BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF034N23

Length=490
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004243704.1|  PREDICTED: subtilisin-like protease                205   1e-58   Solanum lycopersicum
ref|XP_006342387.1|  PREDICTED: subtilisin-like protease-like           205   1e-58   Solanum tuberosum [potatoes]
ref|XP_009782030.1|  PREDICTED: subtilisin-like protease                197   1e-55   Nicotiana sylvestris
ref|XP_009596091.1|  PREDICTED: subtilisin-like protease                192   6e-54   Nicotiana tomentosiformis
gb|ABK96588.1|  unknown                                                 179   3e-53   Populus trichocarpa x Populus deltoides
ref|XP_011078099.1|  PREDICTED: subtilisin-like protease                187   2e-52   Sesamum indicum [beniseed]
gb|KDP33922.1|  hypothetical protein JCGZ_07493                         181   4e-50   Jatropha curcas
ref|XP_011093838.1|  PREDICTED: subtilisin-like protease                181   5e-50   Sesamum indicum [beniseed]
ref|XP_002516266.1|  Xylem serine proteinase 1 precursor, putative      181   5e-50   Ricinus communis
ref|XP_006381615.1|  subtilase family protein                           181   6e-50   
ref|XP_011039978.1|  PREDICTED: subtilisin-like protease                176   3e-48   Populus euphratica
ref|XP_010047469.1|  PREDICTED: subtilisin-like protease                170   4e-46   Eucalyptus grandis [rose gum]
ref|XP_008242250.1|  PREDICTED: subtilisin-like protease                169   8e-46   Prunus mume [ume]
ref|XP_007204263.1|  hypothetical protein PRUPE_ppa001798mg             168   2e-45   Prunus persica
ref|XP_010090170.1|  Subtilisin-like protease                           167   6e-45   Morus notabilis
dbj|BAD94244.1|  serine protease like protein                           160   2e-44   Arabidopsis thaliana [mouse-ear cress]
gb|KDO73903.1|  hypothetical protein CISIN_1g004261mg                   165   2e-44   Citrus sinensis [apfelsine]
ref|XP_010049348.1|  PREDICTED: subtilisin-like protease                165   2e-44   Eucalyptus grandis [rose gum]
ref|XP_006452813.1|  hypothetical protein CICLE_v10007510mg             165   2e-44   
ref|XP_009590702.1|  PREDICTED: subtilisin-like protease                165   2e-44   Nicotiana tomentosiformis
gb|EYU25845.1|  hypothetical protein MIMGU_mgv1a013289mg                156   5e-44   Erythranthe guttata [common monkey flower]
ref|XP_006474722.1|  PREDICTED: subtilisin-like protease-like iso...    164   1e-43   Citrus sinensis [apfelsine]
ref|XP_009767539.1|  PREDICTED: subtilisin-like protease                163   1e-43   Nicotiana sylvestris
emb|CDY18042.1|  BnaC07g04280D                                          162   2e-43   Brassica napus [oilseed rape]
ref|XP_004488082.1|  PREDICTED: subtilisin-like protease-like           162   2e-43   Cicer arietinum [garbanzo]
ref|XP_006356658.1|  PREDICTED: subtilisin-like protease-like           162   3e-43   Solanum tuberosum [potatoes]
ref|XP_010051409.1|  PREDICTED: subtilisin-like protease                162   3e-43   
gb|KCW81959.1|  hypothetical protein EUGRSUZ_C03325                     163   3e-43   Eucalyptus grandis [rose gum]
ref|XP_010042589.1|  PREDICTED: subtilisin-like protease                162   4e-43   Eucalyptus grandis [rose gum]
emb|CDY33400.1|  BnaA07g04390D                                          162   4e-43   Brassica napus [oilseed rape]
gb|KGN66306.1|  hypothetical protein Csa_1G597040                       160   4e-43   Cucumis sativus [cucumbers]
ref|XP_009102354.1|  PREDICTED: subtilisin-like protease                161   5e-43   Brassica rapa
ref|XP_004144036.1|  PREDICTED: subtilisin-like protease-like           160   1e-42   
ref|XP_006396129.1|  hypothetical protein EUTSA_v10002410mg             160   1e-42   Eutrema salsugineum [saltwater cress]
ref|XP_003595292.1|  Subtilisin-like protease                           160   1e-42   Medicago truncatula
ref|XP_002278292.1|  PREDICTED: subtilisin-like protease                160   2e-42   Vitis vinifera
ref|NP_565330.1|  Subtilase-like protein                                160   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010412797.1|  PREDICTED: subtilisin-like protease                160   2e-42   Camelina sativa [gold-of-pleasure]
gb|KHN12283.1|  Subtilisin-like protease                                157   2e-42   Glycine soja [wild soybean]
ref|XP_010557668.1|  PREDICTED: subtilisin-like protease isoform X1     159   5e-42   Tarenaya hassleriana [spider flower]
ref|XP_010488783.1|  PREDICTED: subtilisin-like protease                159   5e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010666857.1|  PREDICTED: subtilisin-like protease                159   5e-42   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN06066.1|  Subtilisin-like protease                                157   8e-42   Glycine soja [wild soybean]
ref|XP_010467108.1|  PREDICTED: subtilisin-like protease                158   8e-42   Camelina sativa [gold-of-pleasure]
ref|XP_003533787.1|  PREDICTED: subtilisin-like protease-like           158   9e-42   Glycine max [soybeans]
ref|XP_002885806.1|  predicted protein                                  158   9e-42   Arabidopsis lyrata subsp. lyrata
ref|XP_004245414.1|  PREDICTED: subtilisin-like protease                157   2e-41   
ref|XP_008450936.1|  PREDICTED: subtilisin-like protease                157   2e-41   Cucumis melo [Oriental melon]
ref|XP_006297042.1|  hypothetical protein CARUB_v10013038mg             157   2e-41   Capsella rubella
ref|XP_009359724.1|  PREDICTED: subtilisin-like protease                156   4e-41   
ref|XP_008388846.1|  PREDICTED: subtilisin-like protease                154   3e-40   
gb|AHA84190.1|  subtilisin-like protease                                154   3e-40   Phaseolus vulgaris [French bean]
ref|XP_008337844.1|  PREDICTED: subtilisin-like protease                154   4e-40   Malus domestica [apple tree]
gb|EYU25847.1|  hypothetical protein MIMGU_mgv1a001711mg                153   8e-40   Erythranthe guttata [common monkey flower]
ref|XP_007012625.1|  Subtilase family protein                           152   1e-39   
gb|KFK39884.1|  hypothetical protein AALP_AA3G301200                    152   1e-39   Arabis alpina [alpine rockcress]
ref|XP_008792868.1|  PREDICTED: subtilisin-like protease                151   3e-39   Phoenix dactylifera
gb|KHG16003.1|  Subtilisin-like protease                                151   4e-39   Gossypium arboreum [tree cotton]
gb|KJB82990.1|  hypothetical protein B456_013G223900                    150   8e-39   Gossypium raimondii
gb|EYU28325.1|  hypothetical protein MIMGU_mgv1a001748mg                150   1e-38   Erythranthe guttata [common monkey flower]
ref|XP_007138654.1|  hypothetical protein PHAVU_009G226900g             149   1e-38   Phaseolus vulgaris [French bean]
ref|XP_008782639.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    149   2e-38   
ref|XP_009337216.1|  PREDICTED: subtilisin-like protease                149   2e-38   
ref|XP_010917484.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    149   3e-38   
gb|KJB27210.1|  hypothetical protein B456_004G284900                    148   5e-38   Gossypium raimondii
ref|XP_010273846.1|  PREDICTED: subtilisin-like protease                144   8e-37   Nelumbo nucifera [Indian lotus]
ref|XP_003541310.1|  PREDICTED: subtilisin-like protease-like           143   3e-36   Glycine max [soybeans]
ref|XP_004287641.1|  PREDICTED: subtilisin-like protease                142   6e-36   Fragaria vesca subsp. vesca
ref|XP_010541995.1|  PREDICTED: subtilisin-like protease                142   6e-36   Tarenaya hassleriana [spider flower]
gb|EPS65938.1|  hypothetical protein M569_08836                         141   1e-35   Genlisea aurea
emb|CAN71376.1|  hypothetical protein VITISV_001491                     141   1e-35   Vitis vinifera
gb|KHN07895.1|  Subtilisin-like protease                                138   2e-35   Glycine soja [wild soybean]
ref|XP_010261834.1|  PREDICTED: subtilisin-like protease                139   5e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010937330.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    138   2e-34   Elaeis guineensis
ref|XP_002519362.1|  conserved hypothetical protein                     128   2e-33   
ref|XP_004507999.1|  PREDICTED: subtilisin-like protease-like           134   5e-33   Cicer arietinum [garbanzo]
dbj|BAJ89916.1|  predicted protein                                      134   5e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AES92191.2|  subtilisin-like serine protease                         134   7e-33   Medicago truncatula
ref|XP_003609994.1|  Subtilisin-like protease                           134   7e-33   
ref|XP_010050438.1|  PREDICTED: subtilisin-like protease                132   3e-32   Eucalyptus grandis [rose gum]
gb|KHN17728.1|  Subtilisin-like protease                                125   4e-32   Glycine soja [wild soybean]
ref|XP_009391730.1|  PREDICTED: subtilisin-like protease                131   5e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380035.1|  PREDICTED: subtilisin-like protease                129   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP32432.1|  hypothetical protein JCGZ_13357                         129   5e-31   Jatropha curcas
dbj|BAD36156.1|  putative serine protease                               126   3e-30   Oryza sativa Japonica Group [Japonica rice]
gb|AGT17100.1|  serine protease                                         125   4e-30   Saccharum hybrid cultivar R570
ref|XP_006661279.1|  PREDICTED: subtilisin-like protease-like           123   2e-29   
tpg|DAA61658.1|  TPA: putative subtilase family protein                 122   2e-29   
ref|XP_007154575.1|  hypothetical protein PHAVU_003G130300g             120   4e-28   Phaseolus vulgaris [French bean]
ref|XP_002460273.1|  hypothetical protein SORBIDRAFT_02g025810          120   4e-28   Sorghum bicolor [broomcorn]
gb|EMS68171.1|  Subtilisin-like protease                                117   6e-28   Triticum urartu
ref|XP_004956934.1|  PREDICTED: subtilisin-like protease-like           118   2e-27   Setaria italica
gb|EMT22975.1|  Subtilisin-like protease                                115   3e-27   
gb|ACF79126.1|  unknown                                                 117   6e-27   Zea mays [maize]
ref|NP_001130775.1|  uncharacterized protein LOC100191879 precursor     115   2e-26   Zea mays [maize]
ref|XP_010238670.1|  PREDICTED: subtilisin-like protease isoform X1     113   1e-25   Brachypodium distachyon [annual false brome]
ref|XP_010238218.1|  PREDICTED: subtilisin-like protease                112   2e-25   Brachypodium distachyon [annual false brome]
gb|ACL52505.1|  unknown                                                 108   6e-25   Zea mays [maize]
gb|EMT16255.1|  Subtilisin-like protease                                111   7e-25   
ref|NP_001064523.2|  Os10g0394200                                       106   9e-25   
ref|XP_004983113.1|  PREDICTED: subtilisin-like protease-like           108   4e-24   Setaria italica
ref|XP_002467295.1|  hypothetical protein SORBIDRAFT_01g023190          107   9e-24   Sorghum bicolor [broomcorn]
gb|EMS60034.1|  Subtilisin-like protease                                105   2e-23   Triticum urartu
ref|XP_006849717.1|  hypothetical protein AMTR_s00024p00243520          105   6e-23   Amborella trichopoda
ref|NP_001145743.1|  uncharacterized protein LOC100279250 precursor     105   8e-23   Zea mays [maize]
tpg|DAA50071.1|  TPA: putative subtilase family protein                 105   8e-23   
gb|EEE50901.1|  hypothetical protein OsJ_31407                          104   1e-22   Oryza sativa Japonica Group [Japonica rice]
gb|EAY78354.1|  hypothetical protein OsI_33442                          104   1e-22   Oryza sativa Indica Group [Indian rice]
gb|AAM22744.1|AC092388_28  putative cucumisin-like serine protease      104   1e-22   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK06243.1|  predicted protein                                      103   3e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006662325.1|  PREDICTED: subtilisin-like protease-like           102   4e-22   
gb|KJB70156.1|  hypothetical protein B456_011G061400                  99.8    6e-21   Gossypium raimondii
gb|EPS61652.1|  hypothetical protein M569_13143                       97.8    3e-20   Genlisea aurea
ref|XP_007134944.1|  hypothetical protein PHAVU_010G088700g           94.4    4e-19   Phaseolus vulgaris [French bean]
ref|XP_006583358.1|  PREDICTED: subtilisin-like protease-like iso...  93.2    1e-18   
ref|XP_003528890.1|  PREDICTED: subtilisin-like protease-like iso...  93.2    1e-18   Glycine max [soybeans]
gb|KHN04600.1|  Subtilisin-like protease                              92.8    1e-18   Glycine soja [wild soybean]
ref|XP_009416811.1|  PREDICTED: subtilisin-like protease              92.8    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABF70004.1|  subtilisin-like serine proteinase, putative           92.8    2e-18   Musa acuminata [banana]
gb|KCW79387.1|  hypothetical protein EUGRSUZ_C00799                   92.4    2e-18   Eucalyptus grandis [rose gum]
emb|CDP20511.1|  unnamed protein product                              91.7    4e-18   Coffea canephora [robusta coffee]
ref|XP_006574858.1|  PREDICTED: subtilisin-like protease-like iso...  91.3    5e-18   Glycine max [soybeans]
gb|EYU29358.1|  hypothetical protein MIMGU_mgv1a024271mg              88.6    7e-18   Erythranthe guttata [common monkey flower]
gb|KHN27220.1|  Subtilisin-like protease                              90.5    8e-18   Glycine soja [wild soybean]
gb|EYU29564.1|  hypothetical protein MIMGU_mgv1a023796mg              90.5    1e-17   Erythranthe guttata [common monkey flower]
ref|XP_008462294.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  90.1    1e-17   Cucumis melo [Oriental melon]
gb|EYU29364.1|  hypothetical protein MIMGU_mgv1a022867mg              89.7    1e-17   Erythranthe guttata [common monkey flower]
gb|KHN13888.1|  Subtilisin-like protease                              89.7    2e-17   Glycine soja [wild soybean]
ref|XP_006576383.1|  PREDICTED: subtilisin-like protease-like iso...  89.7    2e-17   Glycine max [soybeans]
ref|XP_004492670.1|  PREDICTED: subtilisin-like protease-like         89.7    2e-17   Cicer arietinum [garbanzo]
ref|XP_004141706.1|  PREDICTED: subtilisin-like protease-like         89.7    2e-17   Cucumis sativus [cucumbers]
gb|KHN04108.1|  Subtilisin-like protease                              89.4    2e-17   Glycine soja [wild soybean]
gb|EYU28963.1|  hypothetical protein MIMGU_mgv1a023216mg              86.7    3e-17   Erythranthe guttata [common monkey flower]
ref|XP_010917483.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  89.0    4e-17   Elaeis guineensis
ref|XP_002320086.2|  subtilase family protein                         87.4    1e-16   Populus trichocarpa [western balsam poplar]
gb|EYU29552.1|  hypothetical protein MIMGU_mgv1a0178121mg             83.6    1e-16   Erythranthe guttata [common monkey flower]
ref|XP_007139243.1|  hypothetical protein PHAVU_008G013300g           87.0    2e-16   Phaseolus vulgaris [French bean]
ref|XP_004308418.2|  PREDICTED: subtilisin-like protease              86.7    2e-16   Fragaria vesca subsp. vesca
ref|XP_010686124.1|  PREDICTED: subtilisin-like protease              85.9    4e-16   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU29555.1|  hypothetical protein MIMGU_mgv1a022042mg              85.5    4e-16   Erythranthe guttata [common monkey flower]
ref|XP_003551824.2|  PREDICTED: subtilisin-like protease-like         85.1    7e-16   Glycine max [soybeans]
ref|XP_003554304.1|  PREDICTED: subtilisin-like protease SDD1-like    85.1    7e-16   Glycine max [soybeans]
gb|EYU28960.1|  hypothetical protein MIMGU_mgv1a018215mg              85.1    7e-16   Erythranthe guttata [common monkey flower]
gb|ACJ26761.1|  subtilisin-like protein                               81.3    8e-16   Nicotiana benthamiana
gb|KHN13887.1|  Subtilisin-like protease                              84.7    9e-16   Glycine soja [wild soybean]
gb|EYU31528.1|  hypothetical protein MIMGU_mgv1a0212142mg             83.6    9e-16   Erythranthe guttata [common monkey flower]
ref|XP_007051971.1|  Subtilase family protein                         84.7    1e-15   
ref|XP_011035007.1|  PREDICTED: subtilisin-like protease              84.7    1e-15   Populus euphratica
ref|XP_009611962.1|  PREDICTED: subtilisin-like protease              84.7    1e-15   Nicotiana tomentosiformis
ref|XP_004958126.1|  PREDICTED: subtilisin-like protease-like         84.3    1e-15   Setaria italica
ref|XP_003520616.1|  PREDICTED: subtilisin-like protease SDD1-like    84.3    1e-15   Glycine max [soybeans]
gb|KHN10783.1|  Subtilisin-like protease SDD1                         84.3    1e-15   Glycine soja [wild soybean]
gb|ACN28035.1|  unknown                                               82.4    1e-15   Zea mays [maize]
ref|XP_004305758.1|  PREDICTED: subtilisin-like protease              84.3    1e-15   Fragaria vesca subsp. vesca
gb|EAY90937.1|  hypothetical protein OsI_12551                        83.2    2e-15   Oryza sativa Indica Group [Indian rice]
emb|CAN81091.1|  hypothetical protein VITISV_040911                   82.4    2e-15   Vitis vinifera
ref|XP_007220042.1|  hypothetical protein PRUPE_ppa027143mg           83.6    3e-15   
gb|AFG56825.1|  hypothetical protein 2_4281_02                        78.2    3e-15   Pinus taeda
gb|EYU21314.1|  hypothetical protein MIMGU_mgv1a001662mg              83.2    3e-15   Erythranthe guttata [common monkey flower]
gb|KCW53526.1|  hypothetical protein EUGRSUZ_J02805                   83.2    3e-15   Eucalyptus grandis [rose gum]
ref|XP_008228179.1|  PREDICTED: subtilisin-like protease              83.2    3e-15   Prunus mume [ume]
ref|XP_010033727.1|  PREDICTED: subtilisin-like protease              83.2    4e-15   Eucalyptus grandis [rose gum]
gb|EAZ04458.1|  hypothetical protein OsI_26606                        83.2    4e-15   Oryza sativa Indica Group [Indian rice]
ref|NP_001060094.1|  Os07g0578300                                     82.8    4e-15   
ref|XP_006358406.1|  PREDICTED: subtilisin-like protease-like         82.8    4e-15   Solanum tuberosum [potatoes]
gb|ACN27710.1|  unknown                                               82.4    5e-15   Zea mays [maize]
ref|XP_009403290.1|  PREDICTED: subtilisin-like protease              82.4    5e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006490976.1|  PREDICTED: subtilisin-like protease-like         82.4    5e-15   Citrus sinensis [apfelsine]
ref|XP_007024651.1|  Subtilase family protein                         82.4    5e-15   
ref|XP_006358407.1|  PREDICTED: subtilisin-like protease-like         82.4    6e-15   Solanum tuberosum [potatoes]
ref|XP_008232840.1|  PREDICTED: subtilisin-like protease              82.4    6e-15   Prunus mume [ume]
ref|XP_004512212.1|  PREDICTED: subtilisin-like protease-like         82.4    6e-15   Cicer arietinum [garbanzo]
ref|XP_006445191.1|  hypothetical protein CICLE_v10018512mg           82.8    6e-15   
gb|EYU29554.1|  hypothetical protein MIMGU_mgv1a0256351mg             81.3    7e-15   Erythranthe guttata [common monkey flower]
gb|AFG56829.1|  hypothetical protein 2_4281_02                        77.0    7e-15   Pinus taeda
gb|AFB32958.1|  hypothetical protein 0_744_01                         77.8    7e-15   Pinus mugo [mountain pine]
ref|XP_008454762.1|  PREDICTED: subtilisin-like protease              82.0    8e-15   Cucumis melo [Oriental melon]
ref|XP_004140440.1|  PREDICTED: subtilisin-like protease-like         82.0    8e-15   Cucumis sativus [cucumbers]
ref|XP_006357406.1|  PREDICTED: subtilisin-like protease-like         82.0    8e-15   Solanum tuberosum [potatoes]
ref|XP_011072593.1|  PREDICTED: subtilisin-like protease              81.6    9e-15   Sesamum indicum [beniseed]
ref|XP_009762584.1|  PREDICTED: subtilisin-like protease isoform X4   81.6    1e-14   Nicotiana sylvestris
ref|XP_009762581.1|  PREDICTED: subtilisin-like protease isoform X1   81.6    1e-14   Nicotiana sylvestris
gb|AEW08255.1|  hypothetical protein 2_4281_02                        76.3    1e-14   Pinus radiata
gb|AFG70679.1|  hypothetical protein 0_744_01                         77.0    1e-14   Pinus taeda
gb|AFG70691.1|  hypothetical protein 0_744_01                         77.0    1e-14   Pinus taeda
gb|ABR17987.1|  unknown                                               81.3    1e-14   Picea sitchensis
ref|XP_006339499.1|  PREDICTED: subtilisin-like protease-like         81.3    1e-14   Solanum tuberosum [potatoes]
ref|XP_007162604.1|  hypothetical protein PHAVU_001G165300g           81.6    2e-14   Phaseolus vulgaris [French bean]
ref|XP_009613479.1|  PREDICTED: subtilisin-like protease              81.3    2e-14   Nicotiana tomentosiformis
gb|EYU28634.1|  hypothetical protein MIMGU_mgv1a024623mg              80.9    2e-14   Erythranthe guttata [common monkey flower]
ref|XP_003540860.1|  PREDICTED: subtilisin-like protease-like         80.9    2e-14   Glycine max [soybeans]
ref|XP_011036446.1|  PREDICTED: subtilisin-like protease              80.9    2e-14   Populus euphratica
gb|KDP25551.1|  hypothetical protein JCGZ_20707                       80.9    2e-14   Jatropha curcas
ref|XP_010685296.1|  PREDICTED: subtilisin-like protease              80.9    2e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009789823.1|  PREDICTED: subtilisin-like protease              80.9    2e-14   Nicotiana sylvestris
gb|AFB32957.1|  hypothetical protein 0_744_01                         76.6    2e-14   Pinus mugo [mountain pine]
ref|XP_004229864.1|  PREDICTED: subtilisin-like protease              80.5    2e-14   Solanum lycopersicum
ref|XP_004493834.1|  PREDICTED: subtilisin-like protease SDD1-like    80.5    2e-14   
ref|XP_006359680.1|  PREDICTED: subtilisin-like protease-like         80.5    2e-14   Solanum tuberosum [potatoes]
ref|XP_003625390.1|  Subtilisin-like protease                         80.9    3e-14   
ref|XP_007051969.1|  Subtilase family protein isoform 1               80.5    3e-14   
gb|AFB32959.1|  hypothetical protein 0_744_01                         76.3    3e-14   Pinus mugo [mountain pine]
gb|AFB32953.1|  hypothetical protein 0_744_01                         76.3    3e-14   Abies alba [abete-blanco]
ref|XP_010322825.1|  PREDICTED: subtilisin-like protease              80.1    4e-14   Solanum lycopersicum
emb|CDP17728.1|  unnamed protein product                              80.1    4e-14   Coffea canephora [robusta coffee]
ref|XP_010261833.1|  PREDICTED: subtilisin-like protease              80.1    4e-14   Nelumbo nucifera [Indian lotus]
ref|XP_002303551.2|  hypothetical protein POPTR_0003s11870g           80.1    4e-14   
ref|XP_006426684.1|  hypothetical protein CICLE_v10024936mg           79.7    4e-14   Citrus clementina [clementine]
ref|XP_010087293.1|  Subtilisin-like protease                         79.7    4e-14   
gb|KDO64998.1|  hypothetical protein CISIN_1g045236mg                 79.3    5e-14   Citrus sinensis [apfelsine]
ref|XP_004244717.1|  PREDICTED: subtilisin-like protease              79.7    5e-14   Solanum lycopersicum
ref|XP_007051967.1|  Subtilase family protein                         79.7    5e-14   
ref|XP_006841679.1|  hypothetical protein AMTR_s00003p00245290        79.7    5e-14   Amborella trichopoda
ref|XP_009391664.1|  PREDICTED: subtilisin-like protease SDD1         79.7    5e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010685295.1|  PREDICTED: subtilisin-like protease              79.7    5e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002304129.2|  hypothetical protein POPTR_0003s06530g           79.7    5e-14   Populus trichocarpa [western balsam poplar]
gb|AFB33380.1|  hypothetical protein 2_4281_02                        74.7    6e-14   Pinus mugo [mountain pine]
gb|EYU29357.1|  hypothetical protein MIMGU_mgv1a021077mg              79.3    6e-14   Erythranthe guttata [common monkey flower]
emb|CDP10007.1|  unnamed protein product                              79.3    6e-14   Coffea canephora [robusta coffee]
gb|AES80028.2|  subtilisin-like serine protease                       79.3    7e-14   Medicago truncatula
ref|XP_003623810.1|  Subtilisin-like protease                         79.3    7e-14   
ref|XP_007217156.1|  hypothetical protein PRUPE_ppa001739mg           79.3    7e-14   Prunus persica
ref|XP_011033844.1|  PREDICTED: subtilisin-like protease SDD1         79.0    8e-14   Populus euphratica
ref|XP_010091819.1|  Subtilisin-like protease SDD1                    79.0    8e-14   Morus notabilis
emb|CBI34784.3|  unnamed protein product                              77.4    8e-14   Vitis vinifera
ref|NP_001050634.1|  Os03g0605300                                     79.0    9e-14   
gb|AFB32955.1|  hypothetical protein 0_744_01                         74.7    9e-14   Larix decidua
ref|XP_009593174.1|  PREDICTED: subtilisin-like protease              79.0    1e-13   Nicotiana tomentosiformis
ref|XP_008792869.1|  PREDICTED: subtilisin-like protease              78.6    1e-13   Phoenix dactylifera
ref|XP_009407416.1|  PREDICTED: subtilisin-like protease              78.6    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFB32956.1|  hypothetical protein 0_744_01                         74.3    1e-13   Pinus mugo [mountain pine]
ref|XP_006342924.1|  PREDICTED: subtilisin-like protease-like         78.6    1e-13   Solanum tuberosum [potatoes]
emb|CDP09846.1|  unnamed protein product                              78.2    1e-13   Coffea canephora [robusta coffee]
emb|CDY63302.1|  BnaCnng41810D                                        78.2    2e-13   Brassica napus [oilseed rape]
ref|XP_008454764.1|  PREDICTED: subtilisin-like protease              78.2    2e-13   Cucumis melo [Oriental melon]
gb|EMS49460.1|  Subtilisin-like protease SDD1                         78.2    2e-13   Triticum urartu
ref|XP_004166310.1|  PREDICTED: subtilisin-like protease SDD1-like    77.8    2e-13   
ref|XP_010919194.1|  PREDICTED: subtilisin-like protease isoform X1   77.8    2e-13   
ref|XP_010919195.1|  PREDICTED: subtilisin-like protease isoform X2   77.8    2e-13   
tpg|DAA50265.1|  TPA: putative subtilase family protein               77.8    2e-13   
ref|XP_006298979.1|  hypothetical protein CARUB_v10015104mg           77.4    3e-13   Capsella rubella
ref|XP_003605881.1|  Subtilisin-like protease                         77.4    3e-13   
gb|EYU37942.1|  hypothetical protein MIMGU_mgv1a001727mg              77.4    3e-13   Erythranthe guttata [common monkey flower]
ref|XP_003636375.1|  Subtilisin-like protease                         77.4    3e-13   
ref|XP_011088593.1|  PREDICTED: subtilisin-like protease              77.4    3e-13   Sesamum indicum [beniseed]
ref|NP_001151549.1|  subtilisin-like protease precursor               77.4    3e-13   
gb|AEW07410.1|  hypothetical protein 0_744_01                         73.6    3e-13   Pinus radiata
ref|XP_004171629.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  77.4    3e-13   
gb|ABR18065.1|  unknown                                               77.4    3e-13   Picea sitchensis
emb|CDO96926.1|  unnamed protein product                              77.4    3e-13   Coffea canephora [robusta coffee]
ref|XP_004140477.1|  PREDICTED: subtilisin-like protease-like         77.4    3e-13   
ref|XP_009790648.1|  PREDICTED: subtilisin-like protease SDD1 iso...  77.4    3e-13   Nicotiana sylvestris
ref|XP_011035735.1|  PREDICTED: subtilisin-like protease              77.4    3e-13   Populus euphratica
ref|XP_009411443.1|  PREDICTED: subtilisin-like protease              77.0    3e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008780373.1|  PREDICTED: subtilisin-like protease              77.0    3e-13   
gb|KHN41792.1|  Subtilisin-like protease                              77.0    4e-13   Glycine soja [wild soybean]
gb|AFS34694.1|  subtilisin-like serine protease                       77.0    4e-13   Pisum sativum [garden pea]
ref|XP_004231026.1|  PREDICTED: subtilisin-like protease              77.0    4e-13   Solanum lycopersicum
ref|XP_003538919.1|  PREDICTED: subtilisin-like protease-like         77.0    4e-13   Glycine max [soybeans]
ref|XP_009790649.1|  PREDICTED: subtilisin-like protease SDD1 iso...  77.0    4e-13   Nicotiana sylvestris
ref|XP_009790650.1|  PREDICTED: subtilisin-like protease SDD1 iso...  77.0    4e-13   Nicotiana sylvestris
emb|CDY43568.1|  BnaC02g16650D                                        73.9    4e-13   Brassica napus [oilseed rape]
ref|XP_007131701.1|  hypothetical protein PHAVU_011G034700g           77.0    4e-13   Phaseolus vulgaris [French bean]
emb|CBI37888.3|  unnamed protein product                              77.0    4e-13   Vitis vinifera
ref|XP_002275429.1|  PREDICTED: subtilisin-like protease              77.0    4e-13   Vitis vinifera
ref|XP_010646965.1|  PREDICTED: subtilisin-like protease              77.0    5e-13   Vitis vinifera
ref|XP_008447369.1|  PREDICTED: subtilisin-like protease SDD1         76.6    5e-13   Cucumis melo [Oriental melon]
ref|XP_010059854.1|  PREDICTED: subtilisin-like protease              76.6    5e-13   Eucalyptus grandis [rose gum]
gb|KGN58306.1|  hypothetical protein Csa_3G610820                     76.6    5e-13   Cucumis sativus [cucumbers]
ref|XP_002272824.2|  PREDICTED: subtilisin-like protease              76.6    5e-13   Vitis vinifera
ref|XP_008440346.1|  PREDICTED: subtilisin-like protease              76.6    5e-13   Cucumis melo [Oriental melon]
gb|KJB57037.1|  hypothetical protein B456_009G146000                  76.6    5e-13   Gossypium raimondii
ref|NP_001159342.1|  putative subtilase family protein precursor      76.6    5e-13   Zea mays [maize]
ref|XP_003538985.1|  PREDICTED: subtilisin-like protease-like         76.6    5e-13   Glycine max [soybeans]
ref|XP_004152066.1|  PREDICTED: subtilisin-like protease SDD1-like    76.6    6e-13   
ref|XP_010654422.1|  PREDICTED: subtilisin-like protease              76.6    6e-13   Vitis vinifera
ref|XP_004982450.1|  PREDICTED: subtilisin-like protease-like         76.3    6e-13   Setaria italica
gb|EMT24443.1|  Subtilisin-like protease                              76.3    6e-13   
ref|XP_004958127.1|  PREDICTED: subtilisin-like protease-like         76.3    7e-13   Setaria italica
ref|XP_006383545.1|  hypothetical protein POPTR_0005s18880g           76.3    7e-13   
ref|XP_010111996.1|  Subtilisin-like protease                         76.3    8e-13   
ref|XP_003627323.1|  Cucumisin-like serine protease subtilisin-li...  75.9    9e-13   
gb|EYU28633.1|  hypothetical protein MIMGU_mgv1a023843mg              75.9    9e-13   
gb|AGT16121.1|  hypothetical protein SHCRBa_028_H13_F_280             75.9    9e-13   
ref|XP_010530892.1|  PREDICTED: subtilisin-like protease              75.9    9e-13   
gb|ADY38794.1|  serine protease                                       75.9    9e-13   
ref|XP_002509668.1|  Xylem serine proteinase 1 precursor, putative    75.9    9e-13   
ref|XP_009758461.1|  PREDICTED: subtilisin-like protease              75.9    1e-12   
gb|AES81608.2|  subtilisin-like serine protease                       75.9    1e-12   
ref|XP_006283144.1|  hypothetical protein CARUB_v10004172mg           75.9    1e-12   
ref|XP_004505786.1|  PREDICTED: subtilisin-like protease-like         75.9    1e-12   
ref|XP_004231902.2|  PREDICTED: subtilisin-like protease              75.9    1e-12   
ref|XP_002275381.2|  PREDICTED: subtilisin-like protease SDD1         75.9    1e-12   
gb|KDP29636.1|  hypothetical protein JCGZ_18798                       75.5    1e-12   
gb|EPS74284.1|  hypothetical protein M569_00464                       75.5    1e-12   
ref|XP_006418467.1|  hypothetical protein EUTSA_v10006878mg           75.5    1e-12   
ref|XP_003523991.1|  PREDICTED: subtilisin-like protease-like         75.5    1e-12   
emb|CDP10008.1|  unnamed protein product                              75.9    1e-12   
emb|CDY63869.1|  BnaCnng42760D                                        72.4    1e-12   
ref|XP_007135429.1|  hypothetical protein PHAVU_010G128600g           75.1    2e-12   
gb|KJB49367.1|  hypothetical protein B456_008G115500                  75.1    2e-12   
ref|XP_003525925.1|  PREDICTED: subtilisin-like protease-like         75.1    2e-12   
gb|KHN45156.1|  Subtilisin-like protease                              75.1    2e-12   
gb|ADW11233.1|  subtilisin-like protease 2                            75.1    2e-12   
ref|XP_009375850.1|  PREDICTED: subtilisin-like protease              75.1    2e-12   
ref|XP_010105482.1|  Subtilisin-like protease                         75.1    2e-12   
ref|XP_011010186.1|  PREDICTED: subtilisin-like protease              75.1    2e-12   
gb|KFK42754.1|  hypothetical protein AALP_AA1G035200                  74.7    2e-12   
emb|CDO99977.1|  unnamed protein product                              74.7    2e-12   
ref|XP_006352831.1|  PREDICTED: subtilisin-like protease SDD1-like    74.7    2e-12   
gb|ABZ89187.1|  putative protein                                      74.7    2e-12   
dbj|BAK08126.1|  predicted protein                                    74.7    2e-12   
ref|XP_003597117.1|  Subtilisin-like protease                         74.7    2e-12   
emb|CDP11276.1|  unnamed protein product                              74.7    3e-12   
emb|CAN75239.1|  hypothetical protein VITISV_014205                   74.7    3e-12   
ref|XP_006358147.1|  PREDICTED: subtilisin-like protease SDD1-like    74.3    3e-12   
ref|XP_011092912.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  74.3    3e-12   
gb|EAY87749.1|  hypothetical protein OsI_09164                        73.9    3e-12   
gb|EYU28961.1|  hypothetical protein MIMGU_mgv1a020058mg              74.3    3e-12   
gb|KHN01421.1|  Subtilisin-like protease                              73.2    3e-12   
ref|XP_010090327.1|  Subtilisin-like protease                         74.3    3e-12   
ref|XP_002275410.2|  PREDICTED: subtilisin-like protease SDD1         74.3    3e-12   
ref|XP_008780900.1|  PREDICTED: subtilisin-like protease              74.3    4e-12   
ref|XP_002511772.1|  Xylem serine proteinase 1 precursor, putative    74.3    4e-12   
emb|CDX72509.1|  BnaC07g45310D                                        74.3    4e-12   
ref|XP_006369129.1|  subtilase family protein                         73.9    4e-12   
ref|XP_004512211.1|  PREDICTED: subtilisin-like protease-like         73.9    4e-12   
ref|XP_006355907.1|  PREDICTED: subtilisin-like protease SDD1-like    73.9    4e-12   
ref|XP_010931682.1|  PREDICTED: subtilisin-like protease              73.9    4e-12   
emb|CDY63300.1|  BnaCnng41800D                                        73.9    4e-12   
ref|XP_002313716.1|  hypothetical protein POPTR_0009s13590g           73.9    4e-12   
ref|XP_008391410.1|  PREDICTED: subtilisin-like protease              73.9    4e-12   
emb|CDY67452.1|  BnaCnng55020D                                        73.9    4e-12   
gb|EMS62253.1|  Subtilisin-like protease                              71.2    4e-12   
ref|XP_009119746.1|  PREDICTED: subtilisin-like protease              73.9    4e-12   
ref|XP_002892038.1|  predicted protein                                73.9    4e-12   
ref|XP_010255581.1|  PREDICTED: subtilisin-like protease              73.9    4e-12   
gb|ACN26674.1|  unknown                                               73.6    4e-12   
gb|KJB10059.1|  hypothetical protein B456_001G182200                  74.3    4e-12   
emb|CBI34785.3|  unnamed protein product                              73.9    4e-12   
gb|KHN28302.1|  Subtilisin-like protease                              73.9    5e-12   
gb|KDP28707.1|  hypothetical protein JCGZ_14478                       73.9    5e-12   
ref|XP_002463079.1|  hypothetical protein SORBIDRAFT_02g037440        73.9    5e-12   
ref|XP_006465903.1|  PREDICTED: subtilisin-like protease-like         73.6    5e-12   
ref|XP_006296785.1|  hypothetical protein CARUB_v10016006mg           73.6    6e-12   
ref|XP_010262465.1|  PREDICTED: subtilisin-like protease SDD1         73.6    6e-12   
ref|XP_004292169.1|  PREDICTED: subtilisin-like protease              73.6    6e-12   
ref|XP_010240288.1|  PREDICTED: subtilisin-like protease              73.6    6e-12   
ref|XP_004510506.1|  PREDICTED: subtilisin-like protease-like iso...  73.6    6e-12   
ref|NP_001159284.1|  putative subtilase family protein precursor      73.6    6e-12   
gb|AFK43318.1|  unknown                                               70.5    6e-12   
gb|EPS74243.1|  subtilase family protein                              73.6    6e-12   
gb|EYU29563.1|  hypothetical protein MIMGU_mgv1a022413mg              73.2    7e-12   
ref|XP_007050153.1|  Subtilase family protein isoform 1               73.2    7e-12   
ref|XP_006486757.1|  PREDICTED: subtilisin-like protease-like         73.2    7e-12   
ref|XP_002885009.1|  subtilase family protein                         73.2    7e-12   
ref|XP_006422621.1|  hypothetical protein CICLE_v10027859mg           73.2    7e-12   
dbj|BAK03601.1|  predicted protein                                    73.2    8e-12   
ref|XP_003516513.1|  PREDICTED: subtilisin-like protease-like         73.2    8e-12   
gb|KDO68023.1|  hypothetical protein CISIN_1g004010mg                 73.2    8e-12   
gb|ADZ55305.1|  serine protease                                       73.2    8e-12   
gb|KDP28200.1|  hypothetical protein JCGZ_13971                       73.2    9e-12   
gb|KDP26457.1|  hypothetical protein JCGZ_17615                       72.8    9e-12   
ref|XP_003608462.1|  Subtilisin-like protease                         72.8    9e-12   
ref|XP_002526537.1|  Cucumisin precursor, putative                    72.8    9e-12   
ref|XP_007158047.1|  hypothetical protein PHAVU_002G119700g           72.8    1e-11   
ref|XP_004512297.1|  PREDICTED: subtilisin-like protease-like iso...  72.8    1e-11   
ref|XP_004512298.1|  PREDICTED: subtilisin-like protease-like iso...  72.8    1e-11   
emb|CDY12840.1|  BnaC07g15930D                                        72.8    1e-11   
ref|XP_004512299.1|  PREDICTED: subtilisin-like protease-like iso...  72.8    1e-11   
ref|XP_010939822.1|  PREDICTED: subtilisin-like protease              72.8    1e-11   
ref|XP_002965274.1|  hypothetical protein SELMODRAFT_406544           72.8    1e-11   
dbj|BAD19523.1|  putative subtilisin-like proteinase                  72.8    1e-11   
ref|XP_007136744.1|  hypothetical protein PHAVU_009G070500g           72.8    1e-11   
ref|XP_009590434.1|  PREDICTED: subtilisin-like protease SDD1         72.8    1e-11   
ref|XP_003636806.1|  hypothetical protein MTR_061s1001                68.6    1e-11   
ref|XP_010467397.1|  PREDICTED: subtilisin-like protease isoform X2   72.8    1e-11   
ref|XP_010526897.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  72.4    1e-11   
ref|XP_007199629.1|  hypothetical protein PRUPE_ppa001754mg           72.4    1e-11   
ref|XP_009336065.1|  PREDICTED: subtilisin-like protease              72.4    1e-11   
gb|AGN03879.1|  senescence-associated subtilisin protease             72.4    1e-11   
ref|XP_006583162.1|  PREDICTED: subtilisin-like protease-like iso...  72.4    1e-11   
ref|XP_009117189.1|  PREDICTED: subtilisin-like protease              72.4    1e-11   
ref|XP_002986601.1|  hypothetical protein SELMODRAFT_425502           72.0    1e-11   
ref|XP_010467396.1|  PREDICTED: subtilisin-like protease isoform X1   72.4    1e-11   
ref|XP_002305511.2|  hypothetical protein POPTR_0004s17960g           72.4    1e-11   
ref|XP_010056250.1|  PREDICTED: subtilisin-like protease              72.4    1e-11   
ref|XP_004300738.1|  PREDICTED: subtilisin-like protease SDD1         72.4    1e-11   
gb|KFK28394.1|  hypothetical protein AALP_AA8G509300                  72.4    2e-11   
ref|XP_009112378.1|  PREDICTED: subtilisin-like protease              72.0    2e-11   
ref|XP_011091250.1|  PREDICTED: subtilisin-like protease              72.0    2e-11   
ref|XP_010457066.1|  PREDICTED: subtilisin-like protease isoform X1   72.0    2e-11   
gb|KHN34419.1|  Subtilisin-like protease                              67.8    2e-11   
ref|XP_008439131.1|  PREDICTED: subtilisin-like protease              72.0    2e-11   
ref|XP_004244716.2|  PREDICTED: subtilisin-like protease              72.0    2e-11   
gb|KJB43875.1|  hypothetical protein B456_007G221100                  72.0    2e-11   
ref|XP_010028715.1|  PREDICTED: subtilisin-like protease              72.0    2e-11   
ref|XP_011081168.1|  PREDICTED: subtilisin-like protease SDD1         72.0    2e-11   
gb|KHG02130.1|  Subtilisin-like protease                              72.0    2e-11   
gb|KHN39620.1|  Subtilisin-like protease                              71.6    2e-11   
ref|XP_003581517.1|  PREDICTED: subtilisin-like protease              72.0    2e-11   
ref|XP_007047459.1|  Subtilase family protein                         72.0    2e-11   
ref|XP_003547763.1|  PREDICTED: subtilisin-like protease-like         71.6    2e-11   
gb|KJB34441.1|  hypothetical protein B456_006G065800                  71.2    2e-11   
ref|XP_011079622.1|  PREDICTED: subtilisin-like protease              71.6    2e-11   
ref|XP_004141727.1|  PREDICTED: subtilisin-like protease-like         71.6    2e-11   
ref|NP_001234288.1|  SBT2 protein precursor                           71.6    2e-11   
gb|EYU33441.1|  hypothetical protein MIMGU_mgv1a022698mg              71.6    2e-11   
ref|XP_010483084.1|  PREDICTED: subtilisin-like protease SDD1         71.6    3e-11   
gb|EYU40429.1|  hypothetical protein MIMGU_mgv1a001733mg              71.6    3e-11   
ref|XP_006599275.1|  PREDICTED: subtilisin-like protease-like iso...  71.6    3e-11   
gb|KEH30495.1|  subtilisin-like serine protease                       71.6    3e-11   
emb|CDY33251.1|  BnaC01g37240D                                        71.6    3e-11   
ref|XP_006856781.1|  hypothetical protein AMTR_s00055p00107870        71.6    3e-11   
gb|AFK38321.1|  unknown                                               68.6    3e-11   
ref|XP_007051968.1|  Subtilase family protein                         71.6    3e-11   
ref|XP_007156353.1|  hypothetical protein PHAVU_003G279300g           71.6    3e-11   
gb|KJB49366.1|  hypothetical protein B456_008G115400                  71.6    3e-11   
ref|XP_008462247.1|  PREDICTED: subtilisin-like protease              71.6    3e-11   
gb|KHN38839.1|  Subtilisin-like protease                              71.6    3e-11   
ref|XP_003547892.1|  PREDICTED: subtilisin-like protease-like iso...  71.6    3e-11   
ref|XP_010457444.1|  PREDICTED: subtilisin-like protease SDD1         71.6    3e-11   
emb|CDY39093.1|  BnaA01g29630D                                        71.6    3e-11   
ref|XP_004155899.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  71.6    3e-11   
ref|XP_009760563.1|  PREDICTED: subtilisin-like protease              71.2    3e-11   
ref|XP_010690381.1|  PREDICTED: subtilisin-like protease              71.2    3e-11   
ref|XP_004242535.1|  PREDICTED: subtilisin-like protease SDD1         71.2    3e-11   
emb|CDP05276.1|  unnamed protein product                              71.2    3e-11   
gb|ACN34516.1|  unknown                                               70.1    3e-11   
emb|CDY15145.1|  BnaC05g00240D                                        71.2    3e-11   
ref|XP_004954115.1|  PREDICTED: subtilisin-like protease-like         71.2    3e-11   
emb|CAA59963.1|  subtilisin-like protease                             71.2    3e-11   
gb|ACB87529.1|  subtilisin protease                                   70.9    3e-11   
ref|XP_011080122.1|  PREDICTED: subtilisin-like protease SDD1         71.2    3e-11   
gb|KJB34440.1|  hypothetical protein B456_006G065800                  71.2    3e-11   
ref|XP_008236002.1|  PREDICTED: subtilisin-like protease              71.2    3e-11   
ref|XP_010105479.1|  Subtilisin-like protease                         71.2    4e-11   
ref|XP_010484513.1|  PREDICTED: subtilisin-like protease              71.2    4e-11   
ref|XP_010684867.1|  PREDICTED: subtilisin-like protease SDD1         70.9    4e-11   
gb|KJB34439.1|  hypothetical protein B456_006G065800                  70.9    4e-11   
ref|XP_002867098.1|  hypothetical protein ARALYDRAFT_491159           70.9    4e-11   
gb|ABD64827.1|  putative subtilisin serine protease of stomatal d...  70.9    4e-11   
ref|XP_009138332.1|  PREDICTED: subtilisin-like protease              70.9    4e-11   
ref|XP_006393933.1|  hypothetical protein EUTSA_v10003693mg           70.9    4e-11   
emb|CDX97539.1|  BnaA05g25400D                                        70.5    4e-11   
gb|KJB34438.1|  hypothetical protein B456_006G065800                  70.5    4e-11   
gb|AFK33735.1|  unknown                                               67.8    4e-11   
gb|AFW73750.1|  putative subtilase family protein                     70.9    4e-11   
gb|KHN44005.1|  Subtilisin-like protease                              70.1    4e-11   
ref|XP_002318860.1|  hypothetical protein POPTR_0012s14140g           70.9    4e-11   
emb|CDY40653.1|  BnaA03g53100D                                        70.9    4e-11   
ref|XP_010464171.1|  PREDICTED: subtilisin-like protease              70.9    5e-11   
ref|XP_008810058.1|  PREDICTED: subtilisin-like protease SDD1         70.9    5e-11   
gb|EYU28956.1|  hypothetical protein MIMGU_mgv1a023117mg              70.9    5e-11   
ref|XP_006425216.1|  hypothetical protein CICLE_v10024941mg           70.9    5e-11   
gb|KDO71607.1|  hypothetical protein CISIN_1g004205mg                 70.9    5e-11   
ref|NP_563701.1|  subtilisin-like protease SDD1                       70.9    5e-11   
ref|XP_006467138.1|  PREDICTED: subtilisin-like protease-like iso...  70.9    5e-11   
ref|XP_008377749.1|  PREDICTED: subtilisin-like protease              70.9    5e-11   
ref|XP_006362686.1|  PREDICTED: subtilisin-like protease-like         70.9    5e-11   
ref|XP_010558849.1|  PREDICTED: subtilisin-like protease SDD1         70.9    5e-11   
emb|CDY18653.1|  BnaA09g07420D                                        70.9    5e-11   
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease              70.9    5e-11   
ref|NP_001146035.1|  uncharacterized protein LOC100279566             70.1    5e-11   
ref|NP_001048301.1|  Os02g0779200                                     70.9    5e-11   
ref|XP_010489238.1|  PREDICTED: subtilisin-like protease              70.9    5e-11   
ref|XP_006477586.1|  PREDICTED: subtilisin-like protease SDD1-like    70.5    5e-11   
ref|XP_010923357.1|  PREDICTED: subtilisin-like protease              70.5    5e-11   
ref|XP_009112375.1|  PREDICTED: subtilisin-like protease isoform X2   70.5    6e-11   
ref|XP_009335230.1|  PREDICTED: subtilisin-like protease SDD1         70.5    6e-11   
ref|XP_010444660.1|  PREDICTED: subtilisin-like protease              70.5    6e-11   
ref|XP_002886065.1|  predicted protein                                70.5    6e-11   
ref|XP_010692334.1|  PREDICTED: subtilisin-like protease              70.5    6e-11   
ref|XP_009112374.1|  PREDICTED: subtilisin-like protease isoform X1   70.5    6e-11   
gb|EPS72026.1|  serine protease                                       70.5    6e-11   
ref|XP_002892197.1|  hypothetical protein ARALYDRAFT_470387           70.5    6e-11   
ref|XP_003611185.1|  Subtilisin-like serine protease                  70.5    6e-11   
ref|NP_001145849.1|  uncharacterized protein LOC100279360 precursor   70.5    6e-11   
ref|XP_011024491.1|  PREDICTED: subtilisin-like protease SDD1         70.5    6e-11   
ref|XP_006304967.1|  hypothetical protein CARUB_v10012040mg           70.5    6e-11   
ref|XP_010437545.1|  PREDICTED: subtilisin-like protease              70.5    7e-11   
ref|XP_010108071.1|  Subtilisin-like protease SDD1                    70.5    7e-11   
emb|CDY52259.1|  BnaC05g52030D                                        70.5    7e-11   
ref|XP_010540256.1|  PREDICTED: subtilisin-like protease              70.5    7e-11   
ref|XP_004244588.1|  PREDICTED: subtilisin-like protease              70.5    7e-11   
ref|XP_010109072.1|  Subtilisin-like protease                         70.5    7e-11   
ref|XP_006280051.1|  hypothetical protein CARUB_v10025930mg           70.5    7e-11   
ref|XP_002984931.1|  hypothetical protein SELMODRAFT_424020           70.1    7e-11   
ref|XP_004147596.1|  PREDICTED: subtilisin-like protease SDD1-like    70.1    7e-11   
emb|CDY44380.1|  BnaA02g29970D                                        70.1    7e-11   
gb|KGN57311.1|  hypothetical protein Csa_3G178520                     70.1    7e-11   
gb|KHN45603.1|  Subtilisin-like protease                              68.9    7e-11   
gb|KHM99187.1|  Subtilisin-like protease                              67.0    7e-11   
ref|XP_010501588.1|  PREDICTED: subtilisin-like protease              70.1    8e-11   
ref|XP_004148149.1|  PREDICTED: subtilisin-like protease-like         70.1    8e-11   
ref|XP_010487224.1|  PREDICTED: subtilisin-like protease              70.1    8e-11   
gb|EYU39048.1|  hypothetical protein MIMGU_mgv1a002011mg              70.1    8e-11   
gb|AES94159.2|  subtilisin-like serine protease                       70.1    8e-11   
gb|EYU29557.1|  hypothetical protein MIMGU_mgv1a0023062mg             68.2    8e-11   
ref|XP_003550022.1|  PREDICTED: subtilisin-like protease-like         70.1    8e-11   



