emb|CAB41144.1| H+-transporting ATPase-like protein [Arabidopsis thaliana]
Length=960

 Score =   195 bits (495),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 123/145 (85%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN++ Y PLD IKFF RYALSG+AWDLV+EQR+AFTR+
Sbjct  816  YANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDFIKFFIRYALSGRAWDLVIEQRVAFTRQ  875

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F++ T+ ++LNQ+AEEAKRRAEIARLRELHT
Sbjct  876  KDFGKEQRELQWAHAQRTLHGLQAPDTKMFTDRTHVSELNQMAEEAKRRAEIARLRELHT  935

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDIETIQQAYTV
Sbjct  936  LKGHVESVVRLKGLDIETIQQAYTV  960



>emb|CAC29435.1| P-type H+-ATPase [Vicia faba]
Length=958

 Score =   195 bits (495),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 105/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ Y PLD IKFFTRYALSG+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHG
Sbjct  835  LYNIIFYIPLDFIKFFTRYALSGRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHG  894

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PDTK+F+E T+  +LNQ+AEEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQ
Sbjct  895  LQPPDTKMFTERTHVTELNQMAEEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQ  954

Query  288  AYTV  277
            AYTV
Sbjct  955  AYTV  958



>ref|XP_007032428.1| H(+)-ATPase 4 isoform 2 [Theobroma cacao]
 gb|EOY03354.1| H(+)-ATPase 4 isoform 2 [Theobroma cacao]
Length=956

 Score =   194 bits (494),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 126/145 (87%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYNLV Y PLD IKFF RYALSGKAWDLV+EQRIAFTRK
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNLVFYIPLDFIKFFIRYALSGKAWDLVIEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHAQRTLHGLQ PDTK+FS+ T+F +LNQ+AEEAKRRAEIARLREL T
Sbjct  872  KDFGKEERELKWAHAQRTLHGLQAPDTKMFSDRTSFTELNQMAEEAKRRAEIARLRELTT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  932  LKGHVESVVRLKGLDIDTIQQAYTV  956



>ref|XP_006394361.1| hypothetical protein EUTSA_v10003603mg [Eutrema salsugineum]
 dbj|BAJ34039.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31647.1| hypothetical protein EUTSA_v10003603mg [Eutrema salsugineum]
Length=956

 Score =   194 bits (494),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALSG+AWDLV+EQRIAFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFLIRYALSGRAWDLVIEQRIAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PD K+F E T+FN+L+Q+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQAPDAKMFPERTHFNELSQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDIETIQQ+YTV
Sbjct  932  LKGHVESVVRLKGLDIETIQQSYTV  956



>ref|XP_007032427.1| H(+)-ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY03353.1| H(+)-ATPase 4 isoform 1 [Theobroma cacao]
Length=994

 Score =   194 bits (494),  Expect = 4e-53, Method: Composition-based stats.
 Identities = 126/145 (87%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYNLV Y PLD IKFF RYALSGKAWDLV+EQRIAFTRK
Sbjct  850  YANWSFAAIEGIGWGWAGVIWLYNLVFYIPLDFIKFFIRYALSGKAWDLVIEQRIAFTRK  909

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHAQRTLHGLQ PDTK+FS+ T+F +LNQ+AEEAKRRAEIARLREL T
Sbjct  910  KDFGKEERELKWAHAQRTLHGLQAPDTKMFSDRTSFTELNQMAEEAKRRAEIARLRELTT  969

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  970  LKGHVESVVRLKGLDIDTIQQAYTV  994



>gb|KDP45466.1| hypothetical protein JCGZ_09715 [Jatropha curcas]
Length=956

 Score =   194 bits (493),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 105/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYNL+ YFPLD IKFFTRYALSGKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHG
Sbjct  833  LYNLIFYFPLDFIKFFTRYALSGKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            L  PDTK+F+E  +FN+LNQ+AEEAKRRAEIAR REL TLKGHVESVV+LKGLDI+TIQQ
Sbjct  893  LHPPDTKMFNERGSFNELNQMAEEAKRRAEIARFRELTTLKGHVESVVRLKGLDIDTIQQ  952

Query  288  AYTV  277
            AYTV
Sbjct  953  AYTV  956



>gb|KGN63646.1| hypothetical protein Csa_1G008520 [Cucumis sativus]
Length=801

 Score =   193 bits (490),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 104/124 (84%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ Y PLDLIKFF RYALSG+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHG
Sbjct  678  LYNIIFYIPLDLIKFFIRYALSGRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHG  737

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD K+F + T+F +LNQ+AEEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQ
Sbjct  738  LQAPDAKMFHDRTHFTELNQMAEEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQ  797

Query  288  AYTV  277
            AYTV
Sbjct  798  AYTV  801



>ref|XP_006664787.1| PREDICTED: plasma membrane ATPase 1-like [Oryza brachyantha]
Length=956

 Score =   194 bits (493),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYNL+ YFPLD+IKF  RYALSGKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHG
Sbjct  833  LYNLIFYFPLDIIKFLIRYALSGKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD K+F E   +N+LNQ+AEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ
Sbjct  893  LQPPDAKMFPEKAGYNELNQMAEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ  952

Query  288  AYTV  277
            +YTV
Sbjct  953  SYTV  956



>dbj|BAC77532.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=956

 Score =   194 bits (492),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 105/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYNL+ Y PLD IKF  RYALSG+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHG
Sbjct  833  LYNLIFYIPLDFIKFLIRYALSGRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PDTK+F+E T+ N+LNQ+AEEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQ
Sbjct  893  LQPPDTKMFTERTHVNELNQMAEEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQ  952

Query  288  AYTV  277
            AYTV
Sbjct  953  AYTV  956



>ref|XP_008453171.1| PREDICTED: plasma membrane ATPase 3 [Cucumis melo]
Length=959

 Score =   194 bits (492),  Expect = 7e-53, Method: Composition-based stats.
 Identities = 104/124 (84%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ Y PLDLIKFF RYALSG+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHG
Sbjct  836  LYNIIFYIPLDLIKFFIRYALSGRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHG  895

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD K+F + T+F +LNQ+AEEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQ
Sbjct  896  LQAPDAKMFHDRTHFTELNQMAEEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQ  955

Query  288  AYTV  277
            AYTV
Sbjct  956  AYTV  959



>ref|XP_004171391.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 4, plasma membrane-type-like 
[Cucumis sativus]
Length=959

 Score =   194 bits (492),  Expect = 7e-53, Method: Composition-based stats.
 Identities = 104/124 (84%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ Y PLDLIKFF RYALSG+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHG
Sbjct  836  LYNIIFYIPLDLIKFFIRYALSGRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHG  895

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD K+F + T+F +LNQ+AEEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQ
Sbjct  896  LQAPDAKMFHDRTHFTELNQMAEEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQ  955

Query  288  AYTV  277
            AYTV
Sbjct  956  AYTV  959



>ref|XP_004138147.1| PREDICTED: ATPase 4, plasma membrane-type-like [Cucumis sativus]
Length=959

 Score =   194 bits (492),  Expect = 7e-53, Method: Composition-based stats.
 Identities = 104/124 (84%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ Y PLDLIKFF RYALSG+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHG
Sbjct  836  LYNIIFYIPLDLIKFFIRYALSGRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHG  895

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD K+F + T+F +LNQ+AEEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQ
Sbjct  896  LQAPDAKMFHDRTHFTELNQMAEEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQ  955

Query  288  AYTV  277
            AYTV
Sbjct  956  AYTV  959



>ref|XP_004299601.1| PREDICTED: ATPase 11, plasma membrane-type [Fragaria vesca subsp. 
vesca]
Length=957

 Score =   193 bits (491),  Expect = 8e-53, Method: Composition-based stats.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALSGKAWDL++EQRIAFTR+
Sbjct  813  YANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFMIRYALSGKAWDLLIEQRIAFTRQ  872

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LN +AEEAKRRAEIARLRELHT
Sbjct  873  KDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFTELNHMAEEAKRRAEIARLRELHT  932

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  933  LKGHVESVVRLKGLDIDTIQQAYTV  957



>ref|XP_010923303.1| PREDICTED: plasma membrane ATPase 3-like [Elaeis guineensis]
Length=956

 Score =   193 bits (490),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 105/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ YFPLD+IKF  RYALSG+AWDLV+EQRIAFTR+KDFGKE REL+WAHAQRTLHG
Sbjct  833  LYNIIFYFPLDIIKFLIRYALSGRAWDLVIEQRIAFTRQKDFGKEARELKWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            L  PDTK+FSE TNF +LNQLAEEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQ
Sbjct  893  LHPPDTKMFSERTNFTELNQLAEEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQ  952

Query  288  AYTV  277
            AYTV
Sbjct  953  AYTV  956



>ref|XP_008796652.1| PREDICTED: plasma membrane ATPase 3 isoform X1 [Phoenix dactylifera]
 ref|XP_008796653.1| PREDICTED: plasma membrane ATPase 3 isoform X2 [Phoenix dactylifera]
Length=956

 Score =   193 bits (490),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 105/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ YFPLD+IKF  RYALSG+AWDLV+EQRIAFTR+KDFGKE REL+WAHAQRTLHG
Sbjct  833  LYNIIFYFPLDIIKFLIRYALSGRAWDLVIEQRIAFTRQKDFGKEARELKWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            L  PDTK+FSE TNF +LNQLAEEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQ
Sbjct  893  LHPPDTKMFSERTNFTELNQLAEEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQ  952

Query  288  AYTV  277
            AYTV
Sbjct  953  AYTV  956



>ref|XP_010933786.1| PREDICTED: plasma membrane ATPase 3 [Elaeis guineensis]
Length=956

 Score =   193 bits (490),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 104/124 (84%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ YFPLD+IKF  RYALSG+AWDLV+EQRIAFTR+KDFGKE REL+WAHAQRTLHG
Sbjct  833  LYNIIFYFPLDIIKFLIRYALSGRAWDLVIEQRIAFTRQKDFGKEARELKWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            L  PDTK+FSE T+F DLNQ+AEEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQ
Sbjct  893  LHPPDTKMFSERTSFTDLNQMAEEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQ  952

Query  288  AYTV  277
            AYTV
Sbjct  953  AYTV  956



>ref|XP_008673350.1| PREDICTED: uncharacterized protein LOC100502231 isoform X1 [Zea 
mays]
 tpg|DAA54786.1| TPA: hypothetical protein ZEAMMB73_074525 [Zea mays]
Length=956

 Score =   193 bits (490),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 103/124 (83%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ YFPLD+IKF  RYALSGKAWDLV+EQRIAFTRKKDFG+E+REL+WAHAQRTLHG
Sbjct  833  LYNIIFYFPLDIIKFLIRYALSGKAWDLVIEQRIAFTRKKDFGREERELKWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD K+F E   +N+LNQ+AEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ
Sbjct  893  LQAPDAKMFPEKAGYNELNQMAEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ  952

Query  288  AYTV  277
            +YTV
Sbjct  953  SYTV  956



>ref|XP_002442618.1| hypothetical protein SORBIDRAFT_08g023070 [Sorghum bicolor]
 gb|EES16456.1| hypothetical protein SORBIDRAFT_08g023070 [Sorghum bicolor]
Length=956

 Score =   193 bits (490),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 103/124 (83%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ YFPLD+IKF  RYALSGKAWDLV+EQRIAFTRKKDFG+E+REL+WAHAQRTLHG
Sbjct  833  LYNIIFYFPLDIIKFLIRYALSGKAWDLVIEQRIAFTRKKDFGREERELKWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD K+F E   +N+LNQ+AEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ
Sbjct  893  LQAPDAKMFPEKAGYNELNQMAEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ  952

Query  288  AYTV  277
            +YTV
Sbjct  953  SYTV  956



>ref|XP_004508789.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform X3 [Cicer 
arietinum]
Length=958

 Score =   192 bits (489),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 104/124 (84%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ Y PLD IKFF RYALSG+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHG
Sbjct  835  LYNIIFYIPLDFIKFFIRYALSGRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHG  894

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PDTK+F+E T+  +LNQ+AEEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQ
Sbjct  895  LQPPDTKMFTERTHVTELNQMAEEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQ  954

Query  288  AYTV  277
            AYTV
Sbjct  955  AYTV  958



>ref|XP_002322127.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEF06254.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=967

 Score =   192 bits (489),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 124/145 (86%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN+V Y PLDLIKF  RYALSG+AWDLV+EQRIAFT +
Sbjct  823  YANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDLIKFIIRYALSGRAWDLVIEQRIAFTTQ  882

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LN +AEEAKRRAEIARLRELHT
Sbjct  883  KDFGKEQRELQWAHAQRTLHGLQAPDTKMFTERTHFTELNHMAEEAKRRAEIARLRELHT  942

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  943  LKGHVESVVRLKGLDIDTIQQAYTV  967



>gb|AAQ55291.1| plasma membrane H+-ATPase [Juglans regia]
Length=956

 Score =   192 bits (489),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 103/124 (83%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ YFPLD IKFF RYALSG+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHG
Sbjct  833  LYNIIFYFPLDFIKFFIRYALSGRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD+K+F+E T+F +LNQ+AEEAKRRAEIARLREL+TLKGHVESVV+LKGLDI+TIQQ
Sbjct  893  LQPPDSKMFTERTHFTELNQIAEEAKRRAEIARLRELNTLKGHVESVVRLKGLDIDTIQQ  952

Query  288  AYTV  277
            +YTV
Sbjct  953  SYTV  956



>gb|KHG12451.1| ATPase 4, plasma membrane-type -like protein [Gossypium arboreum]
Length=693

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN++ Y PLD IKFF RYALSG+AWDLV+EQRIAFTR+
Sbjct  549  YANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDFIKFFIRYALSGRAWDLVIEQRIAFTRQ  608

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LNQ+AEEAKRRAEIARLRELHT
Sbjct  609  KDFGKEQRELQWAHAQRTLHGLQAPDTKMFTERTHFTELNQMAEEAKRRAEIARLRELHT  668

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LK LDI+TIQQAYTV
Sbjct  669  LKGHVESVVRLKNLDIDTIQQAYTV  693



>ref|XP_007138219.1| hypothetical protein PHAVU_009G190500g [Phaseolus vulgaris]
 gb|ESW10213.1| hypothetical protein PHAVU_009G190500g [Phaseolus vulgaris]
Length=956

 Score =   192 bits (488),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 122/145 (84%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN++ Y PLD IKF  RYALSG+AW+LV+EQRIAFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDPIKFLIRYALSGRAWELVIEQRIAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+FN+LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFNELNQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESV+KLKG+D++TIQQAYTV
Sbjct  932  LKGHVESVLKLKGIDVDTIQQAYTV  956



>ref|XP_003523043.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform 1 [Glycine 
max]
 gb|KHN08862.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=956

 Score =   192 bits (488),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 122/145 (84%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN++ Y PLD IKF  RYALSG+AW+LV+EQRIAFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDPIKFLIRYALSGRAWELVIEQRIAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+FN+LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFNELNQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESV+KLKG+D++TIQQAYTV
Sbjct  932  LKGHVESVLKLKGIDVDTIQQAYTV  956



>dbj|BAC77533.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=386

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGV+WLYNL+ Y PLD IKF  RYALSGKAWDLV+EQRIAFTRK
Sbjct  242  YANWSFAAIEGIGWGWAGVVWLYNLIFYIPLDFIKFIIRYALSGKAWDLVIEQRIAFTRK  301

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHAQRTLHGL  P+ ++FSE TN+ + NQ+AEEAKRRAEIARLRELHT
Sbjct  302  KDFGKEERELKWAHAQRTLHGLHPPEPRMFSERTNYTEFNQMAEEAKRRAEIARLRELHT  361

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  362  LKGHVESVVRLKGLDIDTIQQAYTV  386



>ref|XP_004963335.1| PREDICTED: plasma membrane ATPase 1-like [Setaria italica]
Length=956

 Score =   192 bits (488),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 103/124 (83%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ YFPLD+IKF  RY LSGKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHG
Sbjct  833  LYNIIFYFPLDIIKFLIRYVLSGKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD K+F E   +N+LNQ+AEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ
Sbjct  893  LQAPDAKMFPEKAGYNELNQMAEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ  952

Query  288  AYTV  277
            +YTV
Sbjct  953  SYTV  956



>ref|XP_006290560.1| hypothetical protein CARUB_v10016646mg [Capsella rubella]
 gb|EOA23458.1| hypothetical protein CARUB_v10016646mg [Capsella rubella]
Length=956

 Score =   192 bits (487),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 121/145 (83%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN++ Y PLD IKFF RY LSG+AWDLV+EQR+AFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDFIKFFIRYTLSGRAWDLVIEQRVAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F++ ++ ++LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQAPDTKMFTDRSHVSELNQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDIETIQQAYTV
Sbjct  932  LKGHVESVVRLKGLDIETIQQAYTV  956



>ref|XP_006651704.1| PREDICTED: plasma membrane ATPase 1-like [Oryza brachyantha]
Length=997

 Score =   192 bits (488),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 119/145 (82%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN +F +I+GIGWGWAG++WLYNLV YFPLD+IKF  RYALSGKAWDLV+EQRIAFTRK
Sbjct  853  YANWAFTSIKGIGWGWAGIVWLYNLVFYFPLDIIKFLIRYALSGKAWDLVIEQRIAFTRK  912

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHAQRTLHGLQ PD KLF E T +++LNQ+AEEAKRRAEIARLRELHT
Sbjct  913  KDFGKEERELKWAHAQRTLHGLQPPDVKLFPEKTGYSELNQMAEEAKRRAEIARLRELHT  972

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVVKLKGLDI+TI Q+YTV
Sbjct  973  LKGHVESVVKLKGLDIDTIHQSYTV  997



>ref|XP_008437674.1| PREDICTED: ATPase 11, plasma membrane-type [Cucumis melo]
Length=956

 Score =   192 bits (487),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 124/145 (86%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN++ Y PLD IKF  RYALSGKAWDL+LEQR+AFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDPIKFAIRYALSGKAWDLMLEQRVAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LN +AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFTELNHMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDIETIQQAYTV
Sbjct  932  LKGHVESVVRLKGLDIETIQQAYTV  956



>ref|XP_004152442.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis sativus]
 ref|XP_004157811.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis sativus]
Length=956

 Score =   192 bits (487),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 124/145 (86%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN++ Y PLD IKF  RYALSGKAWDL+LEQR+AFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDPIKFAIRYALSGKAWDLMLEQRVAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LN +AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFTELNHMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDIETIQQAYTV
Sbjct  932  LKGHVESVVRLKGLDIETIQQAYTV  956



>ref|XP_011028703.1| PREDICTED: ATPase 11, plasma membrane-type-like [Populus euphratica]
 ref|XP_011028704.1| PREDICTED: ATPase 11, plasma membrane-type-like [Populus euphratica]
Length=956

 Score =   192 bits (487),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 124/145 (86%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN+V Y PLDLIKF  RYALSG+AWDLV+EQRIAFT +
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDLIKFIIRYALSGRAWDLVIEQRIAFTTQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LN +AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFTELNHMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  932  LKGHVESVVRLKGLDIDTIQQAYTV  956



>gb|KGN64262.1| hypothetical protein Csa_1G045600 [Cucumis sativus]
Length=762

 Score =   190 bits (483),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 124/145 (86%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN++ Y PLD IKF  RYALSGKAWDL+LEQR+AFTR+
Sbjct  618  YANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDPIKFAIRYALSGKAWDLMLEQRVAFTRQ  677

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LN +AEEAKRRAEIARLRELHT
Sbjct  678  KDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFTELNHMAEEAKRRAEIARLRELHT  737

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDIETIQQAYTV
Sbjct  738  LKGHVESVVRLKGLDIETIQQAYTV  762



>gb|AFC88896.1| plasma membrane H+-ATPase [Melastoma malabathricum]
Length=956

 Score =   192 bits (487),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ Y PLD IKFF RYALSGKAWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHG
Sbjct  833  LYNIIFYIPLDFIKFFIRYALSGKAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PDTK+F+E T F +LN +AEEAKRRAEIARLREL+TLKGHVESVV+LKGLDIETIQQ
Sbjct  893  LQPPDTKIFTERTRFAELNHIAEEAKRRAEIARLRELNTLKGHVESVVRLKGLDIETIQQ  952

Query  288  AYTV  277
            AYTV
Sbjct  953  AYTV  956



>ref|XP_010087815.1| hypothetical protein L484_001526 [Morus notabilis]
 gb|EXB30122.1| hypothetical protein L484_001526 [Morus notabilis]
Length=297

 Score =   182 bits (462),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAI GIGWGWAGV+WLYN + YFPLD IKFF RYALSG+AWDLV+EQRIAFTRK
Sbjct  153  YANWSFAAIAGIGWGWAGVVWLYNFIFYFPLDFIKFFIRYALSGRAWDLVIEQRIAFTRK  212

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFG+E+REL+WAHAQRTLHGL  P+TK+F+E T + +LNQ+AEEAKRRAEIARLREL T
Sbjct  213  KDFGREERELKWAHAQRTLHGLHPPETKMFTERTTYPELNQMAEEAKRRAEIARLRELTT  272

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGH+ESVV+LKGLDI+TIQQAYTV
Sbjct  273  LKGHMESVVRLKGLDIDTIQQAYTV  297



>ref|XP_006431062.1| hypothetical protein CICLE_v10011000mg [Citrus clementina]
 gb|ESR44302.1| hypothetical protein CICLE_v10011000mg [Citrus clementina]
Length=956

 Score =   191 bits (485),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 121/145 (83%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEG+GWGWAGV+WLYNL+ Y PLD IKFF RYALSGKAWDLV+EQRIAFTRK
Sbjct  812  YANWSFAAIEGVGWGWAGVVWLYNLIFYIPLDFIKFFIRYALSGKAWDLVIEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHAQRTLHGL  PDTK+FSE   F +LNQ+AEEAKRRAEIARLREL+T
Sbjct  872  KDFGKEERELKWAHAQRTLHGLHAPDTKMFSEHNKFTELNQMAEEAKRRAEIARLRELNT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQ+YTV
Sbjct  932  LKGHVESVVRLKGLDIDTIQQSYTV  956



>ref|XP_008807875.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
 ref|XP_008807876.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
 ref|XP_008807878.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
 ref|XP_008807879.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
Length=956

 Score =   191 bits (485),  Expect = 6e-52, Method: Composition-based stats.
 Identities = 103/124 (83%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ YFPLD+IKF TRYALSG+AWDLV+EQRIAFTR+KDFGKE REL+WAHAQRTLHG
Sbjct  833  LYNIIFYFPLDIIKFLTRYALSGRAWDLVIEQRIAFTRQKDFGKEARELKWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            L  P+TK+F E T+F DLNQ+AEEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQ
Sbjct  893  LHPPETKMFGERTSFADLNQMAEEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQ  952

Query  288  AYTV  277
            AYTV
Sbjct  953  AYTV  956



>gb|KJB33641.1| hypothetical protein B456_006G023600 [Gossypium raimondii]
Length=956

 Score =   191 bits (485),  Expect = 6e-52, Method: Composition-based stats.
 Identities = 104/124 (84%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYNL+ Y PLD IKFF RYALSGKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHG
Sbjct  833  LYNLIFYIPLDFIKFFIRYALSGKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PDTK+F + T++N+LNQ+AEEAKRRAEIARLREL TLKGHVESVV+LKGLDI+TIQQ
Sbjct  893  LQPPDTKMFGDRTSYNELNQMAEEAKRRAEIARLRELTTLKGHVESVVRLKGLDIDTIQQ  952

Query  288  AYTV  277
            AYTV
Sbjct  953  AYTV  956



>ref|XP_006476664.1| PREDICTED: ATPase 11, plasma membrane-type-like [Citrus sinensis]
Length=954

 Score =   191 bits (484),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 2/145 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGV+WLYN++ Y PLD IKFF RYALSGKAWDLV+EQRIAFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVVWLYNIIFYIPLDFIKFFIRYALSGKAWDLVIEQRIAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T  ++LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERT--HELNQMAEEAKRRAEIARLRELHT  929

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  930  LKGHVESVVRLKGLDIDTIQQAYTV  954



>ref|XP_006439665.1| hypothetical protein CICLE_v10018737mg [Citrus clementina]
 gb|ESR52905.1| hypothetical protein CICLE_v10018737mg [Citrus clementina]
Length=954

 Score =   191 bits (484),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 2/145 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGV+WLYN++ Y PLD IKFF RYALSGKAWDLV+EQRIAFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVVWLYNIIFYIPLDFIKFFIRYALSGKAWDLVIEQRIAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T  ++LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERT--HELNQMAEEAKRRAEIARLRELHT  929

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  930  LKGHVESVVRLKGLDIDTIQQAYTV  954



>gb|KHG14131.1| ATPase 4, plasma membrane-type -like protein [Gossypium arboreum]
Length=721

 Score =   189 bits (480),  Expect = 8e-52, Method: Composition-based stats.
 Identities = 104/124 (84%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYNL+ Y PLD IKFF RYALSGKAWDLV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHG
Sbjct  598  LYNLIFYIPLDFIKFFIRYALSGKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHG  657

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PDTK+F + T++N+LNQ+AEEAKRRAEIARLREL TLKGHVESVV+LKGLDI+TIQQ
Sbjct  658  LQPPDTKMFGDRTSYNELNQMAEEAKRRAEIARLRELTTLKGHVESVVRLKGLDIDTIQQ  717

Query  288  AYTV  277
            AYTV
Sbjct  718  AYTV  721



>ref|XP_006482527.1| PREDICTED: plasma membrane ATPase 1-like [Citrus sinensis]
Length=956

 Score =   191 bits (484),  Expect = 9e-52, Method: Composition-based stats.
 Identities = 120/145 (83%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFA IEG+GWGWAGV+WLYNL+ Y PLD IKFF RYALSGKAWDLV+EQRIAFTRK
Sbjct  812  YANWSFAEIEGVGWGWAGVVWLYNLIFYIPLDFIKFFIRYALSGKAWDLVIEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHAQRTLHGL  PDTK+FSE   F +LNQ+AEEAKRRAEIARLREL T
Sbjct  872  KDFGKEERELKWAHAQRTLHGLHAPDTKMFSEHNKFTELNQMAEEAKRRAEIARLRELST  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQ+YTV
Sbjct  932  LKGHVESVVRLKGLDIDTIQQSYTV  956



>gb|KEH31901.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=958

 Score =   191 bits (484),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 103/124 (83%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ Y PLD IKFF RYALSG+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHG
Sbjct  835  LYNIIFYIPLDFIKFFIRYALSGRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHG  894

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PDTK+F+  T+  +LNQ+AEEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQ
Sbjct  895  LQPPDTKMFTGGTHVTELNQMAEEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQ  954

Query  288  AYTV  277
            AYTV
Sbjct  955  AYTV  958



>ref|XP_003578172.1| PREDICTED: plasma membrane ATPase 1 [Brachypodium distachyon]
Length=959

 Score =   191 bits (484),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 102/124 (82%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ YFPLD+IKF  RY LSGKAWDLV++QRIAFTRKKDFGKE+REL+WAHAQRTLHG
Sbjct  836  LYNIITYFPLDIIKFLIRYTLSGKAWDLVIDQRIAFTRKKDFGKEERELKWAHAQRTLHG  895

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD K+FSE   +N+LN +AEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ
Sbjct  896  LQPPDAKMFSEKAGYNELNHMAEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ  955

Query  288  AYTV  277
            +YTV
Sbjct  956  SYTV  959



>ref|XP_010256132.1| PREDICTED: ATPase 11, plasma membrane-type isoform X2 [Nelumbo 
nucifera]
Length=956

 Score =   190 bits (483),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 103/124 (83%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ Y PLD+IKF  RYALSG+AWDLV+EQRIAFTR+KDFGKE REL+WAHAQRTLHG
Sbjct  833  LYNIIVYIPLDVIKFIIRYALSGRAWDLVIEQRIAFTRQKDFGKEARELKWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PDTK+FSE T F +LNQ+AEEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQ
Sbjct  893  LQPPDTKMFSERTTFTELNQMAEEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQ  952

Query  288  AYTV  277
            AYTV
Sbjct  953  AYTV  956



>gb|AEQ27823.1| PM H+-ATPase L [Eichhornia crassipes]
Length=956

 Score =   190 bits (483),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 103/124 (83%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ Y PLD+IKF  RYALSG AWDLV+EQRIAFTR+KDFGKE REL+WAHAQRTLHG
Sbjct  833  LYNIIFYIPLDIIKFLIRYALSGGAWDLVIEQRIAFTRQKDFGKEARELKWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ P+TK+F+E TNFN+LNQ+AEEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQ
Sbjct  893  LQPPETKMFNERTNFNELNQMAEEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQ  952

Query  288  AYTV  277
            AYTV
Sbjct  953  AYTV  956



>ref|XP_009343433.1| PREDICTED: ATPase 11, plasma membrane-type-like [Pyrus x bretschneideri]
Length=956

 Score =   190 bits (483),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 121/145 (83%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAI+GIGWGWAGVIWLYN+V Y PLD+IKF  RYALSGKAWDL++EQR+AFTR+
Sbjct  812  YANWSFAAIKGIGWGWAGVIWLYNIVTYIPLDIIKFMIRYALSGKAWDLLIEQRVAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LNQ+AEEAKRRAEIARLREL T
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFTELNQIAEEAKRRAEIARLRELTT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQ+YTV
Sbjct  932  LKGHVESVVRLKGLDIDTIQQSYTV  956



>ref|XP_010256122.1| PREDICTED: ATPase 11, plasma membrane-type isoform X1 [Nelumbo 
nucifera]
Length=970

 Score =   190 bits (483),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 103/124 (83%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ Y PLD+IKF  RYALSG+AWDLV+EQRIAFTR+KDFGKE REL+WAHAQRTLHG
Sbjct  847  LYNIIVYIPLDVIKFIIRYALSGRAWDLVIEQRIAFTRQKDFGKEARELKWAHAQRTLHG  906

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PDTK+FSE T F +LNQ+AEEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQ
Sbjct  907  LQPPDTKMFSERTTFTELNQMAEEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQ  966

Query  288  AYTV  277
            AYTV
Sbjct  967  AYTV  970



>ref|XP_009369365.1| PREDICTED: ATPase 11, plasma membrane-type [Pyrus x bretschneideri]
Length=956

 Score =   190 bits (483),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 122/145 (84%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALSGKAWDL++EQR+AFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIVTYIPLDIIKFMIRYALSGKAWDLLIEQRVAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LNQ+AEEAKRRAEIARLREL T
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFTELNQIAEEAKRRAEIARLRELTT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQ+YTV
Sbjct  932  LKGHVESVVRLKGLDIDTIQQSYTV  956



>ref|XP_008374513.1| PREDICTED: ATPase 11, plasma membrane-type [Malus domestica]
Length=956

 Score =   190 bits (483),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 122/145 (84%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALSGKAWDL++EQR+AFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIVTYIPLDIIKFMIRYALSGKAWDLLIEQRVAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LNQ+AEEAKRRAEIARLREL T
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERTHFTELNQIAEEAKRRAEIARLRELTT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQ+YTV
Sbjct  932  LKGHVESVVRLKGLDIDTIQQSYTV  956



>gb|KHN19372.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=956

 Score =   190 bits (482),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 121/145 (83%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN++ Y PLD IKF  RYALSG+AW+LV+EQRIAFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDPIKFLIRYALSGRAWELVIEQRIAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E  +FN+LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERPHFNELNQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESV+KLKG+D++TIQQAYTV
Sbjct  932  LKGHVESVLKLKGIDVDTIQQAYTV  956



>ref|XP_003527056.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform 1 [Glycine 
max]
Length=956

 Score =   190 bits (482),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 121/145 (83%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN++ Y PLD IKF  RYALSG+AW+LV+EQRIAFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDPIKFLIRYALSGRAWELVIEQRIAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E  +FN+LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQPPDTKMFTERPHFNELNQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESV+KLKG+D++TIQQAYTV
Sbjct  932  LKGHVESVLKLKGIDVDTIQQAYTV  956



>ref|XP_010444120.1| PREDICTED: ATPase 11, plasma membrane-type isoform X1 [Camelina 
sativa]
Length=959

 Score =   190 bits (482),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 123/148 (83%), Positives = 135/148 (91%), Gaps = 3/148 (2%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN+V Y PLD+IKF  RYALSG+AWDLV+EQR+AFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDIIKFLIRYALSGRAWDLVIEQRVAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiar---lre  361
            KDFGKEQRELQWAHAQRTLHGLQ PD K+F E T+FN+L+Q+AEEAKRRAEIA    LRE
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQAPDAKMFPERTHFNELSQMAEEAKRRAEIASFDRLRE  931

Query  360  LHTLKGHVESVVKLKGLDIETIQQAYTV  277
            LHTLKGHVESVV+LKGLDIETIQQAYTV
Sbjct  932  LHTLKGHVESVVRLKGLDIETIQQAYTV  959



>ref|XP_006838797.1| hypothetical protein AMTR_s00002p00260210 [Amborella trichopoda]
 gb|ERN01366.1| hypothetical protein AMTR_s00002p00260210 [Amborella trichopoda]
Length=956

 Score =   190 bits (482),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 102/124 (82%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ YFPLD+IKF TRYALSGKAWDLV+EQRIAFTR+KDFGKE REL+WAHAQRTLHG
Sbjct  833  LYNIITYFPLDIIKFITRYALSGKAWDLVMEQRIAFTRQKDFGKEARELKWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            L  P+TK+FSE T++ DLNQ+AEEAKRRAEIARLRE  TLKGHVESVV+LKGLDI+TIQQ
Sbjct  893  LHPPETKMFSERTSYTDLNQMAEEAKRRAEIARLREFTTLKGHVESVVRLKGLDIDTIQQ  952

Query  288  AYTV  277
            AYTV
Sbjct  953  AYTV  956



>ref|XP_008459294.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis melo]
Length=956

 Score =   189 bits (481),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 121/145 (83%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGV+WLYNLV YFPLD+IKF  RYA+SG+AWDLV+EQRIAFTRK
Sbjct  812  YANWSFAAIEGIGWGWAGVVWLYNLVFYFPLDIIKFAIRYAISGRAWDLVIEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHAQRTLHGLQ P+ K+FSE T + +LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEERELKWAHAQRTLHGLQPPEAKMFSERTTYTELNQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI TIQQ+YTV
Sbjct  932  LKGHVESVVRLKGLDINTIQQSYTV  956



>ref|XP_010548837.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 11, plasma membrane-type 
[Tarenaya hassleriana]
Length=222

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SF AIEGIGWGWAGVIWLYN++ Y PLDLIKFF   ALSG+AWDLV+EQRIAFTRK
Sbjct  78   YANWSFTAIEGIGWGWAGVIWLYNIIFYIPLDLIKFFICXALSGRAWDLVIEQRIAFTRK  137

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            +DFGKEQRELQWA AQRTLHGLQ  DTK+F+E T+FN+LNQ+AEEAKRRAEIARL+ELHT
Sbjct  138  RDFGKEQRELQWAQAQRTLHGLQPXDTKMFTERTHFNELNQMAEEAKRRAEIARLQELHT  197

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
             KGHVE VV+LKGLD ETIQQAYTV
Sbjct  198  PKGHVELVVRLKGLDTETIQQAYTV  222



>gb|KEH24965.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   189 bits (480),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 119/145 (82%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAG++WLYNL+ Y PLD IKF  RY LSG+AWDLV EQRIAFTRK
Sbjct  807  YANWSFAAIEGIGWGWAGIVWLYNLIFYIPLDFIKFIIRYILSGRAWDLVFEQRIAFTRK  866

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHAQRTLHGL  P+TK+FSE TN+ +LNQ+AEEAKRRAEIAR+RELHT
Sbjct  867  KDFGKEERELKWAHAQRTLHGLHPPETKMFSERTNYTELNQMAEEAKRRAEIARIRELHT  926

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  927  LKGHVESVVRLKGLDIDTIQQAYTV  951



>gb|KEH24964.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=956

 Score =   189 bits (480),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 119/145 (82%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAG++WLYNL+ Y PLD IKF  RY LSG+AWDLV EQRIAFTRK
Sbjct  812  YANWSFAAIEGIGWGWAGIVWLYNLIFYIPLDFIKFIIRYILSGRAWDLVFEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHAQRTLHGL  P+TK+FSE TN+ +LNQ+AEEAKRRAEIAR+RELHT
Sbjct  872  KDFGKEERELKWAHAQRTLHGLHPPETKMFSERTNYTELNQMAEEAKRRAEIARIRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  932  LKGHVESVVRLKGLDIDTIQQAYTV  956



>ref|XP_002517457.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF44999.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=762

 Score =   187 bits (475),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 120/145 (83%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGV+WLYNL+ YFPLD IKF  RYALSGKAWDLV+EQRIAFTRK
Sbjct  618  YANWSFAAIEGIGWGWAGVVWLYNLIFYFPLDFIKFIIRYALSGKAWDLVIEQRIAFTRK  677