>ref|XP_004243704.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=762

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
            + IQAIVK PN+TCAKK S+P Q+ YPSF VLFGKSR+VR TR LTNVGAAG+ YEV  +
Sbjct  635  EHIQAIVKRPNVTCAKKFSDPGQINYPSFAVLFGKSRVVRYTRTLTNVGAAGSTYEVVID  694

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            APPSVTVTVKP+KLVFK VG+RLRYTVTFVSKKGV T S   FGS+SWNNAQNQVRSP++
Sbjct  695  APPSVTVTVKPSKLVFKKVGERLRYTVTFVSKKGVSTMSKTTFGSISWNNAQNQVRSPVS  754

Query  128  FSWTQLF  108
            +SW+QLF
Sbjct  755  YSWSQLF  761



>ref|XP_006342387.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=767

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
              IQAIVK PN+TCAKK S+P Q+ YPSF VLFGKSR+VR TR LTNVGAAG+ YEV  +
Sbjct  640  DHIQAIVKRPNVTCAKKFSDPGQINYPSFAVLFGKSRVVRYTRTLTNVGAAGSTYEVVID  699

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            APPSVTVTVKP+KLVFK VG+RLRYTVTFVSKKGV T S   FGS+SWNNAQNQVRSP++
Sbjct  700  APPSVTVTVKPSKLVFKRVGERLRYTVTFVSKKGVSTMSKTTFGSISWNNAQNQVRSPVS  759

Query  128  FSWTQLF  108
            +SW+QLF
Sbjct  760  YSWSQLF  766



>ref|XP_009782030.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEA  306
             IQAIVK PN+TC KK ++P Q+ YPSF VLFGKSR+VR TR +TNVGAAG++YEV  +A
Sbjct  638  HIQAIVKRPNVTCTKKFADPGQINYPSFSVLFGKSRVVRYTRAVTNVGAAGSVYEVTVDA  697

Query  305  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAF  126
            PPSVTVTVKP+KLVFK VG+RLRYTVTFVSKKGV     +AFGS+SWNNAQNQVRSP+++
Sbjct  698  PPSVTVTVKPSKLVFKRVGERLRYTVTFVSKKGVNMMRKSAFGSISWNNAQNQVRSPVSY  757

Query  125  SWTQLF  108
            SW+QL 
Sbjct  758  SWSQLL  763



>ref|XP_009596091.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=764

 Score =   192 bits (488),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEA  306
             IQAIVK PN+TCAKK ++P Q+ YPSF VLFGKSR+VR TR +TNV AAG++YEV  +A
Sbjct  638  HIQAIVKRPNVTCAKKFADPGQINYPSFSVLFGKSRVVRYTRAVTNVAAAGSVYEVVVDA  697

Query  305  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAF  126
            PPSV VTVKP+KLVFK VG+RLRYTVTFVS KGV     +AFGS+SWNNAQNQVRSP+++
Sbjct  698  PPSVLVTVKPSKLVFKRVGERLRYTVTFVSNKGVNMMRKSAFGSISWNNAQNQVRSPVSY  757

Query  125  SWTQLF  108
            SW+QL 
Sbjct  758  SWSQLL  763



>gb|ABK96588.1| unknown [Populus trichocarpa x Populus deltoides]
Length=218

 Score =   179 bits (455),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
            + +QAIVK PNITC++K +NP  L YPSF V+F  +R+VR TRELTNVGAAG++YEVA  
Sbjct  93   EHVQAIVKRPNITCSRKFNNPGNLNYPSFSVVFTNNRVVRYTRELTNVGAAGSIYEVAVT  152

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P +V VTVKP+KLVFKNVGD+LRYTVTFV++KG      + FG++ W NAQ+QVRSP+A
Sbjct  153  GPQAVQVTVKPSKLVFKNVGDKLRYTVTFVARKGASLTGRSEFGAIVWRNAQHQVRSPVA  212

Query  128  FSWTQL  111
            FSWTQL
Sbjct  213  FSWTQL  218



>ref|XP_011078099.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=758

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 106/126 (84%), Gaps = 1/126 (1%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
            + IQAI K PNITCA+K  +P QL YPSF VLFGKSRIV+ +RELTNVGAAG++Y V+ E
Sbjct  634  EMIQAIAKRPNITCARKFRDPGQLNYPSFSVLFGKSRIVKYSRELTNVGAAGSVYLVSVE  693

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            APP+V V+VKP+KLVFKNVGD+ RYTVTF SKK  V P + AFGS++W NAQ+QV+SP+A
Sbjct  694  APPTVAVSVKPSKLVFKNVGDKQRYTVTFTSKKS-VNPVSHAFGSITWKNAQDQVKSPVA  752

Query  128  FSWTQL  111
            FSWTQL
Sbjct  753  FSWTQL  758



>gb|KDP33922.1| hypothetical protein JCGZ_07493 [Jatropha curcas]
Length=765

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
              +QAIVK PN+TC+KK  +P +L YPSF V+F   R+VR TRELTNVG AG++YEVA  
Sbjct  639  DHVQAIVKRPNVTCSKKFRDPGELNYPSFSVVFASKRVVRYTRELTNVGEAGSIYEVAVN  698

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P +V VTVKPTKLVFKNVGD+LRYTVTFV+KKG    + + FGS+ W NAQ+QVRSPIA
Sbjct  699  GPSTVGVTVKPTKLVFKNVGDKLRYTVTFVAKKGANQDARSEFGSIVWRNAQHQVRSPIA  758

Query  128  FSWTQLF  108
            F+WT L 
Sbjct  759  FTWTHLL  765



>ref|XP_011093838.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=743

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 103/125 (82%), Gaps = 1/125 (1%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
            + IQAIVK PN+TCA K  +P QL YPSF V+FGKSR+VR TR LTNVGAAG++Y V+ E
Sbjct  619  EMIQAIVKHPNVTCAAKFRDPGQLNYPSFSVVFGKSRVVRYTRRLTNVGAAGSVYRVSVE  678

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            APP+V V+VKP+ LVF+NVGDR RYTVTFVS+KG V P +  FGS++W N Q+QVRSP+A
Sbjct  679  APPNVVVSVKPSNLVFRNVGDRQRYTVTFVSQKG-VDPLHNGFGSITWKNEQHQVRSPVA  737

Query  128  FSWTQ  114
            FSW++
Sbjct  738  FSWSR  742



>ref|XP_002516266.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF46268.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=768

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
              +Q IVK PN+TCA+K S+P +L YPSF V+FG  R+VR TRELTNVG AG++YEV   
Sbjct  642  DHVQLIVKRPNVTCARKFSDPGELNYPSFSVVFGNKRVVRYTRELTNVGEAGSIYEVEVT  701

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            AP +V V+VKPTKLVF+NVGD+LRYTVTFV+KKG+   +   FGS+ W NA++QVRSP+A
Sbjct  702  APSTVGVSVKPTKLVFRNVGDKLRYTVTFVAKKGIRKAARNGFGSIVWRNAEHQVRSPVA  761

Query  128  FSWTQLF  108
            F+WTQL 
Sbjct  762  FAWTQLL  768



>ref|XP_006381615.1| subtilase family protein [Populus trichocarpa]
 gb|ERP59412.1| subtilase family protein [Populus trichocarpa]
Length=768

 Score =   181 bits (458),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
            + +QAIVK PNITC++K +NP  L YPSF V+F  +R+VR TRELTNVGAAG++YEVA  
Sbjct  643  EHVQAIVKRPNITCSRKFNNPGNLNYPSFSVVFTNNRVVRYTRELTNVGAAGSIYEVAVT  702

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P +V VTVKP+KLVFKNVGD+LRYTVTFV++KG      + FG++ W NAQ+QVRSP+A
Sbjct  703  GPQAVQVTVKPSKLVFKNVGDKLRYTVTFVARKGASLTGRSEFGAIVWRNAQHQVRSPVA  762

Query  128  FSWTQL  111
            FSWTQL
Sbjct  763  FSWTQL  768



>ref|XP_011039978.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=767

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 101/126 (80%), Gaps = 1/126 (1%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
            + +QAIVK PNITC++K  NP  L YPSF V+F  +R+VR TRELTNVGAAG++YEVA  
Sbjct  643  EHVQAIVKRPNITCSRKF-NPGNLNYPSFSVVFTNNRVVRYTRELTNVGAAGSIYEVAVT  701

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P +V VTVKP+KLVFKN+GD+LRYTVTFV++KG      + FG++ W NAQ+QVRSP+A
Sbjct  702  GPQAVQVTVKPSKLVFKNIGDKLRYTVTFVARKGASLTGRSEFGAIMWRNAQHQVRSPVA  761

Query  128  FSWTQL  111
            FSWTQL
Sbjct  762  FSWTQL  767



>ref|XP_010047469.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW79384.1| hypothetical protein EUGRSUZ_C00797 [Eucalyptus grandis]
Length=768

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
             Q++A+ K PN+TC++K ++P QL YPSF VLFG  RIVR TR+LTNVGAAG++Y V   
Sbjct  642  DQVRAVAKRPNVTCSRKFADPGQLNYPSFSVLFGSKRIVRYTRQLTNVGAAGSVYAVTVM  701

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             PP+V VTVKP KLVF  VGDR  YTVTFVSKKG+     + FGS+ W+NAQN+VRSP+A
Sbjct  702  GPPAVEVTVKPPKLVFAKVGDRRSYTVTFVSKKGMNQTVRSDFGSIVWSNAQNEVRSPVA  761

Query  128  FSWTQL  111
            ++WTQ+
Sbjct  762  YAWTQI  767



>ref|XP_008242250.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=763

 Score =   169 bits (428),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
            + +QAIVK PN+TC++K S+P QL YPSF V+FGK R+VR +RE TNVGAAG++Y VA  
Sbjct  636  EHVQAIVKKPNVTCSRKYSDPGQLNYPSFSVVFGKKRVVRYSREFTNVGAAGSIYRVAVT  695

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P  V + VKPT+LVFKNVG++ +YTVTFV+ KG    + + FGS+ W N Q+QV+SPIA
Sbjct  696  GPQMVRIAVKPTRLVFKNVGEKQKYTVTFVANKGADKTARSEFGSIVWQNPQHQVKSPIA  755

Query  128  FSWTQLF  108
            F+WTQL 
Sbjct  756  FAWTQLI  762



>ref|XP_007204263.1| hypothetical protein PRUPE_ppa001798mg [Prunus persica]
 gb|EMJ05462.1| hypothetical protein PRUPE_ppa001798mg [Prunus persica]
Length=763