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHAQRTLHGL  PD K+F++ +++ +LNQ+AEEAKRRAEIARLRELHT
Sbjct  678  KDFGKEERELKWAHAQRTLHGLHPPDIKMFNDRSSYTELNQMAEEAKRRAEIARLRELHT  737

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  738  LKGHVESVVRLKGLDIDTIQQAYTV  762



>dbj|BAK04567.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=958

 Score =   188 bits (478),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 101/124 (81%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ YFPLD+IKF  RY LSGKAWDLV++QRIAFTRKKDFGKE+REL+WAHAQRTLHG
Sbjct  835  LYNIITYFPLDIIKFLIRYTLSGKAWDLVIDQRIAFTRKKDFGKEERELKWAHAQRTLHG  894

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD K+FS+   +N+LN +AEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ
Sbjct  895  LQPPDAKMFSDKGGYNELNHMAEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ  954

Query  288  AYTV  277
            +YTV
Sbjct  955  SYTV  958



>dbj|BAJ92653.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=958

 Score =   188 bits (478),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 101/124 (81%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ YFPLD+IKF  RY LSGKAWDLV++QRIAFTRKKDFGKE+REL+WAHAQRTLHG
Sbjct  835  LYNIITYFPLDIIKFLIRYTLSGKAWDLVIDQRIAFTRKKDFGKEERELKWAHAQRTLHG  894

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD K+FS+   +N+LN +AEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ
Sbjct  895  LQPPDAKMFSDKGGYNELNHMAEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ  954

Query  288  AYTV  277
            +YTV
Sbjct  955  SYTV  958



>ref|XP_007155353.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
 gb|ESW27347.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
Length=955

 Score =   187 bits (476),  Expect = 9e-51, Method: Composition-based stats.
 Identities = 123/145 (85%), Positives = 136/145 (94%), Gaps = 1/145 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN++ Y PLD+IKF  RYALSG+AWDLV+EQRIAFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDIIKFLIRYALSGRAWDLVIEQRIAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PD+K F+E T+ N+LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQPPDSK-FNERTHVNELNQMAEEAKRRAEIARLRELHT  930

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  931  LKGHVESVVRLKGLDIDTIQQAYTV  955



>ref|XP_004148685.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis sativus]
 ref|XP_004162585.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis sativus]
Length=956

 Score =   187 bits (476),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 119/145 (82%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGV+WLYNL+ YFPLD+IKF  RYA+SG+AWDLV+EQRIAFTRK
Sbjct  812  YANWSFAAIEGIGWGWAGVVWLYNLIFYFPLDIIKFAIRYAISGRAWDLVIEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHAQRTLHGLQ P+ K+FS+ T + +LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEERELKWAHAQRTLHGLQPPEAKMFSDRTTYTELNQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI TIQQ+YTV
Sbjct  932  LKGHVESVVRLKGLDINTIQQSYTV  956



>ref|XP_002270344.1| PREDICTED: plasma membrane ATPase 1 isoform X1 [Vitis vinifera]
 ref|XP_010663416.1| PREDICTED: plasma membrane ATPase 1 isoform X2 [Vitis vinifera]
 emb|CBI15286.3| unnamed protein product [Vitis vinifera]
Length=956

 Score =   187 bits (476),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 121/145 (83%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN++ Y PLD IKF  RYALSG+AWDLV+EQRIAFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDFIKFIIRYALSGRAWDLVIEQRIAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE REL+WAHAQRTLHGLQ PDTK+F++ TNF +LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEARELKWAHAQRTLHGLQPPDTKMFTDRTNFTELNQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI TI QAYTV
Sbjct  932  LKGHVESVVRLKGLDINTIPQAYTV  956



>gb|KGN52442.1| hypothetical protein Csa_5G635370 [Cucumis sativus]
Length=802

 Score =   186 bits (473),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 119/145 (82%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGV+WLYNL+ YFPLD+IKF  RYA+SG+AWDLV+EQRIAFTRK
Sbjct  658  YANWSFAAIEGIGWGWAGVVWLYNLIFYFPLDIIKFAIRYAISGRAWDLVIEQRIAFTRK  717

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHAQRTLHGLQ P+ K+FS+ T + +LNQ+AEEAKRRAEIARLRELHT
Sbjct  718  KDFGKEERELKWAHAQRTLHGLQPPEAKMFSDRTTYTELNQMAEEAKRRAEIARLRELHT  777

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI TIQQ+YTV
Sbjct  778  LKGHVESVVRLKGLDINTIQQSYTV  802



>dbj|BAA01058.1| H-ATPase [Oryza sativa Japonica Group]
 prf||1906387A H ATPase
Length=956

 Score =   187 bits (476),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 117/145 (81%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN +F +I+GIGWGWAG++WLYNLV YFPLD+IKF  RYALSGKAWDLV+EQRIAFTRK
Sbjct  812  YANWAFTSIKGIGWGWAGIVWLYNLVFYFPLDIIKFLIRYALSGKAWDLVIEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHA RTLHGLQ PD K F E T +++LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEERELKWAHAHRTLHGLQPPDAKPFPEKTGYSELNQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVVKLKGLDI+TI Q+YTV
Sbjct  932  LKGHVESVVKLKGLDIDTIHQSYTV  956



>ref|NP_001050947.1| Os03g0689300 [Oryza sativa Japonica Group]
 emb|CAD29294.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 gb|AAT81733.1| H-ATPase [Oryza sativa Japonica Group]
 gb|ABF98274.1| Plasma membrane ATPase 3, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12861.1| Os03g0689300 [Oryza sativa Japonica Group]
Length=956

 Score =   187 bits (476),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 117/145 (81%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN +F +I+GIGWGWAG++WLYNLV YFPLD+IKF  RYALSGKAWDLV+EQRIAFTRK
Sbjct  812  YANWAFTSIKGIGWGWAGIVWLYNLVFYFPLDIIKFLIRYALSGKAWDLVIEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHA RTLHGLQ PD K F E T +++LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEERELKWAHAHRTLHGLQPPDAKPFPEKTGYSELNQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVVKLKGLDI+TI Q+YTV
Sbjct  932  LKGHVESVVKLKGLDIDTIHQSYTV  956



>ref|NP_001169535.1| uncharacterized protein LOC100383411 [Zea mays]
 gb|ACN34046.1| unknown [Zea mays]
Length=309

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 113/124 (91%), Gaps = 2/124 (2%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYNLV YFPLDL+KF  RYALSGKAWDLV+EQRIAFTRKKDFGKE+R L+WAHAQRTLHG
Sbjct  188  LYNLVFYFPLDLLKFLIRYALSGKAWDLVIEQRIAFTRKKDFGKEERALKWAHAQRTLHG  247

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD KLF +    N+LNQ+AEEAKRRAEIARLRELHTLKGHVESVVKLKGLDI+TIQQ
Sbjct  248  LQPPDAKLFPD--RVNELNQMAEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQ  305

Query  288  AYTV  277
            +YTV
Sbjct  306  SYTV  309



>gb|EEC75974.1| hypothetical protein OsI_13084 [Oryza sativa Indica Group]
 gb|EEE59727.1| hypothetical protein OsJ_12166 [Oryza sativa Japonica Group]
Length=966

 Score =   187 bits (476),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 117/145 (81%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN +F +I+GIGWGWAG++WLYNLV YFPLD+IKF  RYALSGKAWDLV+EQRIAFTRK
Sbjct  822  YANWAFTSIKGIGWGWAGIVWLYNLVFYFPLDIIKFLIRYALSGKAWDLVIEQRIAFTRK  881

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHA RTLHGLQ PD K F E T +++LNQ+AEEAKRRAEIARLRELHT
Sbjct  882  KDFGKEERELKWAHAHRTLHGLQPPDAKPFPEKTGYSELNQMAEEAKRRAEIARLRELHT  941

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVVKLKGLDI+TI Q+YTV
Sbjct  942  LKGHVESVVKLKGLDIDTIHQSYTV  966



>gb|EMT31912.1| Plasma membrane ATPase 1 [Aegilops tauschii]
Length=1004

 Score =   187 bits (474),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 100/124 (81%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ Y PLD+IKF  RY LSGKAWDLV++QRIAFTRKKDFGKE+REL+WAHAQRTLHG
Sbjct  865  LYNIITYLPLDIIKFLIRYTLSGKAWDLVIDQRIAFTRKKDFGKEERELKWAHAQRTLHG  924

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD K+FSE   +N+LN +AEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ
Sbjct  925  LQPPDAKMFSEKGGYNELNHMAEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ  984

Query  288  AYTV  277
            +YT+
Sbjct  985  SYTI  988



>gb|ACN49187.1| plasma membrane ATPase 1-like protein [Triticum aestivum]
Length=620

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ Y PLD+IKF  RY LSGKAWDLV++QRIAFTRKKDFGKE+REL+WAHAQRTLHG
Sbjct  497  LYNIITYLPLDIIKFLIRYTLSGKAWDLVIDQRIAFTRKKDFGKEERELKWAHAQRTLHG  556

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD K+FSE   +N+LN +AEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ
Sbjct  557  LQPPDAKMFSEKGGYNELNHMAEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQ  616

Query  288  AYTV  277
            +YTV
Sbjct  617  SYTV  620



>ref|XP_003561110.1| PREDICTED: plasma membrane ATPase 1-like [Brachypodium distachyon]
Length=956

 Score =   186 bits (472),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 101/124 (81%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYNLV YFPLD+IKF  RYALSGKAWDLV++QR+AFTRKK FGKE+REL+WAHAQRTLHG
Sbjct  833  LYNLVFYFPLDIIKFLIRYALSGKAWDLVIDQRVAFTRKKHFGKEERELKWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD KLF E   ++++NQ+AEEAKRRAEIARLRELHTLKGHVESVVKLKGLDI+TIQQ
Sbjct  893  LQPPDAKLFPEKAGYSEMNQMAEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQ  952

Query  288  AYTV  277
            +YTV
Sbjct  953  SYTV  956



>ref|XP_009398401.1| PREDICTED: plasma membrane ATPase 1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=961

 Score =   186 bits (471),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 100/124 (81%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ YFPLD+IKF  RYALSG+AWDLV+EQRIAFTR+KDFGKE REL+WAHAQRTLHG
Sbjct  838  LYNIIFYFPLDIIKFLIRYALSGRAWDLVIEQRIAFTRQKDFGKEARELKWAHAQRTLHG  897

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PDTK+F + ++  +LNQ+AEEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQ
Sbjct  898  LQPPDTKMFGDRSSVTELNQMAEEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQ  957

Query  288  AYTV  277
            AYTV
Sbjct  958  AYTV  961



>ref|XP_009398400.1| PREDICTED: plasma membrane ATPase 1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=989

 Score =   186 bits (471),  Expect = 6e-50, Method: Composition-based stats.
 Identities = 100/124 (81%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ YFPLD+IKF  RYALSG+AWDLV+EQRIAFTR+KDFGKE REL+WAHAQRTLHG
Sbjct  866  LYNIIFYFPLDIIKFLIRYALSGRAWDLVIEQRIAFTRQKDFGKEARELKWAHAQRTLHG  925

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PDTK+F + ++  +LNQ+AEEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQ
Sbjct  926  LQPPDTKMFGDRSSVTELNQMAEEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQ  985

Query  288  AYTV  277
            AYTV
Sbjct  986  AYTV  989



>gb|EMS45119.1| Plasma membrane ATPase 1 [Triticum urartu]
Length=973

 Score =   185 bits (470),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 102/124 (82%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN+V YFPLD+IKFF RYALSGKAW LV++QRIAFTRKK FGKE+REL+WAHAQRTLHG
Sbjct  850  LYNIVFYFPLDIIKFFIRYALSGKAWGLVIDQRIAFTRKKHFGKEERELKWAHAQRTLHG  909

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD KLF E   +N+L+Q+AEEAKRRAEIARLRELHTLKGHVESVVKLKGLDI+TIQQ
Sbjct  910  LQPPDAKLFPEKAAYNELSQMAEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQ  969

Query  288  AYTV  277
            +YTV
Sbjct  970  SYTV  973



>gb|EMT26085.1| Plasma membrane ATPase 1 [Aegilops tauschii]
Length=969

 Score =   185 bits (470),  Expect = 9e-50, Method: Composition-based stats.
 Identities = 101/124 (81%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN+V YFPLD+IKFF RYALSGKAWDLV++QRIAFTRKK FGKE+REL+WAHAQRTLHG
Sbjct  846  LYNIVFYFPLDIIKFFIRYALSGKAWDLVIDQRIAFTRKKHFGKEERELKWAHAQRTLHG  905

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ P+ KLF E   +N+L Q+A+EAKRRAEIARLRELHTLKGHVESVVKLKGLDI+TIQQ
Sbjct  906  LQPPNAKLFPEKAGYNELCQMADEAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQ  965

Query  288  AYTV  277
            +YTV
Sbjct  966  SYTV  969



>ref|XP_009398402.1| PREDICTED: plasma membrane ATPase 1-like [Musa acuminata subsp. 
malaccensis]
Length=961

 Score =   184 bits (468),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 99/124 (80%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN+V YFPLD+IKF  RYALSG+AWDLV+EQRIAFTR+KDFGKE REL+WAHAQRTLHG
Sbjct  838  LYNIVFYFPLDIIKFLIRYALSGRAWDLVIEQRIAFTRQKDFGKEARELKWAHAQRTLHG  897

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PDTK+F + ++F +LNQ+AEEA+RRAEIARLREL+TLKGH+ESVV+LKGLDI+TIQQ
Sbjct  898  LQPPDTKMFGDRSSFTELNQIAEEARRRAEIARLRELNTLKGHMESVVRLKGLDIDTIQQ  957

Query  288  AYTV  277
            AYTV
Sbjct  958  AYTV  961



>ref|XP_003549657.1| PREDICTED: ATPase 11, plasma membrane-type-like [Glycine max]
 gb|KHN18516.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=955

 Score =   184 bits (467),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 103/124 (83%), Positives = 115/124 (93%), Gaps = 1/124 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ Y PLD+IKF  RYALSG+AWDLV+EQRIAFTR+KDFGKEQRELQWAHAQRTLHG
Sbjct  833  LYNIIFYIPLDIIKFLIRYALSGRAWDLVIEQRIAFTRQKDFGKEQRELQWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ  DTK F+E T+ N+LNQ+AEEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQ
Sbjct  893  LQPADTK-FNERTHVNELNQMAEEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQ  951

Query  288  AYTV  277
            AYTV
Sbjct  952  AYTV  955



>ref|XP_010272214.1| PREDICTED: ATPase 11, plasma membrane-type-like [Nelumbo nucifera]
Length=955

 Score =   184 bits (466),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 102/124 (82%), Positives = 114/124 (92%), Gaps = 1/124 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            +YN++ Y PLD IKF  RYALSG+AWDLV+EQRIAFTRKKDFGKE REL+WAHAQRTLHG
Sbjct  833  IYNVIFYIPLDFIKFIIRYALSGRAWDLVIEQRIAFTRKKDFGKEARELKWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PDT +F+E T+F DLNQ+AEEAKRRAEIARLRELHTLKGHVESVV+LKGLDI+TIQQ
Sbjct  893  LQPPDT-MFNERTSFTDLNQMAEEAKRRAEIARLRELHTLKGHVESVVRLKGLDIDTIQQ  951

Query  288  AYTV  277
            AYTV
Sbjct  952  AYTV  955



>ref|XP_008644894.1| PREDICTED: uncharacterized protein LOC100383411 isoform X1 [Zea 
mays]
Length=954

 Score =   184 bits (466),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 104/124 (84%), Positives = 113/124 (91%), Gaps = 2/124 (2%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYNLV YFPLDL+KF  RYALSGKAWDLV+EQRIAFTRKKDFGKE+R L+WAHAQRTLHG
Sbjct  833  LYNLVFYFPLDLLKFLIRYALSGKAWDLVIEQRIAFTRKKDFGKEERALKWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD KLF +    N+LNQ+AEEAKRRAEIARLRELHTLKGHVESVVKLKGLDI+TIQQ
Sbjct  893  LQPPDAKLFPD--RVNELNQMAEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQ  950

Query  288  AYTV  277
            +YTV
Sbjct  951  SYTV  954



>ref|XP_006595243.1| PREDICTED: plasma membrane ATPase 1-like [Glycine max]
Length=918

 Score =   183 bits (465),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 117/145 (81%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGV+WLYNL+ Y PLD IKF  RYALSG+AWDLV+EQRIAFTRK
Sbjct  774  YANWSFAAIEGIGWGWAGVVWLYNLIFYIPLDFIKFIIRYALSGRAWDLVIEQRIAFTRK  833

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHAQRTLHGL  P+TK+F+E T++ +LNQ+AEEA+RRAEIARLRELHT
Sbjct  834  KDFGKEERELKWAHAQRTLHGLHPPETKMFNERTSYTELNQMAEEARRRAEIARLRELHT  893

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKG VESVV+LKGL+I+TIQQAYTV
Sbjct  894  LKGRVESVVRLKGLNIDTIQQAYTV  918



>ref|XP_010029279.1| PREDICTED: ATPase 11, plasma membrane-type-like [Eucalyptus grandis]
 ref|XP_010029280.1| PREDICTED: ATPase 11, plasma membrane-type-like [Eucalyptus grandis]
 gb|KCW56160.1| hypothetical protein EUGRSUZ_I01911 [Eucalyptus grandis]
Length=954

 Score =   183 bits (465),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 119/145 (82%), Positives = 135/145 (93%), Gaps = 2/145 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAG++WLYNL+ Y PLD IKFFTRYALSGKAWDLV+EQRIAFTRK
Sbjct  812  YANWSFAAIEGIGWGWAGIVWLYNLIFYIPLDFIKFFTRYALSGKAWDLVIEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHAQRTLHGL  P+TK+F   +++ +LNQ+AEEAKRRAEIARLREL+T
Sbjct  872  KDFGKEERELKWAHAQRTLHGLHPPETKMF--GSSYTELNQMAEEAKRRAEIARLRELNT  929

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  930  LKGHVESVVRLKGLDIDTIQQAYTV  954



>gb|KCW56159.1| hypothetical protein EUGRSUZ_I01911 [Eucalyptus grandis]
Length=963

 Score =   183 bits (465),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 119/145 (82%), Positives = 135/145 (93%), Gaps = 2/145 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAG++WLYNL+ Y PLD IKFFTRYALSGKAWDLV+EQRIAFTRK
Sbjct  821  YANWSFAAIEGIGWGWAGIVWLYNLIFYIPLDFIKFFTRYALSGKAWDLVIEQRIAFTRK  880