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
            + +QAIVK PN+TC++K S+P QL YPSF V+FG  R+VR +RELTNVGAAG++Y VA  
Sbjct  636  EHVQAIVKKPNVTCSRKYSDPGQLNYPSFSVVFGNKRVVRYSRELTNVGAAGSIYRVAVT  695

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P  V + VKPT+LVFKNVG++ +YTVTFV+ KG    + + FGS+ W N Q+QV+SPIA
Sbjct  696  GPQMVRIAVKPTRLVFKNVGEKQKYTVTFVANKGADKTARSEFGSIVWANPQHQVKSPIA  755

Query  128  FSWTQLF  108
            F+WTQL 
Sbjct  756  FAWTQLI  762



>ref|XP_010090170.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB38967.1| Subtilisin-like protease [Morus notabilis]
Length=761

 Score =   167 bits (422),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
              IQ IVK  N TC+KK S+P  L YPSF VLF   R+VR TR LTNVGAA ++Y VA  
Sbjct  636  DHIQTIVKHRNFTCSKKFSDPGALNYPSFSVLFANKRVVRYTRRLTNVGAAASVYTVAVN  695

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            APP+V VTVKP KL FK+VG+RLRYTVTFV+ +G    S + FGS+ W+NA++QVRSP A
Sbjct  696  APPTVKVTVKPAKLAFKSVGERLRYTVTFVASRGAARTSRSEFGSIVWSNAEHQVRSPAA  755

Query  128  FSWTQL  111
            F+WTQL
Sbjct  756  FAWTQL  761



>dbj|BAD94244.1| serine protease like protein [Arabidopsis thaliana]
Length=334

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
              I AIVK P++ C+KK S+P QL YPSF VLFG  R+VR TR++TNVGAA ++Y+V   
Sbjct  209  DHIVAIVKRPSVNCSKKFSDPGQLNYPSFSVLFGGKRVVRYTRKVTNVGAASSVYKVTVN  268

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
              PSV ++VKP+KL FK+VG++ RYTVTFVSKKGV   + A FGS++W+N Q++VRSP+A
Sbjct  269  GAPSVGISVKPSKLSFKSVGEKKRYTVTFVSKKGVSMTNKAEFGSITWSNPQHEVRSPVA  328

Query  128  FSWTQL  111
            FSW + 
Sbjct  329  FSWNRF  334



>gb|KDO73903.1| hypothetical protein CISIN_1g004261mg [Citrus sinensis]
Length=765

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
            + +QAIVK PNITC +K + P +L YPSF VLFG  R+VR TRELTNVG A +LY V  +
Sbjct  638  EHVQAIVKRPNITCTRKFNTPGELNYPSFSVLFGDQRVVRYTRELTNVGPARSLYNVTAD  697

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P +V ++V+P +L+F+ VG++ RYTVTFV+K G      AAFGS+ W NAQ+QVRSP+A
Sbjct  698  GPSTVGISVRPKRLLFRTVGEKKRYTVTFVAKNGDQKMGGAAFGSIVWGNAQHQVRSPVA  757

Query  128  FSWTQLF  108
            FSWTQL 
Sbjct  758  FSWTQLM  764



>ref|XP_010049348.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW81893.1| hypothetical protein EUGRSUZ_C03260 [Eucalyptus grandis]
Length=778

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
              ++ IVK PN+TC++K S+P +L YPSF V+F   ++VR TRELTNVGAAG++Y V+  
Sbjct  651  DHVKTIVKRPNVTCSRKFSDPGELNYPSFSVVFNDKKVVRYTRELTNVGAAGSMYNVSVT  710

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P +V VTVKP KL+F  VGD++RYTVTFVSKKG    + + FGS+ W+NAQN+VRSP+A
Sbjct  711  GPSTVGVTVKPMKLIFPKVGDKMRYTVTFVSKKGTNPTTRSEFGSIVWSNAQNKVRSPVA  770

Query  128  FSWTQL  111
            ++WT+L
Sbjct  771  YAWTKL  776



>ref|XP_006452813.1| hypothetical protein CICLE_v10007510mg [Citrus clementina]
 gb|ESR66053.1| hypothetical protein CICLE_v10007510mg [Citrus clementina]
Length=784

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
            + +QAIVK PNITC +K + P +L YPSF VLFG  R+VR TRELTNVG A +LY V  +
Sbjct  657  EHVQAIVKRPNITCTRKFNTPGELNYPSFSVLFGDQRVVRYTRELTNVGPARSLYNVTAD  716

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P +V ++V+P +L+F+ VG++ RYTVTFV+K G      AAFGS+ W NAQ+QVRSP+A
Sbjct  717  GPSTVGISVRPKRLLFRTVGEKKRYTVTFVAKNGDQKMGGAAFGSIVWGNAQHQVRSPVA  776

Query  128  FSWTQLF  108
            FSWTQL 
Sbjct  777  FSWTQLM  783



>ref|XP_009590702.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=778

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 99/125 (79%), Gaps = 4/125 (3%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFG--KSRIVRQTRELTNVGAAGTLYEVA  315
             QIQAIVK  N TCA K ++  Q+ YPSF VLFG   +R+VR TRE+TNVGAAG++YEVA
Sbjct  651  DQIQAIVKRVNFTCANKFADAGQINYPSFSVLFGVNSTRVVRYTREVTNVGAAGSVYEVA  710

Query  314  XEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSP  135
             + P SVTVTVKP KLVFK VG++L YTVTFVSKKG+ T +  AFG +SW NA+NQVRSP
Sbjct  711  IDGPSSVTVTVKPPKLVFKKVGEKLHYTVTFVSKKGIKTGN--AFGWISWKNAENQVRSP  768

Query  134  IAFSW  120
            +A+SW
Sbjct  769  VAYSW  773



>gb|EYU25845.1| hypothetical protein MIMGU_mgv1a013289mg [Erythranthe guttata]
Length=225

 Score =   156 bits (394),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 94/130 (72%), Gaps = 6/130 (5%)
 Frame = -3

Query  488  QQIQAIVKAPNITCA--KKLSNPAQLXYPSFXVLFG----KSRIVRQTRELTNVGAAGTL  327
              +Q I + PN TC+  ++  +P QL YPSF V+FG     SR+VR TRELTNVG AG+ 
Sbjct  93   DAVQLIARRPNATCSSSRRFRDPGQLNYPSFSVVFGGGKKNSRVVRYTRELTNVGPAGSA  152

Query  326  YEVAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQ  147
            Y    EAPP+V  TVKP+KLVF NVGD+LRYTVTFVSKK V     + FGS++W NAQ+Q
Sbjct  153  YVAEIEAPPTVVATVKPSKLVFGNVGDKLRYTVTFVSKKDVDYSLTSGFGSITWKNAQHQ  212

Query  146  VRSPIAFSWT  117
            VRSP++FSWT
Sbjct  213  VRSPVSFSWT  222



>ref|XP_006474722.1| PREDICTED: subtilisin-like protease-like isoform X1 [Citrus sinensis]
 ref|XP_006474723.1| PREDICTED: subtilisin-like protease-like isoform X2 [Citrus sinensis]
Length=765

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
            + ++AIVK PNITC +K + P +L YPSF VLFG  R+VR TRELTNVG A +LY V  +
Sbjct  638  EHVKAIVKRPNITCTRKFNTPGELNYPSFSVLFGDQRVVRYTRELTNVGPARSLYNVTVD  697

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P +V ++V+P +L+F+ VG++ RYTVTFV+K G      AAFGS+ W NAQ+QVRSP+A
Sbjct  698  GPSTVGISVRPKRLLFRTVGEKKRYTVTFVAKNGDQKMGGAAFGSIVWGNAQHQVRSPVA  757

Query  128  FSWTQLF  108
            FSWTQL 
Sbjct  758  FSWTQLM  764



>ref|XP_009767539.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=761

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 98/125 (78%), Gaps = 4/125 (3%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFG--KSRIVRQTRELTNVGAAGTLYEVA  315
             QIQAIVK  N TCA K ++  Q+ YPSF VLFG   +R+VR TRE+TNVGAA ++YEVA
Sbjct  634  DQIQAIVKRVNFTCANKFADAGQINYPSFSVLFGINSTRVVRYTREVTNVGAAESVYEVA  693

Query  314  XEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSP  135
             +AP SVT TVKP KLVFK VG++L YTVTFVSKKGV T +  AFG +SW NA+NQVRSP
Sbjct  694  IDAPSSVTATVKPPKLVFKKVGEKLHYTVTFVSKKGVKTGN--AFGWISWENAENQVRSP  751

Query  134  IAFSW  120
            +AFSW
Sbjct  752  VAFSW  756



>emb|CDY18042.1| BnaC07g04280D [Brassica napus]
Length=737

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
              I AIVK P++ C+ K SNP QL YPSF VLFG  R+VR TRE+TNVGAA ++Y+V   
Sbjct  612  DHIVAIVKRPSVNCSNKFSNPGQLNYPSFSVLFGGKRVVRYTREVTNVGAANSVYKVVVN  671

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
              PSV ++VKP+KL F++VG++ RYTVTFVSKKGV   + A FGS++W+N Q+QVRSP+A
Sbjct  672  GAPSVGISVKPSKLAFRSVGEKKRYTVTFVSKKGVSLTNKAEFGSITWSNPQHQVRSPVA  731

Query  128  FSWTQL  111
            FSW + 
Sbjct  732  FSWNRF  737



>ref|XP_004488082.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=774

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 95/127 (75%), Gaps = 1/127 (1%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
            +QIQ IVK P++ C  K +NP QL YPSF ++F   R+VR TR LTNVG AG++Y V  +
Sbjct  648  EQIQLIVKRPDVNCTNKFANPGQLNYPSFSIMFSSKRVVRYTRILTNVGEAGSVYNVVVD  707

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPS-NAAFGSVSWNNAQNQVRSPI  132
             P  V +TVKP++LVF+ VGDR RYTVTFVSKKGV T S    FGS+ W+N Q+QVRSPI
Sbjct  708  GPSWVDITVKPSRLVFEKVGDRKRYTVTFVSKKGVDTSSVRNGFGSILWSNTQHQVRSPI  767

Query  131  AFSWTQL  111
            AF+WT+L
Sbjct  768  AFAWTEL  774



>ref|XP_006356658.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=768

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 99/125 (79%), Gaps = 4/125 (3%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLF--GKSRIVRQTRELTNVGAAGTLYEVA  315
             QIQ+IVK  N TCA K ++  Q+ YPSF VLF     R+VR TRE+TNVGAA ++YEVA
Sbjct  637  DQIQSIVKRLNFTCANKFADAGQINYPSFSVLFEINSKRVVRYTREVTNVGAASSVYEVA  696

Query  314  XEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSP  135
             +APPSVTVTVKPTKLVFK VG++L YTVTFVSKK  V P N AFG +SWNNA+++VRSP
Sbjct  697  TDAPPSVTVTVKPTKLVFKKVGEKLHYTVTFVSKKD-VKPGN-AFGWISWNNAKHEVRSP  754

Query  134  IAFSW  120
            +A+SW
Sbjct  755  VAYSW  759



>ref|XP_010051409.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=791

 Score =   162 bits (411),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 72/124 (58%), Positives = 98/124 (79%), Gaps = 0/124 (0%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEA  306
             ++AIVK PN+TC++K S+P +L YPSF V+F   ++VR TRELTNVGAAG++Y V+   
Sbjct  651  HVKAIVKRPNVTCSRKFSDPGELNYPSFSVVFNDKKVVRYTRELTNVGAAGSMYNVSVTG  710

Query  305  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAF  126
            P +V VTVKP KL+F  VGD++RYTVTFVSKKG    + + FGS+ W+NAQN+VRSP+A+
Sbjct  711  PSTVGVTVKPMKLIFPKVGDKMRYTVTFVSKKGTNPTTRSEFGSIVWSNAQNKVRSPVAY  770

Query  125  SWTQ  114
            +WT+
Sbjct  771  AWTK  774



>gb|KCW81959.1| hypothetical protein EUGRSUZ_C03325 [Eucalyptus grandis]
Length=840

 Score =   163 bits (412),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 72/124 (58%), Positives = 98/124 (79%), Gaps = 0/124 (0%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEA  306
             ++AIVK PN+TC++K S+P +L YPSF V+F   ++VR TRELTNVGAAG++Y V+   
Sbjct  651  HVKAIVKRPNVTCSRKFSDPGELNYPSFSVVFNDKKVVRYTRELTNVGAAGSMYNVSVTG  710

Query  305  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAF  126
            P +V VTVKP KL+F  VGD++RYTVTFVSKKG    + + FGS+ W+NAQN+VRSP+A+
Sbjct  711  PSTVGVTVKPMKLIFPKVGDKMRYTVTFVSKKGTNPTTRSEFGSIVWSNAQNKVRSPVAY  770

Query  125  SWTQ  114
            +WT+
Sbjct  771  AWTK  774



>ref|XP_010042589.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=781

 Score =   162 bits (410),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 72/125 (58%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEA  306
             ++ IVK PN+TC++K S+P +L YPSF V+F   ++VR TRELTNVGAAG++Y V+   
Sbjct  655  HVKTIVKRPNVTCSRKFSDPGELNYPSFSVVFNDKKVVRYTRELTNVGAAGSMYNVSVTG  714

Query  305  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAF  126
            P +V VTVKP KL+F  VGD++RYTVTFVSKKG    + + FGS+ W+NAQN+VRSP+A+
Sbjct  715  PSTVGVTVKPMKLIFPKVGDKMRYTVTFVSKKGTNPTTRSEFGSIVWSNAQNKVRSPVAY  774

Query  125  SWTQL  111
            +WT+L
Sbjct  775  AWTKL  779



>emb|CDY33400.1| BnaA07g04390D [Brassica napus]
Length=751

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
              I AIVK P++ C+KK SNP QL YPSF VLFG  R+VR TRE+TNVGA  ++Y+V   
Sbjct  626  DHIVAIVKRPSVNCSKKFSNPGQLNYPSFSVLFGGKRVVRYTREVTNVGAPNSVYKVVVN  685

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
              PSV ++VKP+KL F++VG++ RYTVTFVSKKGV   + A FGS++W+N Q+QVRSP+A
Sbjct  686  GAPSVGISVKPSKLSFRSVGEKKRYTVTFVSKKGVSLTNKAEFGSITWSNPQHQVRSPVA  745

Query  128  FSWTQL  111
            FSW + 
Sbjct  746  FSWNRF  751



>gb|KGN66306.1| hypothetical protein Csa_1G597040 [Cucumis sativus]
Length=566

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
              +QAIVK  NITC++K ++P QL YPSF V+FG  R+VR TR +TNVGAAG++Y+VA  
Sbjct  441  DHVQAIVKRSNITCSRKFADPGQLNYPSFSVVFGSKRVVRYTRIVTNVGAAGSVYDVATT  500

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            APP V VTVKP+KLVF  VG+R RYTVTFV+ +     +   FGS+ W+N Q+QVRSP++
Sbjct  501  APPVVKVTVKPSKLVFTKVGERKRYTVTFVASRDAAQTTRFGFGSIVWSNDQHQVRSPVS  560

Query  128  FSWTQL  111
            F+WT+L
Sbjct  561  FAWTRL  566



>ref|XP_009102354.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=763

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
              I AIVK P++ C+KK SNP QL YPSF VLFG  R+VR TRE+TNVGA  ++Y+V   
Sbjct  638  DHIVAIVKRPSVNCSKKFSNPGQLNYPSFSVLFGGKRVVRYTREVTNVGAPNSVYKVVVN  697

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
              PSV ++VKP+KL F++VG++ RYTVTFVSKKGV   + A FGS++W+N Q+QVRSP+A
Sbjct  698  GAPSVGISVKPSKLSFRSVGEKKRYTVTFVSKKGVSLTNKAEFGSITWSNPQHQVRSPVA  757

Query  128  FSWTQL  111
            FSW + 
Sbjct  758  FSWNRF  763



>ref|XP_004144036.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004166699.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=763

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
              +QAIVK  NITC++K ++P QL YPSF V+FG  R+VR TR +TNVGAAG++Y+VA  
Sbjct  638  DHVQAIVKRSNITCSRKFADPGQLNYPSFSVVFGSKRVVRYTRIVTNVGAAGSVYDVATT  697

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            APP V VTVKP+KLVF  VG+R RYTVTFV+ +     +   FGS+ W+N Q+QVRSP++
Sbjct  698  APPVVKVTVKPSKLVFTKVGERKRYTVTFVASRDAAQTTRFGFGSIVWSNDQHQVRSPVS  757

Query  128  FSWTQL  111
            F+WT+L
Sbjct  758  FAWTRL  763



>ref|XP_006396129.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
 gb|ESQ36908.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
Length=762

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
              I AIVK P++ C KK SNP QL YPSF VLFG  R+VR TRE+TNVGAA  +Y+V   
Sbjct  637  DHIVAIVKRPSVNCLKKFSNPGQLNYPSFSVLFGGKRVVRYTREVTNVGAANAVYKVVVS  696

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
              PSV ++VKP+KL F+ VG++ RYTVTFVSKKGV   + A +GS++W N Q++VRSP+A
Sbjct  697  GAPSVGISVKPSKLAFRKVGEKKRYTVTFVSKKGVSLTNKAEYGSITWTNTQHEVRSPVA  756

Query  128  FSWTQL  111
            FSW + 
Sbjct  757  FSWNRF  762



>ref|XP_003595292.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES65543.1| subtilisin-like serine protease [Medicago truncatula]
Length=779

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 97/128 (76%), Gaps = 1/128 (1%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
            +QIQ IVK P++ C KK +NP QL YPSF V+F   R+VR TR +TNVG AG++Y V  +
Sbjct  651  EQIQLIVKRPSVNCTKKFANPGQLNYPSFSVVFSSKRVVRYTRIVTNVGEAGSVYNVVVD  710

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGV-VTPSNAAFGSVSWNNAQNQVRSPI  132
             P SV +TVKP++LVF+ VG+R RYTVTFVSKKG   +   + FGS+ W+NAQ+QVRSPI
Sbjct  711  VPSSVGITVKPSRLVFEKVGERKRYTVTFVSKKGADASKVRSGFGSILWSNAQHQVRSPI  770

Query  131  AFSWTQLF  108
            AF+WT+L 
Sbjct  771  AFAWTELL  778



>ref|XP_002278292.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=761

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 99/129 (77%), Gaps = 3/129 (2%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
            + ++AIVK  NITC++K S+P +L YPSF VLFG    VR TRELTNVGAA ++Y+VA  
Sbjct  633  EHVRAIVKRQNITCSRKFSDPGELNYPSFSVLFGSKGFVRYTRELTNVGAADSVYQVAVT  692

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTP---SNAAFGSVSWNNAQNQVRS  138
             PPSV V V+P+ LVFKNVG++ RYTVTFV+KKG       + +AFGS+ W+N Q+QV+S
Sbjct  693  GPPSVGVVVRPSTLVFKNVGEKKRYTVTFVAKKGKKVQNRMTRSAFGSIVWSNTQHQVKS  752

Query  137  PIAFSWTQL  111
            P+A++WTQL
Sbjct  753  PVAYAWTQL  761



>ref|NP_565330.1| Subtilase-like protein [Arabidopsis thaliana]
 gb|AAC95169.1| subtilisin-like serine protease, putative [Arabidopsis thaliana]
 gb|AAK59595.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AAN13182.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEC05985.1| Subtilase-like protein [Arabidopsis thaliana]
Length=754

 Score =   160 bits (404),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 74/125 (59%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEA  306
             I AIVK P++ C+KK S+P QL YPSF VLFG  R+VR TRE+TNVGAA ++Y+V    
Sbjct  630  HIVAIVKRPSVNCSKKFSDPGQLNYPSFSVLFGGKRVVRYTREVTNVGAASSVYKVTVNG  689

Query  305  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAF  126
             PSV ++VKP+KL FK+VG++ RYTVTFVSKKGV   + A FGS++W+N Q++VRSP+AF
Sbjct  690  APSVGISVKPSKLSFKSVGEKKRYTVTFVSKKGVSMTNKAEFGSITWSNPQHEVRSPVAF  749

Query  125  SWTQL  111
            SW + 
Sbjct  750  SWNRF  754



>ref|XP_010412797.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=754

 Score =   160 bits (404),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 75/125 (60%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEA  306
             I AIVK P++ C+KK S+P QL YPSF VLFG  R+VR TRE+TNVGAA ++Y+V    
Sbjct  630  HIVAIVKRPSVNCSKKFSDPGQLNYPSFSVLFGGKRVVRYTREVTNVGAASSVYKVMVNG  689

Query  305  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAF  126
             PSV ++VKPTKL FK VG++ RYTVTFVSKKGV   + A FGS++W N Q++VRSP+AF
Sbjct  690  APSVGISVKPTKLAFKRVGEKKRYTVTFVSKKGVSMTNKAEFGSITWINPQHEVRSPVAF  749

Query  125  SWTQL  111
            SW + 
Sbjct  750  SWNRF  754



>gb|KHN12283.1| Subtilisin-like protease, partial [Glycine soja]
Length=438

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
            ++IQ I K   + C K+ S+P QL YPSF VLFG  R+VR TR LTNVG AG++Y V  +
Sbjct  313  ERIQLITKRSGVNCTKRFSDPGQLNYPSFSVLFGGKRVVRYTRVLTNVGEAGSVYNVTVD  372

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            AP +VTVTVKP  LVF  VG+R RYT TFVSK GV       FGS+ W+NAQ+QVRSP+A
Sbjct  373  APSTVTVTVKPVALVFGKVGERQRYTATFVSKNGVGDSVRYGFGSILWSNAQHQVRSPVA  432

Query  128  FSWTQL  111
            FSWT L
Sbjct  433  FSWTLL  438



>ref|XP_010557668.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557669.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557670.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557671.1| PREDICTED: subtilisin-like protease isoform X2 [Tarenaya hassleriana]
Length=772

 Score =   159 bits (402),  Expect = 5e-42, Method: Composition-based stats.
 Identities = 71/125 (57%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEA  306
             IQAIVK P++ C++K S+P QL YPSF VLFG  R+ R TRELTNVG  G++Y+VA + 
Sbjct  648  HIQAIVKRPSVNCSRKFSDPGQLNYPSFSVLFGDKRVARYTRELTNVGTPGSIYKVAVDG  707

Query  305  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAF  126
            P SV VTVKPT+LVF  VG++ RYTVTF +K+G+   +++ FGS++W+N+++ VRSP+ F
Sbjct  708  PASVAVTVKPTRLVFGAVGEKKRYTVTFSAKRGMSLATSSEFGSITWSNSEHSVRSPVVF  767

Query  125  SWTQL  111
            SWT+L
Sbjct  768  SWTRL  772



>ref|XP_010488783.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=755

 Score =   159 bits (401),  Expect = 5e-42, Method: Composition-based stats.
 Identities = 75/125 (60%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEA  306
             I AIVK P++ C+KK S+P QL YPSF VLFG  R+VR TRE+TNVGAA ++Y+V    
Sbjct  631  HIVAIVKRPSVNCSKKFSDPGQLNYPSFSVLFGGKRVVRYTREVTNVGAASSVYKVMVNG  690

Query  305  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAF  126
             PSV V+VKP KL FK+VG++ RYTVTFVSKKGV   + A FGS++W N Q++VRSP+AF
Sbjct  691  APSVGVSVKPLKLAFKSVGEKKRYTVTFVSKKGVSMTNKAEFGSITWINPQHEVRSPVAF  750

Query  125  SWTQL  111
            SW + 
Sbjct  751  SWNRF  755



>ref|XP_010666857.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=776

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 99/125 (79%), Gaps = 1/125 (1%)
 Frame = -3

Query  479  QAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEAPP  300
            Q I K PNITC++KLS+P QL YPSF + FGKSRIVR TRELTNVGAA TLY+V  +AP 
Sbjct  651  QIIAKRPNITCSRKLSDPGQLNYPSFSIQFGKSRIVRYTRELTNVGAARTLYQVQVDAPR  710

Query  299  SVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVV-TPSNAAFGSVSWNNAQNQVRSPIAFS  123
            SV V V+P++L+F+++G++ +YTVTFV++KG    P+  AFGS+ W++  NQVRSP++F+
Sbjct  711  SVGVKVRPSRLLFRSIGEKKKYTVTFVARKGKTPPPTRTAFGSLLWSSKTNQVRSPVSFT  770

Query  122  WTQLF  108
            WT L 
Sbjct  771  WTTLL  775



>gb|KHN06066.1| Subtilisin-like protease [Glycine soja]
Length=598

 Score =   157 bits (397),  Expect = 8e-42, Method: Composition-based stats.
 Identities = 72/126 (57%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
            + IQ I K   + C KK S+P QL YPSF +LFG  R+VR TR L NVG  G++Y V  +
Sbjct  473  EHIQLITKRHGVNCTKKFSDPGQLNYPSFSILFGGKRVVRYTRVLINVGETGSIYNVTVD  532

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            AP ++T+ VKPT+LVF+ VG+R RYTVTFVSK+GV   +   FGS+ W+NAQ+QVRSP+A
Sbjct  533  APSTMTIKVKPTRLVFEKVGERQRYTVTFVSKRGVGDSARYGFGSIMWSNAQHQVRSPVA  592

Query  128  FSWTQL  111
            FSWT L
Sbjct  593  FSWTLL  598



>ref|XP_010467108.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=756

 Score =   158 bits (400),  Expect = 8e-42, Method: Composition-based stats.
 Identities = 74/125 (59%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEA  306
             I AIVK P++ C+KK S+P QL YPSF VLFG  R+VR TRE+TNVGAA ++Y+V    
Sbjct  632  HIVAIVKRPSVNCSKKFSDPGQLNYPSFSVLFGGKRVVRYTREVTNVGAASSVYKVMVNG  691

Query  305  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAF  126
             PSV ++VKP KL FK+VG++ RYTVTFVSKKGV   + A FGS++W N Q++VRSP+AF
Sbjct  692  APSVGISVKPLKLAFKSVGEKKRYTVTFVSKKGVSMTNKAEFGSITWINPQHEVRSPVAF  751

Query  125  SWTQL  111
            SW + 
Sbjct  752  SWNRF  756



>ref|XP_003533787.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=770

 Score =   158 bits (400),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
            ++IQ I K   + C K+ S+P QL YPSF VLFG  R+VR TR LTNVG AG++Y V  +
Sbjct  645  ERIQLITKRSGVNCTKRFSDPGQLNYPSFSVLFGGKRVVRYTRVLTNVGEAGSVYNVTVD  704

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            AP +VTVTVKP  LVF  VG+R RYT TFVSK GV       FGS+ W+NAQ+QVRSP+A
Sbjct  705  APSTVTVTVKPAALVFGKVGERQRYTATFVSKNGVGDSVRYGFGSIMWSNAQHQVRSPVA  764

Query  128  FSWTQL  111
            FSWT L
Sbjct  765  FSWTLL  770



>ref|XP_002885806.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62065.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=752

 Score =   158 bits (399),  Expect = 9e-42, Method: Composition-based stats.
 Identities = 72/125 (58%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEA  306
             I AIVK P++ C+KK S+P QL YPSF VLFG  R+VR TRE+TNVGA  ++Y+V    
Sbjct  628  HIVAIVKRPSVNCSKKFSDPGQLNYPSFSVLFGGKRVVRYTREVTNVGAENSVYKVTVNG  687

Query  305  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAF  126
             PSV ++VKP+KL F++VG++ RYTVTFVSKKGV   + A FGS++W+N Q++VRSP+AF
Sbjct  688  APSVAISVKPSKLAFRSVGEKKRYTVTFVSKKGVSMTNKAEFGSITWSNPQHEVRSPVAF  747

Query  125  SWTQL  111
            SW + 
Sbjct  748  SWNRF  752



>ref|XP_004245414.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=768

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 98/125 (78%), Gaps = 4/125 (3%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLF--GKSRIVRQTRELTNVGAAGTLYEVA  315
             QIQ+IV+  N TCAKK ++  Q+ YPSF VLF     R+VR TRE+TNVGAA ++YEVA
Sbjct  637  DQIQSIVRRLNFTCAKKFADVGQINYPSFSVLFEINSKRVVRYTREVTNVGAASSVYEVA  696

Query  314  XEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSP  135
             +APPSVTVTVKPTKLVFK VG++L YTVTFVS K  V P N AFG +SW NA+++VRSP
Sbjct  697  IDAPPSVTVTVKPTKLVFKKVGEKLHYTVTFVSMKD-VKPGN-AFGWISWKNAKHEVRSP  754

Query  134  IAFSW  120
            +A+SW
Sbjct  755  VAYSW  759



>ref|XP_008450936.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=765

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
              +QAIVK  NITC++K ++P QL YPSF V+FG  R+VR TR +TNVGAAG++Y+VA  
Sbjct  640  DHVQAIVKRSNITCSRKFADPGQLNYPSFSVVFGSKRVVRYTRIVTNVGAAGSVYDVATT  699

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            AP  V VTVKP+KLVF  VG+R RYTVTFV+ +     +   FGS+ W+N Q+QVRSP++
Sbjct  700  APSVVKVTVKPSKLVFTKVGERKRYTVTFVASRDAAQTTRFGFGSIVWSNDQHQVRSPVS  759

Query  128  FSWTQL  111
            F+WT+L
Sbjct  760  FAWTRL  765



>ref|XP_006297042.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
 gb|EOA29940.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
Length=757

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
              I AIVK  ++ C KK S+P QL YPSF VLFG  R+VR TRE+TNVGAA ++Y+V   
Sbjct  632  DHIVAIVKRSSVNCTKKFSDPGQLNYPSFSVLFGGKRVVRYTREVTNVGAANSVYKVMVN  691

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
              P+V ++VKP+KL FK VG++ RYTVTFVSKKGV   + A FGS++W N Q++VRSP+A
Sbjct  692  GAPTVEISVKPSKLTFKRVGEKKRYTVTFVSKKGVSMTNKAEFGSITWINPQHEVRSPVA  751

Query  128  FSWTQL  111
            FSW + 
Sbjct  752  FSWNRF  757



>ref|XP_009359724.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 96/129 (74%), Gaps = 2/129 (2%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLF--GKSRIVRQTRELTNVGAAGTLYEVA  315
            + +QAIVK PN+TCA+K S+P QL YPSF V+F   K R+V  TRELTNVG AG++Y VA
Sbjct  635  EHVQAIVKRPNVTCARKYSDPGQLNYPSFSVMFWNKKKRVVSYTRELTNVGPAGSVYRVA  694

Query  314  XEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSP  135
              +P  V   VKPT+LVF NVG++ +YTVTFV+ +G    S + FGS+ W+N Q+QV+SP
Sbjct  695  VTSPSMVRTIVKPTRLVFNNVGEKQKYTVTFVASQGAEKTSRSEFGSIMWSNPQHQVKSP  754

Query  134  IAFSWTQLF  108
            +AF+WTQL 
Sbjct  755  VAFAWTQLI  763



>ref|XP_008388846.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 95/129 (74%), Gaps = 2/129 (2%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFG--KSRIVRQTRELTNVGAAGTLYEVA  315
            + +QAIVK PN+TCA+K S+P QL YPSF ++FG    R+VR TRELTNVGAAG++Y  +
Sbjct  635  EHVQAIVKRPNVTCARKYSDPGQLNYPSFSIVFGSKNKRVVRYTRELTNVGAAGSVYRAS  694

Query  314  XEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSP  135
              +P +V   VKPT+LVF NVG++ +YTVTFV+  G    + + FGS+ W N Q+QV+SP
Sbjct  695  VTSPSTVRTIVKPTRLVFNNVGEKQKYTVTFVALPGAXKTARSEFGSIVWANPQHQVKSP  754

Query  134  IAFSWTQLF  108
            + F+WTQL 
Sbjct  755  VTFAWTQLI  763



>gb|AHA84190.1| subtilisin-like protease [Phaseolus vulgaris]
Length=760

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
            + IQ IVK   + C +K S+P QL YPSF + FG  R+VR TR LTNVG AG++Y+V  +
Sbjct  635  EHIQLIVKRHAVNCTRKFSDPGQLNYPSFSIHFGGKRVVRYTRTLTNVGEAGSVYDVTVD  694

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            AP +V VTV+P +LVF  +G+R RYTVTFVSKK         FGS+ W+NAQ+QVRSP+A
Sbjct  695  APSTVEVTVRPARLVFGKLGERKRYTVTFVSKKSGGDSGRYGFGSIMWSNAQHQVRSPVA  754

Query  128  FSWTQL  111
            FSWT L
Sbjct  755  FSWTLL  760



>ref|XP_008337844.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 95/129 (74%), Gaps = 2/129 (2%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLF--GKSRIVRQTRELTNVGAAGTLYEVA  315
            + +QAIVK PN+TCA+K S+P QL YPSF V+F   K R+V  TRELTNVG AG++Y VA
Sbjct  635  EHVQAIVKRPNVTCARKYSDPGQLNYPSFSVVFWNKKKRVVSYTRELTNVGPAGSVYRVA  694

Query  314  XEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSP  135
              +P  V   VKPT+LVF NVG++ +Y VTFV+ +G    S + FGS+ W+N Q+QV+SP
Sbjct  695  VTSPSMVRTIVKPTRLVFNNVGEKQKYRVTFVASRGAEKTSRSEFGSIMWSNPQHQVKSP  754

Query  134  IAFSWTQLF  108
            +AF+WTQL 
Sbjct  755  VAFAWTQLI  763



>gb|EYU25847.1| hypothetical protein MIMGU_mgv1a001711mg [Erythranthe guttata]
Length=770

 Score =   153 bits (386),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 93/130 (72%), Gaps = 6/130 (5%)
 Frame = -3

Query  488  QQIQAIVKAPNITCA--KKLSNPAQLXYPSFXVLFG----KSRIVRQTRELTNVGAAGTL  327
              +Q I + PN TC+  ++  +P QL YPSF V+FG     SR+VR TRELTNVG AG+ 
Sbjct  638  DAVQLIARRPNATCSSSRRFRDPGQLNYPSFSVVFGGGKKNSRVVRYTRELTNVGPAGSA  697

Query  326  YEVAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQ  147
            Y    E PP+V  TVKP+KLVF NVG++LRYTVTFVSKK V     + FGS++W NAQ+Q
Sbjct  698  YVAELEVPPTVGATVKPSKLVFGNVGEKLRYTVTFVSKKDVDYSLTSGFGSITWKNAQHQ  757

Query  146  VRSPIAFSWT  117
            VRSP++FSWT
Sbjct  758  VRSPVSFSWT  767



>ref|XP_007012625.1| Subtilase family protein [Theobroma cacao]
 gb|EOY30244.1| Subtilase family protein [Theobroma cacao]
Length=759

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
              ++ IVK PN+TC+ K  +P +L YPSF VLFG  R+VR TRELTNVG + ++Y+V   
Sbjct  634  DHVKTIVKRPNVTCSTKFKDPGELNYPSFSVLFGDKRVVRYTRELTNVGPSRSIYKVTVN  693

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P +V ++V+PT L+F++ G++ RYTVTFV+K+G    + + FGS+ W+NAQNQV+SP++
Sbjct  694  GPSTVGISVRPTTLIFRSAGEKKRYTVTFVAKRGTSPMARSEFGSIVWSNAQNQVKSPVS  753

Query  128  FSWTQL  111
            FSWT L
Sbjct  754  FSWTLL  759



>gb|KFK39884.1| hypothetical protein AALP_AA3G301200 [Arabis alpina]
Length=754

 Score =   152 bits (385),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 70/125 (56%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEA  306
             I AIVK P++ C+KK ++P QL YPSF V+FG  R+VR TRE+TNVGAA ++Y+V    
Sbjct  630  HIVAIVKRPSVNCSKKFADPGQLNYPSFSVVFGGKRVVRYTREVTNVGAASSVYKVTVNG  689

Query  305  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAF  126
              SV ++VKP KL F+ VG++ RYTVTFVSKKGV   + A FGS++W+N Q++VRSP+AF
Sbjct  690  AASVGISVKPAKLAFRRVGEKKRYTVTFVSKKGVSLTNKAEFGSITWSNPQHEVRSPVAF  749

Query  125  SWTQL  111
            SW + 
Sbjct  750  SWNRF  754



>ref|XP_008792868.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=766

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 95/125 (76%), Gaps = 3/125 (2%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKS--RIVRQTRELTNVGAAGTLYEVA  315
              I AI ++PN TC+++LS+P  L YPSF V+FG+   RIVR +RELTNVG +G++Y + 
Sbjct  641  NHILAISQSPNTTCSRRLSDPGNLNYPSFSVIFGRKSRRIVRYSRELTNVGLSGSVYNLT  700

Query  314  XEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSP  135
               PPSV+VTV+PTKLVFK VG++L+YTVTF SKK    P++ AFG +SW N Q+QVRSP
Sbjct  701  YSGPPSVSVTVRPTKLVFKQVGEKLKYTVTFTSKK-QGNPTDMAFGWISWKNEQHQVRSP  759

Query  134  IAFSW  120
            I++ W
Sbjct  760  ISYMW  764



>gb|KHG16003.1| Subtilisin-like protease [Gossypium arboreum]
Length=760

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
              ++ IVK PN+TC+KK  +P +L YPSF V+FG  R+VR TRELTNVG A ++Y+V   
Sbjct  635  DHVKTIVKRPNVTCSKKFKDPGELNYPSFSVMFGGKRVVRYTRELTNVGPARSMYKVTVN  694

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P +V ++V+P  L+F+ VG++ RYTVTFV+K+G    +   FGS+ W NAQNQV+SP++
Sbjct  695  GPSTVGISVRPKTLIFRTVGEKKRYTVTFVAKRGTSPMAKPEFGSIVWGNAQNQVKSPVS  754

Query  128  FSWTQL  111
            FSW+ +
Sbjct  755  FSWSLM  760



>gb|KJB82990.1| hypothetical protein B456_013G223900 [Gossypium raimondii]
Length=760

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
              ++ IVK PNITC+ K  +P +L YPSF VLFG  R+VR TRELTNVG A ++Y+V   
Sbjct  635  DHVKTIVKRPNITCSTKFKDPGELNYPSFSVLFGGKRVVRYTRELTNVGPARSIYKVTVN  694

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P +V ++V+P  L+F++VG++ RYTVTFV+K+G    +   FGS+ W NAQNQV+SP++
Sbjct  695  GPSTVGISVRPKTLIFRSVGEKKRYTVTFVAKRGTSPMAKPEFGSIVWGNAQNQVKSPVS  754

Query  128  FSWTQL  111
            FSW+ +
Sbjct  755  FSWSLM  760



>gb|EYU28325.1| hypothetical protein MIMGU_mgv1a001748mg [Erythranthe guttata]
Length=765

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
            + +Q + K PNITC+K+  +P QL YPSF V+F K+ +VR +RELTNVG AG  Y V+ +
Sbjct  640  EMVQIVAKHPNITCSKRFHDPGQLNYPSFSVMFRKTGVVRYSRELTNVGPAGLTYRVSVD  699

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            APP+V V+V P+ LVFKNVGD+ R+ VTFV KK V       FGS+ W+NA ++V SP+A
Sbjct  700  APPNVEVSVSPSTLVFKNVGDKRRFRVTFVWKKEVGPVVRHGFGSIVWSNALHRVSSPVA  759

Query  128  FSWTQL  111
            +SWTQL
Sbjct  760  YSWTQL  765



>ref|XP_007138654.1| hypothetical protein PHAVU_009G226900g [Phaseolus vulgaris]
 gb|ESW10648.1| hypothetical protein PHAVU_009G226900g [Phaseolus vulgaris]
Length=761

 Score =   149 bits (377),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 71/126 (56%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
            + IQ IVK   + C +K S+P QL YPSF + FG  R+VR TR LTNVG AG++Y+V  +
Sbjct  636  EHIQLIVKRHAVNCTRKFSDPGQLNYPSFSIHFGGKRVVRYTRTLTNVGEAGSVYDVTVD  695

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            AP +V VTV+P +LVF  +G+R RYTVTFVSKK         FGS+ W+NAQ+QVRSP+A
Sbjct  696  APSTVEVTVRPARLVFGKLGERKRYTVTFVSKKSGGDSGRYGFGSIMWSNAQHQVRSPVA  755

Query  128  FSWTQL  111
            FSWT L
Sbjct  756  FSWTLL  761



>ref|XP_008782639.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Phoenix 
dactylifera]
Length=772

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 95/125 (76%), Gaps = 3/125 (2%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKS--RIVRQTRELTNVGAAGTLYEVA  315
            Q IQ IVK PN+TC+++ SNP  L YPSF V+F K   ++V+  RELTNVG+AG++Y V 
Sbjct  647  QHIQVIVKRPNVTCSRRFSNPGDLNYPSFSVIFEKKSRKVVKYRRELTNVGSAGSVYSVK  706

Query  314  XEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSP  135
               P +++VTVKP KL+FK+VG +L+Y+V F SKKG   P NAAFG ++W+N Q++VRSP
Sbjct  707  ITGPENISVTVKPAKLIFKHVGQKLKYSVIFASKKG-GNPKNAAFGWITWSNKQHKVRSP  765

Query  134  IAFSW  120
            +A++W
Sbjct  766  VAYTW  770



>ref|XP_009337216.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 93/129 (72%), Gaps = 2/129 (2%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFG--KSRIVRQTRELTNVGAAGTLYEVA  315
            + +QAIVK PN+TC +K S+P QL YPSF + FG    R+VR TRELTNVGAAG++Y  +
Sbjct  635  EHVQAIVKRPNVTCERKYSDPGQLNYPSFSIAFGSKNKRVVRYTRELTNVGAAGSVYRAS  694

Query  314  XEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSP  135
              +P +V   VKPT+LVF NVG++ +YTVTF++  G    + + FGS+ W N Q+ V+SP
Sbjct  695  VTSPSTVRTVVKPTRLVFNNVGEKQKYTVTFMALPGAEKTARSEFGSIVWANPQHLVKSP  754

Query  134  IAFSWTQLF  108
            +AF+WTQL 
Sbjct  755  VAFAWTQLI  763



>ref|XP_010917484.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=767

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 93/125 (74%), Gaps = 3/125 (2%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKS--RIVRQTRELTNVGAAGTLYEVA  315
              IQAI ++PN TC++KLS+P  L YPSF V+FG    R VR +RELTNVG AG++Y + 
Sbjct  641  DHIQAISQSPNTTCSRKLSDPGNLNYPSFSVVFGGKSRRPVRYSRELTNVGLAGSVYNLT  700

Query  314  XEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSP  135
               PPSV+VTV+P KLVFK VG++L+YTV F SKK    P++ AFG +SWNN Q+QV+SP
Sbjct  701  YSGPPSVSVTVRPKKLVFKQVGEKLKYTVIFTSKK-EGNPTDVAFGWISWNNEQHQVQSP  759

Query  134  IAFSW  120
            I++ W
Sbjct  760  ISYMW  764



>gb|KJB27210.1| hypothetical protein B456_004G284900 [Gossypium raimondii]
Length=762

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 96/127 (76%), Gaps = 1/127 (1%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
             Q++ IVK PNITC+K+  +P +L YPSF VLFG  R+VR TRELTNVG A ++Y+VA +
Sbjct  636  DQVKTIVKRPNITCSKRFKDPGELNYPSFSVLFGDKRVVRYTRELTNVGPARSIYKVAVD  695

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSK-KGVVTPSNAAFGSVSWNNAQNQVRSPI  132
             P SV ++V+P  LVF+++G++ RYTV+FV+K K   +   + +GS+ W NAQ+QV+SP+
Sbjct  696  GPSSVGISVRPRTLVFRHIGEKKRYTVSFVAKRKRRGSTVRSEYGSIVWGNAQHQVKSPV  755

Query  131  AFSWTQL  111
            +FSWT L
Sbjct  756  SFSWTFL  762



>ref|XP_010273846.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=761

 Score =   144 bits (364),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 90/127 (71%), Gaps = 2/127 (2%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFG-KSRIVRQTRELTNVGAAGTLYEVAX  312
             Q++AI K  NITC+++ ++P +L YPSF VLFG K R+VR TRELTNVG  G++Y VA 
Sbjct  634  DQVKAITKRQNITCSRRFADPGELNYPSFSVLFGTKKRVVRYTRELTNVGPTGSVYNVAI  693

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVV-TPSNAAFGSVSWNNAQNQVRSP  135
              P SV VTVKPTKLVFK VG+  +YTVTFV+KKG+      A FG + W N Q QVRSP
Sbjct  694  GGPSSVGVTVKPTKLVFKEVGEMKKYTVTFVAKKGLSRMLGTAEFGWIVWRNEQYQVRSP  753

Query  134  IAFSWTQ  114
            +++ W  
Sbjct  754  VSYEWLH  760



>ref|XP_003541310.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=751

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
              ++ +VK P+  C+KK ++P  L YPSF V+FG +++VR TR LTNVG  G+ Y+VA  
Sbjct  626  DHLRLLVKHPDANCSKKFADPGDLNYPSFSVVFGSNKVVRYTRTLTNVGEPGSAYDVAVS  685

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            AP +V +TV P KL F  VG+R  YTVTFVS + V   + + FGS+ W+N Q+QVRSP+A
Sbjct  686  APSTVDITVNPNKLEFGEVGERQTYTVTFVSNRSVNDSATSGFGSIMWSNEQHQVRSPVA  745

Query  128  FSWT  117
            F+WT
Sbjct  746  FTWT  749



>ref|XP_004287641.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=765

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 88/126 (70%), Gaps = 1/126 (1%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
            QQ+Q+I K+ N+TCA+K S+P QL YPSF V+FG  R+VR TRELTNVG A +LY+V   
Sbjct  641  QQVQSIAKS-NVTCARKYSDPGQLNYPSFSVVFGNKRVVRYTRELTNVGTARSLYKVIVS  699

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             PP V   VKP+ L F  VG++ +YTVTFVS K     S A FGS+ W N  + V+SP+A
Sbjct  700  GPPGVRTIVKPSSLFFATVGEKKKYTVTFVSAKSGSRTSRAEFGSIVWANTLHLVKSPVA  759

Query  128  FSWTQL  111
            F+WT L
Sbjct  760  FAWTLL  765



>ref|XP_010541995.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=765

 Score =   142 bits (358),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 71/125 (57%), Positives = 98/125 (78%), Gaps = 1/125 (1%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEA  306
             IQAI+K PN+ C++K S+P QL YPSF VLF   R+VR TRELTNVGA G++Y+V  + 
Sbjct  642  HIQAIIKRPNVNCSRKFSDPGQLNYPSFSVLFRDKRVVRYTRELTNVGAPGSVYKVTVDV  701

Query  305  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAF  126
              SV+VTV+P +LVF+  G++ RYTVTF +K+G V+ + A FGS++W+N+Q+QVRSP+AF
Sbjct  702  SVSVSVTVRPKRLVFRTAGEKKRYTVTFSAKRG-VSGATAEFGSITWSNSQHQVRSPVAF  760

Query  125  SWTQL  111
            SWT+ 
Sbjct  761  SWTRF  765



>gb|EPS65938.1| hypothetical protein M569_08836, partial [Genlisea aurea]
Length=738

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 91/128 (71%), Gaps = 5/128 (4%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAG--TLYEVA  315
            + +Q IV   N TC++K ++P QL YPSF V+FGKSR+VR TRELTNV   G   +Y  +
Sbjct  611  EMLQMIVS--NATCSRKFADPGQLNYPSFSVVFGKSRVVRYTRELTNVDPRGGSVIYRAS  668

Query  314  XEAPPS-VTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRS  138
             EAPP  V  TVKP+ L F+N GD+ RYTVTFVS++  V P   AFGSV W N+++QV+S
Sbjct  669  VEAPPELVAATVKPSILEFRNAGDKRRYTVTFVSRRQNVKPMKNAFGSVVWKNSEHQVKS  728

Query  137  PIAFSWTQ  114
            P+AFSW +
Sbjct  729  PVAFSWER  736



>emb|CAN71376.1| hypothetical protein VITISV_001491 [Vitis vinifera]
Length=734

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 98/129 (76%), Gaps = 3/129 (2%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
            + ++AIVK  NITC++K S+P +L YPSF VLFG    VR TRELTNVGAA ++Y+VA  
Sbjct  606  EHVRAIVKRQNITCSRKFSDPGELNYPSFSVLFGSKXFVRYTRELTNVGAAXSVYQVAVT  665

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTP---SNAAFGSVSWNNAQNQVRS  138
             PPSV V V P+ LVFKNVG++ RYTVTFV+KKG       + +AFGS+ W+N Q+QV+S
Sbjct  666  GPPSVGVVVXPSTLVFKNVGEKXRYTVTFVAKKGKKVQNRMTRSAFGSIVWSNTQHQVKS  725

Query  137  PIAFSWTQL  111
            P+A++WTQL
Sbjct  726  PVAYAWTQL  734



>gb|KHN07895.1| Subtilisin-like protease [Glycine soja]
Length=519

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
              ++ +VK P+  C+KK ++P  L YPSF V+FG +++VR TR LTNVG  G+ Y VA  
Sbjct  394  DHLRLLVKHPDANCSKKFADPGDLNYPSFSVVFGSNKVVRYTRTLTNVGEPGSAYNVAVS  453

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            AP +V +TV P KL F  VG+R  YTVTFVS + V   + + FGS+ W+N Q+ VRSP+A
Sbjct  454  APSTVDITVNPNKLEFGEVGERQTYTVTFVSNRSVNDSATSGFGSIMWSNEQHLVRSPVA  513

Query  128  FSWT  117
            F+WT
Sbjct  514  FTWT  517



>ref|XP_010261834.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=773

 Score =   139 bits (351),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 67/128 (52%), Positives = 94/128 (73%), Gaps = 4/128 (3%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLF-GKSRIVRQTRELTNVGAAGTLYEVAXE  309
            QIQ I K PNITC+++ ++P  L YPSF VLF  ++R+VR TRELTNVG AG++Y+V+  
Sbjct  645  QIQMITKRPNITCSRRFADPGHLNYPSFSVLFSAETRMVRYTRELTNVGPAGSVYDVSVS  704

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKK---GVVTPSNAAFGSVSWNNAQNQVRS  138
             P SV +TVKP +LVF+ VG++ +Y+V FV++K   G       AFG +SW+NAQ+QVRS
Sbjct  705  GPASVGITVKPRRLVFREVGEKQKYSVMFVARKEGTGGRRVGTTAFGWLSWSNAQHQVRS  764

Query  137  PIAFSWTQ  114
            PI++ W+ 
Sbjct  765  PISYEWSH  772



>ref|XP_010937330.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=772

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 93/125 (74%), Gaps = 3/125 (2%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGK-SR-IVRQTRELTNVGAAGTLYEVA  315
            Q IQ IVK PN+TC++  SNP +L YPSF V+F K SR +V+  RELTNVG+AG++Y V 
Sbjct  647  QHIQVIVKRPNVTCSRSFSNPGELNYPSFSVVFKKKSRNVVKYIRELTNVGSAGSVYNVR  706

Query  314  XEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSP  135
               P +V+VTVKP KL+FK+VG +L+Y++ F SK G    +  AFG ++W+N Q++VRSP
Sbjct  707  IRGPENVSVTVKPAKLIFKHVGQKLKYSIIFASKNGGHLKTT-AFGWITWSNKQHEVRSP  765

Query  134  IAFSW  120
            +A++W
Sbjct  766  VAYTW  770



>ref|XP_002519362.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42979.1| conserved hypothetical protein [Ricinus communis]
Length=208

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 82/116 (71%), Gaps = 2/116 (2%)
 Frame = -3

Query  458  NITCAKKLSNPAQLXYPSFXVLFGK-SRIVRQTRELTNVGAAGTLYEVAXEAPPSVTVTV  282
            N+TC +K S+  +L YPSF VLFGK +  VR +RELTNVG A   Y VA  AP  V VTV
Sbjct  93   NLTCPRKFSDLGELNYPSFSVLFGKKTTAVRYSRELTNVGTARATYRVAVTAPSEVAVTV  152

Query  281  KPTKLVFKNVGDRLRYTVTFVSKKGVVTPS-NAAFGSVSWNNAQNQVRSPIAFSWT  117
             P KLVFK VG++LRYT TF +K+    P+  AAFGS+ W+NA+ +V SP+AF+WT
Sbjct  153  APAKLVFKKVGEKLRYTATFAAKRNAKKPAGGAAFGSIVWSNAKYKVSSPVAFAWT  208



>ref|XP_004507999.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=753

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 89/128 (70%), Gaps = 2/128 (2%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKK-LSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAX  312
              +Q IVK  ++ C+K   ++P  L YPSF V+FG + +V+ TR LTNVG A ++Y+V  
Sbjct  626  DHVQLIVKRHDVNCSKYYFADPGDLNYPSFSVVFGNNSVVQYTRRLTNVGEAKSVYDVVV  685

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPS-NAAFGSVSWNNAQNQVRSP  135
              P +V +TVKPT+LVF+ VG+R  YTVTF+S K  V  S    FGS++W+N ++QVRSP
Sbjct  686  SGPSTVGITVKPTRLVFEQVGERQTYTVTFISNKDTVDDSVTYEFGSITWSNKRHQVRSP  745

Query  134  IAFSWTQL  111
            +AF+WT L
Sbjct  746  VAFTWTNL  753



>dbj|BAJ89916.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=772

 Score =   134 bits (337),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 68/126 (54%), Positives = 90/126 (71%), Gaps = 4/126 (3%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFG--KSRI-VRQTRELTNVGAAGTLYEV  318
            +Q+QA+  APN TC +KLS+P  L YPSF V+FG  KSR  VR  RELTNVGAAG++Y  
Sbjct  646  RQVQAVTGAPNATCQRKLSSPGDLNYPSFSVVFGLRKSRTTVRYHRELTNVGAAGSVYAA  705

Query  317  AXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRS  138
                PPS+ V+VKP +LVFK  GD+LRYTV F S      P++AAFG ++W++ +  VRS
Sbjct  706  KVTGPPSIVVSVKPARLVFKKAGDKLRYTVAFKS-TAQGGPTDAAFGWLTWSSGEQDVRS  764

Query  137  PIAFSW  120
            PI+++W
Sbjct  765  PISYTW  770



>gb|AES92191.2| subtilisin-like serine protease [Medicago truncatula]
Length=756

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 87/128 (68%), Gaps = 2/128 (2%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGK-SRIVRQTRELTNVGAAGTLYEVAX  312
              ++ IVK PN+ C+  LS P  L YPSF V+FG  S +V+  R LTNVG A ++Y+VA 
Sbjct  629  DHVKLIVKRPNVNCSTYLSGPGDLNYPSFSVVFGNNSGVVQYKRTLTNVGEAESVYDVAV  688

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPS-NAAFGSVSWNNAQNQVRSP  135
              P +V + V PTKLVF+ VG+R  Y V F+S K +V  S  + FGS++W+N Q+QVRSP
Sbjct  689  SGPSTVGIIVNPTKLVFEQVGERQTYMVKFISNKDIVDDSVTSEFGSITWSNKQHQVRSP  748

Query  134  IAFSWTQL  111
            IAF+WT L
Sbjct  749  IAFTWTIL  756



>ref|XP_003609994.1| Subtilisin-like protease [Medicago truncatula]
Length=756

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 87/128 (68%), Gaps = 2/128 (2%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGK-SRIVRQTRELTNVGAAGTLYEVAX  312
              ++ IVK PN+ C+  LS P  L YPSF V+FG  S +V+  R LTNVG A ++Y+VA 
Sbjct  629  DHVKLIVKRPNVNCSTYLSGPGDLNYPSFSVVFGNNSGVVQYKRTLTNVGEAESVYDVAV  688

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPS-NAAFGSVSWNNAQNQVRSP  135
              P +V + V PTKLVF+ VG+R  Y V F+S K +V  S  + FGS++W+N Q+QVRSP
Sbjct  689  SGPSTVGIIVNPTKLVFEQVGERQTYMVKFISNKDIVDDSVTSEFGSITWSNKQHQVRSP  748

Query  134  IAFSWTQL  111
            IAF+WT L
Sbjct  749  IAFTWTIL  756



>ref|XP_010050438.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW79388.1| hypothetical protein EUGRSUZ_C00800 [Eucalyptus grandis]
Length=759

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 90/126 (71%), Gaps = 4/126 (3%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSR-IVRQTRELTNVGAAGTLYEVAX  312
            +Q+Q+ V+  N+TC+ KLS+P QL YPSF VLF  +R +VR +RELTNVG AG++Y+VA 
Sbjct  633  KQVQSTVRRTNVTCSTKLSDPGQLNYPSFSVLFRPNRKVVRYSRELTNVGDAGSVYKVAV  692

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPI  132
            +AP +V V VKP +LVF  VG++ RYTVTFV++           GS++W N Q++VRSP+
Sbjct  693  QAPSTVAVRVKPRRLVFGKVGEKQRYTVTFVARN---QTDETHGGSITWKNRQHRVRSPV  749

Query  131  AFSWTQ  114
             F W +
Sbjct  750  GFLWGE  755



>gb|KHN17728.1| Subtilisin-like protease [Glycine soja]
Length=224

 Score =   125 bits (314),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
              ++ +VK P+  C+KK ++PA+L YPSF ++FG ++++R TR LTNVG  G++Y++   
Sbjct  99   DHLRLVVKDPDANCSKKFADPAELNYPSFSLVFGSNKLLRYTRTLTNVGEPGSVYDLVLS  158

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P +V VTV P +L F+ +G+   YTVTF+S + +     + FG++ W N  +QVR+P+A
Sbjct  159  VPSTVHVTVNPRRLQFRQLGESQTYTVTFLSNRTLNDSVTSDFGTIMWTNQLHQVRTPLA  218

Query  128  FSWT  117
            F+WT
Sbjct  219  FTWT  222



>ref|XP_009391730.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009391731.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=770

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 84/125 (67%), Gaps = 3/125 (2%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKS--RIVRQTRELTNVGAAGTLYEVA  315
              IQAI K+ N TC+++L NP  L YPSF V+FG+   R V+  R LTNVG  G++Y V 
Sbjct  644  DHIQAISKSTNKTCSRRLPNPGNLNYPSFSVVFGRRSRRFVKYNRVLTNVGVPGSVYNVK  703

Query  314  XEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSP  135
               PP V VTVKPTKL+F  VG +LRY VTF S K    P + AFG ++W++ Q+QVRSP
Sbjct  704  VGGPPGVKVTVKPTKLIFNQVGQKLRYKVTFTSTK-AGDPVDMAFGWITWSSEQHQVRSP  762

Query  134  IAFSW  120
            +++ W
Sbjct  763  VSYRW  767



>ref|XP_009380035.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009380036.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009380037.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=767

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 89/124 (72%), Gaps = 3/124 (2%)
 Frame = -3

Query  485  QIQAIVKAPNIT-CAKKLSNPAQLXYPSFXVLFGKS-RIVRQTRELTNVGAAGTLYEVAX  312
             IQAI K PN+T C+++ S+P  L YPSF V+FGK  R+V+  RELTNVG+A + YE   
Sbjct  643  HIQAITKRPNVTTCSRRFSDPGNLNYPSFSVVFGKKWRVVKYRRELTNVGSASSTYEAKV  702

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPI  132
              P  V VTVKP KL+FK+V  +L+Y+VTF SK+   + +  AFG ++W+N Q++VRSP+
Sbjct  703  SGPGGVAVTVKPAKLMFKHVNQKLKYSVTFASKERGRS-AGTAFGWITWSNKQHKVRSPV  761

Query  131  AFSW  120
            A++W
Sbjct  762  AYTW  765



>gb|KDP32432.1| hypothetical protein JCGZ_13357 [Jatropha curcas]
Length=1003

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 84/122 (69%), Gaps = 0/122 (0%)
 Frame = -3

Query  482   IQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEAP  303
             ++ I + P +TC+K+  +  +L YPSF VLFG    V+ TR LTNVG A + YEV   AP
Sbjct  882   VREITENPFLTCSKRFDDLGELNYPSFSVLFGNKTTVQYTRTLTNVGTAKSTYEVKVTAP  941

Query  302   PSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFS  123
             P++TVTVKP KLVFKNVG++  Y VTF + K        AFGS++W +AQ++V SP+AF+
Sbjct  942   PALTVTVKPRKLVFKNVGEKHSYRVTFAAIKNRKPVGGVAFGSITWIDAQHKVSSPVAFT  1001

Query  122   WT  117
             WT
Sbjct  1002  WT  1003


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -3

Query  482  IQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEAP  303
            I+ I   P ++C+ +  +  +L YPSF VLFG   +V+ +R+LTN GAA + YEV   AP
Sbjct  603  IRTITLNPKVSCSSRFDDLGELNYPSFSVLFGNKTMVQYSRKLTNAGAANSAYEVIVAAP  662

Query  302  PSVTVTVKPTKLVFKNVGDRLR  237
            P+VTVTVKP  LVFKNVG++ +
Sbjct  663  PAVTVTVKPRNLVFKNVGEKHK  684



>dbj|BAD36156.1| putative serine protease [Oryza sativa Japonica Group]
 gb|EAZ09256.1| hypothetical protein OsI_31529 [Oryza sativa Indica Group]
 gb|EAZ44882.1| hypothetical protein OsJ_29522 [Oryza sativa Japonica Group]
Length=770

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 83/128 (65%), Gaps = 7/128 (5%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSR------IVRQTRELTNVGAAGTLY  324
            Q+QAI  APN+TC +KLS+P  L YPSF V+FG+         V+  RELTNVG   ++Y
Sbjct  642  QVQAITAAPNVTCQRKLSSPGDLNYPSFSVVFGRRSSSSRSTTVKYRRELTNVGDGRSVY  701

Query  323  EVAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQV  144
                  P  + V VKP +L FK  GD+LRYTVTF S      P++AAFG ++W+N ++ V
Sbjct  702  TARVTGPSDIAVAVKPARLAFKKAGDKLRYTVTFKSTT-PGGPTDAAFGWLTWSNGEHDV  760

Query  143  RSPIAFSW  120
            RSPI+++W
Sbjct  761  RSPISYTW  768



>gb|AGT17100.1| serine protease [Saccharum hybrid cultivar R570]
Length=750

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 91/132 (69%), Gaps = 8/132 (6%)
 Frame = -3

Query  488  QQIQAIVKA-PNITCAKKLSNPAQLXYPSFXVLFGK--SR-IVRQTRELTNVGAAGTLYE  321
            +QIQAI  A PN+TC +KLS+P  L YPSF V+FG+  SR  V+  RELTNVG AG  Y 
Sbjct  616  RQIQAITAAGPNVTCTRKLSSPGDLNYPSFSVVFGQRSSRSTVKYRRELTNVGNAGDTYT  675