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHAQRTLHGL  P+TK+F   +++ +LNQ+AEEAKRRAEIARLREL+T
Sbjct  881  KDFGKEERELKWAHAQRTLHGLHPPETKMF--GSSYTELNQMAEEAKRRAEIARLRELNT  938

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYTV
Sbjct  939  LKGHVESVVRLKGLDIDTIQQAYTV  963



>gb|KHN13245.1| Plasma membrane ATPase 1 [Glycine soja]
Length=956

 Score =   183 bits (465),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 117/145 (81%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGV+WLYNL+ Y PLD IKF  RYALSG+AWDLV+EQRIAFTRK
Sbjct  812  YANWSFAAIEGIGWGWAGVVWLYNLIFYIPLDFIKFIIRYALSGRAWDLVIEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHAQRTLHGL  P+TK+F+E T++ +LNQ+AEEA+RRAEIARLRELHT
Sbjct  872  KDFGKEERELKWAHAQRTLHGLHPPETKMFNERTSYTELNQMAEEARRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKG VESVV+LKGL+I+TIQQAYTV
Sbjct  932  LKGRVESVVRLKGLNIDTIQQAYTV  956



>tpg|DAA50741.1| TPA: hypothetical protein ZEAMMB73_722190 [Zea mays]
Length=1149

 Score =   184 bits (466),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 104/124 (84%), Positives = 113/124 (91%), Gaps = 2/124 (2%)
 Frame = -3

Query  648   LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
             LYNLV YFPLDL+KF  RYALSGKAWDLV+EQRIAFTRKKDFGKE+R L+WAHAQRTLHG
Sbjct  1028  LYNLVFYFPLDLLKFLIRYALSGKAWDLVIEQRIAFTRKKDFGKEERALKWAHAQRTLHG  1087

Query  468   LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
             LQ PD KLF +    N+LNQ+AEEAKRRAEIARLRELHTLKGHVESVVKLKGLDI+TIQQ
Sbjct  1088  LQPPDAKLFPD--RVNELNQMAEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQ  1145

Query  288   AYTV  277
             +YTV
Sbjct  1146  SYTV  1149



>ref|XP_009417143.1| PREDICTED: plasma membrane ATPase 1-like [Musa acuminata subsp. 
malaccensis]
Length=955

 Score =   182 bits (462),  Expect = 8e-49, Method: Composition-based stats.
 Identities = 103/124 (83%), Positives = 115/124 (93%), Gaps = 1/124 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYNL+ YFPLD+IKFF RYALSGKAW+LV+EQRIAFTRKKDFGKE+REL+WAHAQRTLHG
Sbjct  833  LYNLIFYFPLDIIKFFIRYALSGKAWELVIEQRIAFTRKKDFGKEERELRWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PDTK FSE +   +LNQ+AEEAKRRAEIARLREL+TLKGHVESVV+LKGLDI TIQQ
Sbjct  893  LQPPDTK-FSERSTVTELNQIAEEAKRRAEIARLRELNTLKGHVESVVRLKGLDIGTIQQ  951

Query  288  AYTV  277
            +YTV
Sbjct  952  SYTV  955



>ref|XP_004982139.1| PREDICTED: plasma membrane ATPase 1-like [Setaria italica]
Length=954

 Score =   182 bits (462),  Expect = 8e-49, Method: Composition-based stats.
 Identities = 117/145 (81%), Positives = 131/145 (90%), Gaps = 2/145 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  F +I+GIGWGWAGV+WLYNL+ YFPLD++KF  RYALSG+AWDLV+EQRIAFT K
Sbjct  812  YANWGFTSIKGIGWGWAGVVWLYNLIFYFPLDILKFLIRYALSGRAWDLVIEQRIAFTMK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHAQRTLHGLQ PD KLF E    N+LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEERELKWAHAQRTLHGLQPPDAKLFPE--RVNELNQMAEEAKRRAEIARLRELHT  929

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  930  LKGHVESVVKLKGLDIDTIQQSYTV  954



>gb|KHN34200.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=956

 Score =   182 bits (462),  Expect = 9e-49, Method: Composition-based stats.
 Identities = 115/145 (79%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGV+WLYNLV Y PLD IKF  RYALSG+AWDLV+EQRIAFTRK
Sbjct  812  YANWSFAAIEGIGWGWAGVVWLYNLVFYIPLDFIKFIIRYALSGRAWDLVIEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHA RTLHGL  P+TK+F+E T++ +LNQ+AEEA+RRA IARLRELHT
Sbjct  872  KDFGKEERELKWAHAHRTLHGLHPPETKMFNERTSYTELNQMAEEARRRANIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            L GHVESV +LKGLDI+TIQQAYT+
Sbjct  932  LTGHVESVFRLKGLDIDTIQQAYTI  956



>ref|XP_003554288.1| PREDICTED: plasma membrane ATPase 1-like [Glycine max]
Length=956

 Score =   182 bits (462),  Expect = 9e-49, Method: Composition-based stats.
 Identities = 115/145 (79%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGV+WLYNLV Y PLD IKF  RYALSG+AWDLV+EQRIAFTRK
Sbjct  812  YANWSFAAIEGIGWGWAGVVWLYNLVFYIPLDFIKFIIRYALSGRAWDLVIEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHA RTLHGL  P+TK+F+E T++ +LNQ+AEEA+RRA IARLRELHT
Sbjct  872  KDFGKEERELKWAHAHRTLHGLHPPETKMFNERTSYTELNQMAEEARRRANIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            L GHVESV +LKGLDI+TIQQAYT+
Sbjct  932  LTGHVESVFRLKGLDIDTIQQAYTI  956



>ref|XP_003525017.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform 1 [Glycine 
max]
 gb|KHN48653.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=955

 Score =   182 bits (461),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 120/145 (83%), Positives = 135/145 (93%), Gaps = 1/145 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN++ Y PLD++KF  RYALSG+AWDLV+EQRIAFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDIVKFLIRYALSGRAWDLVIEQRIAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ  DTK F+E T+ ++LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQPADTK-FNERTHVSELNQMAEEAKRRAEIARLRELHT  930

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQAYT+
Sbjct  931  LKGHVESVVRLKGLDIDTIQQAYTL  955



>ref|XP_002282263.1| PREDICTED: ATPase 4, plasma membrane-type [Vitis vinifera]
 ref|XP_010661009.1| PREDICTED: ATPase 4, plasma membrane-type [Vitis vinifera]
 emb|CBI35033.3| unnamed protein product [Vitis vinifera]
Length=955

 Score =   181 bits (460),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 122/145 (84%), Positives = 131/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYNLVCY PLD IKF  RYALSGKAWDLV+EQRIAFTRK
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNLVCYIPLDFIKFIIRYALSGKAWDLVIEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE REL+WA AQRTLHGL  P+TK+F++  N  +LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEARELKWALAQRTLHGLHPPETKMFTDH-NITELNQMAEEAKRRAEIARLRELHT  930

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI TIQQAYTV
Sbjct  931  LKGHVESVVRLKGLDINTIQQAYTV  955



>ref|XP_011082991.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 1-like 
[Sesamum indicum]
Length=951

 Score =   181 bits (459),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 118/145 (81%), Positives = 132/145 (91%), Gaps = 1/145 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN++ YFPLDLIKFF RYALSG+AWDLV+EQRIAFTRK
Sbjct  808  YANWSFAAIEGIGWGWAGVIWLYNIIFYFPLDLIKFFIRYALSGRAWDLVIEQRIAFTRK  867

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE REL+WA AQRTLHGL  P T+ F E  N+N+LNQ+AEEAKRRAE+ARLRELHT
Sbjct  868  KDFGKEDRELKWAQAQRTLHGLHPPQTQ-FGERNNYNELNQIAEEAKRRAEMARLRELHT  926

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESV+K+K LDI+TIQQ+YTV
Sbjct  927  LKGHVESVIKMKNLDIDTIQQSYTV  951



>ref|XP_011098566.1| PREDICTED: plasma membrane ATPase 1-like [Sesamum indicum]
 ref|XP_011098567.1| PREDICTED: plasma membrane ATPase 1-like [Sesamum indicum]
Length=955

 Score =   181 bits (459),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 118/145 (81%), Positives = 132/145 (91%), Gaps = 1/145 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN++ YFPLDLIKFF RYALSG+AWDLV+EQRIAFTRK
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIIFYFPLDLIKFFIRYALSGRAWDLVIEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE REL+WA AQRTLHGL  P T+ F E  N+N+LNQ+AEEAKRRAE+ARLRELHT
Sbjct  872  KDFGKEDRELKWAQAQRTLHGLHPPQTQ-FGERNNYNELNQIAEEAKRRAEMARLRELHT  930

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESV+K+K LDI+TIQQ+YTV
Sbjct  931  LKGHVESVIKMKNLDIDTIQQSYTV  955



>ref|XP_010678593.1| PREDICTED: plasma membrane ATPase 1 [Beta vulgaris subsp. vulgaris]
Length=963

 Score =   181 bits (459),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 115/145 (79%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN +FAAIEGIGWGWAGVIWLYN++ Y PLD +KFFT Y LSG+AWDLV+EQRIAFT+K
Sbjct  819  YANWAFAAIEGIGWGWAGVIWLYNVIFYIPLDFVKFFTSYVLSGRAWDLVIEQRIAFTKK  878

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHAQRTLHGLQ P+ K+F+E TN+++LNQ+AEEAKRRAE+ARLREL T
Sbjct  879  KDFGKEERELKWAHAQRTLHGLQAPEAKMFTERTNYHELNQMAEEAKRRAEMARLRELLT  938

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHV+SVVKLKGLDIETIQ +YTV
Sbjct  939  LKGHVDSVVKLKGLDIETIQGSYTV  963



>ref|XP_004955721.1| PREDICTED: plasma membrane ATPase 1-like [Setaria italica]
Length=956

 Score =   181 bits (458),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 114/145 (79%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN +FAAI+GIGWGWAGVIWLYN+V YFPLD+IKF TRYALSG+AWDLVLEQRIAFTRK
Sbjct  812  YANWAFAAIKGIGWGWAGVIWLYNVVFYFPLDVIKFLTRYALSGRAWDLVLEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFG+E+REL+WAHAQRTLHGLQ P+  +F   T FN+LNQLAEEA+RRAE+ARLRE++T
Sbjct  872  KDFGREERELKWAHAQRTLHGLQAPEASIFENKTTFNELNQLAEEARRRAEMARLREVNT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKG +ESVV+ KGLD+ETIQQ+YTV
Sbjct  932  LKGKMESVVRQKGLDMETIQQSYTV  956



>gb|KJB19306.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=987

 Score =   179 bits (455),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 124/176 (70%), Positives = 136/176 (77%), Gaps = 31/176 (18%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQR------  550
            YAN SFAAIEGIGWGWAGVIWLYN++ Y PLD IKFF RYALSG+AWDLV+EQR      
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDFIKFFIRYALSGRAWDLVIEQRVCIPLS  871

Query  549  -------------------------IAFTRKKDFGKEQRELQWAHAQRTLHGLQVPDTKL  445
                                     IAFTR+KDFGKEQRELQWAHAQRTLHGLQ PDTK+
Sbjct  872  YRVHCYCCCLIRHIGLSDEFLFDAQIAFTRQKDFGKEQRELQWAHAQRTLHGLQAPDTKM  931

Query  444  FSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQAYTV  277
            F+E T+F +LNQ+AEEAKRRAEIARLRELHTLKGHVESVV+LK LDI+TIQQAYTV
Sbjct  932  FTERTHFTELNQMAEEAKRRAEIARLRELHTLKGHVESVVRLKNLDIDTIQQAYTV  987



>ref|XP_007151191.1| hypothetical protein PHAVU_004G025700g [Phaseolus vulgaris]
 gb|ESW23185.1| hypothetical protein PHAVU_004G025700g [Phaseolus vulgaris]
Length=956

 Score =   179 bits (454),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 116/145 (80%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGV+WLYNL+ Y PLD IKF  RYALSG+AWDLV+EQRIAFTRK
Sbjct  812  YANWSFAAIEGIGWGWAGVVWLYNLIFYMPLDFIKFVIRYALSGRAWDLVIEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            K+FG+E+REL+WAHAQRTLHGL  P+TK+F E T   +LN +AEEAKRRAEIARLRELHT
Sbjct  872  KNFGREERELKWAHAQRTLHGLHPPETKMFGERTPHTELNHMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+LKGLDI+TIQQ+YTV
Sbjct  932  LKGHVESVVRLKGLDIDTIQQSYTV  956



>ref|XP_002466646.1| hypothetical protein SORBIDRAFT_01g011610 [Sorghum bicolor]
 gb|EER93644.1| hypothetical protein SORBIDRAFT_01g011610 [Sorghum bicolor]
Length=749

 Score =   177 bits (449),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 116/145 (80%), Positives = 131/145 (90%), Gaps = 2/145 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  F +I+GIGWGWAGV+WLYNLV YFPLD++KF  RYA+SGKAWDLV+EQRIAFTRK
Sbjct  607  YANWGFTSIKGIGWGWAGVVWLYNLVFYFPLDILKFLIRYAMSGKAWDLVVEQRIAFTRK  666

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            K+FGKE+R L+WAHAQRTLHGLQ PD KLF E    ++LNQ+AEEAKRRAEIARLRELHT
Sbjct  667  KNFGKEERALKWAHAQRTLHGLQPPDAKLFPE--RVHELNQMAEEAKRRAEIARLRELHT  724

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  725  LKGHVESVVKLKGLDIDTIQQSYTV  749



>ref|XP_011466246.1| PREDICTED: plasma membrane ATPase 1-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=966

 Score =   177 bits (450),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 97/124 (78%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYNLV Y PLD++KF  RYALSG+AWDLV EQRIAFTRKK FGKE+REL+WAHAQRTLHG
Sbjct  833  LYNLVFYLPLDILKFIIRYALSGRAWDLVFEQRIAFTRKKHFGKEERELRWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD+K F E +++ +LNQ+AEEAKRRAEIARLREL+TLKGHVESVV++KGLDI+TIQQ
Sbjct  893  LQPPDSKKFGERSSYTELNQMAEEAKRRAEIARLRELNTLKGHVESVVRMKGLDIDTIQQ  952

Query  288  AYTV  277
            +YTV
Sbjct  953  SYTV  956



>ref|XP_009335819.1| PREDICTED: plasma membrane ATPase 1-like [Pyrus x bretschneideri]
Length=956

 Score =   177 bits (450),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 115/145 (79%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGV+WLYNL+ YFPLD IKFF RYALSG+AWDLV+EQR AFTRK
Sbjct  812  YANWSFAAIEGIGWGWAGVVWLYNLIFYFPLDFIKFFIRYALSGRAWDLVIEQRTAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHAQRTLHGL  P+  +FS+ T + +LNQ+AEEAKRRAEIARLREL T
Sbjct  872  KDFGKEERELKWAHAQRTLHGLHPPEATMFSDRTTYTELNQMAEEAKRRAEIARLRELQT  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKG VESVV+LK LDI+TIQQ+YTV
Sbjct  932  LKGRVESVVRLKNLDIDTIQQSYTV  956



>ref|XP_007214948.1| hypothetical protein PRUPE_ppa000931mg [Prunus persica]
 gb|EMJ16147.1| hypothetical protein PRUPE_ppa000931mg [Prunus persica]
Length=956

 Score =   177 bits (449),  Expect = 6e-47, Method: Composition-based stats.
 Identities = 113/145 (78%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAI+GIGWGWAGV+WLYNLV YFPLD IKF  RYALSG+AWDL+++QRIAFTRK
Sbjct  812  YANWSFAAIKGIGWGWAGVVWLYNLVFYFPLDFIKFVVRYALSGRAWDLIIDQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHAQRTLHGL  P+  +F + +N+++LNQ+AEEAKRRAEIARLREL T
Sbjct  872  KDFGKEERELKWAHAQRTLHGLHPPEANIFGDRSNYSELNQMAEEAKRRAEIARLRELST  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+ KGLDI+TIQQ+YTV
Sbjct  932  LKGHVESVVRNKGLDIDTIQQSYTV  956



>ref|XP_008230721.1| PREDICTED: plasma membrane ATPase 1-like [Prunus mume]
Length=959

 Score =   177 bits (448),  Expect = 8e-47, Method: Composition-based stats.
 Identities = 112/145 (77%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAA++GIGWGWAGV+WLYNLV YFPLD IKF  RYALSG+AWDL+++QRIAFTRK
Sbjct  815  YANWSFAAVKGIGWGWAGVVWLYNLVFYFPLDFIKFVIRYALSGRAWDLIIDQRIAFTRK  874

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHAQRTLHGL  P+  +F + +N+ +LNQ+AEEAKRRAEIARLREL T
Sbjct  875  KDFGKEERELKWAHAQRTLHGLHPPEANIFGDRSNYTELNQMAEEAKRRAEIARLRELST  934

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV+ KGLDI+TIQQ+YTV
Sbjct  935  LKGHVESVVRNKGLDIDTIQQSYTV  959



>gb|EYU34115.1| hypothetical protein MIMGU_mgv1a000867mg [Erythranthe guttata]
Length=955

 Score =   176 bits (447),  Expect = 9e-47, Method: Composition-based stats.
 Identities = 117/145 (81%), Positives = 132/145 (91%), Gaps = 1/145 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN +FAAIEGIGWGWAGVIWLYN+V YFPLD+IKFF RYALSGKAWDLV+EQRIAFTRK
Sbjct  812  YANWNFAAIEGIGWGWAGVIWLYNIVFYFPLDMIKFFIRYALSGKAWDLVIEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE REL+WA AQRTLHGL  P+ K   + TN+N+LNQ+AEEAKRRAE+ARLRELHT
Sbjct  872  KDFGKEDRELKWAQAQRTLHGLHPPE-KQSGDRTNYNELNQIAEEAKRRAEMARLRELHT  930

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESV+K+K LDI+TIQQ+YTV
Sbjct  931  LKGHVESVIKMKNLDIDTIQQSYTV  955



>ref|XP_004302360.1| PREDICTED: plasma membrane ATPase 1-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=956

 Score =   176 bits (447),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 96/124 (77%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYNLV Y PLD++KF  RYALSG+AWDLV EQRIAFTRKK FGKE+REL+WAHAQRTLHG
Sbjct  833  LYNLVFYLPLDILKFIIRYALSGRAWDLVFEQRIAFTRKKHFGKEERELRWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD+K F E +++ +LNQ+AEEAKRRAEIARLRE  TLKGHVESVV++KGLDI+TIQQ
Sbjct  893  LQPPDSKKFGERSSYTELNQMAEEAKRRAEIARLREFGTLKGHVESVVRMKGLDIDTIQQ  952