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVS--KKGVVTPSNAAFGSVSWNNAQNQ  147
            V    P  ++V+VKP +L F+  GD+LRYTVTF S   +G + P  AAFG ++W++ ++ 
Sbjct  676  VKVTGPSDISVSVKPARLQFRRAGDKLRYTVTFRSANARGRMDP--AAFGWLTWSSDEHD  733

Query  146  VRSPIAFSWTQL  111
            VRSPI+++W  +
Sbjct  734  VRSPISYTWGDV  745



>ref|XP_006661279.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=635

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 89/130 (68%), Gaps = 10/130 (8%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGK--SR-IVRQTRELTNVGA-AGTLYE  321
            QQ+QAI  APN+TC +KLS+P  L YPSF V+FG+  SR  V+  RELTNVG   G++Y 
Sbjct  507  QQVQAITAAPNVTCQRKLSSPGDLNYPSFSVVFGRRSSRSSVKYRRELTNVGGDGGSVYT  566

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSK--KGVVTPSNAAFGSVSWNN-AQN  150
            V    P  + V VKP +L FK  GD+LRYTVTF S   +G   P ++AFG ++W++  ++
Sbjct  567  VRVTGPSDIAVAVKPARLAFKAAGDKLRYTVTFKSATPRG---PMDSAFGWLTWSDGGEH  623

Query  149  QVRSPIAFSW  120
             VRSPI+++W
Sbjct  624  DVRSPISYTW  633



>tpg|DAA61658.1| TPA: putative subtilase family protein [Zea mays]
Length=548

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 89/129 (69%), Gaps = 8/129 (6%)
 Frame = -3

Query  488  QQIQAI-VKAPNITCAKKLSNPAQLXYPSFXVLFGK--SR-IVRQTRELTNVGAAGTLYE  321
            +QIQAI  + PN+TC +KLS+P  L YPSF V+F +  SR  V+  R+LTNVG+AG  Y 
Sbjct  420  RQIQAITAEGPNVTCTRKLSSPGDLNYPSFSVVFDRRSSRSTVKYRRDLTNVGSAGDTYT  479

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVS--KKGVVTPSNAAFGSVSWNNAQNQ  147
            V    P  ++V VKP +L F+  GD+LRYTVTF S   +G + P  AAFG ++W++ ++ 
Sbjct  480  VKVTGPSDISVRVKPARLEFRRAGDKLRYTVTFRSANARGPMDP--AAFGWLTWSSGEHD  537

Query  146  VRSPIAFSW  120
            VRSPI+++W
Sbjct  538  VRSPISYTW  546



>ref|XP_007154575.1| hypothetical protein PHAVU_003G130300g [Phaseolus vulgaris]
 gb|ESW26569.1| hypothetical protein PHAVU_003G130300g [Phaseolus vulgaris]
Length=761

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 81/124 (65%), Gaps = 0/124 (0%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
              ++ +VK  +  C+ K ++P  L YPSF V+FG +++V+ TR LTNVG A ++Y+V   
Sbjct  636  DHLRLVVKHSDANCSTKFADPGDLNYPSFSVVFGSNKVVQYTRTLTNVGKAASVYDVVVS  695

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P +V +TV P ++ F  VG+   Y VTFVS + V     + FGS+ W+N +++VRSP+A
Sbjct  696  TPSTVEITVNPNRVSFAEVGECQTYKVTFVSNRSVSDSVASEFGSIMWSNEEHEVRSPVA  755

Query  128  FSWT  117
            F+WT
Sbjct  756  FTWT  759



>ref|XP_002460273.1| hypothetical protein SORBIDRAFT_02g025810 [Sorghum bicolor]
 gb|EER96794.1| hypothetical protein SORBIDRAFT_02g025810 [Sorghum bicolor]
Length=774

 Score =   120 bits (300),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 64/127 (50%), Positives = 86/127 (68%), Gaps = 4/127 (3%)
 Frame = -3

Query  488  QQIQAIVKA-PNITCAKKLSNPAQLXYPSFXVLFGK--SR-IVRQTRELTNVGAAGTLYE  321
            +QIQAI  A PN+TC +KLS+P  L YPSF V+FG+  SR  V+  RELTNVG AG  Y 
Sbjct  646  RQIQAITAAGPNVTCTRKLSSPGDLNYPSFSVVFGRRSSRSTVKYRRELTNVGNAGDTYT  705

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVR  141
            V    P  ++V+VKP +L F+  GD+LRYTVTF S         AAFG ++W++ ++ VR
Sbjct  706  VKVTGPSDISVSVKPARLQFRRAGDKLRYTVTFRSANARGPMDPAAFGWLTWSSDEHVVR  765

Query  140  SPIAFSW  120
            SPI+++W
Sbjct  766  SPISYTW  772



>gb|EMS68171.1| Subtilisin-like protease [Triticum urartu]
Length=419

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 78/111 (70%), Gaps = 4/111 (4%)
 Frame = -3

Query  443  KKLSNPAQLXYPSFXVLFG--KSRI-VRQTRELTNVGAAGTLYEVAXEAPPSVTVTVKPT  273
            +KL +P  L YPSF V+FG  KSR  V+  RELTNVGAAG++Y      PPS+ V+VKP 
Sbjct  308  RKLPSPGDLNYPSFSVVFGLRKSRTTVKYHRELTNVGAAGSVYAAKVTGPPSIVVSVKPA  367

Query  272  KLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            +LVFK VGD+LRYTV F S      P +AAFG ++W++ +  VRSPI+++W
Sbjct  368  RLVFKKVGDKLRYTVAFKSTA-EGGPMDAAFGWLTWSSGEQDVRSPISYTW  417



>ref|XP_004956934.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=773

 Score =   118 bits (295),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 66/129 (51%), Positives = 89/129 (69%), Gaps = 8/129 (6%)
 Frame = -3

Query  488  QQIQAIVKA-PNITCAKKLSNPAQLXYPSFXVLFGK--SR-IVRQTRELTNVGAAGTLYE  321
            +Q+QA+  A PN+TC +KLS+P  L YPSF V+FG+  SR  V+  RELTNVG  G  Y 
Sbjct  645  RQVQAVAAAGPNVTCTRKLSSPGDLNYPSFSVVFGRRSSRSTVKYRRELTNVGDTGATYT  704

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSK--KGVVTPSNAAFGSVSWNNAQNQ  147
            V    P  V V+VKP  L F+  GD+LRYTVTF SK  KG + P  AAFG ++W++ +++
Sbjct  705  VKVTGPSDVGVSVKPAMLQFRRPGDKLRYTVTFRSKSAKGPMDP--AAFGWLTWSSDEHE  762

Query  146  VRSPIAFSW  120
            VRSPI+++W
Sbjct  763  VRSPISYTW  771



>gb|EMT22975.1| Subtilisin-like protease [Aegilops tauschii]
Length=432

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 84/123 (68%), Gaps = 4/123 (3%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFG--KSR-IVRQTRELTNVGAAGTLYEV  318
            +Q+QAI  APN TC +KLS+P  L YPSF V+FG  KSR  VR  RELTNVGAAG +Y  
Sbjct  238  RQVQAITGAPNATCQRKLSSPGDLNYPSFSVVFGLRKSRSTVRYHRELTNVGAAGAVYAA  297

Query  317  AXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRS  138
                PPS+ V+VKP +LVFK  GD+LRYTV F S      P +AAFG ++W++    VRS
Sbjct  298  KVTGPPSIAVSVKPARLVFKKAGDKLRYTVAFKSTA-EGGPMDAAFGWLTWSSGGQDVRS  356

Query  137  PIA  129
            PI+
Sbjct  357  PIS  359



>gb|ACF79126.1| unknown [Zea mays]
 tpg|DAA61657.1| TPA: putative subtilase family protein [Zea mays]
Length=766

 Score =   117 bits (292),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 61/127 (48%), Positives = 85/127 (67%), Gaps = 4/127 (3%)
 Frame = -3

Query  488  QQIQAIV-KAPNITCAKKLSNPAQLXYPSFXVLFGK--SR-IVRQTRELTNVGAAGTLYE  321
            +QIQAI  + PN+TC +KLS+P  L YPSF V+F +  SR  V+  R+LTNVG+AG  Y 
Sbjct  638  RQIQAITAEGPNVTCTRKLSSPGDLNYPSFSVVFDRRSSRSTVKYRRDLTNVGSAGDTYT  697

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVR  141
            V    P  ++V VKP +L F+  GD+LRYTVTF S         AAFG ++W++ ++ VR
Sbjct  698  VKVTGPSDISVRVKPARLEFRRAGDKLRYTVTFRSANARGPMDPAAFGWLTWSSGEHDVR  757

Query  140  SPIAFSW  120
            SPI+++W
Sbjct  758  SPISYTW  764



>ref|NP_001130775.1| uncharacterized protein LOC100191879 precursor [Zea mays]
 gb|ACG30165.1| subtilisin-like protease precursor [Zea mays]
Length=766

 Score =   115 bits (287),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 60/127 (47%), Positives = 84/127 (66%), Gaps = 4/127 (3%)
 Frame = -3

Query  488  QQIQAIV-KAPNITCAKKLSNPAQLXYPSFXVLFGK--SR-IVRQTRELTNVGAAGTLYE  321
            +QIQ I  + PN+TC +KLS+P  L YPSF V+F +  SR  V+  R+LTNVG+AG  Y 
Sbjct  638  RQIQVITAEGPNVTCTRKLSSPGDLNYPSFSVVFDRRSSRSTVKYRRDLTNVGSAGDTYT  697

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVR  141
            V    P  ++V VKP +L F+  GD+LRYTVTF S         AAFG ++W++ ++ VR
Sbjct  698  VKVTGPSDISVRVKPARLEFRRAGDKLRYTVTFRSANARGPMDPAAFGWLTWSSGEHDVR  757

Query  140  SPIAFSW  120
            SPI+++W
Sbjct  758  SPISYTW  764



>ref|XP_010238670.1| PREDICTED: subtilisin-like protease isoform X1 [Brachypodium 
distachyon]
Length=769

 Score =   113 bits (282),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 65/127 (51%), Positives = 82/127 (65%), Gaps = 7/127 (6%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKS--RIVRQTRELTNVGAAGTLYEVAX  312
             I+ + K  NI+C +K S P  L YPSF V+F      +VR  RELTNVG A ++Y V  
Sbjct  645  HIRVVTKMSNISCPQK-SRPGDLNYPSFSVVFRNKPKHVVRYRRELTNVGPAMSVYNVKV  703

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAA--FGSVSWNNAQNQVRS  138
             +P SV+V V P KLVFK +G +LRY VTF SK  VV P+ A   FG +SW N Q+ VRS
Sbjct  704  SSPASVSVKVSPEKLVFKKLGQKLRYYVTFTSK--VVDPNRAKPDFGWISWVNNQHVVRS  761

Query  137  PIAFSWT  117
            P+AF+WT
Sbjct  762  PVAFTWT  768



>ref|XP_010238218.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=805

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 89/134 (66%), Gaps = 13/134 (10%)
 Frame = -3

Query  488  QQIQAIVKA----PNITCAKKLSNPAQLXYPSFXVLF---GKSRIVRQTRELTNVGAAGT  330
            +QIQAI  +     N TC +KLS+P  L YPSF V++        V+  RELTNVGAAG+
Sbjct  672  RQIQAITGSRTAKGNATCQRKLSSPGDLNYPSFSVVYPLRKSHSTVKYRRELTNVGAAGS  731

Query  329  LYEV-AXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTF-VSKKGVVTPSNAAFGSVSWNNA  156
            +Y V     P SV+V VKP +LVFK  GD+L+YTV F  S +G   P++AAFG ++W++A
Sbjct  732  VYTVKVTGGPSSVSVAVKPARLVFKKAGDKLKYTVAFKSSAQGA--PTDAAFGWLTWSSA  789

Query  155  --QNQVRSPIAFSW  120
              ++ VRSPI+++W
Sbjct  790  DGEHDVRSPISYTW  803



>gb|ACL52505.1| unknown [Zea mays]
Length=421

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 79/131 (60%), Gaps = 12/131 (9%)
 Frame = -3

Query  485  QIQAIVKAPNITC-AKKLSNPAQLXYPSFXVLFGKSR------IVRQTRELTNVGAAGTL  327
             +Q I KA N++C A   S P  L YPSF V+FG+ R       +R  RELTNVG A ++
Sbjct  292  HVQVITKASNVSCGAPNKSRPGDLNYPSFSVVFGQKRKTKPAAALRFRRELTNVGPAASV  351

Query  326  YEVAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVS--KKGVVTPSNAAFGSVSWNNAQ  153
            Y+V    P SV VTV P +L F+  G +LRY VTF S  ++G   P    FG +SW N +
Sbjct  352  YDVKVVGPESVAVTVTPARLTFRQAGQKLRYYVTFASRARQGHAKPD---FGWISWVNDE  408

Query  152  NQVRSPIAFSW  120
            + VRSP+A++W
Sbjct  409  HVVRSPVAYTW  419



>gb|EMT16255.1| Subtilisin-like protease [Aegilops tauschii]
Length=761

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 76/128 (59%), Gaps = 3/128 (2%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKS--RIVRQTRELTNVGAAGTLYEVAX  312
             I+ I K  N++C  + S P  L YPSF V+F K    +VR  RELTNVG A  +Y+V  
Sbjct  564  HIRVITKMSNVSCPPR-SRPGDLNYPSFSVVFRKKPRHVVRYRRELTNVGPAMAVYDVKV  622

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPI  132
              P SV VTV P KLVFK VG + RY VTF SK      +   FG +SW + ++ VRSP+
Sbjct  623  SGPASVGVTVTPAKLVFKKVGQKQRYYVTFESKAAGAGRAKPDFGWISWASDEHVVRSPV  682

Query  131  AFSWTQLF  108
            A++W   F
Sbjct  683  AYTWKMCF  690



>ref|NP_001064523.2| Os10g0394200 [Oryza sativa Japonica Group]
 dbj|BAF26437.2| Os10g0394200, partial [Oryza sativa Japonica Group]
Length=230

 Score =   106 bits (264),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 76/126 (60%), Gaps = 8/126 (6%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKS--RIVRQTRELTNVGAAGTLYEVAX  312
             IQ I K  NITC +K   P  L YPSF V+F K    ++R  RE+TNVG A ++Y V  
Sbjct  107  HIQVITKMSNITCPRKF-RPGDLNYPSFSVVFKKKSKHVMRFRREVTNVGPAMSVYNVKV  165

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNA--AFGSVSWNNAQNQVRS  138
              P SV+V V P KLVF  VG + RY V F S    V  SNA   FG +SW ++Q+ VRS
Sbjct  166  SGPASVSVKVTPAKLVFNKVGQKQRYYVIFAS---TVDASNAKPDFGWISWMSSQHVVRS  222

Query  137  PIAFSW  120
            PIA++W
Sbjct  223  PIAYTW  228



>ref|XP_004983113.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=766

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 77/124 (62%), Gaps = 4/124 (3%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKS--RIVRQTRELTNVGAAGTLYEVAX  312
             IQ I K  N +C KK   P  L YPSF V+F +   R++R  RE+TNVG A ++Y V  
Sbjct  643  HIQVITKMSNFSCPKKF-RPGDLNYPSFSVVFKQKSKRVMRFRREVTNVGPATSVYNVKV  701

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPI  132
             +P SV+VTV PTKL FK VG + RY VTF SK G    +   FG +SW N  + VRSP+
Sbjct  702  TSPASVSVTVTPTKLTFKKVGQKQRYYVTFASKAGQGQ-AKPDFGWISWANDDHVVRSPV  760

Query  131  AFSW  120
            A++W
Sbjct  761  AYTW  764



>ref|XP_002467295.1| hypothetical protein SORBIDRAFT_01g023190 [Sorghum bicolor]
 gb|EER94293.1| hypothetical protein SORBIDRAFT_01g023190 [Sorghum bicolor]
Length=767

 Score =   107 bits (268),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 78/124 (63%), Gaps = 4/124 (3%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFG-KSRIV-RQTRELTNVGAAGTLYEVAX  312
             IQ I K  N++C KK   P  L YPSF V+F  KS+ V R  RELTNVG A ++Y V  
Sbjct  644  HIQVITKTSNVSCPKKF-RPGDLNYPSFSVVFNQKSKPVQRFRRELTNVGPATSVYNVKV  702

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPI  132
             +P SV VTV P KL FK  G +LRY VTF SK G  + +   FG +SW N ++ VRSP+
Sbjct  703  ISPESVAVTVTPAKLTFKKAGQKLRYHVTFASKAG-QSHAKPDFGWISWVNDEHVVRSPV  761

Query  131  AFSW  120
            A++W
Sbjct  762  AYTW  765



>gb|EMS60034.1| Subtilisin-like protease [Triticum urartu]
Length=478

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 74/124 (60%), Gaps = 3/124 (2%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKS--RIVRQTRELTNVGAAGTLYEVAX  312
             I+ I K  N++C  + S P  L YPSF V+F K    +VR  RELTNVG A  +Y+V  
Sbjct  354  HIRVITKMANVSCPPR-SRPGDLNYPSFSVVFRKKPRHVVRYRRELTNVGPAMAVYDVKV  412

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPI  132
              P S  VTV P +LVFK VG + RY VTF SK      +   FG +SW + ++ VRSP+
Sbjct  413  SGPASAGVTVTPARLVFKKVGQKQRYYVTFESKAAGPGRAKPDFGWISWASDEHVVRSPV  472

Query  131  AFSW  120
            A++W
Sbjct  473  AYTW  476



>ref|XP_006849717.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
 gb|ERN11298.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
Length=780

 Score =   105 bits (262),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 56/124 (45%), Positives = 80/124 (65%), Gaps = 4/124 (3%)
 Frame = -3

Query  485  QIQAIVKAPNITCAK-KLSNPAQLXYPSFXVLF-GKSRIVRQTRELTNVGAAGTLYEVAX  312
            Q++ + K  N +C + K+ +   L YPSF V+F G  ++VR +R LTNVG   ++Y V+ 
Sbjct  655  QVRIVSKHSNFSCPRDKVLDTGNLNYPSFSVIFRGYEKVVRYSRVLTNVGEPSSVYTVSV  714

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPI  132
             AP  V +TVKP +LVFK VG++  YTV F SK     P +  FG + W+N +++VRSPI
Sbjct  715  SAPEGVGITVKPQRLVFKGVGNKQGYTVEFASKIKTSGPMD--FGWILWSNQKHKVRSPI  772

Query  131  AFSW  120
            AFSW
Sbjct  773  AFSW  776



>ref|NP_001145743.1| uncharacterized protein LOC100279250 precursor [Zea mays]
 gb|ACN33223.1| unknown [Zea mays]
Length=773

 Score =   105 bits (261),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 59/131 (45%), Positives = 79/131 (60%), Gaps = 12/131 (9%)
 Frame = -3

Query  485  QIQAIVKAPNITC-AKKLSNPAQLXYPSFXVLFGKSR------IVRQTRELTNVGAAGTL  327
             +Q I KA N++C A   S P  L YPSF V+FG+ R       +R  RELTNVG A ++
Sbjct  644  HVQVITKASNVSCGAPNKSRPGDLNYPSFSVVFGQKRKTKPAAALRFRRELTNVGPAASV  703

Query  326  YEVAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVS--KKGVVTPSNAAFGSVSWNNAQ  153
            Y+V    P SV VTV P +L F+  G +LRY VTF S  ++G   P    FG +SW N +
Sbjct  704  YDVKVVGPESVAVTVTPARLTFRQAGQKLRYYVTFASRARQGHAKPD---FGWISWVNDE  760

Query  152  NQVRSPIAFSW  120
            + VRSP+A++W
Sbjct  761  HVVRSPVAYTW  771



>tpg|DAA50071.1| TPA: putative subtilase family protein [Zea mays]
Length=773

 Score =   105 bits (261),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 59/131 (45%), Positives = 79/131 (60%), Gaps = 12/131 (9%)
 Frame = -3

Query  485  QIQAIVKAPNITC-AKKLSNPAQLXYPSFXVLFGKSR------IVRQTRELTNVGAAGTL  327
             +Q I KA N++C A   S P  L YPSF V+FG+ R       +R  RELTNVG A ++
Sbjct  644  HVQVITKASNVSCGAPNKSRPGDLNYPSFSVVFGQKRKTKPAAALRFRRELTNVGPAASV  703

Query  326  YEVAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVS--KKGVVTPSNAAFGSVSWNNAQ  153
            Y+V    P SV VTV P +L F+  G +LRY VTF S  ++G   P    FG +SW N +
Sbjct  704  YDVKVVGPESVAVTVTPARLTFRQAGQKLRYYVTFASRARQGHAKPD---FGWISWVNDE  760

Query  152  NQVRSPIAFSW  120
            + VRSP+A++W
Sbjct  761  HVVRSPVAYTW  771



>gb|EEE50901.1| hypothetical protein OsJ_31407 [Oryza sativa Japonica Group]
Length=758

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 76/126 (60%), Gaps = 8/126 (6%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKS--RIVRQTRELTNVGAAGTLYEVAX  312
             IQ I K  NITC +K   P  L YPSF V+F K    ++R  RE+TNVG A ++Y V  
Sbjct  635  HIQVITKMSNITCPRKF-RPGDLNYPSFSVVFKKKSKHVMRFRREVTNVGPAMSVYNVKV  693

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNA--AFGSVSWNNAQNQVRS  138
              P SV+V V P KLVF  VG + RY V F S    V  SNA   FG +SW ++Q+ VRS
Sbjct  694  SGPASVSVKVTPAKLVFNKVGQKQRYYVIFAS---TVDASNAKPDFGWISWMSSQHVVRS  750

Query  137  PIAFSW  120
            PIA++W
Sbjct  751  PIAYTW  756



>gb|EAY78354.1| hypothetical protein OsI_33442 [Oryza sativa Indica Group]
Length=773

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 76/126 (60%), Gaps = 8/126 (6%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKS--RIVRQTRELTNVGAAGTLYEVAX  312
             IQ I K  NITC +K   P  L YPSF V+F K    ++R  RE+TNVG A ++Y V  
Sbjct  650  HIQVITKMSNITCPRKF-RPGDLNYPSFSVVFKKKSKHVMRFRREVTNVGPAMSVYNVKV  708

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNA--AFGSVSWNNAQNQVRS  138
              P SV+V V P KLVF  VG + RY V F S    V  SNA   FG +SW ++Q+ VRS
Sbjct  709  SGPASVSVKVTPAKLVFNKVGQKQRYYVIFAS---TVDASNAKPDFGWISWMSSQHVVRS  765

Query  137  PIAFSW  120
            PIA++W
Sbjct  766  PIAYTW  771



>gb|AAM22744.1|AC092388_28 putative cucumisin-like serine protease [Oryza sativa Japonica 
Group]
 gb|AAP53584.1| Subtilisin N-terminal Region family protein, expressed [Oryza 
sativa Japonica Group]
Length=773

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 76/126 (60%), Gaps = 8/126 (6%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKS--RIVRQTRELTNVGAAGTLYEVAX  312
             IQ I K  NITC +K   P  L YPSF V+F K    ++R  RE+TNVG A ++Y V  
Sbjct  650  HIQVITKMSNITCPRKF-RPGDLNYPSFSVVFKKKSKHVMRFRREVTNVGPAMSVYNVKV  708

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNA--AFGSVSWNNAQNQVRS  138
              P SV+V V P KLVF  VG + RY V F S    V  SNA   FG +SW ++Q+ VRS
Sbjct  709  SGPASVSVKVTPAKLVFNKVGQKQRYYVIFAS---TVDASNAKPDFGWISWMSSQHVVRS  765

Query  137  PIAFSW  120
            PIA++W
Sbjct  766  PIAYTW  771



>dbj|BAK06243.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=769

 Score =   103 bits (257),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 58/124 (47%), Positives = 74/124 (60%), Gaps = 3/124 (2%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKS--RIVRQTRELTNVGAAGTLYEVAX  312
             I+ I K  N++C  + S P  L YPSF V+F K     VR  RELTNVG A  +Y+V  
Sbjct  645  HIRVITKMSNVSCPPR-SRPGDLNYPSFSVVFRKKARHAVRYRRELTNVGPAMAVYDVKV  703

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPI  132
              P SV VTV P KLVFK VG + RY VTF SK      +   FG +SW + ++ VRSP+
Sbjct  704  SGPASVGVTVTPAKLVFKKVGQKQRYYVTFESKAAGAGRAKPDFGWISWVSDEHVVRSPV  763

Query  131  AFSW  120
            A++W
Sbjct  764  AYTW  767



>ref|XP_006662325.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=535

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 79/127 (62%), Gaps = 9/127 (7%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKS--RIVRQTRELTNVGAAGTLYEVAX  312
             IQ I K  NITC +K   P  L YPSF V+F K+   ++R  RE+TNVG A ++Y V  
Sbjct  411  HIQVITKMSNITCPRKF-RPGDLNYPSFSVVFKKNSRHVMRFRREVTNVGPAMSVYNVKV  469

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSK---KGVVTPSNAAFGSVSWNNAQNQVR  141
             +P SV+V V P+++VF  VG + RY VTF +K    G V P    FG +SW + ++ VR
Sbjct  470  TSPASVSVKVTPSRIVFNRVGQKQRYYVTFAAKVDDTGSVKPD---FGWISWLSNEHVVR  526

Query  140  SPIAFSW  120
            SP+A++W
Sbjct  527  SPVAYTW  533



>gb|KJB70156.1| hypothetical protein B456_011G061400 [Gossypium raimondii]
Length=764

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 53/130 (41%), Positives = 78/130 (60%), Gaps = 5/130 (4%)
 Frame = -3

Query  488  QQIQAIVKAPNIT--CAKKLSNPAQLXYPSFXVLFGKS-RIVRQTRELTNVG-AAGTLYE  321
            ++I+  V+ PN +  CA KL+ P  L YPSF V+F  +  +V+  R++ NVG +AG +YE
Sbjct  628  KRIEVFVREPNSSDVCATKLATPGDLNYPSFSVVFNSNDHVVKYRRKVKNVGTSAGAVYE  687

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKK-GVVTPSNAAFGSVSWNNAQNQV  144
                APP V ++V P+KL F  V   L Y V+F S   G+ +  +  FGS+ W++  + V
Sbjct  688  AKVNAPPGVKISVSPSKLEFSAVNQTLSYEVSFASDSLGLSSVESQGFGSIEWSDGVHLV  747

Query  143  RSPIAFSWTQ  114
            RSPIA  W Q
Sbjct  748  RSPIAVRWIQ  757



>gb|EPS61652.1| hypothetical protein M569_13143, partial [Genlisea aurea]
Length=738

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 73/126 (58%), Gaps = 3/126 (2%)
 Frame = -3

Query  488  QQIQAIVKAPNITC--AKKLSNPAQLXYPSFXVLF-GKSRIVRQTRELTNVGAAGTLYEV  318
            + I  I    N+TC  A  + +P QL YPSF V+F    R V  TR +TNVG   + Y V
Sbjct  613  ESISTIAGGRNVTCPEANGVDDPGQLNYPSFSVVFVSGGRPVSYTRVVTNVGNGPSTYVV  672

Query  317  AXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRS  138
            +  AP + T+ V P +LVF   G +L+YT TF S +G    +  AFG++SW +   QV S
Sbjct  673  SVTAPSAATIVVIPKELVFGAKGQKLQYTSTFGSNRGANATAGNAFGAISWISNTTQVTS  732

Query  137  PIAFSW  120
            P+AF+W
Sbjct  733  PVAFTW  738



>ref|XP_007134944.1| hypothetical protein PHAVU_010G088700g [Phaseolus vulgaris]
 gb|ESW06938.1| hypothetical protein PHAVU_010G088700g [Phaseolus vulgaris]
Length=764

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 72/123 (59%), Gaps = 4/123 (3%)
 Frame = -3

Query  476  AIVKAPNITCAKKLS-NPAQLXYPSFXVLFGKSRI---VRQTRELTNVGAAGTLYEVAXE  309
            A++   N  CAKK +     L YPSF VLFG S +   VR  R +TNVG     Y V  E
Sbjct  641  ALLSKGNFKCAKKSALRAGDLNYPSFAVLFGTSALNASVRYKRIVTNVGNPKISYAVKVE  700

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P  V+V V+PT + F+  G++L Y V+FVS +      +++FGS++W + +  VRSPIA
Sbjct  701  EPKGVSVRVEPTNISFRKTGEKLSYKVSFVSNENTTVSGSSSFGSITWVSGKYAVRSPIA  760

Query  128  FSW  120
             +W
Sbjct  761  VTW  763



>ref|XP_006583358.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=734

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 72/123 (59%), Gaps = 4/123 (3%)
 Frame = -3

Query  476  AIVKAPNITCAKKLS-NPAQLXYPSFXVLFGKSR---IVRQTRELTNVGAAGTLYEVAXE  309
            AI+   N  CAKK + +   L YPSF VLFG S     V   R +TNVG   + Y V  E
Sbjct  611  AILSKGNFKCAKKSALHAGDLNYPSFAVLFGTSARNASVAYKRVVTNVGKPSSSYAVKVE  670

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P  V+V+V+P  + F+ +GD+L Y VTFVS        +++FGS++W + +  VRSPIA
Sbjct  671  EPKGVSVSVEPRNISFRKIGDKLSYKVTFVSYGRTAIAGSSSFGSLTWVSDKYTVRSPIA  730

Query  128  FSW  120
             +W
Sbjct  731  VTW  733



>ref|XP_003528890.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
Length=763

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 72/123 (59%), Gaps = 4/123 (3%)
 Frame = -3

Query  476  AIVKAPNITCAKKLS-NPAQLXYPSFXVLFGKSR---IVRQTRELTNVGAAGTLYEVAXE  309
            AI+   N  CAKK + +   L YPSF VLFG S     V   R +TNVG   + Y V  E
Sbjct  640  AILSKGNFKCAKKSALHAGDLNYPSFAVLFGTSARNASVAYKRVVTNVGKPSSSYAVKVE  699

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P  V+V+V+P  + F+ +GD+L Y VTFVS        +++FGS++W + +  VRSPIA
Sbjct  700  EPKGVSVSVEPRNISFRKIGDKLSYKVTFVSYGRTAIAGSSSFGSLTWVSDKYTVRSPIA  759

Query  128  FSW  120
             +W
Sbjct  760  VTW  762



>gb|KHN04600.1| Subtilisin-like protease [Glycine soja]
Length=734

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 72/123 (59%), Gaps = 4/123 (3%)
 Frame = -3

Query  476  AIVKAPNITCAKKLS-NPAQLXYPSFXVLFGKSR---IVRQTRELTNVGAAGTLYEVAXE  309
            AI+   N  CAKK + +   L YPSF VLFG S     V   R +TNVG   + Y V  E
Sbjct  611  AILSKGNFKCAKKSALHAGDLNYPSFAVLFGTSARNASVAYKRVVTNVGKPSSSYAVKVE  670

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P  V+V+V+P  + F+ +GD+L Y VTFVS        +++FGS++W + +  VRSPIA
Sbjct  671  EPKGVSVSVEPRNISFRKIGDKLSYKVTFVSYGRTAIAGSSSFGSLTWVSDKYTVRSPIA  730