Query  288  AYTV  277
            +YTV
Sbjct  953  SYTV  956



>ref|XP_010531800.1| PREDICTED: ATPase 4, plasma membrane-type-like [Tarenaya hassleriana]
Length=954

 Score =   176 bits (446),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 115/145 (79%), Positives = 131/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  FA IEGIGW WAGV+WLYNL+ YFPLD +KFF RYALSG+AWDLV+EQRIAFTRK
Sbjct  811  YANWGFAFIEGIGWRWAGVVWLYNLIFYFPLDPLKFFIRYALSGRAWDLVIEQRIAFTRK  870

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE+REL+WAHAQRTLHGLQ P+T  F+E +++ +LN+LAEEAKRRAEI RLREL T
Sbjct  871  KDFGKEERELRWAHAQRTLHGLQPPETG-FTERSSYVELNRLAEEAKRRAEITRLRELRT  929

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  930  LKGHVESVVKLKGLDIDTIQQSYTV  954



>ref|XP_008341531.1| PREDICTED: plasma membrane ATPase 1-like [Malus domestica]
Length=956

 Score =   174 bits (442),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 97/124 (78%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYNL+ YFPLDLIKFF RYALSG+AWDLV+EQR AFTRKKDFGKE+R L+WAHAQRTLHG
Sbjct  833  LYNLIFYFPLDLIKFFIRYALSGRAWDLVIEQRTAFTRKKDFGKEERALKWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            L  P+   FS+ T + +LNQ+AEEAKRRAEIARLREL TLKG VESVV+LK LDI+TIQQ
Sbjct  893  LHPPEATXFSDRTTYTELNQMAEEAKRRAEIARLRELQTLKGRVESVVRLKNLDIDTIQQ  952

Query  288  AYTV  277
            AYTV
Sbjct  953  AYTV  956



>gb|ACR38028.1| unknown [Zea mays]
Length=368

 Score =   168 bits (425),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN +FAAI+GIGWGWAGVIWLYN+V YFPLD+IKF  RYALSG+AW+LVLEQRIAFT K
Sbjct  224  YANWAFAAIKGIGWGWAGVIWLYNIVFYFPLDIIKFLIRYALSGRAWNLVLEQRIAFTSK  283

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            K+FG E+RE +WAHAQRTLHGLQ P+  +F   T FN+LNQLAEEA+RRAE+ARLRE+ T
Sbjct  284  KNFGTEERERKWAHAQRTLHGLQPPEASIFENKTTFNELNQLAEEARRRAEMARLREVST  343

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKG +ESVVK KGLDIETIQQ+YTV
Sbjct  344  LKGRMESVVKQKGLDIETIQQSYTV  368



>ref|NP_001136587.1| uncharacterized protein LOC100216710 [Zea mays]
 gb|ACF82226.1| unknown [Zea mays]
Length=422

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN +FAAI+GIGWGWAGVIWLYN+V YFPLD+IKF  RYALSG+AW+LVLEQRIAFT K
Sbjct  278  YANWAFAAIKGIGWGWAGVIWLYNIVFYFPLDIIKFLIRYALSGRAWNLVLEQRIAFTSK  337

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            K+FG E+RE +WAHAQRTLHGLQ P+  +F   T FN+LNQLAEEA+RRAE+ARLRE+ T
Sbjct  338  KNFGTEERERKWAHAQRTLHGLQPPEASIFENKTTFNELNQLAEEARRRAEMARLREVST  397

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKG +ESVVK KGLDIETIQQ+YTV
Sbjct  398  LKGRMESVVKQKGLDIETIQQSYTV  422



>tpg|DAA59899.1| TPA: membrane H(+)-ATPase1 [Zea mays]
Length=426

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN +FAAI+GIGWGWAGVIWLYN+V YFPLD+IKF  RYALSG+AW+LVLEQRIAFT K
Sbjct  282  YANWAFAAIKGIGWGWAGVIWLYNIVFYFPLDIIKFLIRYALSGRAWNLVLEQRIAFTSK  341

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            K+FG E+RE +WAHAQRTLHGLQ P+  +F   T FN+LNQLAEEA+RRAE+ARLRE+ T
Sbjct  342  KNFGTEERERKWAHAQRTLHGLQPPEASIFENKTTFNELNQLAEEARRRAEMARLREVST  401

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKG +ESVVK KGLDIETIQQ+YTV
Sbjct  402  LKGRMESVVKQKGLDIETIQQSYTV  426



>tpg|DAA59901.1| TPA: membrane H(+)-ATPase1 [Zea mays]
Length=444

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN +FAAI+GIGWGWAGVIWLYN+V YFPLD+IKF  RYALSG+AW+LVLEQRIAFT K
Sbjct  300  YANWAFAAIKGIGWGWAGVIWLYNIVFYFPLDIIKFLIRYALSGRAWNLVLEQRIAFTSK  359

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            K+FG E+RE +WAHAQRTLHGLQ P+  +F   T FN+LNQLAEEA+RRAE+ARLRE+ T
Sbjct  360  KNFGTEERERKWAHAQRTLHGLQPPEASIFENKTTFNELNQLAEEARRRAEMARLREVST  419

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKG +ESVVK KGLDIETIQQ+YTV
Sbjct  420  LKGRMESVVKQKGLDIETIQQSYTV  444



>ref|XP_002459489.1| hypothetical protein SORBIDRAFT_02g005440 [Sorghum bicolor]
 gb|EER96010.1| hypothetical protein SORBIDRAFT_02g005440 [Sorghum bicolor]
Length=956

 Score =   171 bits (432),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 111/145 (77%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN +FA+I+GIGWGWAGVIWLYNLV YFPLD+IKF  RYALSG+AW+LVLEQRIAFT K
Sbjct  812  YANWAFASIKGIGWGWAGVIWLYNLVFYFPLDIIKFLIRYALSGRAWNLVLEQRIAFTSK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            K+FG E+RE +WAHAQRTLHGLQ P+  +F   T FN+LNQLAEEA+RRAE+ARLRE+ T
Sbjct  872  KNFGTEERERKWAHAQRTLHGLQPPEASIFENKTTFNELNQLAEEARRRAEMARLREVST  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKG +ESVVK KGLDIETIQQ+YTV
Sbjct  932  LKGKMESVVKQKGLDIETIQQSYTV  956



>ref|XP_008650970.1| PREDICTED: uncharacterized protein LOC100216710 isoform X1 [Zea 
mays]
 tpg|DAA59903.1| TPA: membrane H(+)-ATPase1 [Zea mays]
Length=956

 Score =   170 bits (430),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 111/145 (77%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN +FAAI+GIGWGWAGVIWLYN+V YFPLD+IKF  RYALSG+AW+LVLEQRIAFT K
Sbjct  812  YANWAFAAIKGIGWGWAGVIWLYNIVFYFPLDIIKFLIRYALSGRAWNLVLEQRIAFTSK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            K+FG E+RE +WAHAQRTLHGLQ P+  +F   T FN+LNQLAEEA+RRAE+ARLRE+ T
Sbjct  872  KNFGTEERERKWAHAQRTLHGLQPPEASIFENKTTFNELNQLAEEARRRAEMARLREVST  931

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKG +ESVVK KGLDIETIQQ+YTV
Sbjct  932  LKGRMESVVKQKGLDIETIQQSYTV  956



>gb|ACN34067.1| unknown [Zea mays]
Length=698

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN +FAAI+GIGWGWAGVIWLYN+V YFPLD+IKF  RYALSG+AW+LVLEQRIAFT K
Sbjct  554  YANWAFAAIKGIGWGWAGVIWLYNIVFYFPLDIIKFLIRYALSGRAWNLVLEQRIAFTSK  613

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            K+FG E+RE +WAHAQRTLHGLQ P+  +F   T FN+LNQLAEEA+RRAE+ARLRE+ T
Sbjct  614  KNFGTEERERKWAHAQRTLHGLQPPEASIFENKTTFNELNQLAEEARRRAEMARLREVST  673

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKG +ESVVK KGLDIETIQQ+YTV
Sbjct  674  LKGRMESVVKQKGLDIETIQQSYTV  698



>emb|CAH58642.1| plasma membrane H+-ATPase [Plantago major]
Length=218

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 123/145 (85%), Gaps = 1/145 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN+V Y PLD IKF  RY LSGKAWDLV EQRIAFTRK
Sbjct  75   YANWSFAAIEGIGWGWAGVIWLYNIVTYIPLDFIKFAIRYVLSGKAWDLVFEQRIAFTRK  134

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE REL+WA AQRTLHGL  P  +   E T+  +LNQ+AEEAKRRAE+ARLREL T
Sbjct  135  KDFGKEDRELKWAQAQRTLHGLNPPQEQ-SGERTHVTELNQIAEEAKRRAEMARLRELLT  193

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVVKLK LDI+TIQQ+YTV
Sbjct  194  LKGHVESVVKLKNLDIDTIQQSYTV  218



>ref|XP_007037195.1| H(+)-transporting atpase plant/fungi plasma membrane type [Theobroma 
cacao]
 gb|EOY21696.1| H(+)-transporting atpase plant/fungi plasma membrane type [Theobroma 
cacao]
Length=1607

 Score =   167 bits (424),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 110/129 (85%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFAAIEGIGWGWAGVIWLYN++ Y PLD IKFF RYALSG+AWDLV+EQRIAFTR+
Sbjct  812  YANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDFIKFFIRYALSGRAWDLVIEQRIAFTRQ  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKEQRELQWAHAQRTLHGLQ PDTK+F+E T+F +LNQ+AEEAKRRAEIARLRELHT
Sbjct  872  KDFGKEQRELQWAHAQRTLHGLQAPDTKMFTERTHFTELNQMAEEAKRRAEIARLRELHT  931

Query  351  LKGHVESVV  325
            LKGHVESV+
Sbjct  932  LKGHVESVL  940



>ref|XP_010228254.1| PREDICTED: plasma membrane ATPase 3-like isoform X2 [Brachypodium 
distachyon]
Length=956

 Score =   165 bits (417),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 91/124 (73%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN+V Y PLD+IKF  RYALSG+AWDLVL+QRIAFTRKKDFG+E+REL+WA AQRTLHG
Sbjct  833  LYNIVFYLPLDVIKFLIRYALSGRAWDLVLDQRIAFTRKKDFGREERELKWATAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ P++  F   T++++LNQLA+EA+RRAEIARLREL+TLKG +ESVV+ KGLD+ETIQQ
Sbjct  893  LQPPESTTFQGMTSYSELNQLADEARRRAEIARLRELNTLKGRMESVVRQKGLDLETIQQ  952

Query  288  AYTV  277
            +YTV
Sbjct  953  SYTV  956



>ref|XP_010228253.1| PREDICTED: plasma membrane ATPase 3-like isoform X1 [Brachypodium 
distachyon]
Length=991

 Score =   165 bits (417),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 91/124 (73%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN+V Y PLD+IKF  RYALSG+AWDLVL+QRIAFTRKKDFG+E+REL+WA AQRTLHG
Sbjct  868  LYNIVFYLPLDVIKFLIRYALSGRAWDLVLDQRIAFTRKKDFGREERELKWATAQRTLHG  927

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ P++  F   T++++LNQLA+EA+RRAEIARLREL+TLKG +ESVV+ KGLD+ETIQQ
Sbjct  928  LQPPESTTFQGMTSYSELNQLADEARRRAEIARLRELNTLKGRMESVVRQKGLDLETIQQ  987

Query  288  AYTV  277
            +YTV
Sbjct  988  SYTV  991



>gb|KGN62871.1| hypothetical protein Csa_2G378530 [Cucumis sativus]
Length=170

 Score =   152 bits (384),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  FA I+G+GWGWAGVIWLY+LV Y PLD++KF  RYA SGKAWD +LE + AFT K
Sbjct  25   YANWGFARIKGMGWGWAGVIWLYSLVTYIPLDILKFGIRYAHSGKAWDTLLENKTAFTTK  84

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+ + LF E +++ +L+++AE+AKRRAE+ARLRELH
Sbjct  85   KDYGKEEREAQWAAAQRTLHGLQPPENSNLFPEKSSYRELSEIAEQAKRRAEVARLRELH  144

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  145  TLKGHVESVVKLKGLDIDTIQQHYTV  170



>gb|ABR18001.1| unknown [Picea sitchensis]
Length=955

 Score =   163 bits (413),  Expect = 5e-42, Method: Composition-based stats.
 Identities = 105/145 (72%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YA+ SFA I+ IGWGWAGVIWLY+LV YFPLD+ KF  RYALSGKAWD ++E++ AFT K
Sbjct  811  YADFSFANIKPIGWGWAGVIWLYSLVFYFPLDIFKFAVRYALSGKAWDNLIERKTAFTSK  870

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KD+GKE+RE QWAHAQRTLHGL  P+T LF+E +++ +L+++AE+AKRRAE+ARLREL+T
Sbjct  871  KDYGKEEREAQWAHAQRTLHGLHPPETHLFNERSSYRELSEIAEQAKRRAEVARLRELNT  930

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  931  LKGHVESVVKLKGLDIDTIQQSYTV  955



>emb|CDP02191.1| unnamed protein product [Coffea canephora]
Length=967

 Score =   162 bits (411),  Expect = 8e-42, Method: Composition-based stats.
 Identities = 90/124 (73%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN+VCY PLD +KFF RY LSGKAWDL++EQR+AFT+KKDFGKE+REL+W  AQRTLHG
Sbjct  845  LYNIVCYIPLDFLKFFVRYILSGKAWDLLIEQRVAFTKKKDFGKEERELKWVQAQRTLHG  904

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            L  P+T  F + +   DLNQ+AEEA+RRAE+ARLREL TLKGHVESVVK K LDI+TIQQ
Sbjct  905  LHPPETH-FGDHSRAADLNQIAEEARRRAEMARLRELRTLKGHVESVVKSKNLDIDTIQQ  963

Query  288  AYTV  277
            +YTV
Sbjct  964  SYTV  967



>gb|AFK46374.1| unknown [Lotus japonicus]
Length=289

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFA I G+GWGWAGVIWLY +V Y PLDL+KF  RYALSGKAWD +LE + AFT K
Sbjct  144  YANWSFARINGMGWGWAGVIWLYTIVTYIPLDLLKFAIRYALSGKAWDNLLENKTAFTTK  203

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTK-LFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+T  +F+E  ++ +L+++AE+AKRRAE+ARLRELH
Sbjct  204  KDYGKEEREAQWAAAQRTLHGLQPPETSNVFNEKNSYRELSEIAEQAKRRAEVARLRELH  263

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  264  TLKGHVESVVKLKGLDIDTIQQHYTV  289



>ref|XP_006428674.1| hypothetical protein CICLE_v10011040mg [Citrus clementina]
 gb|ESR41914.1| hypothetical protein CICLE_v10011040mg [Citrus clementina]
Length=889

 Score =   160 bits (405),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 89/124 (72%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN+V Y PLD IKFF RY LS   WDLV EQR AFT KKDFGKE+REL WAHAQRTLHG
Sbjct  766  LYNIVFYIPLDFIKFFIRYVLSRNFWDLVTEQRTAFTSKKDFGKEERELLWAHAQRTLHG  825

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PDT +FS  +++ +L+ +AEEA+RRAEIARLRELHTLKGHVES+++LKGLDI+ IQQ
Sbjct  826  LQPPDTSMFSVRSSYGELSWMAEEARRRAEIARLRELHTLKGHVESLIRLKGLDIDAIQQ  885

Query  288  AYTV  277
            +Y+V
Sbjct  886  SYSV  889



>ref|XP_006480481.1| PREDICTED: ATPase 4, plasma membrane-type-like [Citrus sinensis]
Length=935

 Score =   160 bits (405),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 89/124 (72%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN+V Y PLD IKFF RY LS   WDLV EQR AFT KKDFGKE+REL WAHAQRTLHG
Sbjct  812  LYNIVFYIPLDFIKFFIRYVLSRNFWDLVTEQRTAFTSKKDFGKEERELLWAHAQRTLHG  871

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PDT +FS  +++ +L+ +AEEA+RRAEIARLRELHTLKGHVES+++LKGLDI+ IQQ
Sbjct  872  LQPPDTSMFSVRSSYGELSWMAEEARRRAEIARLRELHTLKGHVESLIRLKGLDIDAIQQ  931

Query  288  AYTV  277
            +Y+V
Sbjct  932  SYSV  935



>ref|XP_006658357.1| PREDICTED: plasma membrane ATPase 1-like [Oryza brachyantha]
Length=957

 Score =   160 bits (405),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 111/146 (76%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN +FAAI+GIGWGWAGVIWLYN+V Y PLD+IKF  RYALSGKAWDLVLEQRIAFTRK
Sbjct  812  YANWAFAAIKGIGWGWAGVIWLYNIVFYLPLDIIKFLIRYALSGKAWDLVLEQRIAFTRK  871

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTK-LFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KDFG ++ +L+WA AQRT+HGLQ   T  +F + T++NDLNQLAEEA+RRAEIARLREL+
Sbjct  872  KDFGTQENQLKWATAQRTIHGLQPATTAGVFRDMTSYNDLNQLAEEARRRAEIARLRELN  931

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKG +ESVVK KGLD+ETIQQ+YTV
Sbjct  932  TLKGRMESVVKQKGLDLETIQQSYTV  957



>gb|KDO67287.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=885

 Score =   159 bits (401),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 107/146 (73%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFA IEG GWGWAGVIWLY+LV YFPLD++KF  RY LSGKAWD +LE + AFT K
Sbjct  740  YANWSFARIEGCGWGWAGVIWLYSLVTYFPLDILKFGIRYILSGKAWDTLLENKTAFTTK  799

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTK-LFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+T  +FS+  ++ +L+++AE+AKRRAE+ARLRELH
Sbjct  800  KDYGKEEREAQWAAAQRTLHGLQPPETNGIFSDKNSYRELSEIAEQAKRRAEVARLRELH  859

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  860  TLKGHVESVVKLKGLDIDTIQQHYTV  885



>dbj|BAD16685.1| plasma membrane H+-ATPase [Daucus carota]
Length=951

 Score =   159 bits (401),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 89/126 (71%), Positives = 113/126 (90%), Gaps = 2/126 (2%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            +Y++V YFPLD++KF TRYALSGKAW+ ++EQR+AFT KKD+GKE+RE QWAH QRTLHG
Sbjct  826  IYSVVFYFPLDIMKFGTRYALSGKAWNNMIEQRVAFTTKKDYGKEEREAQWAHVQRTLHG  885

Query  468  LQVPD-TKLFSEA-TNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETI  295
            LQ P+ T +F++  +N+ +L+++AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TI
Sbjct  886  LQPPEATNIFNDKNSNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTI  945

Query  294  QQAYTV  277
            QQ YTV
Sbjct  946  QQHYTV  951



>ref|XP_006483568.1| PREDICTED: plasma membrane ATPase-like [Citrus sinensis]
Length=954

 Score =   159 bits (401),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 107/146 (73%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFA IEG GWGWAGVIWLY+LV YFPLD++KF  RY LSGKAWD +LE + AFT K
Sbjct  809  YANWSFARIEGCGWGWAGVIWLYSLVTYFPLDILKFGIRYILSGKAWDTLLENKTAFTTK  868

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTK-LFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+T  +FS+  ++ +L+++AE+AKRRAE+ARLRELH
Sbjct  869  KDYGKEEREAQWAAAQRTLHGLQPPETNGIFSDKNSYRELSEIAEQAKRRAEVARLRELH  928

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  929  TLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_006450166.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|ESR63406.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|KDO67281.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=954

 Score =   159 bits (401),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 107/146 (73%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFA IEG GWGWAGVIWLY+LV YFPLD++KF  RY LSGKAWD +LE + AFT K
Sbjct  809  YANWSFARIEGCGWGWAGVIWLYSLVTYFPLDILKFGIRYILSGKAWDTLLENKTAFTTK  868

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTK-LFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+T  +FS+  ++ +L+++AE+AKRRAE+ARLRELH
Sbjct  869  KDYGKEEREAQWAAAQRTLHGLQPPETNGIFSDKNSYRELSEIAEQAKRRAEVARLRELH  928

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  929  TLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_007225350.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
 gb|EMJ26549.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
Length=943

 Score =   157 bits (398),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 107/146 (73%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN +FA IEG GWGWAGVIWL+++V YFPLDL+KF  RY LSGKAWD +LE + AFT K
Sbjct  798  YANWAFARIEGCGWGWAGVIWLFSVVTYFPLDLLKFAIRYILSGKAWDNLLENKTAFTTK  857

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+T  LFSE  ++ +L+++AE+AKRRAE+ARLRELH
Sbjct  858  KDYGKEEREAQWAAAQRTLHGLQPPETNNLFSEKNSYRELSEIAEQAKRRAEVARLRELH  917

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  918  TLKGHVESVVKLKGLDIDTIQQHYTV  943



>gb|EEC81667.1| hypothetical protein OsI_25220 [Oryza sativa Indica Group]
 gb|EEE66722.1| hypothetical protein OsJ_23404 [Oryza sativa Japonica Group]
Length=951

 Score =   157 bits (398),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN+V Y PLD+IKF  RYALSG+AWDLVLEQRIAFTRKKDFG ++ +L+WA AQRT+HG
Sbjct  827  LYNIVFYLPLDIIKFLIRYALSGRAWDLVLEQRIAFTRKKDFGTQENQLKWATAQRTIHG  886

Query  468  LQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ   T  +F + T++NDLNQLAEEA+RRAEIARLREL TLKG +ESVVK KGLD+ETIQ
Sbjct  887  LQPAATAAVFRDMTSYNDLNQLAEEARRRAEIARLRELTTLKGRMESVVKQKGLDLETIQ  946

Query  291  QAYTV  277
            Q+YTV
Sbjct  947  QSYTV  951



>emb|CAB69823.1| plasma membrane H+ ATPase [Prunus persica]
Length=954

 Score =   157 bits (398),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 107/146 (73%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN +FA IEG GWGWAGVIWL+++V YFPLDL+KF  RY LSGKAWD +LE + AFT K
Sbjct  809  YANWAFARIEGCGWGWAGVIWLFSVVTYFPLDLLKFAIRYILSGKAWDNLLENKTAFTTK  868

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+T  LFSE  ++ +L+++AE+AKRRAE+ARLRELH
Sbjct  869  KDYGKEEREAQWAAAQRTLHGLQPPETNNLFSEKNSYRELSEIAEQAKRRAEVARLRELH  928

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  929  TLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|NP_001059093.1| Os07g0191200 [Oryza sativa Japonica Group]
 emb|CAD29295.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 dbj|BAC83861.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 dbj|BAF21007.1| Os07g0191200 [Oryza sativa Japonica Group]
Length=957

 Score =   157 bits (398),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN+V Y PLD+IKF  RYALSG+AWDLVLEQRIAFTRKKDFG ++ +L+WA AQRT+HG
Sbjct  833  LYNIVFYLPLDIIKFLIRYALSGRAWDLVLEQRIAFTRKKDFGTQENQLKWATAQRTIHG  892

Query  468  LQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ   T  +F + T++NDLNQLAEEA+RRAEIARLREL TLKG +ESVVK KGLD+ETIQ
Sbjct  893  LQPAATAAVFRDMTSYNDLNQLAEEARRRAEIARLRELTTLKGRMESVVKQKGLDLETIQ  952

Query  291  QAYTV  277
            Q+YTV
Sbjct  953  QSYTV  957



>dbj|BAA06629.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
Length=957

 Score =   157 bits (398),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN+V Y PLD+IKF  RYALSG+AWDLVLEQRIAFTRKKDFG ++ +L+WA AQRT+HG
Sbjct  833  LYNIVFYLPLDIIKFLIRYALSGRAWDLVLEQRIAFTRKKDFGTQENQLKWATAQRTIHG  892

Query  468  LQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ   T  +F + T++NDLNQLAEEA+RRAEIARLREL TLKG +ESVVK KGLD+ETIQ
Sbjct  893  LQPAATAAVFRDMTSYNDLNQLAEEARRRAEIARLRELTTLKGRMESVVKQKGLDLETIQ  952

Query  291  QAYTV  277
            Q+YTV
Sbjct  953  QSYTV  957



>ref|XP_010265488.1| PREDICTED: plasma membrane ATPase 4 [Nelumbo nucifera]
Length=954

 Score =   157 bits (398),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 89/125 (71%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LY +V Y PLD+IKFF RY LSGKAWD +LE + AFT KKD+GKE+RE QWA AQRTLHG
Sbjct  830  LYTIVSYVPLDIIKFFIRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWALAQRTLHG  889

Query  468  LQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ P+T  LF++ +++ +L+++AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQ
Sbjct  890  LQPPETSNLFNDKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQ  949

Query  291  QAYTV  277
            Q YTV
Sbjct  950  QHYTV  954



>dbj|BAM20990.1| plasma membrane H+-ATPase [Marchantia polymorpha]
Length=954

 Score =   157 bits (396),  Expect = 9e-40, Method: Composition-based stats.
 Identities = 103/145 (71%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFA I+GIGWGWAGVIWLY+L+ Y PLD+IKF  RY LSG+AW  ++ QR AFT +
Sbjct  810  YANWSFAFIKGIGWGWAGVIWLYSLIFYIPLDIIKFLVRYILSGRAWHYMINQRTAFTTQ  869

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KDFGKE RE++WAHAQRTLHGLQ PD K+  +  ++ +LN +AE+AKRRAEIARLREL+T
Sbjct  870  KDFGKEAREMKWAHAQRTLHGLQSPDVKMAGDRGSYKELNDIAEQAKRRAEIARLRELNT  929

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHVESVV++KGLDI+TIQQAYTV
Sbjct  930  LKGHVESVVRMKGLDIDTIQQAYTV  954



>ref|XP_002280201.1| PREDICTED: plasma membrane ATPase-like [Vitis vinifera]
Length=950

 Score =   157 bits (396),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 88/125 (70%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LY++V YFPLD++KFF RYAL+GKAWD +L+ + AFT KKD+G+ +RE QWA AQRTLHG
Sbjct  826  LYSIVFYFPLDILKFFIRYALTGKAWDTLLQNKTAFTTKKDYGRGEREAQWALAQRTLHG  885

Query  468  LQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ P T +LF+E  N+ +L+++AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDIE IQ
Sbjct  886  LQPPQTSELFTEKGNYRELSEMAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIEGIQ  945

Query  291  QAYTV  277
            Q YTV
Sbjct  946  QHYTV  950



>emb|CBI35956.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   157 bits (396),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 88/125 (70%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LY++V YFPLD++KFF RYAL+GKAWD +L+ + AFT KKD+G+ +RE QWA AQRTLHG
Sbjct  828  LYSIVFYFPLDILKFFIRYALTGKAWDTLLQNKTAFTTKKDYGRGEREAQWALAQRTLHG  887

Query  468  LQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ P T +LF+E  N+ +L+++AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDIE IQ
Sbjct  888  LQPPQTSELFTEKGNYRELSEMAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIEGIQ  947

Query  291  QAYTV  277
            Q YTV
Sbjct  948  QHYTV  952



>emb|CAN78639.1| hypothetical protein VITISV_031738 [Vitis vinifera]
Length=958

 Score =   157 bits (396),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 88/125 (70%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LY++V YFPLD++KFF RYAL+GKAWD +L+ + AFT KKD+G+ +RE QWA AQRTLHG
Sbjct  834  LYSIVFYFPLDILKFFIRYALTGKAWDTLLQNKTAFTTKKDYGRGEREAQWALAQRTLHG  893

Query  468  LQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ P T +LF+E  N+ +L+++AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDIE IQ
Sbjct  894  LQPPQTSELFTEKGNYRELSEMAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIEGIQ  953

Query  291  QAYTV  277
            Q YTV
Sbjct  954  QHYTV  958



>gb|KCW83494.1| hypothetical protein EUGRSUZ_B00400 [Eucalyptus grandis]
Length=954

 Score =   157 bits (396),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 88/124 (71%), Positives = 102/124 (82%), Gaps = 1/124 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++CY PLD IKFF RYA+SG+AWDL+ EQRIAFTR+KDFGKE RE +WAHAQRTLHG
Sbjct  832  LYNIICYIPLDFIKFFIRYAMSGRAWDLMFEQRIAFTRQKDFGKEHREREWAHAQRTLHG  891

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD K FSE ++  +L Q+AEEAK RAEIARLREL T K H+ SVV+ K LDI+TI Q
Sbjct  892  LQPPDVK-FSERSHATELTQMAEEAKTRAEIARLRELRTFKDHLNSVVRDKRLDIDTIPQ  950

Query  288  AYTV  277
             YTV
Sbjct  951  GYTV  954



>ref|XP_010028675.1| PREDICTED: ATPase 11, plasma membrane-type [Eucalyptus grandis]
 gb|KCW83493.1| hypothetical protein EUGRSUZ_B00400 [Eucalyptus grandis]
Length=955

 Score =   157 bits (396),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 88/124 (71%), Positives = 102/124 (82%), Gaps = 1/124 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++CY PLD IKFF RYA+SG+AWDL+ EQRIAFTR+KDFGKE RE +WAHAQRTLHG
Sbjct  833  LYNIICYIPLDFIKFFIRYAMSGRAWDLMFEQRIAFTRQKDFGKEHREREWAHAQRTLHG  892

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ PD K FSE ++  +L Q+AEEAK RAEIARLREL T K H+ SVV+ K LDI+TI Q
Sbjct  893  LQPPDVK-FSERSHATELTQMAEEAKTRAEIARLRELRTFKDHLNSVVRDKRLDIDTIPQ  951

Query  288  AYTV  277
             YTV
Sbjct  952  GYTV  955



>ref|XP_008219933.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Prunus 
mume]
Length=935

 Score =   156 bits (394),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 106/146 (73%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN +FA IEG GWGWAGVIWL+++V YFPLDL+KF  RY LSGKAWD +LE + AFT K
Sbjct  790  YANWAFARIEGCGWGWAGVIWLFSVVTYFPLDLLKFAIRYILSGKAWDNLLENKTAFTTK  849

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+T  LF+E  ++ +L+++AE+AKRRAE+ARLRELH
Sbjct  850  KDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSYRELSEIAEQAKRRAEVARLRELH  909

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  910  TLKGHVESVVKLKGLDIDTIQQHYTV  935



>gb|KEH35952.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=950

 Score =   156 bits (394),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 103/146 (71%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFA I+G+GWGWAGVIW+Y++V Y PLD++KF  RY LSGKAWD +LE + AFT K
Sbjct  805  YANWSFARIKGMGWGWAGVIWMYSIVTYIPLDILKFVIRYVLSGKAWDNLLENKTAFTTK  864

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ PD T LF++  ++ +L+++AE+AKRRAE+ARLRELH
Sbjct  865  KDYGKEEREAQWATAQRTLHGLQSPDTTNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  924

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+T+QQ YTV
Sbjct  925  TLKGHVESVVKLKGLDIDTMQQHYTV  950



>ref|XP_003603532.1| Plasma membrane H+ ATPase [Medicago truncatula]
 gb|AES73783.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   156 bits (394),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 103/146 (71%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFA I+G+GWGWAGVIW+Y++V Y PLD++KF  RY LSGKAWD +LE + AFT K
Sbjct  806  YANWSFARIKGMGWGWAGVIWMYSIVTYIPLDILKFVIRYVLSGKAWDNLLENKTAFTTK  865

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ PD T LF++  ++ +L+++AE+AKRRAE+ARLRELH
Sbjct  866  KDYGKEEREAQWATAQRTLHGLQSPDTTNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+T+QQ YTV
Sbjct  926  TLKGHVESVVKLKGLDIDTMQQHYTV  951



>gb|AAB41898.1| H+-transporting ATPase [Mesembryanthemum crystallinum]
Length=953

 Score =   155 bits (393),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 101/146 (69%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFA IEG+GWGWA  +W+Y LV Y PLD++KF  RYALSG+AW+ +L+ + AFT K
Sbjct  808  YANWSFAKIEGMGWGWALAVWIYTLVTYIPLDILKFTIRYALSGRAWNNLLDNKTAFTTK  867

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRT+HGLQ P+ T LF E +N+ +L+++AE+AKRRAE+ARLRELH
Sbjct  868  KDYGKEEREAQWAAAQRTMHGLQPPETTNLFPEKSNYRELSEIAEQAKRRAEVARLRELH  927

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  928  TLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_007023380.1| H(+)-ATPase 9 [Theobroma cacao]
 gb|EOY26002.1| H(+)-ATPase 9 [Theobroma cacao]
Length=926

 Score =   155 bits (393),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 85/125 (68%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            +Y++V YFPLD++KF  RY+LSGKAWD +L+ + AFT KKD+G+ +RE QWA AQRTLHG
Sbjct  802  IYSVVFYFPLDVLKFLIRYSLSGKAWDNLLQNKTAFTTKKDYGRGEREAQWAMAQRTLHG  861

Query  468  LQVPDTK-LFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ P+T  LF+E TN+ +L+++AE+A++RAE+ARLRELHTLKGHVESVVKLKGLDI+TIQ
Sbjct  862  LQPPETTDLFNEKTNYRELSEIAEQARKRAEVARLRELHTLKGHVESVVKLKGLDIDTIQ  921

Query  291  QAYTV  277
            Q YTV
Sbjct  922  QHYTV  926



>ref|XP_009334638.1| PREDICTED: ATPase 9, plasma membrane-type [Pyrus x bretschneideri]
Length=954

 Score =   155 bits (393),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 88/125 (70%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LY+L+ Y PLD++KF  RY LSGKAWD VLE++ AFT KKD+GK +RE QWA AQRTLHG
Sbjct  830  LYSLITYVPLDILKFIIRYVLSGKAWDNVLERKTAFTTKKDYGKGEREAQWATAQRTLHG  889

Query  468  LQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ P+T +LF++  N+ +L+++AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQ
Sbjct  890  LQPPETSELFNDKNNYGELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQ  949

Query  291  QAYTV  277
            Q YTV
Sbjct  950  QHYTV  954



>ref|XP_008381054.1| PREDICTED: ATPase 9, plasma membrane-type [Malus domestica]
Length=954

 Score =   155 bits (393),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 88/125 (70%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LY+L+ Y PLD++KF  RY LSGKAWD VLE++ AFT KKD+GK +RE QWA AQRTLHG
Sbjct  830  LYSLITYVPLDILKFIIRYVLSGKAWDNVLERKTAFTTKKDYGKGEREAQWATAQRTLHG  889

Query  468  LQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ P+T +LF++  N+ +L+++AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQ
Sbjct  890  LQPPETSELFNDKNNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQ  949

Query  291  QAYTV  277
            Q YTV
Sbjct  950  QHYTV  954



>ref|XP_009419963.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=956

 Score =   155 bits (393),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 87/125 (70%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            L++L+ YFPLD++KF TRYALSGKAWD +L+ + AFT KKD+G+ +RE QWA AQRTLHG
Sbjct  832  LFSLITYFPLDILKFITRYALSGKAWDNLLQNKTAFTSKKDYGRGEREAQWALAQRTLHG  891

Query  468  LQVPDTK-LFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ  DT  LF++ +++ +L+++AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQ
Sbjct  892  LQTADTSVLFNDKSSYRELSEVAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQ  951

Query  291  QAYTV  277
            Q YTV
Sbjct  952  QHYTV  956



>gb|ABM68570.1| plasma membrane H+ ATPase [Lilium longiflorum]
Length=191

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 106/125 (85%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            ++++V YFPLD++KF  RYALSGK WD +++ + AFT KKD+GK +RE QWA AQRTLHG
Sbjct  67   IFSIVTYFPLDILKFIIRYALSGKTWDNLIQNKTAFTSKKDYGKGEREAQWATAQRTLHG  126

Query  468  LQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ  DT  LF++  ++ +L+++AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQ
Sbjct  127  LQTADTSSLFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQ  186

Query  291  QAYTV  277
            Q YTV
Sbjct  187  QHYTV  191



>ref|XP_004303259.1| PREDICTED: ATPase 9, plasma membrane-type [Fragaria vesca subsp. 
vesca]
Length=954

 Score =   155 bits (393),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 104/146 (71%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  FA I+G+GWGWAGVIWLY++V Y PLD++KF  RYALSGKAWD VLE + AFT K
Sbjct  809  YANWGFARIKGMGWGWAGVIWLYSIVTYIPLDILKFMIRYALSGKAWDNVLENKTAFTTK  868

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTK-LFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GK +RE QWA AQRTLHGLQ P+T  +F++  N+ +L+++AE+AKRRAE+ARLRELH
Sbjct  869  KDYGKGEREAQWATAQRTLHGLQPPETSDIFNDKNNYRELSEIAEQAKRRAEVARLRELH  928

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  929  TLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|AAY42948.1| plasma membrane H+ ATPase [Lupinus albus]
Length=956