Query  128  FSW  120
             +W
Sbjct  731  VTW  733



>ref|XP_009416811.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=757

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 74/126 (59%), Gaps = 7/126 (6%)
 Frame = -3

Query  485  QIQAIVKAPNITCAK-KLSNPAQLXYPSFXVLFG-KSRIVRQTRELTNVGAAGTLYEVAX  312
            QI  + +  N TC + K    + L YPSF V F   S  V+ TR LTNVGA GT Y+   
Sbjct  636  QIARLSRLTNYTCDRQKAYEVSDLNYPSFAVAFATASTTVKHTRTLTNVGAPGT-YKATV  694

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNA-AFGSVSWNNAQNQVRSP  135
             AP  V V V+PT L F  +G++  YTVTF +      PS + AFG + W++AQ+ V SP
Sbjct  695  SAPEDVKVVVEPTALTFAALGEKKNYTVTFSTAS---QPSGSTAFGRLEWSDAQHVVASP  751

Query  134  IAFSWT  117
            +AFSWT
Sbjct  752  LAFSWT  757



>gb|ABF70004.1| subtilisin-like serine proteinase, putative [Musa acuminata]
Length=757

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 74/126 (59%), Gaps = 7/126 (6%)
 Frame = -3

Query  485  QIQAIVKAPNITCAK-KLSNPAQLXYPSFXVLFG-KSRIVRQTRELTNVGAAGTLYEVAX  312
            QI  + +  N TC + K    + L YPSF V F   S  V+ TR LTNVGA GT Y+   
Sbjct  636  QIARLSRLTNYTCDRQKAYEVSDLNYPSFAVAFATASTTVKHTRTLTNVGAPGT-YKATV  694

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNA-AFGSVSWNNAQNQVRSP  135
             AP  V V V+PT L F  +G++  YTVTF +      PS + AFG + W++AQ+ V SP
Sbjct  695  SAPEGVKVVVEPTALTFSALGEKKNYTVTFSTAS---QPSGSTAFGRLEWSDAQHVVASP  751

Query  134  IAFSWT  117
            +AFSWT
Sbjct  752  LAFSWT  757



>gb|KCW79387.1| hypothetical protein EUGRSUZ_C00799 [Eucalyptus grandis]
Length=729

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 64/90 (71%), Gaps = 3/90 (3%)
 Frame = -3

Query  383  SRIVRQTRELTNVGAAGTLYEVAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGV  204
            +++VR +RE+TNVG AG++Y+VA +AP +V V VKP +LVF  VG++ RYTVTFV++   
Sbjct  642  NKVVRYSREVTNVGDAGSVYKVAVQAPSTVAVRVKPRRLVFGKVGEKQRYTVTFVARN--  699

Query  203  VTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
                    GS++W N Q++VRSP+ F W +
Sbjct  700  -KTDETHGGSITWKNRQHRVRSPVGFLWGE  728



>emb|CDP20511.1| unnamed protein product [Coffea canephora]
Length=777

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 49/112 (44%), Positives = 70/112 (63%), Gaps = 3/112 (3%)
 Frame = -3

Query  446  AKKLSNPAQLXYPSFXVLFGK-SRIVRQTRELTNVGA-AGTLYEVAXEAPPSVTVTVKPT  273
            A+ +  P  L YPSF V+F   + +V+ TR + NVG+ A  +YEV   APPSV VTV P+
Sbjct  657  AQGMGTPGDLNYPSFSVVFSPGNSVVKYTRVVKNVGSNAEAVYEVKVNAPPSVEVTVSPS  716

Query  272  KLVFKNVGDRLRYTVTFVSKKGVVTPS-NAAFGSVSWNNAQNQVRSPIAFSW  120
            +LVF    D L Y V+F +  G++  +   AFGS+ W++ ++ VRSPIA  W
Sbjct  717  QLVFSQGNDTLSYEVSFTTASGILVGALKPAFGSLEWSDGEHLVRSPIAVVW  768



>ref|XP_006574858.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
 ref|XP_006574859.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=772

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 71/123 (58%), Gaps = 4/123 (3%)
 Frame = -3

Query  476  AIVKAPNITCAKK-LSNPAQLXYPSFXVLFGKSRI---VRQTRELTNVGAAGTLYEVAXE  309
            A++      C+KK +     L YPSF VL GKS +   V   R +TNVG   + Y V  E
Sbjct  649  ALLSRGKFVCSKKAVLQAGDLNYPSFAVLLGKSALNVSVTYRRVVTNVGKPQSAYAVKLE  708

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P  V+VTV+P KL F+ VG +L Y VTF+S  G      ++FGS+ W + + QVRSP+A
Sbjct  709  QPNGVSVTVEPRKLKFEKVGQKLSYKVTFLSIGGARVAGTSSFGSLIWVSGRYQVRSPMA  768

Query  128  FSW  120
             +W
Sbjct  769  VTW  771



>gb|EYU29358.1| hypothetical protein MIMGU_mgv1a024271mg [Erythranthe guttata]
Length=354

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 76/122 (62%), Gaps = 6/122 (5%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNP-AQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAX  312
            Q++  IV +  + C+K+ S P AQL YPSF ++FG S     TR LTNVG A + Y+V  
Sbjct  232  QEVGIIVGS-KVDCSKEKSIPEAQLNYPSFSIIFG-STPQTYTRTLTNVGKANSSYDVEI  289

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSP  135
             +P  V V V+P KLVF  +GD+  Y+VTF  + KGV+  S   F  + W++A+  VRSP
Sbjct  290  VSPDGVNVKVEPKKLVFPKLGDKSSYSVTFTRTTKGVMNSSTQGF--IRWHSAKYSVRSP  347

Query  134  IA  129
            IA
Sbjct  348  IA  349



>gb|KHN27220.1| Subtilisin-like protease [Glycine soja]
Length=741

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 71/123 (58%), Gaps = 4/123 (3%)
 Frame = -3

Query  476  AIVKAPNITCAKK-LSNPAQLXYPSFXVLFGKSRI---VRQTRELTNVGAAGTLYEVAXE  309
            A++      C+KK +     L YPSF VL GKS +   V   R +TNVG   + Y V  E
Sbjct  618  ALLSRGKFVCSKKAVLQAGDLNYPSFAVLLGKSALNVSVTYRRVVTNVGKPQSAYAVKLE  677

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P  V+VTV+P KL F+ VG +L Y VTF+S  G      ++FGS+ W + + QVRSP+A
Sbjct  678  QPNGVSVTVEPRKLNFEKVGQKLSYKVTFLSIGGARVAGTSSFGSLIWVSGRYQVRSPMA  737

Query  128  FSW  120
             +W
Sbjct  738  VTW  740



>gb|EYU29564.1| hypothetical protein MIMGU_mgv1a023796mg [Erythranthe guttata]
Length=738

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 73/122 (60%), Gaps = 5/122 (4%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNP-AQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAX  312
             Q   I+ A  + C+K+ + P AQL YPSF ++FG S     TR LTNVG A + Y+V  
Sbjct  615  NQEVGIIVARKVDCSKEKTIPEAQLNYPSFSIIFGSSPQT-YTRTLTNVGKANSSYDVEI  673

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSP  135
             +P  V V V+P KLVF  +GD+  Y+VTF  + KGV+  S   F  + W+ A+  VRSP
Sbjct  674  GSPDGVNVKVEPKKLVFPKLGDKSSYSVTFTRTNKGVMNSSTQGF--IRWHTAEYSVRSP  731

Query  134  IA  129
            IA
Sbjct  732  IA  733



>ref|XP_008462294.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Cucumis 
melo]
Length=770

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 52/126 (41%), Positives = 70/126 (56%), Gaps = 5/126 (4%)
 Frame = -3

Query  488  QQIQAIVKAPNIT--CAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVG-AAGTLYEV  318
            +QI   VK  + +  C  KLSNP  L YPSF V+F    +V+ TR +TNVG     +Y V
Sbjct  639  KQIAVFVKGSSYSQLCEHKLSNPGNLNYPSFSVVFDDGEVVKYTRTVTNVGDETEVVYGV  698

Query  317  AXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRS  138
              EAP  V ++V P KL F      L Y +TF    G     +A+FGS+ W++  + VRS
Sbjct  699  KVEAPQGVEISVVPNKLEFNKEKTTLSYEITFTKINGF--KESASFGSIQWSDGIHNVRS  756

Query  137  PIAFSW  120
            PIA S+
Sbjct  757  PIAVSF  762



>gb|EYU29364.1| hypothetical protein MIMGU_mgv1a022867mg [Erythranthe guttata]
Length=672

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 74/122 (61%), Gaps = 6/122 (5%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNP-AQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAX  312
            QQ+  IV   N+ C+K+ S P AQL YPSF ++FG S     TR LTNVG A + Y+V  
Sbjct  550  QQVGIIV-GRNVDCSKEKSIPEAQLNYPSFSIIFGSSPQT-YTRTLTNVGKANSSYDVEI  607

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSP  135
             +P  V V V+P +LVF  +GD+  Y VTF  + KG +  +   F  + W+NA+  VRSP
Sbjct  608  VSPDGVIVKVEPKQLVFPKLGDKSSYNVTFTRTTKGAMNGTTQGF--IRWHNAEYSVRSP  665

Query  134  IA  129
            IA
Sbjct  666  IA  667



>gb|KHN13888.1| Subtilisin-like protease [Glycine soja]
Length=738

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 71/123 (58%), Gaps = 4/123 (3%)
 Frame = -3

Query  476  AIVKAPNITCAKK-LSNPAQLXYPSFXVLFGKSRI---VRQTRELTNVGAAGTLYEVAXE  309
            A++      C+KK L     L YPSF VLFG+S     V   R +TNVG   + Y V  E
Sbjct  615  ALLSRGKFVCSKKTLLQAGNLNYPSFSVLFGRSASNASVTYRRVVTNVGNPQSAYAVKLE  674

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P  V+VTV+P KL F+ VG +L Y VTF+S  G      ++FGS+ W + + +VRSP+A
Sbjct  675  QPNGVSVTVEPRKLKFEKVGQKLSYKVTFLSIGGARVAGTSSFGSLVWVSGKYKVRSPMA  734

Query  128  FSW  120
             +W
Sbjct  735  VTW  737



>ref|XP_006576383.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
 ref|XP_006576384.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=766

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 72/123 (59%), Gaps = 4/123 (3%)
 Frame = -3

Query  476  AIVKAPNITCAKKLS-NPAQLXYPSFXVLF---GKSRIVRQTRELTNVGAAGTLYEVAXE  309
            AI+   N  CAKK + +   L YPSF VLF    ++  V   R +TNVG   + Y V  E
Sbjct  643  AILSKGNFKCAKKSALHAGGLNYPSFAVLFDTSARNASVTYKRVVTNVGNPSSSYAVKVE  702

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P  V+VTV+P  + F+ +GD+L Y V+FVS        +++FGS++W + +  VRSPIA
Sbjct  703  EPKGVSVTVEPRNIGFRKIGDKLSYKVSFVSYGRTAVAGSSSFGSLTWVSGKYAVRSPIA  762

Query  128  FSW  120
             +W
Sbjct  763  VTW  765



>ref|XP_004492670.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=785

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 72/123 (59%), Gaps = 5/123 (4%)
 Frame = -3

Query  476  AIVKAPNITCAKKLSNPAQLXYPSFXVLF---GKSRIVRQTRELTNVGAAGTLYEVAXEA  306
            AI+      C+ K      L YPSF V+F   GKS  V   R +TNVG + ++YEV  E 
Sbjct  663  AILSKSKFNCSMKQVQVGDLNYPSFSVIFSRTGKSASVTYKRVVTNVGKSESVYEVKVEQ  722

Query  305  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVS-KKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            P  V V+V+P KL F  +G +LRY VTF    KG V  S ++FGS+ W + + +VRSPIA
Sbjct  723  PNGVVVSVEPRKLKFDKLGQKLRYKVTFFGIGKGRVIGS-SSFGSLIWVSDKYKVRSPIA  781

Query  128  FSW  120
             +W
Sbjct  782  VTW  784



>ref|XP_004141706.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004155913.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN45480.1| Subtilase family protein [Cucumis sativus]
Length=771

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 69/126 (55%), Gaps = 5/126 (4%)
 Frame = -3

Query  488  QQIQAIVKAPNI--TCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVG-AAGTLYEV  318
            +QI   VK  +    C  KL+NP  L YPSF V+F +  +V+ TR +TNVG     +YEV
Sbjct  639  KQIAVFVKGSSYFQLCEHKLTNPGNLNYPSFSVVFDEEEVVKYTRTVTNVGDETEVVYEV  698

Query  317  AXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRS  138
              EAP  V ++V P KL F        Y +TF    G     +A+FGS+ W +  + VRS
Sbjct  699  KVEAPQGVVISVVPNKLEFNKEKTTQSYEITFTKINGF--KESASFGSIQWGDGIHSVRS  756

Query  137  PIAFSW  120
            PIA S+
Sbjct  757  PIAVSF  762



>gb|KHN04108.1| Subtilisin-like protease [Glycine soja]
Length=738

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 70/123 (57%), Gaps = 4/123 (3%)
 Frame = -3

Query  476  AIVKAPNITCAKKLS-NPAQLXYPSFXVLFGKSR---IVRQTRELTNVGAAGTLYEVAXE  309
            AI+   N  CAKK + +   L YPSF VLF  S     V   R +TNVG   + Y V  E
Sbjct  615  AILSKGNFKCAKKSALHAGGLNYPSFAVLFDTSTRNASVTYKRVVTNVGNPSSSYAVKVE  674

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P  V+V V+P  + F+ +GD+L Y V+FVS        +++FGS++W + +  VRSPIA
Sbjct  675  EPKGVSVIVEPRNISFRKIGDKLSYKVSFVSYGRTAVAGSSSFGSLTWVSGKYHVRSPIA  734

Query  128  FSW  120
             +W
Sbjct  735  VTW  737



>gb|EYU28963.1| hypothetical protein MIMGU_mgv1a023216mg [Erythranthe guttata]
Length=341

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 71/118 (60%), Gaps = 5/118 (4%)
 Frame = -3

Query  476  AIVKAPNITCAKKLSNP-AQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEAPP  300
             I+    + C+K+ S P AQL YPSF ++FG S     TR L NVG A + Y+V   +P 
Sbjct  222  GIIVGSKVDCSKEKSIPEAQLNYPSFSIIFG-STPQTYTRTLANVGKANSSYDVEIVSPD  280

Query  299  SVTVTVKPTKLVFKNVGDRLRYTVTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             V V V+P KLVF  +GD+  Y+VTF  + KGV+  S   F  + W++A+  VRSPIA
Sbjct  281  GVNVKVEPKKLVFPKLGDKSSYSVTFTRTTKGVMNSSTQGF--IRWHSAKYSVRSPIA  336



>ref|XP_010917483.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=778

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 49/115 (43%), Positives = 63/115 (55%), Gaps = 2/115 (2%)
 Frame = -3

Query  446  AKKLSNPAQLXYPSFXVLFGK-SRIVRQTRELTNVGAAG-TLYEVAXEAPPSVTVTVKPT  273
            A  L++P  L YP+F V+F   S IV  +R + NVG     +YE     PP V VTV P+
Sbjct  660  AMTLASPGDLNYPAFSVVFSSTSDIVTFSRVVRNVGGPDDAVYEAEISGPPGVNVTVAPS  719

Query  272  KLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  108
            KLVF  V   L Y +TF S        +  FG +SW++  + VRSPIA SW Q F
Sbjct  720  KLVFDAVDQSLSYEITFASIADAAVAGSNGFGGISWSDGTHSVRSPIAVSWRQSF  774



>ref|XP_002320086.2| subtilase family protein [Populus trichocarpa]
 gb|EEE98401.2| subtilase family protein [Populus trichocarpa]
Length=769

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 68/117 (58%), Gaps = 4/117 (3%)
 Frame = -3

Query  458  NITC-AKKLSNPAQLXYPSFXVLF-GKSR--IVRQTRELTNVGAAGTLYEVAXEAPPSVT  291
            N+TC   K   P  L YPSF V F G +R   V+  R LTNVG   + Y V  E P  V+
Sbjct  652  NVTCPDNKALQPGDLNYPSFAVNFEGNARNNRVKYKRTLTNVGTPWSTYAVKVEEPNGVS  711

Query  290  VTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            V ++P  L F+ +G +L Y VTFVS +G     +++FGS+ W + +  VRSPIA +W
Sbjct  712  VILEPKSLSFEKLGQKLSYNVTFVSSRGKGREGSSSFGSLVWLSGKYSVRSPIAVTW  768



>gb|EYU29552.1| hypothetical protein MIMGU_mgv1a0178121mg, partial [Erythranthe 
guttata]
Length=188

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 71/122 (58%), Gaps = 6/122 (5%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNP-AQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAX  312
            QQ+  I+    + C+K+ S P AQL YPSF ++FG S     TR LTNVG A + Y+V  
Sbjct  66   QQV-GILVGRKVDCSKEKSIPEAQLNYPSFSIVFG-STPQTYTRMLTNVGKANSSYDVEI  123

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSP  135
             +P  V V V+P KLVF  +GD+  Y+VTF  + KG +  +   F  + W  A   VRSP
Sbjct  124  VSPDGVNVKVEPKKLVFPKLGDKSSYSVTFTRTTKGAINSTTQGF--IRWYTADYSVRSP  181

Query  134  IA  129
            IA
Sbjct  182  IA  183



>ref|XP_007139243.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
 ref|XP_007139244.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
 gb|ESW11237.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
 gb|ESW11238.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
Length=770

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 71/123 (58%), Gaps = 4/123 (3%)
 Frame = -3

Query  476  AIVKAPNITCAKK-LSNPAQLXYPSFXVLFGKSRI---VRQTRELTNVGAAGTLYEVAXE  309
            A++      C+KK +     L YPSF VLFG+S     V   R +TNVG + + Y V  E
Sbjct  647  ALLSRRKFVCSKKAVLQAGDLNYPSFAVLFGRSAFNASVTYMRVVTNVGKSKSSYAVKVE  706

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P  V+V+V+P KL F+ +G +L Y VTF +  G      ++FGS+ W + + +VRSPIA
Sbjct  707  QPNGVSVSVEPRKLKFEKLGQKLSYNVTFFATGGPKVGGTSSFGSLIWVSDRYKVRSPIA  766

Query  128  FSW  120
             +W
Sbjct  767  ITW  769



>ref|XP_004308418.2| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=773

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 71/119 (60%), Gaps = 9/119 (8%)
 Frame = -3

Query  458  NITCAKKLS--NPAQLXYPSFXVLF---GKSRIVRQTRELTNVGAAG-TLYEVAXEAPPS  297
            N TC    +   P  L YPS  V+F   G+      TR +TNVGA   + Y V  EAP  
Sbjct  657  NFTCPSNSTVLQPGNLNYPSLSVVFRRDGRKMSATYTRTVTNVGAINPSTYAVQVEAPIG  716

Query  296  VTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            V+VTV+P KLVFK +G++L Y V+FV   G+   +N++FGS+ W + + +VRSPIA  W
Sbjct  717  VSVTVEPRKLVFKKMGEKLSYKVSFV---GMSATTNSSFGSLVWVSEKYRVRSPIAVIW  772



>ref|XP_010686124.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=771

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 76/126 (60%), Gaps = 8/126 (6%)
 Frame = -3

Query  485  QIQAIVKAPN-ITCA-KKLSNPAQLXYPSFXVLF-GKSRIVRQTRELTNVGAA-GTLYEV  318
             I+ I KAP  I CA +KLS+P  L YPSF V+F G +  V+ TR + NVG++   +Y+V
Sbjct  639  MIRVIFKAPAVIDCASQKLSSPGNLNYPSFSVVFRGATNKVKYTRVVKNVGSSKNAVYKV  698

Query  317  AXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRS  138
              +AP +V ++V P+ L F +    L Y +TF S     +   ++FGS+ W++  + VRS
Sbjct  699  NVKAPLNVQISVAPSTLTFTSTVQTLSYDITFTS----TSRGASSFGSIEWSDGNHHVRS  754

Query  137  PIAFSW  120
            PIA  W
Sbjct  755  PIAIQW  760



>gb|EYU29555.1| hypothetical protein MIMGU_mgv1a022042mg [Erythranthe guttata]
Length=720

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 71/122 (58%), Gaps = 6/122 (5%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNP-AQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAX  312
            QQ+  IV   N+ C+K+ S P AQL YPSF ++FG S     TR LTNVG A + Y+V  
Sbjct  598  QQVGIIV-GRNVDCSKEKSIPEAQLNYPSFSIIFGSSPQT-YTRTLTNVGKANSSYDVEI  655

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSP  135
             +P  VTV V+P KLVF  +GD+  Y VTF  + KG +      F  + W  A   VRSP
Sbjct  656  VSPNGVTVKVEPKKLVFPKLGDKSSYNVTFTRTTKGAMNSITQGF--IRWYTADYSVRSP  713

Query  134  IA  129
            I+
Sbjct  714  IS  715



>ref|XP_003551824.2| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=767

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 70/123 (57%), Gaps = 4/123 (3%)
 Frame = -3

Query  476  AIVKAPNITCAKK-LSNPAQLXYPSFXVLFGKSRI---VRQTRELTNVGAAGTLYEVAXE  309
            A++      C+KK +     L YPSF VLF +S +   V  TR +TNVG   + Y V  +
Sbjct  644  ALLSRGKFACSKKAVLQAGDLNYPSFAVLFDRSALNANVTYTRVVTNVGKPQSAYAVKVK  703

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P  V+VTV+P  L F+ VG +L Y VTF++         ++FGS+ W + + QVRSPIA
Sbjct  704  QPDGVSVTVEPRVLKFEKVGQKLSYKVTFLAVGKARVAGTSSFGSLIWVSGRYQVRSPIA  763

Query  128  FSW  120
             +W
Sbjct  764  LTW  766



>ref|XP_003554304.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
 gb|KHN02462.1| Subtilisin-like protease SDD1 [Glycine soja]
Length=768

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 75/123 (61%), Gaps = 11/123 (9%)
 Frame = -3

Query  458  NITCAK--KLSNPAQLXYPSFXVLFGKSRIVRQ--TRELTNVGAAGTLYEVAXEAPPSVT  291
            N++C    K++    L YPSF V+F K  + R+  +R LTNVG+A ++Y V  +AP  V 
Sbjct  644  NVSCNGIIKMNRGFSLNYPSFSVIF-KDEVRRKMFSRRLTNVGSANSIYSVEVKAPAGVK  702

Query  290  VTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPS---NAAFGSVSWNNAQN---QVRSPIA  129
            V VKP +LVFK V   L Y V F+S+K V       N + GS++W ++QN   +VRSP+A
Sbjct  703  VIVKPKRLVFKQVNQSLSYRVWFISRKKVKRGDGLVNHSEGSLTWVHSQNGSYRVRSPVA  762

Query  128  FSW  120
             +W
Sbjct  763  VTW  765



>gb|EYU28960.1| hypothetical protein MIMGU_mgv1a018215mg, partial [Erythranthe 
guttata]
Length=715

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 74/122 (61%), Gaps = 6/122 (5%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNP-AQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAX  312
            Q+I  IV    + C+++ S P AQL YPSF ++FG S     TR LTNVG A + Y V  
Sbjct  593  QEIGIIV-GRKVDCSEEKSIPEAQLNYPSFSIIFG-STPQTYTRTLTNVGKANSSYVVEI  650

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSP  135
             +P  V V V+P KLVF  +GD+  Y+VTF  + KGV+  +N   G + W+ A+  VRSP
Sbjct  651  ASPDGVIVKVEPQKLVFPKLGDKSSYSVTFTRTNKGVM--NNTTQGFIRWHTAEYSVRSP  708

Query  134  IA  129
            IA
Sbjct  709  IA  710



>gb|ACJ26761.1| subtilisin-like protein [Nicotiana benthamiana]
Length=191

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 68/122 (56%), Gaps = 8/122 (7%)
 Frame = -3

Query  455  ITCAKK-LSNPAQLXYPSFXVLF-GKSR-IVRQTRELTNVGA-AGTLYEVAXEAPPSVTV  288
            + C+++ L+ P  L YPSF V+F G+S  +V+  R + NVG     +YEV   AP SV V
Sbjct  63   VNCSERSLATPGDLNYPSFSVVFTGESNGVVKYKRVVKNVGKNTDAVYEVKVNAPSSVEV  122

Query  287  TVKPTKLVFKNVGDRLRYTVTFVSKKG----VVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             V P KLVF      L Y ++  SKK     +V    +AFGS+ W++  + VRSPIA  W
Sbjct  123  NVSPAKLVFSEEKQSLSYEISLKSKKSGDLQMVKGIESAFGSIEWSDGIHNVRSPIAVRW  182

Query  119  TQ  114
              
Sbjct  183  RH  184



>gb|KHN13887.1| Subtilisin-like protease [Glycine soja]
Length=687

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 70/123 (57%), Gaps = 4/123 (3%)
 Frame = -3

Query  476  AIVKAPNITCAKK-LSNPAQLXYPSFXVLFGKSRI---VRQTRELTNVGAAGTLYEVAXE  309
            A++      C+KK +     L YPSF VLF +S +   V  TR +TNVG   + Y V  +
Sbjct  564  ALLSRGKFACSKKAVLQAGDLNYPSFAVLFDRSALNANVTYTRVVTNVGKPQSAYAVKVK  623

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P  V+VTV+P  L F+ VG +L Y VTF++         ++FGS+ W + + QVRSPIA
Sbjct  624  QPDGVSVTVEPRVLKFEKVGQKLSYKVTFLAVGKARVAGTSSFGSLIWVSGRYQVRSPIA  683

Query  128  FSW  120
             +W
Sbjct  684  LTW  686



>gb|EYU31528.1| hypothetical protein MIMGU_mgv1a0212142mg, partial [Erythranthe 
guttata]
Length=435

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 70/118 (59%), Gaps = 5/118 (4%)
 Frame = -3

Query  476  AIVKAPNITCAKKLSNP-AQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEAPP  300
            +I+    + C+K+ S P AQL YPSF ++FG S     TR LTNVG A + Y+V   +P 
Sbjct  316  SILVGRKVDCSKEKSIPEAQLNYPSFSIVFG-STPQTYTRTLTNVGKANSSYDVEIVSPD  374

Query  299  SVTVTVKPTKLVFKNVGDRLRYTVTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             V V V+P KLVF  +GD+  Y+VTF  + KG +  +   F  + W +A   VRSPIA
Sbjct  375  GVNVKVEPKKLVFPKLGDKSSYSVTFTRTTKGAINSTTQGF--IRWYSADYSVRSPIA  430



>ref|XP_007051971.1| Subtilase family protein [Theobroma cacao]
 gb|EOX96128.1| Subtilase family protein [Theobroma cacao]
Length=768

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 65/116 (56%), Gaps = 3/116 (3%)
 Frame = -3

Query  458  NITCAKK-LSNPAQLXYPSFXVLFGKSRI--VRQTRELTNVGAAGTLYEVAXEAPPSVTV  288
            N TC K  +  P  L YPSF V F  S    V   R +TNVG   + Y+V  E P  V+V
Sbjct  652  NFTCPKHAIMQPGDLNYPSFAVNFKSSAAENVTYKRTVTNVGTPKSTYKVLVEEPKGVSV  711

Query  287  TVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             VKP  L FK +G +L Y VTF+  K     + ++FGS+ W + + +VRSPIA SW
Sbjct  712  IVKPEILTFKMLGKKLSYKVTFIGLKRTKPVAASSFGSLVWVSGKYRVRSPIAASW  767



>ref|XP_011035007.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=769

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 66/117 (56%), Gaps = 4/117 (3%)
 Frame = -3

Query  458  NITC-AKKLSNPAQLXYPSFXVLF-GKSR--IVRQTRELTNVGAAGTLYEVAXEAPPSVT  291
            N+TC   K   P  L YPSF V F G +R   V+  R LTNVG   + Y V  E P  V+
Sbjct  652  NVTCPDNKALQPGDLNYPSFAVNFEGNARNNRVKYKRTLTNVGTPSSTYAVKVEEPNGVS  711

Query  290  VTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            V ++P  L F+ +G +L Y VTFVS  G     +++ GS+ W + +  VRSPIA +W
Sbjct  712  VILEPKSLSFEKLGQKLSYNVTFVSSGGKGREGSSSIGSLVWLSGKYSVRSPIAVTW  768



>ref|XP_009611962.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
 ref|XP_009611971.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=767

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 73/123 (59%), Gaps = 5/123 (4%)
 Frame = -3

Query  476  AIVKAPNITC-AKKLSNPAQLXYPSFXVLFG-KSRIVRQT--RELTNVGAAGTLYEVAXE  309
            A++   N TC +  + +P  L YPSF VLF  KSR + QT  R  TNVG   + Y V   
Sbjct  645  ALLLRKNYTCPSHAIQSPGDLNYPSFAVLFDSKSRNLIQTFKRSATNVGNPMSTYVVQVN  704

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            AP  V+VTVKP  L F+  G +LRY + FV+ +G  +  ++ FGS+ W +  + VRSPIA
Sbjct  705  APSGVSVTVKPKILKFEKKGQKLRYKMRFVA-RGKRSAGDSTFGSLVWFSKIHIVRSPIA  763

Query  128  FSW  120
             +W
Sbjct  764  ITW  766



>ref|XP_004958126.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=780

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 47/114 (41%), Positives = 61/114 (54%), Gaps = 2/114 (2%)
 Frame = -3

Query  455  ITCAKKLSN-PAQLXYPSFXVLFGKSRIVRQ-TRELTNVGAAGTLYEVAXEAPPSVTVTV  282
            + C + L+  PA L YPSF V+F     +R  TR LT V      Y V   AP  V V +
Sbjct  665  VKCTRTLAGGPADLNYPSFVVVFDDRTAIRTLTRTLTKVFEEAETYNVTVMAPEHVKVII  724

Query  281  KPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             PT L FK   +   YTV FV++ G    S   FG +SW N +++VRSP+AF W
Sbjct  725  TPTTLEFKEPKETRSYTVEFVNEAGGNRKSGWDFGHISWENEKHRVRSPVAFQW  778



>ref|XP_003520616.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
Length=768

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 73/122 (60%), Gaps = 9/122 (7%)
 Frame = -3

Query  458  NITC--AKKLSNPAQLXYPSFXVLF-GKSRIVRQTRELTNVGAAGTLYEVAXEAPPSVTV  288
            N++C    K++    L YPSF V+F G  R    +R LTNVG+A ++Y +  +AP  V V
Sbjct  644  NVSCNAIMKMNRGFSLNYPSFSVIFKGGVRRKMFSRRLTNVGSANSIYSMEVKAPEGVKV  703

Query  287  TVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPS---NAAFGSVSWNNAQN---QVRSPIAF  126
             VKP +LVFK V   L Y V F+S+K V       N A GS++W ++QN   +VRSP+A 
Sbjct  704  IVKPKRLVFKQVNQSLSYRVWFISRKRVKRGDDLVNYAEGSLTWVHSQNGSYRVRSPVAV  763

Query  125  SW  120
            +W
Sbjct  764  TW  765



>gb|KHN10783.1| Subtilisin-like protease SDD1 [Glycine soja]
Length=693

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 73/122 (60%), Gaps = 9/122 (7%)
 Frame = -3

Query  458  NITC--AKKLSNPAQLXYPSFXVLF-GKSRIVRQTRELTNVGAAGTLYEVAXEAPPSVTV  288
            N++C    K++    L YPSF V+F G  R    +R LTNVG+A ++Y +  +AP  V V
Sbjct  569  NVSCNAIMKMNRGFSLNYPSFSVIFKGGVRRKMFSRRLTNVGSANSIYSMEVKAPEGVKV  628

Query  287  TVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPS---NAAFGSVSWNNAQN---QVRSPIAF  126
             VKP +LVFK V   L Y V F+S+K V       N A GS++W ++QN   +VRSP+A 
Sbjct  629  IVKPKRLVFKQVNQSLSYRVWFISRKRVKRGDDLVNYAEGSLTWVHSQNGSYRVRSPVAV  688

Query  125  SW  120
            +W
Sbjct  689  TW  690



>gb|ACN28035.1| unknown [Zea mays]
Length=380

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 71/134 (53%), Gaps = 14/134 (10%)
 Frame = -3

Query  485  QIQAIVKAPNITCAK-KLSNPAQLXYPSFXVLF--------GKSRIVRQTRELTNVGAAG  333
             I A+ ++    CA+ K  +   L YPSF V +        G S  V  TR LTNVG AG
Sbjct  250  MIAAVARSREYACAENKTYSVGALNYPSFSVAYSTANGDGGGDSATVTHTRTLTNVGGAG  309

Query  332  TL-YEVAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSN-AAFGSVSWNN  159
            T     +  A   V V V+P +L F +VG++  YTV F SK     PS  A FG + W++
Sbjct  310  TYKASTSLAAAKGVAVDVEPAELEFTSVGEKKSYTVRFTSKS---QPSGTAGFGRLVWSD  366

Query  158  AQNQVRSPIAFSWT  117
             ++ V SPIAF+WT
Sbjct  367  GKHSVASPIAFTWT  380



>ref|XP_004305758.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=773

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 46/114 (40%), Positives = 70/114 (61%), Gaps = 5/114 (4%)
 Frame = -3

Query  449  CAKK-LSNPAQLXYPSFXVLFGKSR-IVRQTRELTNVGAA-GTLYEVAXEAPPSVTVTVK  279
            CA+  L++P  L YPSF V+F   R +V+  R +TNVG+    +YEV  +AP  V ++V+
Sbjct  654  CARNSLASPGDLNYPSFAVVFKPGRELVKYKRVVTNVGSVVDAVYEVNVDAPAGVEISVE  713

Query  278  PTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  117
            P+KLVF  V     Y VTF   KG+   +   +GS+ W++ ++ VRSP+A  W+
Sbjct  714  PSKLVFSEVNQTQSYEVTFA--KGIGYVNGERYGSIEWSDGRHHVRSPVAVRWS  765



>gb|EAY90937.1| hypothetical protein OsI_12551 [Oryza sativa Indica Group]
Length=470

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 75/137 (55%), Gaps = 18/137 (13%)
 Frame = -3

Query  485  QIQAIVKAPNITCAK-KLSNPAQLXYPSFXVLF------------GKSRIVRQTRELTNV  345
             I A+ ++ +  C + K  +   L YPSF V +              +  V   R LTNV
Sbjct  338  MIAAVARSKSYGCTEGKAYSVYNLNYPSFAVAYSTASSQAAEGSGAAATTVTHKRTLTNV  397

Query  344  GAAGTLYEVAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSN-AAFGSVS  168
            GAAGT Y+V+  A P V V V+PT+L F + G++  YTV+F +K     PS  A FG + 
Sbjct  398  GAAGT-YKVSAAAMPGVAVAVEPTELAFTSAGEKKSYTVSFTAKS---QPSGTAGFGRLV  453

Query  167  WNNAQNQVRSPIAFSWT  117
            W++ ++ V SPIAF+WT
Sbjct  454  WSDGKHSVASPIAFTWT  470



>emb|CAN81091.1| hypothetical protein VITISV_040911 [Vitis vinifera]
Length=430

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 71/127 (56%), Gaps = 5/127 (4%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSN--PAQLXYPSFXVLF-GKSRIVRQT--RELTNVGAAGTLYE  321
            QI  + +  + TC     +  P  L YPSF VLF G ++  R T  R +TNVG   T Y 
Sbjct  303  QIARVSRRISFTCPNDTVHLQPGDLNYPSFAVLFNGNAQKNRATYKRSVTNVGYPTTTYV  362

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVR  141
               + P  V+V VKP  L FK +  +L Y V+FV+ +   T SN +FGS+ W + + +VR
Sbjct  363  AQVQEPEGVSVMVKPNVLKFKELNQKLSYKVSFVASRKTSTSSNWSFGSLVWVSRKYRVR  422

Query  140  SPIAFSW  120
            SPIA +W
Sbjct  423  SPIAVTW  429



>ref|XP_007220042.1| hypothetical protein PRUPE_ppa027143mg [Prunus persica]
 gb|EMJ21241.1| hypothetical protein PRUPE_ppa027143mg [Prunus persica]
Length=765

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 71/126 (56%), Gaps = 5/126 (4%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKK-LSNPAQLXYPSFXVLFGKS---RIVRQTRELTNVGAAGTLYEV  318
            QI       N TC K  +  P  L YPSF VLF K      V   R + NVG   + Y V
Sbjct  640  QIALFSSGVNFTCPKNAVLQPGDLNYPSFSVLFSKDARNMSVTYKRTVKNVGKIPSTYAV  699

Query  317  AXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRS  138
              + P  V+VTV+P  L FK +G++L Y V+FV+  G  T +N++FG+++W + + +V S
Sbjct  700  QVKEPTGVSVTVEPRSLRFKKMGEKLSYKVSFVALGG-PTLTNSSFGTLTWVSGKYRVGS  758

Query  137  PIAFSW  120
            PIA +W
Sbjct  759  PIAVTW  764



>gb|AFG56825.1| hypothetical protein 2_4281_02, partial [Pinus taeda]
 gb|AFG56826.1| hypothetical protein 2_4281_02, partial [Pinus taeda]
 gb|AFG56827.1| hypothetical protein 2_4281_02, partial [Pinus taeda]
 gb|AFG56828.1| hypothetical protein 2_4281_02, partial [Pinus taeda]
 gb|AFG56830.1| hypothetical protein 2_4281_02, partial [Pinus taeda]
Length=114

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 64/106 (60%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  LXYPSFXVLFGKSRIVR-QTRELTNVGAAGTLYEVAXEAPPSVTVTVKPTKLVFKNVGDR  243
            L YPSF V+F    +VR  TR +TNVG A ++Y++A E+PP+V + V+P+ L F    ++
Sbjct  1    LNYPSFSVVFKPLNLVRVATRTVTNVGGAPSVYKIAVESPPTVNIIVEPSTLTFGKKNEK  60

Query  242  LRYTVTFVSKK--GVVTPSNAAFGSVSWNNAQNQ---VRSPIAFSW  120
              +TVTF SK   G  +    +FG +SW   Q     VRSP+A +W
Sbjct  61   ANFTVTFESKIAFGFKSRERQSFGQISWQCVQGGAQVVRSPVAITW  106



>gb|EYU21314.1| hypothetical protein MIMGU_mgv1a001662mg [Erythranthe guttata]
Length=777

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 51/125 (41%), Positives = 71/125 (57%), Gaps = 10/125 (8%)
 Frame = -3

Query  464  APNITCAK-KLSNPAQLXYPSFXVLF-GKSRIVRQTRELTNVGA-AGTLYEVAXEAPPSV  294
            A ++ C K     P  L YPSF V+F G+  +V+  R +TNVG+    +YEV   APP V
Sbjct  645  ASSVDCDKLGFKTPGNLNYPSFSVVFYGEESVVKYNRTVTNVGSEVDAVYEVRVGAPPGV  704

Query  293  TVTVKPTKLVFKNVGDRLRYTVTFVSKKG------VVTPSNAAFGSVSWNNAQNQ-VRSP  135
             V+V P+KLVF    D+L Y VTF S         +V  + ++FGS+ W++  +  VRSP
Sbjct  705  EVSVSPSKLVFSETEDKLSYEVTFKSSSSASSGLEIVGSAKSSFGSIEWSDGGSHLVRSP  764

Query  134  IAFSW  120
            IA  W
Sbjct  765  IAAVW  769



>gb|KCW53526.1| hypothetical protein EUGRSUZ_J02805 [Eucalyptus grandis]
Length=778

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/130 (38%), Positives = 73/130 (56%), Gaps = 8/130 (6%)
 Frame = -3

Query  488  QQIQAIVKAP--NITCAKKLSNPAQLXYPSFXV-LFGKSRIVRQTRELTNVGA-AGTLYE  321
            ++I   ++ P  +  CA +++ P +L YPSF V L     +V+  R + NVG+ A  +YE
Sbjct  646  RRIAVFLREPMSSTVCANRMATPGELNYPSFSVVLTSNGDVVKYRRVVKNVGSSADAVYE  705

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVS-KKGVVTPSNAAFGSVSWNNAQNQV  144
            V  +AP +V V+V P+KL F      L Y +TF S   G  TP    FGS+ W +  ++V
Sbjct  706  VKVDAPENVEVSVSPSKLEFSAENQILSYEITFSSIALGSSTPK---FGSIEWTDGTHRV  762

Query  143  RSPIAFSWTQ  114
            RSPIA  W Q
Sbjct  763  RSPIAVKWHQ  772



>ref|XP_008228179.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=810

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 70/129 (54%), Gaps = 7/129 (5%)
 Frame = -3

Query  488  QQIQAIVKAP---NITCAKKLSNPAQLXYPSFXVLFGKSR-IVRQTRELTNVGA-AGTLY  324
            +QI   V  P   +I     L++P  L YPSF V+    + +V+  R  TNVGA A  +Y
Sbjct  676  RQIAVFVGKPTGSDICTRNSLASPGDLNYPSFSVVLSSDQGLVKYKRIATNVGADADAVY  735

Query  323  EVAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQV  144
            EV   AP  V ++V+P KLVF        Y VTF  K+GV   S   +GS+ W + ++ V
Sbjct  736  EVTVNAPAGVEISVEPRKLVFSAENQTQSYEVTF--KRGVGYDSGERYGSIEWTDGRHLV  793

Query  143  RSPIAFSWT  117
            RSP+A  W+
Sbjct  794  RSPVAVRWS  802



>ref|XP_010033727.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=829

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 50/130 (38%), Positives = 73/130 (56%), Gaps = 8/130 (6%)
 Frame = -3

Query  488  QQIQAIVKAP--NITCAKKLSNPAQLXYPSFXV-LFGKSRIVRQTRELTNVGA-AGTLYE  321
            ++I   ++ P  +  CA +++ P +L YPSF V L     +V+  R + NVG+ A  +YE
Sbjct  697  RRIAVFLREPMSSTVCANRMATPGELNYPSFSVVLTSNGDVVKYRRVVKNVGSSADAVYE  756

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVS-KKGVVTPSNAAFGSVSWNNAQNQV  144
            V  +AP +V V+V P+KL F      L Y +TF S   G  TP    FGS+ W +  ++V
Sbjct  757  VKVDAPENVEVSVSPSKLEFSAENQILSYEITFSSIALGSSTPK---FGSIEWTDGTHRV  813

Query  143  RSPIAFSWTQ  114
            RSPIA  W Q
Sbjct  814  RSPIAVKWHQ  823



>gb|EAZ04458.1| hypothetical protein OsI_26606 [Oryza sativa Indica Group]
Length=770

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 59/113 (52%), Gaps = 3/113 (3%)
 Frame = -3

Query  449  CAKKL--SNPAQLXYPSFXVLF-GKSRIVRQTRELTNVGAAGTLYEVAXEAPPSVTVTVK  279
            CA  L    PA L YPSF V F G +R+   TR +T V      Y VA  AP  V VTV+
Sbjct  657  CAPALPGGGPANLNYPSFVVAFNGSTRVRTLTRTVTKVYEKPETYSVAVSAPAGVKVTVR  716

Query  278  PTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            P  L FK   +   YTV F S  G     +  FG +SW N ++QVRSP+ F W
Sbjct  717  PATLEFKEKNEEKSYTVEFTSVAGGHVNQSWDFGHISWENRKHQVRSPVVFMW  769



>ref|NP_001060094.1| Os07g0578300 [Oryza sativa Japonica Group]
 dbj|BAC83078.1| putative subtilisin-like serine protease [Oryza sativa Japonica 
Group]
 dbj|BAD30472.1| putative subtilisin-like serine protease [Oryza sativa Japonica 
Group]
 dbj|BAF22008.1| Os07g0578300 [Oryza sativa Japonica Group]
 gb|EAZ40414.1| hypothetical protein OsJ_24865 [Oryza sativa Japonica Group]
Length=770

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 59/113 (52%), Gaps = 3/113 (3%)
 Frame = -3

Query  449  CAKKL--SNPAQLXYPSFXVLF-GKSRIVRQTRELTNVGAAGTLYEVAXEAPPSVTVTVK  279
            CA  L    PA L YPSF V F G +R+   TR +T V      Y VA  AP  V VTV+
Sbjct  657  CAPALPGGGPANLNYPSFVVAFNGSTRVRTLTRTVTKVYEKPETYSVAVSAPAGVKVTVR  716

Query  278  PTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            P  L FK   +   YTV F S  G     +  FG +SW N ++QVRSP+ F W
Sbjct  717  PATLEFKEKNEEKSYTVEFTSVAGGHVNQSWDFGHISWENRKHQVRSPVVFMW  769



>ref|XP_006358406.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=742

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 72/121 (60%), Gaps = 4/121 (3%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNP-AQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAX  312
            QQ+ +IVK   + C K    P AQL YPSF + FG+S     TR +TN+G A + Y V  
Sbjct  616  QQVGSIVKH-KVDCNKVKHIPEAQLNYPSFSIKFGESSQTY-TRTVTNIGEANSSYSVEI  673

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPI  132
            ++PP VTV VKP+ L F  +  +L+Y VTF +++   T S  A G + W+  +  VRSPI
Sbjct  674  DSPPGVTVIVKPSTLKFSQLNQKLKYQVTF-TRRDNSTNSGIAQGFLKWSWKKYSVRSPI  732

Query  131  A  129
            A
Sbjct  733  A  733



>gb|ACN27710.1| unknown [Zea mays]
Length=701

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 71/134 (53%), Gaps = 14/134 (10%)
 Frame = -3

Query  485  QIQAIVKAPNITCAK-KLSNPAQLXYPSFXVLF--------GKSRIVRQTRELTNVGAAG  333
             I A+ ++    CA+ K  +   L YPSF V +        G S  V  TR LTNVG AG
Sbjct  571  MIAAVARSREYACAENKTYSVGALNYPSFSVAYSTANGDGGGDSATVTHTRTLTNVGGAG  630

Query  332  TL-YEVAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSN-AAFGSVSWNN  159
            T     +  A   V V V+P +L F +VG++  YTV F SK     PS  A FG + W++
Sbjct  631  TYKASTSLAAAKGVAVDVEPAELEFTSVGEKKSYTVRFTSKS---QPSGTAGFGRLVWSD  687

Query  158  AQNQVRSPIAFSWT  117
             ++ V SPIAF+WT
Sbjct  688  GKHSVASPIAFTWT  701



>ref|XP_009403290.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=773

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 45/108 (42%), Positives = 61/108 (56%), Gaps = 2/108 (2%)
 Frame = -3

Query  437  LSNPAQLXYPSFXVLFG-KSRIVRQTRELTNVG-AAGTLYEVAXEAPPSVTVTVKPTKLV  264
            L +P  L YP+F V+F   S +V   R + NVG +A   YE    +PP V VTV P+ LV
Sbjct  658  LDSPGDLNYPAFSVIFSSNSDVVTYKRVVRNVGTSAAAAYEARVSSPPGVDVTVTPSTLV  717

Query  263  FKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            F  V   L Y +TF S        + A+GS+SW++  + VRSPIA +W
Sbjct  718  FDAVNVSLSYEITFTSLASQAVAGSYAYGSISWSDGDHDVRSPIAVTW  765



>ref|XP_006490976.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
 gb|KDO85943.1| hypothetical protein CISIN_1g004242mg [Citrus sinensis]
Length=766

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 69/123 (56%), Gaps = 7/123 (6%)
 Frame = -3

Query  476  AIVKAPNITCAKKLS-NPAQLXYPSFXVLFG---KSRIVRQTRELTNVGAAGTLYEVAXE  309
            A+    N TC    + +P +L YPSF V F    K+  +   R +TNVG +   Y V  E
Sbjct  646  ALFAGGNFTCPNPSAFHPGKLNYPSFAVNFKGNVKNMSLEYERSVTNVGTSYCTYAVKVE  705

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P  V VT+ P  L F+ +G+ L Y VTFVS +G    SN +FGS++W + +  V+SPIA
Sbjct  706  EPNGVLVTITPPILSFQKIGEILSYKVTFVSLRGA---SNESFGSLTWVSGKYAVKSPIA  762

Query  128  FSW  120
             +W
Sbjct  763  VTW  765



>ref|XP_007024651.1| Subtilase family protein [Theobroma cacao]
 gb|EOY27273.1| Subtilase family protein [Theobroma cacao]
Length=767

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 48/130 (37%), Positives = 68/130 (52%), Gaps = 5/130 (4%)
 Frame = -3

Query  488  QQIQAIVKAPN--ITCAKKLSNPAQLXYPSFXVLF-GKSRIVRQTRELTNVG-AAGTLYE  321
            ++I   V+ P     C  KL+ P  L YPSF V+F     +V+  R + NVG +   +YE
Sbjct  632  KRIAIFVREPTGPDVCEGKLATPGNLNYPSFSVVFDSNDHVVKYKRTVKNVGPSVDAVYE  691

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKK-GVVTPSNAAFGSVSWNNAQNQV  144
                APP V ++V P+KL F      L Y +TF S    +   +  AFGS+ W++  + V
Sbjct  692  AKVNAPPGVEISVSPSKLEFSAENQTLSYEITFASDGLALFAVALEAFGSIEWSDGVHLV  751

Query  143  RSPIAFSWTQ  114
            RSPIA  W Q
Sbjct  752  RSPIAVRWLQ  761



>ref|XP_006358407.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=743

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 72/121 (60%), Gaps = 4/121 (3%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNP-AQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAX  312
            QQ+ +IVK   + C K    P AQL YPSF + FG+S     TR +TNVG A + Y V  
Sbjct  617  QQVGSIVKH-KVDCKKVKHIPEAQLNYPSFSIEFGESSQTY-TRTVTNVGEAKSSYTVEI  674

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPI  132
            ++PP VTV VKP+ L F  +  +L+Y V F +++   T S  A G + W++ +  VRSPI
Sbjct  675  DSPPGVTVIVKPSTLKFSQLNQKLKYQVMF-TRRDNSTNSGIAQGFLKWSSKKYSVRSPI  733

Query  131  A  129
            A
Sbjct  734  A  734



>ref|XP_008232840.1| PREDICTED: subtilisin-like protease [Prunus mume]
 ref|XP_008232841.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=765

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 70/126 (56%), Gaps = 5/126 (4%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKK-LSNPAQLXYPSFXVLFGKS---RIVRQTRELTNVGAAGTLYEV  318
            QI       N TC K  +  P  L YPSF VLF K      V   R + NVG   + Y V
Sbjct  640  QIALFSSGVNFTCPKNAVLQPGDLNYPSFSVLFSKDARNMSVTYKRTVKNVGKIPSTYAV  699

Query  317  AXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRS  138
              + P  V+VTV+P  L FK +G++L Y V+FV+  G    +N++FG+++W + + +V S
Sbjct  700  QVKEPTGVSVTVEPRSLGFKKMGEKLSYKVSFVALGGPAL-TNSSFGTLTWVSGKYRVGS  758

Query  137  PIAFSW  120
            PIA +W
Sbjct  759  PIAVTW  764



>ref|XP_004512212.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=757

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 67/105 (64%), Gaps = 9/105 (9%)
 Frame = -3

Query  422  QLXYPSFXVLFGKSRIVRQ---TRELTNVGAAGTLYEVAXEAP-PSVTVTVKPTKLVFKN  255
             L YPSF V+F  +  V++   TR LTNVG AGT Y+V+ ++  PSV + V+PT L FK 
Sbjct  656  DLNYPSFAVVFESANGVKEIKYTRTLTNVGEAGT-YKVSIKSDVPSVKILVEPTVLSFKQ  714

Query  254  VGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
              ++  YTVTF +     TPS   FGS+ W+N +  VRSPIAFSW
Sbjct  715  -NEKKSYTVTFTTSGSQDTPS---FGSLEWSNGKTIVRSPIAFSW  755



>ref|XP_006445191.1| hypothetical protein CICLE_v10018512mg [Citrus clementina]
 gb|ESR58431.1| hypothetical protein CICLE_v10018512mg [Citrus clementina]
Length=1364

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 69/123 (56%), Gaps = 7/123 (6%)
 Frame = -3

Query  476   AIVKAPNITCAKKLS-NPAQLXYPSFXVLFG---KSRIVRQTRELTNVGAAGTLYEVAXE  309
             A+    N TC    + +P +L YPSF V F    K+  +   R +TNVG +   Y V  E
Sbjct  1244  ALFAGGNFTCPNPSAFHPGKLNYPSFAVNFKGNVKNMSLEYERSVTNVGTSYCTYAVKVE  1303

Query  308   APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
              P  V VT+ P  L F+ +G+ L Y VTFVS +G    SN +FGS++W + +  V+SPIA
Sbjct  1304  EPNGVLVTITPPILSFQKIGEILSYKVTFVSLRGA---SNESFGSLTWVSGKYAVKSPIA  1360

Query  128   FSW  120
              +W
Sbjct  1361  VTW  1363



>gb|EYU29554.1| hypothetical protein MIMGU_mgv1a0256351mg, partial [Erythranthe 
guttata]
Length=434

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 71/122 (58%), Gaps = 6/122 (5%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNP-AQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAX  312
            QQ+  IV   ++ C+K+ S P AQL YPSF ++FG S     TR LTNVG   + Y+V  
Sbjct  312  QQVGIIV-GRDVDCSKEKSIPEAQLNYPSFSIIFG-STPQTYTRTLTNVGKPDSSYDVEI  369

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSP  135
             +P +V V V+P KLVF  +GD+  Y VTF  + K V+  +   F  + W  A   VRSP
Sbjct  370  VSPDNVIVKVEPKKLVFPKLGDKSSYNVTFTRTTKEVMNSTTQGF--IRWYTADYSVRSP  427

Query  134  IA  129
            IA
Sbjct  428  IA  429



>gb|AFG56829.1| hypothetical protein 2_4281_02, partial [Pinus taeda]
Length=114

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 63/106 (59%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  LXYPSFXVLFGKSRIVR-QTRELTNVGAAGTLYEVAXEAPPSVTVTVKPTKLVFKNVGDR  243
            L YPSF V+F    +VR  TR +TNVG A ++Y++A E+PP+V + V+P  L F    ++
Sbjct  1    LNYPSFSVVFKPLNLVRVATRTVTNVGGAPSVYKIAVESPPTVNIIVEPRTLTFGKKNEK  60

Query  242  LRYTVTFVSKK--GVVTPSNAAFGSVSWNNAQNQ---VRSPIAFSW  120
              +TVTF SK   G  +    +FG +SW   Q     VRSP+A +W
Sbjct  61   ANFTVTFESKIAFGFKSRERQSFGQISWQCVQGGAQVVRSPVAITW  106



>gb|AFB32958.1| hypothetical protein 0_744_01, partial [Pinus mugo]
 gb|AFG70680.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70681.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70682.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70683.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70684.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70685.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70686.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70687.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70688.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70689.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70690.1| hypothetical protein 0_744_01, partial [Pinus taeda]
Length=152

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 57/99 (58%), Gaps = 3/99 (3%)
 Frame = -3

Query  452  TCAKKLSNPAQLXYPSFXVLFGKSRIVRQT-RELTNVGAAGTLYEVAXEAPPSVTVTVKP  276
            +C K  S P  L YPSF V+F    +VR T R +TNVG A  +YE+A E+P +V +TV+P
Sbjct  43   SCPKLSSAPGDLNYPSFSVVFKPRSLVRVTKRTVTNVGGAPCVYEMAVESPENVNITVEP  102

Query  275  TKLVFKNVGDRLRYTVTFVSKKGVVTPSNA--AFGSVSW  165
            T L F+   D+  YTV F SK      S    AFG + W
Sbjct  103  TTLAFEKQNDKATYTVKFESKIAADNKSKGGQAFGQILW  141



>ref|XP_008454762.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=764

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 66/124 (53%), Gaps = 5/124 (4%)
 Frame = -3

Query  476  AIVKAPNITCAKKLS--NPAQLXYPSFXVLF---GKSRIVRQTRELTNVGAAGTLYEVAX  312
            A+V   N+TC+ K +   P  L YPSF V      K   +   R +TNVG   + Y V  
Sbjct  640  ALVSRGNLTCSSKRTVVKPGDLNYPSFSVFMKKKAKKVSITLKRTVTNVGITRSDYTVKI  699

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPI  132
              P  VTV VKP KL F ++G++L Y V+FVS  G       +FGS+ W + +  VRSPI
Sbjct  700  NNPKGVTVIVKPEKLSFGSLGEQLSYKVSFVSLGGKEALDKFSFGSLVWISGKYAVRSPI  759

Query  131  AFSW  120
              +W
Sbjct  760  VVTW  763



>ref|XP_004140440.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004167887.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=766

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 66/124 (53%), Gaps = 5/124 (4%)
 Frame = -3

Query  476  AIVKAPNITCAKKLS--NPAQLXYPSFXVLF---GKSRIVRQTRELTNVGAAGTLYEVAX  312
            A+V   N TC+ K +   P  L YPSF V      K   +   R +TNVG + + Y V  
Sbjct  642  ALVSRGNFTCSSKRTVVKPGDLNYPSFSVFMKKKAKKVSITLKRTVTNVGISRSDYTVKI  701

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPI  132
              P  +TV VKP KL F ++G++L Y V FVS  G       +FGS+ W + +  VRSPI
Sbjct  702  NNPKGITVIVKPEKLSFGSLGEQLSYQVRFVSLGGKEALDTFSFGSLVWISGKYAVRSPI  761

Query  131  AFSW  120
            A +W
Sbjct  762  AVTW  765



>ref|XP_006357406.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=776

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 46/119 (39%), Positives = 68/119 (57%), Gaps = 7/119 (6%)
 Frame = -3

Query  455  ITCAKK-LSNPAQLXYPSFXVLFGKSR--IVRQTRELTNVGA-AGTLYEVAXEAPPSVTV  288
            + C+++ L+ P  L YPSF V F      +V+  R + NVG  +  +YEV   AP +V V
Sbjct  650  VNCSERSLATPGDLNYPSFSVDFTSDSNGVVKYKRVVKNVGGDSNAVYEVKVNAPSAVEV  709

Query  287  TVKPTKLVFKNVGDRLRYTVTFVSKKG---VVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            +V P KLVF    + L Y ++F SK+    +V    +AFGS+ W++  + VRSPIA  W
Sbjct  710  SVSPAKLVFSEENNSLSYEISFTSKRSEDIMVKGIQSAFGSIEWSDGIHSVRSPIAVRW  768



>ref|XP_011072593.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=774

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 51/124 (41%), Positives = 68/124 (55%), Gaps = 8/124 (6%)
 Frame = -3

Query  467  KAPNITC-AKKLSNPAQLXYPSFXVLF-GKSRIVRQTRELTNVGA-AGTLYEVAXEAPPS  297
            +A ++ C A     P  L YPSF V+F G   +V+  R + NVG  A  +YEV    P  
Sbjct  643  QASSVDCDALGFKTPGNLNYPSFSVVFSGSESVVKYKRTVKNVGKEANAVYEVKVNTPLG  702

Query  296  VTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVV----TPSNAAFGSVSWNNAQNQ-VRSPI  132
            V V+V P+KLVF    D+L Y VTF S    V    T S ++FGS+ W++  +  VRSPI
Sbjct  703  VEVSVSPSKLVFSEKEDKLSYEVTFKSSANAVGFEITGSKSSFGSIEWSDGGSHLVRSPI  762

Query  131  AFSW  120
            A  W
Sbjct  763  AVLW  766



>ref|XP_009762584.1| PREDICTED: subtilisin-like protease isoform X4 [Nicotiana sylvestris]
 ref|XP_009762585.1| PREDICTED: subtilisin-like protease isoform X4 [Nicotiana sylvestris]
Length=767

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 72/123 (59%), Gaps = 5/123 (4%)
 Frame = -3

Query  476  AIVKAPNITC-AKKLSNPAQLXYPSFXVLFG-KSRIVRQT--RELTNVGAAGTLYEVAXE  309
            A++   N TC +  L +P  L YPSF VLF  KSR + QT  R +TNVG   + Y V   
Sbjct  645  ALLLRKNYTCPSHVLKSPGDLNYPSFAVLFDSKSRNLIQTFKRSVTNVGNPMSTYVVQVN  704

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P  V+VTVKP  L F+  G +LRY +  V+ +G  +  ++ FGS+ W +  + VRSPIA
Sbjct  705  TPSGVSVTVKPKILKFQKKGQKLRYKMRVVA-RGKRSAGDSTFGSLVWFSRTHIVRSPIA  763

Query  128  FSW  120
             +W
Sbjct  764  ITW  766



>ref|XP_009762581.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana sylvestris]
 ref|XP_009762582.1| PREDICTED: subtilisin-like protease isoform X2 [Nicotiana sylvestris]
 ref|XP_009762583.1| PREDICTED: subtilisin-like protease isoform X3 [Nicotiana sylvestris]
Length=769

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 72/123 (59%), Gaps = 5/123 (4%)
 Frame = -3

Query  476  AIVKAPNITC-AKKLSNPAQLXYPSFXVLFG-KSRIVRQT--RELTNVGAAGTLYEVAXE  309
            A++   N TC +  L +P  L YPSF VLF  KSR + QT  R +TNVG   + Y V   
Sbjct  647  ALLLRKNYTCPSHVLKSPGDLNYPSFAVLFDSKSRNLIQTFKRSVTNVGNPMSTYVVQVN  706

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P  V+VTVKP  L F+  G +LRY +  V+ +G  +  ++ FGS+ W +  + VRSPIA
Sbjct  707  TPSGVSVTVKPKILKFQKKGQKLRYKMRVVA-RGKRSAGDSTFGSLVWFSRTHIVRSPIA  765

Query  128  FSW  120
             +W
Sbjct  766  ITW  768



>gb|AEW08255.1| hypothetical protein 2_4281_02, partial [Pinus radiata]
Length=114

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 63/106 (59%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  LXYPSFXVLFGKSRIVR-QTRELTNVGAAGTLYEVAXEAPPSVTVTVKPTKLVFKNVGDR  243
            L YPSF V+F    +VR  TR +TNVG A ++Y++  E+PP+V + V+P+ L F    ++
Sbjct  1    LNYPSFSVVFKPLNLVRVATRTVTNVGGAPSVYKIVVESPPTVNIIVEPSTLTFGKKNEK  60

Query  242  LRYTVTFVSKK--GVVTPSNAAFGSVSWNNAQNQ---VRSPIAFSW  120
              +TVTF SK   G  +    +FG +SW   Q     VRSP+A +W
Sbjct  61   ANFTVTFESKIAFGFKSRERQSFGQISWQCVQGGAQVVRSPVAITW  106



>gb|AFG70679.1| hypothetical protein 0_744_01, partial [Pinus taeda]
Length=152

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 56/99 (57%), Gaps = 3/99 (3%)
 Frame = -3