 Score =   155 bits (393),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 105/146 (72%), Positives = 127/146 (87%), Gaps = 2/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  FA I+G+GWGWAGVIWLY++V YFPLDL+KF  RY LSGKAW + +E + AFT K
Sbjct  812  YANWGFAKIQGVGWGWAGVIWLYSVVFYFPLDLLKFAIRYVLSGKAW-VNIENKTAFTTK  870

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWAHAQRTLHGLQ P+T  +F+E+ N+ +L+++AE+AKRRAE+ARLRELH
Sbjct  871  KDYGKEEREAQWAHAQRTLHGLQPPETSNIFNESNNYRELSEIAEQAKRRAEVARLRELH  930

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  931  TLKGHVESVVKLKGLDIDTIQQHYTV  956



>ref|XP_004498582.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   155 bits (393),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 105/146 (72%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  FA I+G+GWGWAGVIWLY+LV Y PLDL+KF  RY LSGKAWD +LE + AFT K
Sbjct  806  YANWGFARIKGMGWGWAGVIWLYSLVTYIPLDLLKFAIRYVLSGKAWDNLLENKTAFTTK  865

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+ + LF+E  ++ +L+++AE+AKRRAE+ARLRELH
Sbjct  866  KDYGKEEREAQWAAAQRTLHGLQPPEASNLFNEKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  926  TLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_003550136.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
 gb|KHN31599.1| ATPase 5, plasma membrane-type [Glycine soja]
Length=951

 Score =   155 bits (393),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 105/146 (72%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFA I+G+GWGWAGVIWLY++V Y PLDL+KF  RY LSGKAWD +LE + AFT K
Sbjct  806  YANWSFARIKGMGWGWAGVIWLYSVVTYIPLDLLKFAIRYILSGKAWDNLLENKTAFTTK  865

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+T  LF++  ++ +L+++AE+AKRRAE+ARLRELH
Sbjct  866  KDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  926  TLKGHVESVVKLKGLDIDTIQQHYTV  951



>emb|CAC29436.1| P-type H+-ATPase [Vicia faba]
Length=951

 Score =   155 bits (392),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 103/146 (71%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  FA I+G+GWGWAGVIW+Y+LV YFPLD++KF  RY LSGKAWD +LE + AFT K
Sbjct  806  YANWGFARIKGMGWGWAGVIWVYSLVTYFPLDILKFVIRYVLSGKAWDNLLENKTAFTTK  865

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+ T LF++  ++ +L+++AE+AKRRAE+ARLRELH
Sbjct  866  KDYGKEEREAQWATAQRTLHGLQSPETTNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+T+QQ YTV
Sbjct  926  TLKGHVESVVKLKGLDIDTMQQHYTV  951



>gb|KGN65225.1| hypothetical protein Csa_1G267210 [Cucumis sativus]
Length=778

 Score =   154 bits (389),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 86/124 (69%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            ++++V YFPLD++KF  RY LSGKAWD +LE + AFT KKD+GK +RE QWA AQRT+HG
Sbjct  656  VFSIVTYFPLDVLKFAIRYGLSGKAWDNMLENKTAFTTKKDYGKGEREAQWAIAQRTMHG  715

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ P+T +F E +N+ DL+++AE+AK+RAE+ARLRELHTLKGHVESVVKLKGLDIETIQQ
Sbjct  716  LQPPET-IFHEKSNYEDLSEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQ  774

Query  288  AYTV  277
             YTV
Sbjct  775  HYTV  778



>gb|KHN22686.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   155 bits (391),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 88/125 (70%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LY++V Y PLD++KF TRY LSGKAW  +LE + AFT KKD+GKE+RE QWAHAQRTLHG
Sbjct  829  LYSIVFYIPLDVMKFATRYVLSGKAWVNMLENKTAFTTKKDYGKEEREAQWAHAQRTLHG  888

Query  468  LQVPDTK-LFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ P+T  +F+E  ++ +L+++AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQ
Sbjct  889  LQPPETSGIFNEKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQ  948

Query  291  QAYTV  277
            Q YTV
Sbjct  949  QHYTV  953



>gb|KHN35778.1| Plasma membrane ATPase 4 [Glycine soja]
Length=365

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  FA I+GIGWGWAGVIWLY++V YFPLD++KF  RY LSGKAW+ +LE + AFT K
Sbjct  220  YANWGFARIQGIGWGWAGVIWLYSIVFYFPLDIMKFAIRYILSGKAWNNLLENKTAFTTK  279

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTK-LFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+T  +F+E +++ +L ++AE+AKRRAE+ARLRELH
Sbjct  280  KDYGKEEREAQWALAQRTLHGLQPPETSNIFNEKSSYRELTEIAEQAKRRAEVARLRELH  339

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  340  TLKGHVESVVKLKGLDIDTIQQHYTV  365



>ref|XP_008781833.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
 ref|XP_008781834.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
Length=954

 Score =   155 bits (391),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 104/146 (71%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  FA I+GIGWGWA VIWLY++V +FPLDL KF  RY LSGKAWD +LE++ AFT K
Sbjct  809  YANWGFARIKGIGWGWAAVIWLYSIVFFFPLDLFKFSIRYILSGKAWDNLLEKKTAFTTK  868

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+G+E+RE QWA AQRTLHGLQ P+ T LF+E  ++ +L+++AE+AKRRAE+ARLRELH
Sbjct  869  KDYGREEREAQWAMAQRTLHGLQPPETTNLFNEKNSYRELSEIAEQAKRRAEVARLRELH  928

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  929  TLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_009396235.1| PREDICTED: plasma membrane ATPase [Musa acuminata subsp. malaccensis]
Length=954

 Score =   155 bits (391),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 107/146 (73%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFA I+GIGWGWAGVIWLY++V +FPLD  KF  RY LSGKAWD +LE R AFT K
Sbjct  809  YANWSFARIKGIGWGWAGVIWLYSIVFFFPLDCFKFAIRYILSGKAWDNLLENRTAFTTK  868

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+G+E+RE QWA AQRTLHGLQ P+T  LFS+  ++ +L+++AE+AKRRAEIARLRELH
Sbjct  869  KDYGREEREAQWAMAQRTLHGLQPPETANLFSDKNSYRELSEIAEQAKRRAEIARLRELH  928

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  929  TLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_007011592.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY29211.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   155 bits (391),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 105/146 (72%), Positives = 127/146 (87%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  FA I+G+GWGWAGVIWLY++V + PLDLIKF TRY LSGKAWD +LE + AFT K
Sbjct  809  YANWGFARIKGMGWGWAGVIWLYSVVTFVPLDLIKFATRYVLSGKAWDNLLENKTAFTTK  868

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+T  +FSE +++ +L+++AE+AKRRAE+ARLREL+
Sbjct  869  KDYGKEEREAQWAAAQRTLHGLQPPETSNIFSERSSYRELSEIAEQAKRRAEVARLRELN  928

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  929  TLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_007217150.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
 gb|EMJ18349.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
Length=954

 Score =   155 bits (391),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 89/125 (71%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LY++V Y PLD++KF  RYALSGKAWD VLE++ AFT KKD+GK +RE QWA AQRTLHG
Sbjct  830  LYSIVFYIPLDILKFIIRYALSGKAWDNVLERKTAFTTKKDYGKGEREAQWATAQRTLHG  889

Query  468  LQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ  +T +LFS+  N+ +L+++AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQ
Sbjct  890  LQSAETAELFSDKNNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQ  949

Query  291  QAYTV  277
            Q YTV
Sbjct  950  QHYTV  954



>ref|XP_004146701.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis sativus]
 ref|XP_004165941.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis sativus]
Length=948

 Score =   154 bits (390),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 86/124 (69%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            ++++V YFPLD++KF  RY LSGKAWD +LE + AFT KKD+GK +RE QWA AQRT+HG
Sbjct  826  VFSIVTYFPLDVLKFAIRYGLSGKAWDNMLENKTAFTTKKDYGKGEREAQWAIAQRTMHG  885

Query  468  LQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQQ  289
            LQ P+T +F E +N+ DL+++AE+AK+RAE+ARLRELHTLKGHVESVVKLKGLDIETIQQ
Sbjct  886  LQPPET-IFHEKSNYEDLSEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQ  944

Query  288  AYTV  277
             YTV
Sbjct  945  HYTV  948



>gb|EPS66977.1| hypothetical protein M569_07799, partial [Genlisea aurea]
Length=922

 Score =   154 bits (390),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LYN++ Y PLD+IKFF RY+LSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG
Sbjct  830  LYNIIFYIPLDIIKFFIRYSLSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  889

Query  468  LQVPDTKLFSEATNFNDLNQ  409
            LQVPDTKLF+E  +F++LNQ
Sbjct  890  LQVPDTKLFNETNSFSELNQ  909



>gb|EYU22075.1| hypothetical protein MIMGU_mgv1a000872mg [Erythranthe guttata]
Length=954

 Score =   154 bits (390),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 87/125 (70%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LY++V YFPLD++KF  RY LSGKAWD +LE R AFT K ++GKE+RE QWA +QRTLHG
Sbjct  830  LYSIVTYFPLDILKFCIRYVLSGKAWDNLLENRTAFTTKSNYGKEEREAQWAASQRTLHG  889

Query  468  LQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ P+T  LF+E +++ +L+++AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQ
Sbjct  890  LQPPETANLFAEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQ  949

Query  291  QAYTV  277
            Q YTV
Sbjct  950  QHYTV  954



>gb|KHN16462.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   154 bits (390),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 104/146 (71%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  FA I+G+GWGWAGVIWLY+LV Y PLD++KF  RY LSGKAWD +LE + AFT K
Sbjct  806  YANWGFARIQGMGWGWAGVIWLYSLVTYIPLDILKFAIRYVLSGKAWDNLLENKTAFTTK  865

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+ T LF++  ++ +L+++AE+AKRRAE+ARLRELH
Sbjct  866  KDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  926  TLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_003526452.1| PREDICTED: plasma membrane ATPase 4 isoform 1 [Glycine max]
Length=951

 Score =   154 bits (390),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 104/146 (71%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  FA I+G+GWGWAGVIWLY+LV Y PLD++KF  RY LSGKAWD +LE + AFT K
Sbjct  806  YANWGFARIQGMGWGWAGVIWLYSLVTYIPLDILKFAIRYVLSGKAWDNLLENKTAFTTK  865

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+ T LF++  ++ +L+++AE+AKRRAE+ARLRELH
Sbjct  866  KDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  926  TLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_003522660.1| PREDICTED: plasma membrane ATPase 4-like isoformX1 [Glycine max]
 gb|KHN10275.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   154 bits (390),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 104/146 (71%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  FA I+G+GWGWAGVIWLY+LV Y PLD++KF  RY LSGKAWD +LE + AFT K
Sbjct  806  YANWGFARIQGMGWGWAGVIWLYSLVTYIPLDILKFAIRYVLSGKAWDNLLENKTAFTTK  865

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+ T LF++  ++ +L+++AE+AKRRAE+ARLRELH
Sbjct  866  KDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  926  TLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_007137116.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
 gb|ESW09110.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
Length=951

 Score =   154 bits (390),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 104/146 (71%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  FA I+G+GWGWAGVIWLY+LV Y PLD++KF  RY LSGKAWD +LE + AFT K
Sbjct  806  YANWEFARIKGMGWGWAGVIWLYSLVTYIPLDILKFAIRYVLSGKAWDNLLENKTAFTTK  865

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+ T LF++  ++ +L+++AE+AKRRAE+ARLRELH
Sbjct  866  KDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  926  TLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_008789658.1| PREDICTED: plasma membrane ATPase 4-like [Phoenix dactylifera]
Length=954

 Score =   154 bits (390),  Expect = 6e-39, Method: Composition-based stats.
 Identities = 88/125 (70%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LY++V +FPLDL KF  RY LSGKAWD +LE++ AFT KKD+G+E+RE QWA AQRTLHG
Sbjct  830  LYSVVFFFPLDLFKFAIRYILSGKAWDNLLEKKTAFTSKKDYGREEREAQWAMAQRTLHG  889

Query  468  LQVPD-TKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ P+ T LF++  ++ +L+++AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQ
Sbjct  890  LQPPETTNLFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQ  949

Query  291  QAYTV  277
            Q YTV
Sbjct  950  QHYTV  954



>ref|XP_011043940.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=952

 Score =   154 bits (390),  Expect = 6e-39, Method: Composition-based stats.
 Identities = 87/125 (70%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            +Y++V YFPLD++KF  RY LSGKAW  +LE + AFT KKD+GKE+RE QWAHAQRTLHG
Sbjct  828  IYSIVFYFPLDIMKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHG  887

Query  468  LQVPDTK-LFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ P+T  +F+E +++ +L+++AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQ
Sbjct  888  LQPPETAGIFNEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQ  947

Query  291  QAYTV  277
            Q YTV
Sbjct  948  QHYTV  952



>gb|KJB82763.1| hypothetical protein B456_013G212200 [Gossypium raimondii]
Length=954

 Score =   154 bits (390),  Expect = 6e-39, Method: Composition-based stats.
 Identities = 104/146 (71%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  FA I+G+GWGWA VIWLY+LV Y PLDLIKF  RY LSGKAWD +LE + AFT K
Sbjct  809  YANWRFAKIQGMGWGWAAVIWLYSLVTYIPLDLIKFAIRYVLSGKAWDNLLENKTAFTTK  868

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+T  +F+E +++ +L+++AE+AKRRAE+ARLREL+
Sbjct  869  KDYGKEEREAQWAAAQRTLHGLQPPETSNVFNERSSYRELSEIAEQAKRRAEVARLRELN  928

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  929  TLKGHVESVVKLKGLDIDTIQQHYTV  954



>dbj|BAD16687.1| plasma membrane H+-ATPase [Daucus carota]
Length=949

 Score =   154 bits (390),  Expect = 6e-39, Method: Composition-based stats.
 Identities = 87/125 (70%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            +Y++V Y PLD++KF TRYALSGKAW  +LE + AFT KKD+GKE+RE QWAHAQRTLHG
Sbjct  825  IYSIVFYIPLDILKFGTRYALSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHG  884

Query  468  LQVP-DTKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ P D+ +F +  ++ +L+++AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQ
Sbjct  885  LQPPADSNIFDDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQ  944

Query  291  QAYTV  277
            Q YTV
Sbjct  945  QHYTV  949



>gb|KJB55190.1| hypothetical protein B456_009G068100 [Gossypium raimondii]
Length=954

 Score =   154 bits (390),  Expect = 6e-39, Method: Composition-based stats.
 Identities = 105/146 (72%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  FA I+G+GWGWAGVIWLY++V Y PLDLIKF  RY LSGKAWD +LE + AFT K
Sbjct  809  YANWGFARIKGMGWGWAGVIWLYSVVTYIPLDLIKFAIRYVLSGKAWDNLLENKTAFTTK  868

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+T  LF+E +++ +L+++AE+AKRRAE+ARLREL+
Sbjct  869  KDYGKEEREAQWAAAQRTLHGLQPPETSNLFNEKSSYRELSEIAEQAKRRAEVARLRELN  928

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  929  TLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KHN17608.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   154 bits (389),  Expect = 7e-39, Method: Composition-based stats.
 Identities = 88/125 (70%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LY++V Y PLD++KF TRY LSGKAW  +LE + AFT KKD+GKE+RE QWAHAQRTLHG
Sbjct  829  LYSVVFYIPLDVMKFATRYILSGKAWVNMLENKTAFTTKKDYGKEEREAQWAHAQRTLHG  888

Query  468  LQVPDTK-LFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ P+T  +F+E  ++ +L+++AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQ
Sbjct  889  LQPPETSGIFNEKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQ  948

Query  291  QAYTV  277
            Q YTV
Sbjct  949  QHYTV  953



>ref|XP_003549363.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=953

 Score =   154 bits (389),  Expect = 7e-39, Method: Composition-based stats.
 Identities = 88/125 (70%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LY++V Y PLD++KF TRY LSGKAW  +LE + AFT KKD+GKE+RE QWAHAQRTLHG
Sbjct  829  LYSVVFYIPLDVMKFATRYILSGKAWVNMLENKTAFTTKKDYGKEEREAQWAHAQRTLHG  888

Query  468  LQVPDTK-LFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ P+T  +F+E  ++ +L+++AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQ
Sbjct  889  LQPPETSGIFNEKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQ  948

Query  291  QAYTV  277
            Q YTV
Sbjct  949  QHYTV  953



>ref|XP_006845683.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
 gb|ERN07358.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
Length=950

 Score =   154 bits (389),  Expect = 7e-39, Method: Composition-based stats.
 Identities = 87/125 (70%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            +Y++V Y PLDLIKF  +Y LSGKAWD +LE++ AFT KKD+G+E+RE QWA AQRTLHG
Sbjct  826  IYSIVFYVPLDLIKFAVKYILSGKAWDTLLEKKTAFTSKKDYGREEREAQWALAQRTLHG  885

Query  468  LQVPD-TKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ P+ + LF+E +++ +L+++AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQ
Sbjct  886  LQPPEASNLFNEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQ  945

Query  291  QAYTV  277
            Q YTV
Sbjct  946  QHYTV  950



>emb|CAD29579.1| proton-exporting ATPase [Zea mays]
Length=312

 Score =   147 bits (372),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 127/148 (86%), Gaps = 3/148 (2%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  FA I+GIGWGWAGV+WLY++V YFPLDL+KFF R+ LSG+AWD +LE + AFT K
Sbjct  165  YANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLLKFFIRFVLSGRAWDNLLENKTAFTTK  224

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTK---LFSEATNFNDLNQlaeeakrraeiarlre  361
            KD+G+E+RE QWA AQRTLHGLQ P+     LF++ +++ +L+++AE+AKRRAEIARLRE
Sbjct  225  KDYGREEREAQWATAQRTLHGLQPPEASSNTLFNDKSSYRELSEIAEQAKRRAEIARLRE  284

Query  360  LHTLKGHVESVVKLKGLDIETIQQAYTV  277
            L+TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  285  LNTLKGHVESVVKLKGLDIDTIQQNYTV  312



>gb|KHN15309.1| Plasma membrane ATPase 4 [Glycine soja]
Length=955

 Score =   154 bits (389),  Expect = 7e-39, Method: Composition-based stats.
 Identities = 88/125 (70%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LY++V YFPLDL+KF  RY LSGKAW+ +LE + AFT KKD+GKE+RE QWA AQRTLHG
Sbjct  831  LYSIVFYFPLDLMKFAIRYILSGKAWNNLLENKTAFTTKKDYGKEEREAQWALAQRTLHG  890

Query  468  LQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ P+T  +F+E +++ +L ++AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQ
Sbjct  891  LQPPETSNIFNEKSSYRELTEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQ  950

Query  291  QAYTV  277
            Q YTV
Sbjct  951  QHYTV  955



>ref|XP_003546412.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=955

 Score =   154 bits (389),  Expect = 7e-39, Method: Composition-based stats.
 Identities = 88/125 (70%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LY++V YFPLDL+KF  RY LSGKAW+ +LE + AFT KKD+GKE+RE QWA AQRTLHG
Sbjct  831  LYSIVFYFPLDLMKFAIRYILSGKAWNNLLENKTAFTTKKDYGKEEREAQWALAQRTLHG  890

Query  468  LQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ P+T  +F+E +++ +L ++AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQ
Sbjct  891  LQPPETSNIFNEKSSYRELTEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQ  950

Query  291  QAYTV  277
            Q YTV
Sbjct  951  QHYTV  955



>ref|XP_009588974.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana tomentosiformis]
Length=952

 Score =   154 bits (389),  Expect = 8e-39, Method: Composition-based stats.
 Identities = 103/146 (71%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN +FA ++G GWGWAGVIWLY++V YFPLD++KF  RY LSGKAW+ +L+ + AFT K
Sbjct  807  YANWAFARVKGCGWGWAGVIWLYSIVFYFPLDIMKFAIRYILSGKAWNNLLDNKTAFTTK  866

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+ T LF+E  ++ +L+++AE+AKRRAE+ARLRELH
Sbjct  867  KDYGKEEREAQWALAQRTLHGLQPPEATNLFNEKNSYRELSEIAEQAKRRAEMARLRELH  926

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDIETIQQ YTV
Sbjct  927  TLKGHVESVVKLKGLDIETIQQHYTV  952



>emb|CAD62443.1| proton-exporting ATPase [Zea mays]
Length=312

 Score =   147 bits (372),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 126/148 (85%), Gaps = 3/148 (2%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  FA I+GIGWGWAGV+WLY++V YFPLDLIKFF R+ LSG+AWD +LE + AFT K
Sbjct  165  YANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLIKFFIRFVLSGRAWDNLLENKTAFTTK  224

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPD---TKLFSEATNFNDLNQlaeeakrraeiarlre  361
            KD+G+E+RE QWA AQRTLHGLQ P+   + LF +  ++ +L+++AE+AKRRAEIARLRE
Sbjct  225  KDYGREEREAQWATAQRTLHGLQPPEAATSTLFHDKNSYRELSEIAEQAKRRAEIARLRE  284

Query  360  LHTLKGHVESVVKLKGLDIETIQQAYTV  277
            L+TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  285  LNTLKGHVESVVKLKGLDIDTIQQNYTV  312



>ref|XP_006848755.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
 gb|ERN10336.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
Length=954

 Score =   154 bits (389),  Expect = 8e-39, Method: Composition-based stats.
 Identities = 87/125 (70%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LY+++ Y PLD+ KF  RYALSGKAWD +L+ + AFT KKD+GK +RE QWA AQRTLHG
Sbjct  830  LYSIITYSPLDIFKFIVRYALSGKAWDTLLQNKTAFTSKKDYGKGEREAQWALAQRTLHG  889

Query  468  LQVPD-TKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ P+ +++F++ TN+ +L +LAE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQ
Sbjct  890  LQPPESSQIFNDKTNYRELTELAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQ  949

Query  291  QAYTV  277
            Q YTV
Sbjct  950  QHYTV  954



>ref|XP_008445089.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=955

 Score =   154 bits (389),  Expect = 8e-39, Method: Composition-based stats.
 Identities = 104/146 (71%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  FA I+G+GWGWAGVIWLY+LV Y PLD++KF  RYA SGKAWD +LE + AFT K
Sbjct  810  YANWGFARIKGMGWGWAGVIWLYSLVTYIPLDILKFGIRYAHSGKAWDTLLENKTAFTTK  869

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+ + LF E +++ +L+++AE+AKRRAE+ARLRELH
Sbjct  870  KDYGKEEREAQWAAAQRTLHGLQPPENSNLFPEKSSYRELSEIAEQAKRRAEVARLRELH  929

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  930  TLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_004160843.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=955

 Score =   154 bits (389),  Expect = 8e-39, Method: Composition-based stats.
 Identities = 104/146 (71%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  FA I+G+GWGWAGVIWLY+LV Y PLD++KF  RYA SGKAWD +LE + AFT K
Sbjct  810  YANWGFARIKGMGWGWAGVIWLYSLVTYIPLDILKFGIRYAHSGKAWDTLLENKTAFTTK  869

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+ + LF E +++ +L+++AE+AKRRAE+ARLRELH
Sbjct  870  KDYGKEEREAQWAAAQRTLHGLQPPENSNLFPEKSSYRELSEIAEQAKRRAEVARLRELH  929

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  930  TLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_007138806.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
 gb|ESW10800.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
Length=955

 Score =   154 bits (389),  Expect = 9e-39, Method: Composition-based stats.
 Identities = 104/146 (71%), Positives = 128/146 (88%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFA I+G+GWGWAGVIWLY++V YFPLD++KF TRY LSGKAW  +LE + AFT K
Sbjct  810  YANWSFARIKGVGWGWAGVIWLYSIVFYFPLDIMKFATRYILSGKAWLNLLENKTAFTTK  869

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+ + +F+E +++ +L+++AE+AKRRAE+ARLRELH
Sbjct  870  KDYGKEEREAQWALAQRTLHGLQPPEASNIFNEKSSYRELSEIAEQAKRRAEVARLRELH  929

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  930  TLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_009399554.1| PREDICTED: plasma membrane ATPase isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=955

 Score =   154 bits (389),  Expect = 9e-39, Method: Composition-based stats.
 Identities = 84/125 (67%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            +++LV YFPLD++KF  RYALSG+AWD +L+ + AFT KKD+G+E+RE QWA AQRTLHG
Sbjct  831  IFSLVTYFPLDVLKFIIRYALSGRAWDNLLQNKTAFTTKKDYGREEREAQWALAQRTLHG  890

Query  468  LQVPDTK-LFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQVPDT  LF++  ++ +L+++A++A RRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQ
Sbjct  891  LQVPDTSALFNDNNSYRELSEIADQAMRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQ  950

Query  291  QAYTV  277
            Q YTV
Sbjct  951  QHYTV  955



>ref|XP_004487948.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=956

 Score =   154 bits (388),  Expect = 9e-39, Method: Composition-based stats.
 Identities = 87/125 (70%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LY+++ Y PLD+IKFF RY LSGKAW  +LE + AFT KKD+GKE+RE QWA AQRTLHG
Sbjct  832  LYSIIFYLPLDVIKFFIRYLLSGKAWQNLLENKTAFTTKKDYGKEEREAQWALAQRTLHG  891

Query  468  LQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ P+T  +F+E +++ +L+++AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQ
Sbjct  892  LQPPETSSVFNEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQ  951

Query  291  QAYTV  277
            Q YTV
Sbjct  952  QHYTV  956



>ref|XP_010913679.1| PREDICTED: plasma membrane ATPase [Elaeis guineensis]
Length=954

 Score =   154 bits (388),  Expect = 9e-39, Method: Composition-based stats.
 Identities = 87/125 (70%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LY++V +FPLDL KF  RY LSGKAWD +LE++ AFT KKD+G+E+RE QWA AQRTLHG
Sbjct  830  LYSIVFFFPLDLFKFAIRYILSGKAWDNLLEKKTAFTTKKDYGREEREAQWAMAQRTLHG  889

Query  468  LQVPD-TKLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ P+ T LF++ +++ +L+++AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQ
Sbjct  890  LQPPETTNLFNDKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQ  949

Query  291  QAYTV  277
            Q YTV
Sbjct  950  QHYTV  954



>ref|XP_008228760.1| PREDICTED: ATPase 9, plasma membrane-type [Prunus mume]
Length=954

 Score =   154 bits (388),  Expect = 9e-39, Method: Composition-based stats.
 Identities = 88/125 (70%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            LY++V Y PLD++KF  RYALSGKAWD VLE++ AFT KKD+G+ +RE QWA AQRTLHG
Sbjct  830  LYSIVFYIPLDILKFIIRYALSGKAWDNVLERKTAFTTKKDYGRGEREAQWATAQRTLHG  889

Query  468  LQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ  +T +LFS+  N+ +L+++AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQ
Sbjct  890  LQSAETAELFSDKNNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQ  949

Query  291  QAYTV  277
            Q YTV
Sbjct  950  QHYTV  954



>ref|XP_009399553.1| PREDICTED: plasma membrane ATPase isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=981

 Score =   154 bits (389),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 84/125 (67%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            +++LV YFPLD++KF  RYALSG+AWD +L+ + AFT KKD+G+E+RE QWA AQRTLHG
Sbjct  857  IFSLVTYFPLDVLKFIIRYALSGRAWDNLLQNKTAFTTKKDYGREEREAQWALAQRTLHG  916

Query  468  LQVPDTK-LFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQVPDT  LF++  ++ +L+++A++A RRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQ
Sbjct  917  LQVPDTSALFNDNNSYRELSEIADQAMRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQ  976

Query  291  QAYTV  277
            Q YTV
Sbjct  977  QHYTV  981



>ref|XP_009399552.1| PREDICTED: plasma membrane ATPase isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=982

 Score =   154 bits (389),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 84/125 (67%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            +++LV YFPLD++KF  RYALSG+AWD +L+ + AFT KKD+G+E+RE QWA AQRTLHG
Sbjct  858  IFSLVTYFPLDVLKFIIRYALSGRAWDNLLQNKTAFTTKKDYGREEREAQWALAQRTLHG  917

Query  468  LQVPDTK-LFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQVPDT  LF++  ++ +L+++A++A RRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQ
Sbjct  918  LQVPDTSALFNDNNSYRELSEIADQAMRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQ  977

Query  291  QAYTV  277
            Q YTV
Sbjct  978  QHYTV  982



>ref|XP_004138879.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=1038

 Score =   154 bits (389),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 104/146 (71%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711   YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
             YAN  FA I+G+GWGWAGVIWLY+LV Y PLD++KF  RYA SGKAWD +LE + AFT K
Sbjct  893   YANWGFARIKGMGWGWAGVIWLYSLVTYIPLDILKFGIRYAHSGKAWDTLLENKTAFTTK  952

Query  531   KDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQlaeeakrraeiarlreLH  355
             KD+GKE+RE QWA AQRTLHGLQ P+ + LF E +++ +L+++AE+AKRRAE+ARLRELH
Sbjct  953   KDYGKEEREAQWAAAQRTLHGLQPPENSNLFPEKSSYRELSEIAEQAKRRAEVARLRELH  1012

Query  354   TLKGHVESVVKLKGLDIETIQQAYTV  277
             TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  1013  TLKGHVESVVKLKGLDIDTIQQHYTV  1038



>gb|KHG19606.1| ATPase 5, plasma membrane-type -like protein [Gossypium arboreum]
Length=659

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  FA I+G+GWGWAGVIWLY++V Y PLDLIKF  RY LSGKAWD +LE + AFT K
Sbjct  514  YANWGFARIKGMGWGWAGVIWLYSVVTYIPLDLIKFAIRYVLSGKAWDNLLENKTAFTTK  573

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTK-LFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+T  LF+E +++ +L+++AE+AKRRAE+ARLREL+
Sbjct  574  KDYGKEEREAQWAAAQRTLHGLQPPETSNLFNEKSSYRELSEIAEQAKRRAEVARLRELN  633

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  634  TLKGHVESVVKLKGLDIDTIQQHYTV  659



>gb|AAY42949.1| plasma membrane H+ ATPase [Lupinus albus]
Length=951

 Score =   154 bits (388),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 104/146 (71%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFA I+G+GWGWAGVIWLY+LV Y PLD++KF   YALSGKAW+ +LE + AFT K
Sbjct  806  YANWSFARIKGMGWGWAGVIWLYSLVTYVPLDILKFAIAYALSGKAWNTLLENKTAFTTK  865

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+ T LF++  ++ +L+++AE+AKRRAE+ARLRELH
Sbjct  866  KDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  926  TLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_009399551.1| PREDICTED: plasma membrane ATPase isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=1008

 Score =   154 bits (389),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 84/125 (67%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = -3

Query  648   LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
             +++LV YFPLD++KF  RYALSG+AWD +L+ + AFT KKD+G+E+RE QWA AQRTLHG
Sbjct  884   IFSLVTYFPLDVLKFIIRYALSGRAWDNLLQNKTAFTTKKDYGREEREAQWALAQRTLHG  943

Query  468   LQVPDTK-LFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
             LQVPDT  LF++  ++ +L+++A++A RRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQ
Sbjct  944   LQVPDTSALFNDNNSYRELSEIADQAMRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQ  1003

Query  291   QAYTV  277
             Q YTV
Sbjct  1004  QHYTV  1008



>gb|KHM99449.1| ATPase 5, plasma membrane-type [Glycine soja]
Length=940

 Score =   154 bits (388),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 104/146 (71%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  FA I+G+GWGWAGVIWLY++V Y PLDL+KF  RY LSGKAWD +LE + AFT K
Sbjct  795  YANWGFARIKGMGWGWAGVIWLYSVVTYIPLDLLKFAIRYILSGKAWDNLLENKTAFTTK  854

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+T  LF++  ++ +L+++AE+AKRRAE+ARLRELH
Sbjct  855  KDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  914

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  915  TLKGHVESVVKLKGLDIDTIQQHYTV  940



>ref|XP_010929115.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   154 bits (388),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 85/125 (68%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -3

Query  648  LYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRKKDFGKEQRELQWAHAQRTLHG  469
            +Y+++ Y PLD++KF TRYALSGKAWD V++ + AFT KKD+GK +RE QWA AQRTLHG
Sbjct  826  VYSVITYIPLDILKFITRYALSGKAWDNVIQNKTAFTSKKDYGKGEREAQWAMAQRTLHG  885

Query  468  LQVPDTK-LFSEATNFNDLNQlaeeakrraeiarlreLHTLKGHVESVVKLKGLDIETIQ  292
            LQ PDT   F++ +++ +L+++AE+AKRRAE+ARLRELHTLKGHV+SVVKLKGLDIETIQ
Sbjct  886  LQSPDTSGFFNDKSSYKELSEIAEQAKRRAEVARLRELHTLKGHVDSVVKLKGLDIETIQ  945

Query  291  QAYTV  277
            Q YTV
Sbjct  946  QHYTV  950



>ref|XP_011017965.1| PREDICTED: ATPase 8, plasma membrane-type-like [Populus euphratica]
Length=949

 Score =   154 bits (388),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 99/145 (68%), Positives = 126/145 (87%), Gaps = 1/145 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFA I+G+GWGWAG+IW+Y+++ Y PLD++KF  RYAL+GKAWD +L+ + AFT K
Sbjct  806  YANWSFARIQGVGWGWAGIIWIYSIITYIPLDILKFIIRYALTGKAWDNLLQNKTAFTNK  865

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDTKLFSEATNFNDLNQlaeeakrraeiarlreLHT  352
            KD+GK +RE QWA AQRTLHGLQ P+T +F++ T + +LN+LAE+AK+RAE+ARLRELHT
Sbjct  866  KDYGKGEREAQWATAQRTLHGLQPPET-MFNDKTTYRELNELAEQAKKRAEVARLRELHT  924

Query  351  LKGHVESVVKLKGLDIETIQQAYTV  277
            LKGHV+SVVK+KGLDIETIQQ YTV
Sbjct  925  LKGHVDSVVKMKGLDIETIQQHYTV  949



>ref|XP_003544641.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=951

 Score =   154 bits (388),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 104/146 (71%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  FA I+G+GWGWAGVIWLY++V Y PLDL+KF  RY LSGKAWD +LE + AFT K
Sbjct  806  YANWGFARIKGMGWGWAGVIWLYSVVTYIPLDLLKFAIRYILSGKAWDNLLENKTAFTTK  865

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPDT-KLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+T  LF++  ++ +L+++AE+AKRRAE+ARLRELH
Sbjct  866  KDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  926  TLKGHVESVVKLKGLDIDTIQQHYTV  951



>dbj|BAC77530.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=951

 Score =   154 bits (388),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 102/146 (70%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN  FA I+G+GWGWA VIWLY+LV Y PLD++KF  RY LSGKAWD +LE + AFT K
Sbjct  806  YANWGFARIKGMGWGWAAVIWLYSLVTYVPLDILKFTIRYVLSGKAWDNLLENKTAFTTK  865

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+ T +F++  ++ +L+++AE+AKRRAE+ARLRELH
Sbjct  866  KDYGKEEREAQWATAQRTLHGLQPPETTSIFNDKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  926  TLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_009798265.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana sylvestris]
Length=952

 Score =   154 bits (388),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 102/146 (70%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN +FA ++G GWGWAGVIWLY+++ YFPLD++KF  RY LSGKAW+ +L+ + AFT K
Sbjct  807  YANWAFARVKGCGWGWAGVIWLYSIIFYFPLDIMKFAIRYILSGKAWNNLLDNKTAFTTK  866

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWA AQRTLHGLQ P+ T LF+E  ++ +L+++AE+AKRRAE+ARLRELH
Sbjct  867  KDYGKEEREAQWALAQRTLHGLQPPEATNLFNEKNSYRELSEIAEQAKRRAEMARLRELH  926

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDIETIQQ YTV
Sbjct  927  TLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_008372282.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=955

 Score =   154 bits (388),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 102/146 (70%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  YANXSFaaiegigwgwagviWLYNLVCYFPLDLIKFFTRYALSGKAWDLVLEQRIAFTRK  532
            YAN SFA I G GWGWAGVIW+Y++V YFPLDL+KF  RY LSGKAW  +LE + AFT K
Sbjct  810  YANWSFARIHGCGWGWAGVIWIYSIVFYFPLDLMKFAIRYILSGKAWLNLLENKTAFTTK  869

Query  531  KDFGKEQRELQWAHAQRTLHGLQVPD-TKLFSEATNFNDLNQlaeeakrraeiarlreLH  355
            KD+GKE+RE QWAHAQRTLHGL+ P+ + +F++ +++ +L+++AE+AKRRAE+ARLRELH
Sbjct  870  KDYGKEEREAQWAHAQRTLHGLEAPESSSIFNDKSSYRELSEIAEQAKRRAEVARLRELH  929

Query  354  TLKGHVESVVKLKGLDIETIQQAYTV  277
            TLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  930  TLKGHVESVVKLKGLDIDTIQQHYTV  955



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1233376381380