Query  452  TCAKKLSNPAQLXYPSFXVLFGKSRIVRQT-RELTNVGAAGTLYEVAXEAPPSVTVTVKP  276
            +C K  S P  L YPSF V+F    +VR T R +TNVG A  +YE A E+P +V +TV+P
Sbjct  43   SCPKLSSAPGDLNYPSFSVVFKPRSLVRVTKRTVTNVGGAPCVYETAVESPENVNITVEP  102

Query  275  TKLVFKNVGDRLRYTVTFVSKKGVVTPSNA--AFGSVSW  165
            T L F+   D+  YTV F SK      S    AFG + W
Sbjct  103  TTLAFEKQNDKATYTVKFESKIAADNKSKGGQAFGQILW  141



>gb|AFG70691.1| hypothetical protein 0_744_01, partial [Pinus taeda]
Length=152

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 56/99 (57%), Gaps = 3/99 (3%)
 Frame = -3

Query  452  TCAKKLSNPAQLXYPSFXVLFGKSRIVRQT-RELTNVGAAGTLYEVAXEAPPSVTVTVKP  276
            +C K  S P  L YPSF V+F    +VR T R +TNVG A  +YE+A E P +V +TV+P
Sbjct  43   SCPKLSSAPGDLNYPSFSVVFKPRSLVRVTKRTVTNVGGAPCVYEMAVENPENVNITVEP  102

Query  275  TKLVFKNVGDRLRYTVTFVSKKGVVTPSNA--AFGSVSW  165
            T L F+   D+  YTV F SK      S    AFG + W
Sbjct  103  TTLAFEKQNDKATYTVKFESKIAADNKSKGGQAFGQILW  141



>gb|ABR17987.1| unknown [Picea sitchensis]
Length=772

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 50/129 (39%), Positives = 68/129 (53%), Gaps = 7/129 (5%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRE-LTNVGAAGTLYEVAX  312
            + IQ + K    +C K  S P  L YPSF V+F    +VR TR  +TNVG A ++YE+A 
Sbjct  642  KHIQILTKNAT-SCPKLRSRPGDLNYPSFSVVFKPRSLVRVTRRTVTNVGGAPSVYEMAV  700

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPS--NAAFGSVSW---NNAQNQ  147
            E+P +V V V+P  L F    ++  YTV F SK      S  +  FG + W         
Sbjct  701  ESPENVNVIVEPRTLAFTKQNEKATYTVRFESKIASDNKSKRHRGFGQILWKCVKGGTQV  760

Query  146  VRSPIAFSW  120
            VRSP+A +W
Sbjct  761  VRSPVAIAW  769



>ref|XP_006339499.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=765

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 73/123 (59%), Gaps = 5/123 (4%)
 Frame = -3

Query  476  AIVKAPNITC-AKKLSNPAQLXYPSFXVLFGKS-RIVRQT--RELTNVGAAGTLYEVAXE  309
            A++   N TC +    +   L YPSF VLF  + + + QT  R +TNVG   + Y V  +
Sbjct  643  ALLLRENYTCPSHSFQSLGDLNYPSFAVLFDSNNQHLIQTFKRTVTNVGTPRSTYSVQVK  702

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P  V+VTVKP  L F+  G +LRY V FV+ +G  +P ++ FGS++W +  + VRSPIA
Sbjct  703  TPYGVSVTVKPKILKFQKKGQKLRYKVRFVT-RGKRSPGDSTFGSLTWISRTHIVRSPIA  761

Query  128  FSW  120
             +W
Sbjct  762  VTW  764



>ref|XP_007162604.1| hypothetical protein PHAVU_001G165300g, partial [Phaseolus vulgaris]
 gb|ESW34598.1| hypothetical protein PHAVU_001G165300g, partial [Phaseolus vulgaris]
Length=1214

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 51/123 (41%), Positives = 70/123 (57%), Gaps = 11/123 (9%)
 Frame = -3

Query  458   NITC--AKKLSNPAQLXYPSFXVLF--GKSRIVRQTRELTNVGAAGTLYEVAXEAPPSVT  291
             N++C    K++    L YPSF V+F  G+ R + + R LTNVG+A ++Y V   AP  V 
Sbjct  1090  NVSCNAVMKMNRGFSLNYPSFSVIFKDGERRKMFR-RRLTNVGSANSIYSVEVMAPEGVK  1148

Query  290   VTVKPTKLVFKNVGDRLRYTVTFVSKK------GVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             V VKP +LVFK V   L Y V F+S+K      G+VT +      V   N  N+VRSP+A
Sbjct  1149  VIVKPKRLVFKQVNQSLTYRVWFISRKRVKRGDGLVTYAEGNLTWVHSQNGFNRVRSPVA  1208

Query  128   FSW  120
              +W
Sbjct  1209  VTW  1211



>ref|XP_009613479.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=774

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 49/120 (41%), Positives = 69/120 (58%), Gaps = 8/120 (7%)
 Frame = -3

Query  455  ITCAKK-LSNPAQLXYPSFXVLF-GKSR-IVRQTRELTNVGA-AGTLYEVAXEAPPSVTV  288
            + C+++ L+ P  L YPSF V+F G+S  +V+  R + NVG     +YEV   AP SV V
Sbjct  647  VNCSEQNLATPGDLNYPSFSVVFTGESNGVVKYKRVMKNVGKNTDAVYEVKVNAPSSVEV  706

Query  287  TVKPTKLVFKNVGDRLRYTVTFVSKKG----VVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            +V P KLVF      L Y ++F SK      +V    +AFGS+ W++  + VRSPIA  W
Sbjct  707  SVSPAKLVFSEEKKSLSYEISFKSKSSGDLEMVKGIESAFGSIEWSDGIHNVRSPIAVRW  766



>gb|EYU28634.1| hypothetical protein MIMGU_mgv1a024623mg, partial [Erythranthe 
guttata]
Length=699

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 69/122 (57%), Gaps = 5/122 (4%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNP-AQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAX  312
             Q  +I+    + C+K+ S P AQL YPSF ++ G S     TR LTNVG A + Y+V  
Sbjct  576  NQEVSILVGRKVDCSKEKSIPEAQLNYPSFSIVLG-STPQTYTRTLTNVGKANSSYDVKI  634

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSP  135
             +P  V V V+P KLVF  +GD+  Y+VTF  + KG +  +   F  + W  A   VRSP
Sbjct  635  VSPDGVNVKVEPKKLVFPKLGDKSSYSVTFTRTTKGAINSTTQGF--IRWYTADYSVRSP  692

Query  134  IA  129
            IA
Sbjct  693  IA  694



>ref|XP_003540860.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=773

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 74/124 (60%), Gaps = 8/124 (6%)
 Frame = -3

Query  482  IQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSR--IVRQT--RELTNVGAAGTLYEVA  315
            IQ I +AP  +C  +   P  L YPSF  +F  S   +  +T  R +TNVG A ++Y V+
Sbjct  643  IQVITRAP-ASCPVRRPAPENLNYPSFVAMFPASSKGVASKTFIRTVTNVGPANSVYRVS  701

Query  314  XEAPPS-VTVTVKPTKLVFKNVGDRLRYTVTFV--SKKGVVTPSNAAFGSVSWNNAQNQV  144
             EAP S V+VTVKP++LVF     +  Y VT    ++K  + PS A FGS++W + ++ V
Sbjct  702  VEAPASGVSVTVKPSRLVFSEAVKKRSYVVTVAGDTRKLKMGPSGAVFGSLTWTDGKHVV  761

Query  143  RSPI  132
            RSPI
Sbjct  762  RSPI  765



>ref|XP_011036446.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=774

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 48/130 (37%), Positives = 73/130 (56%), Gaps = 5/130 (4%)
 Frame = -3

Query  488  QQIQAIVKAPNIT--CAKKLSNPAQLXYPSFXVLF-GKSRIVRQTRELTNVG-AAGTLYE  321
            ++I   V+ P  +  C+ K+ +P  L YPSF V+F   S +V   R + +VG +   +YE
Sbjct  638  KRIAVFVREPPSSDICSGKVGSPGNLNYPSFSVVFQSNSDVVTYRRTVKSVGNSPDAVYE  697

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAA-FGSVSWNNAQNQV  144
            V   AP +V + V P++LVF      + Y +TF S     +  N+A FGS+ W+N  ++V
Sbjct  698  VEVNAPANVDIKVSPSRLVFNAENKTVSYEITFSSVSSGWSSINSATFGSIEWSNGIHRV  757

Query  143  RSPIAFSWTQ  114
            RSPIA  W Q
Sbjct  758  RSPIAVKWRQ  767



>gb|KDP25551.1| hypothetical protein JCGZ_20707 [Jatropha curcas]
Length=757

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 67/117 (57%), Gaps = 3/117 (3%)
 Frame = -3

Query  476  AIVKAPNITCAKKLSNP-AQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEAPP  300
            +I+    I C++KLS P  QL YPSF V  G S+    TR +TNVG A ++Y      PP
Sbjct  639  SIIAHRRIKCSEKLSIPEGQLNYPSFSVTLGASQTF--TRTVTNVGEANSVYAATIVPPP  696

Query  299  SVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             V VTV+P +L F  V  ++ Y+VTF         S  A G + W++A++ VRSPI+
Sbjct  697  GVAVTVEPYRLYFSQVNQKVTYSVTFSPTGSSGKTSEFAQGYILWSSAKHLVRSPIS  753



>ref|XP_010685296.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=767

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 73/127 (57%), Gaps = 8/127 (6%)
 Frame = -3

Query  488  QQIQAIVKAPNI-TCAKK-LSNPAQLXYPSFXVLF-GKSRIVRQTRELTNVGAA-GTLYE  321
            ++I  + K P +  CA + LS+P  L YPSF V+F G +  V+ TR + NVG++   +Y+
Sbjct  640  KRIHVLFKEPAVVDCASQILSSPGNLNYPSFSVVFRGDTNKVKYTRVVKNVGSSKNAVYK  699

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVR  141
            V  + P +V ++V PT L F +    L Y +TF S   +  PS   FGS+ W +  + VR
Sbjct  700  VNVKVPLNVHISVAPTTLAFTSTVQTLSYDITFTSTS-IGPPS---FGSIEWTDGSHHVR  755

Query  140  SPIAFSW  120
            SPIA  W
Sbjct  756  SPIAVQW  762



>ref|XP_009789823.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=774

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 69/125 (55%), Gaps = 7/125 (6%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSR--IVRQT--RELTNVGAAGTLYE  321
            + IQ I K+P + C  K   P  L YPS   LF  +   +  +T  R +TNVG     Y+
Sbjct  643  KTIQVITKSP-VNCPMKKPLPENLNYPSIAALFSTAAKGVSSKTFFRTVTNVGDTNAEYK  701

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRY--TVTFVSKKGVVTPSNAAFGSVSWNNAQNQ  147
            V  EAP  VTV+VKP KLVF     +L Y  T+T  SK  V+  S A FGS+SW +  + 
Sbjct  702  VKIEAPKGVTVSVKPDKLVFSEKVRKLSYYVTITVDSKNLVLNDSGAEFGSLSWIDGNHV  761

Query  146  VRSPI  132
            VRSPI
Sbjct  762  VRSPI  766



>gb|AFB32957.1| hypothetical protein 0_744_01, partial [Pinus mugo]
Length=152

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 57/99 (58%), Gaps = 3/99 (3%)
 Frame = -3

Query  452  TCAKKLSNPAQLXYPSFXVLFGKSRIVRQT-RELTNVGAAGTLYEVAXEAPPSVTVTVKP  276
            +C K  S P  L YPSF V+F    +VR T R +TNVG A  +YE+A ++P +V +TV+P
Sbjct  43   SCPKLSSAPGDLNYPSFSVVFKPRSLVRVTKRTVTNVGGAPCVYEMAVQSPENVNITVEP  102

Query  275  TKLVFKNVGDRLRYTVTFVSKKGVVTPSNA--AFGSVSW  165
            T L F+   D+  YTV F SK      S    AFG + W
Sbjct  103  TTLAFEKQNDKATYTVKFESKIAADNKSKGGQAFGQILW  141



>ref|XP_004229864.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
 ref|XP_010326049.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
 ref|XP_010326050.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=764

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 73/123 (59%), Gaps = 5/123 (4%)
 Frame = -3

Query  476  AIVKAPNITC-AKKLSNPAQLXYPSFXVLFGKS-RIVRQT--RELTNVGAAGTLYEVAXE  309
            A++   N TC +    +   L YPSF VLF  + + + QT  R +TNVG   + Y V  +
Sbjct  642  ALLLRENYTCPSHSFQSLGNLNYPSFSVLFDSNNQHLIQTFKRTVTNVGTPRSTYIVQVK  701

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P  V+VTVKP  L F   G +LRY V FV+ KG  +P+++ FGS++W +  + VRSPIA
Sbjct  702  TPYGVSVTVKPKILKFHKKGQKLRYKVRFVT-KGKRSPADSTFGSLTWISRTHIVRSPIA  760

Query  128  FSW  120
             +W
Sbjct  761  VTW  763



>ref|XP_004493834.1| PREDICTED: subtilisin-like protease SDD1-like [Cicer arietinum]
Length=763

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 70/121 (58%), Gaps = 9/121 (7%)
 Frame = -3

Query  458  NITC--AKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEAPPSVTVT  285
            N++C    +++    L YPS  V+F K  + R+ R ++NVG   ++Y V   AP  V V 
Sbjct  641  NVSCHAMMQMNRGFSLNYPSISVIF-KDGMTRKIRRVSNVGGPNSIYSVEVVAPQGVKVI  699

Query  284  VKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNA---AFGSVSWNNAQN---QVRSPIAFS  123
            VKP +LVFK +   L Y V F+S+KG    ++    A G ++W ++QN   +VRSPIA S
Sbjct  700  VKPKRLVFKQINQSLSYRVWFISRKGAKRGADTMDFAEGHLTWVHSQNGSYRVRSPIAVS  759

Query  122  W  120
            W
Sbjct  760  W  760



>ref|XP_006359680.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=772

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 70/125 (56%), Gaps = 7/125 (6%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSR--IVRQT--RELTNVGAAGTLYE  321
            + IQ I K+P + C  +   P  L YPS   LF  +   +  +T  R +TNVG A  +Y 
Sbjct  641  KTIQVITKSP-VNCPMRKPLPENLNYPSIAALFSTATKGVSSKTFFRTVTNVGDANAVYR  699

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRY--TVTFVSKKGVVTPSNAAFGSVSWNNAQNQ  147
            V  EAP  VTV+VKP KL F     +L Y  T+T  SK  V+  S A FGS+SW + ++ 
Sbjct  700  VKIEAPKGVTVSVKPAKLGFSEKIRKLSYYVTITVDSKNLVLNDSGAVFGSLSWVDGKHV  759

Query  146  VRSPI  132
            VRSPI
Sbjct  760  VRSPI  764



>ref|XP_003625390.1| Subtilisin-like protease [Medicago truncatula]
Length=932

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 71/123 (58%), Gaps = 11/123 (9%)
 Frame = -3

Query  458  NITCA--KKLSNPAQLXYPSFXVLFGKSRIVRQ--TRELTNVGAAGTLYEVAXEAPPSVT  291
            NI+C    +++    L YPS  V+F K  I R+  +R +TNVG   ++Y V   AP  V 
Sbjct  641  NISCHTIMRMNRGFSLNYPSISVIF-KDGIRRKMFSRRVTNVGNPNSIYSVEVVAPQGVK  699

Query  290  VTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPS---NAAFGSVSWNNAQN---QVRSPIA  129
            V VKP KL+FK +   L Y V F+S+K V   S   N A G ++W N+QN   +VRSPIA
Sbjct  700  VIVKPKKLIFKKINQSLSYRVYFISRKRVKKGSDTMNFAEGHLTWINSQNGSYRVRSPIA  759

Query  128  FSW  120
             SW
Sbjct  760  VSW  762



>ref|XP_007051969.1| Subtilase family protein isoform 1 [Theobroma cacao]
 gb|EOX96126.1| Subtilase family protein isoform 1 [Theobroma cacao]
Length=773

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 67/130 (52%), Gaps = 7/130 (5%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKK-LSNPAQLXYPSFXVLFGKSRIVRQT----RELTNVGAAGTLYE  321
            QI   V   N TC K  +  P  L YPSF V F  S     T    R +TNVG   + Y+
Sbjct  645  QISGFVY--NFTCPKDAIMQPGDLNYPSFVVNFKSSAAENITLTYHRTVTNVGTPKSTYD  702

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVR  141
            V  E P  V+V V P  L F  +G++L Y VTF   K     + ++FGS+ W +   +VR
Sbjct  703  VLVEEPEGVSVVVTPKVLTFNMLGEKLSYKVTFTGLKRTKPVAASSFGSLVWVSGNYRVR  762

Query  140  SPIAFSWTQL  111
            SPIA SW ++
Sbjct  763  SPIAASWLKM  772



>gb|AFB32959.1| hypothetical protein 0_744_01, partial [Pinus mugo]
Length=152

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 56/99 (57%), Gaps = 3/99 (3%)
 Frame = -3

Query  452  TCAKKLSNPAQLXYPSFXVLFGKSRIVRQT-RELTNVGAAGTLYEVAXEAPPSVTVTVKP  276
            +C K  S P  L YPSF V+F    +VR T R +TNVG A  +YE+  E+P +V +TV+P
Sbjct  43   SCPKLSSAPGDLNYPSFSVVFKPRSLVRVTKRTVTNVGGAPCVYEMTVESPENVNITVEP  102

Query  275  TKLVFKNVGDRLRYTVTFVSKKGVVTPSNA--AFGSVSW  165
            T L F+   D+  YTV F SK      S    AFG + W
Sbjct  103  TTLAFEKQNDKATYTVKFESKIAADNKSKGGQAFGQILW  141



>gb|AFB32953.1| hypothetical protein 0_744_01, partial [Abies alba]
 gb|AFB32954.1| hypothetical protein 0_744_01, partial [Abies alba]
Length=152

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 64/111 (58%), Gaps = 4/111 (4%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRE-LTNVGAAGTLYEVAX  312
            +QI  + +  + +C K    P  L YPSF V+F +  +VR TR  +TNVGA  ++YE+A 
Sbjct  32   KQIHLLTRKAS-SCPKLPGQPGDLNYPSFSVVFKQRDLVRVTRRTVTNVGAVPSVYEMAV  90

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSK--KGVVTPSNAAFGSVSW  165
            E+P +V + V+P+KL FK   ++  + V F SK      +  N  FG +SW
Sbjct  91   ESPANVNIIVEPSKLAFKKQNEKASFKVRFESKVASDFKSSGNKEFGQISW  141



>ref|XP_010322825.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=776

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 46/120 (38%), Positives = 67/120 (56%), Gaps = 8/120 (7%)
 Frame = -3

Query  455  ITCAKK-LSNPAQLXYPSFXVLFGKSR--IVRQTRELTNVGA-AGTLYEVAXEAPPSVTV  288
            + C+++ L+ P  L YPSF V F      +V+  R + NVG     +YEV   AP  V V
Sbjct  649  VNCSERSLATPGDLNYPSFAVDFTSDSNGVVKYKRVVKNVGGNPNAVYEVKVNAPLGVEV  708

Query  287  TVKPTKLVFKNVGDRLRYTVTFVSKKG----VVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            +V P KLVF    + L Y ++F SK+     +V  + +AFGS+ W++  + VRSPIA  W
Sbjct  709  SVSPAKLVFSEENNSLSYEISFTSKRSEDNIMVKGTPSAFGSIEWSDGIHSVRSPIAVRW  768



>emb|CDP17728.1| unnamed protein product [Coffea canephora]
Length=683

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 74/121 (61%), Gaps = 8/121 (7%)
 Frame = -3

Query  482  IQAIVKAPNITCAKKLSNP-AQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEA  306
            ++ I++ P ++C+ + S P AQL YPSF ++ G S +VR TR +TNVG A + Y V    
Sbjct  562  VRLILQRP-VSCSAESSIPEAQLNYPSFSIIVG-SNLVRYTRTVTNVGEANSSYTVHMAP  619

Query  305  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAF--GSVSWNNAQNQVRSPI  132
            P  V VTV+P+ L F  +  R+ YTVTF     +    +A +  G ++WN+ ++ VRSPI
Sbjct  620  PAGVDVTVEPSTLNFSGLNQRITYTVTFAR---LANSGSAGYSQGLLTWNSDKHSVRSPI  676

Query  131  A  129
            +
Sbjct  677  S  677



>ref|XP_010261833.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=783

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 49/126 (39%), Positives = 70/126 (56%), Gaps = 16/126 (13%)
 Frame = -3

Query  458  NITC-AKKLSNPAQLXYPSFXVLF---GKSRIVRQTRELTNVG-AAGTLYEVAXEAPPSV  294
            ++ C A+ L +P  L YPSF V+F   G   +V+  R +TNVG +   +YE     P SV
Sbjct  653  SVNCSAQSLPSPGDLNYPSFSVVFKLNGGKDVVKYRRVVTNVGDSVDAVYEAKVWGPDSV  712

Query  293  TVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTP--------SNAAFGSVSWNNAQNQVRS  138
             ++V P+KLVF    +R  Y +TF   K VV P        S + FG + W++  ++VRS
Sbjct  713  EISVSPSKLVFSGEEERQSYEITF---KSVVPPNETEERTASASKFGWIEWSDGSHRVRS  769

Query  137  PIAFSW  120
            PIAF W
Sbjct  770  PIAFWW  775



>ref|XP_002303551.2| hypothetical protein POPTR_0003s11870g [Populus trichocarpa]
 gb|EEE78530.2| hypothetical protein POPTR_0003s11870g [Populus trichocarpa]
Length=764

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 66/117 (56%), Gaps = 3/117 (3%)
 Frame = -3

Query  476  AIVKAPNITCAKKLSNP-AQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEAPP  300
            +I+    + C++K S P  +L YPSF V  G S+    TR +TNVG   + YEVA  +PP
Sbjct  639  SIIVHEQVKCSEKPSIPEGELNYPSFAVTLGPSQTF--TRTVTNVGDVNSAYEVAIVSPP  696

Query  299  SVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             V VTVKP+KL F  V  +  Y+V F   +     S  A G + W +A+  VRSPIA
Sbjct  697  GVDVTVKPSKLYFSKVNQKATYSVAFSRTEYGGKTSETAQGYIVWASAKYTVRSPIA  753



>ref|XP_006426684.1| hypothetical protein CICLE_v10024936mg [Citrus clementina]
 gb|ESR39924.1| hypothetical protein CICLE_v10024936mg [Citrus clementina]
Length=776

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 50/132 (38%), Positives = 74/132 (56%), Gaps = 9/132 (7%)
 Frame = -3

Query  488  QQIQAIVKAPNIT--CAKKLSNPAQLXYPSFXVLFGKSR-IVRQTRELTNVGAA-GTLYE  321
            ++I   V+ P  +  C + L+ P  L YPSF V+F  +  +V+  R + NVG++   +YE
Sbjct  641  KRISVFVREPASSDICTRALATPGNLNYPSFSVVFNSNNDVVKYKRVVKNVGSSVDAVYE  700

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTF--VSKKGV-VTPSNAAFGSVSWNNAQN  150
            V   APP+V V V P+KL F      L Y +TF  V   G+ V+P  +  GS+ W++  +
Sbjct  701  VKVNAPPNVAVNVWPSKLAFSAEKKALAYEITFSSVGLDGLGVSPQQS--GSIEWSDGVH  758

Query  149  QVRSPIAFSWTQ  114
             VRSPIA  W Q
Sbjct  759  LVRSPIAVRWIQ  770



>ref|XP_010087293.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB28740.1| Subtilisin-like protease [Morus notabilis]
Length=743

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 47/126 (37%), Positives = 69/126 (55%), Gaps = 4/126 (3%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNPAQLXYPSFXVLF---GKSRIVRQTRELTNVGAAGTLYEVA  315
            QI  + +      AKK  +   L YPSF V F   G S +   +R LTNVG AGT     
Sbjct  619  QISGLTRKEFSCDAKKKYSVTDLNYPSFAVNFQSNGGSSVYNYSRTLTNVGPAGTYKLSL  678

Query  314  XEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSP  135
                 SV ++V+P  L F +  ++  YTVTF +  G ++P + +FG + W++ ++ V SP
Sbjct  679  KSETQSVKISVEPETLSFSHANEKKSYTVTFTA-VGSMSPDSKSFGRIEWSDGKHIVGSP  737

Query  134  IAFSWT  117
            IAFSW+
Sbjct  738  IAFSWS  743



>gb|KDO64998.1| hypothetical protein CISIN_1g045236mg, partial [Citrus sinensis]
Length=604

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 50/132 (38%), Positives = 74/132 (56%), Gaps = 9/132 (7%)
 Frame = -3

Query  488  QQIQAIVKAP--NITCAKKLSNPAQLXYPSFXVLFGKSR-IVRQTRELTNVGAA-GTLYE  321
            ++I   V+ P  +  C + L+ P  L YPSF V+F  +  +V+  R + NVG++   +YE
Sbjct  469  KRISVFVREPVSSDICTRALATPGNLNYPSFSVVFNSNNDVVKYKRVVKNVGSSVDAVYE  528

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTF--VSKKGV-VTPSNAAFGSVSWNNAQN  150
            V   APP+V V V P+KL F      L Y +TF  V   G+ V+P  +  GS+ W++  +
Sbjct  529  VKVNAPPNVAVNVWPSKLAFSAEKKALAYEITFSSVGLDGLGVSPQQS--GSIEWSDGVH  586

Query  149  QVRSPIAFSWTQ  114
             VRSPIA  W Q
Sbjct  587  LVRSPIAVRWIQ  598



>ref|XP_004244717.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=744

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 51/121 (42%), Positives = 70/121 (58%), Gaps = 4/121 (3%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNP-AQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAX  312
            QQ+ +IVK   + C K    P AQL YPSF +  G       TR +TNVG A + Y V  
Sbjct  618  QQVGSIVKH-KVDCNKVKHIPEAQLNYPSFSITLGDISQT-YTRTVTNVGEAKSSYTVEI  675

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPI  132
            ++PP VTV VKP+ L F  +  +L+Y VTF +++   T S  A G + W++ +  VRSPI
Sbjct  676  DSPPRVTVIVKPSTLKFSQLDQKLKYQVTF-TRRDDSTSSGIAQGFLKWSSKKYSVRSPI  734

Query  131  A  129
            A
Sbjct  735  A  735



>ref|XP_007051967.1| Subtilase family protein [Theobroma cacao]
 gb|EOX96124.1| Subtilase family protein [Theobroma cacao]
Length=771

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 64/118 (54%), Gaps = 6/118 (5%)
 Frame = -3

Query  458  NITCAKKLS-NPAQLXYPSFXVLFGKS---RIVRQTRELTNVGAAGTLYEVAXEAPPSVT  291
            + TC + L+  P  L YPSF V F +S     V  TR +T+VG     YEV    P  V+
Sbjct  655  DFTCPQNLTMQPGDLNYPSFAVNFKRSIDNNTVTFTRTVTHVGIPNVTYEVRGTEPDGVS  714

Query  290  VTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQN-QVRSPIAFSW  120
            +TV+P  L F+N G +L Y +TF  + G V P   +FG + W+      VRSP+A +W
Sbjct  715  ITVEPEILKFENPGQKLSYKITFTQRNGTV-PRKTSFGYIKWSYLDKYHVRSPVAVTW  771



>ref|XP_006841679.1| hypothetical protein AMTR_s00003p00245290 [Amborella trichopoda]
 gb|ERN03354.1| hypothetical protein AMTR_s00003p00245290 [Amborella trichopoda]
Length=765

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 63/107 (59%), Gaps = 2/107 (2%)
 Frame = -3

Query  437  LSNPAQLXYPSFXVLFGKSRIVRQ-TRELTNVGAAGTLYEVAXEAPPSVTVTVKPTKLVF  261
             +    L YPSF ++FG  + V + +R +TNVG A + Y  +   P SV + V P KLVF
Sbjct  652  FAKSGDLNYPSFSMVFGPGKTVAKFSRTVTNVGDARSAYAASINGPDSVRIRVDPEKLVF  711

Query  260  KNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
                  L Y+VTF   +G  +P +  FG ++W++ ++ V+SPIAFSW
Sbjct  712  CAQNQSLSYSVTFEYVEG-YSPLDTCFGLLTWSDGRHDVKSPIAFSW  757



>ref|XP_009391664.1| PREDICTED: subtilisin-like protease SDD1 [Musa acuminata subsp. 
malaccensis]
Length=772

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 65/119 (55%), Gaps = 6/119 (5%)
 Frame = -3

Query  458  NITCAKKLSNPAQ--LXYPSFXVLFGKSRIVRQT-RELTNVGAAGTLYEVAXEAPPSVTV  288
            NI+C K L    Q  L YPS  V F + R      R+LTNVG   ++Y V   APP VTV
Sbjct  652  NISCGKLLKGQKQFNLNYPSISVSFTQGRTSTTIQRKLTNVGLPDSIYTVQVTAPPGVTV  711

Query  287  TVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNA---QNQVRSPIAFSW  120
            TV P  L F  + +   YTV F SKKGV    + A G + W ++   + +VRSPI+ +W
Sbjct  712  TVTPKILAFGGINEIKSYTVVFESKKGVQEEGSVAGGQLMWVHSGRKKYKVRSPISVTW  770



>ref|XP_010685295.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=808

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 53/135 (39%), Positives = 75/135 (56%), Gaps = 11/135 (8%)
 Frame = -3

Query  485  QIQAIVKAPN-ITCA-KKLSNPAQLXYPSFXVLFGKSR-IVRQTRELTNVGA-AGTLYEV  318
            +I   +K P  I CA K LS    L YPSF V+F   + +V+ TR + NVG+ A  +YEV
Sbjct  664  RIAIFLKEPTTIDCAAKNLSTAGNLNYPSFSVVFESGKNVVKYTRVVKNVGSSADAVYEV  723

Query  317  AXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKK-----GVVTP--SNAAFGSVSWNN  159
            +  AP +V V+V P KL F      L Y ++F S       G V P    ++FGS+ W++
Sbjct  724  SVNAPLNVDVSVSPRKLEFSADKQTLSYEISFTSISETYLTGKVKPILGTSSFGSIEWSD  783

Query  158  AQNQVRSPIAFSWTQ  114
              ++VRSPIA  W +
Sbjct  784  GSHRVRSPIAVRWVE  798



>ref|XP_002304129.2| hypothetical protein POPTR_0003s06530g [Populus trichocarpa]
 gb|EEE79108.2| hypothetical protein POPTR_0003s06530g [Populus trichocarpa]
Length=774

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 50/130 (38%), Positives = 71/130 (55%), Gaps = 5/130 (4%)
 Frame = -3

Query  488  QQIQAIVKAPNIT--CAKKLSNPAQLXYPSFXVLF-GKSRIVRQTRELTNVG-AAGTLYE  321
            ++I   V+ P  +  C+ K  +P  L YPSF V+F   S  V   R + NVG +   +YE
Sbjct  638  KRIAVFVREPPSSDICSGKEGSPGNLNYPSFSVVFQSNSDEVTYRRTVKNVGNSLDAVYE  697

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAA-FGSVSWNNAQNQV  144
            V   AP +V + V P+KLVF      + Y +TF S     +  N+A FGS+ W+N  ++V
Sbjct  698  VEVNAPANVDIKVSPSKLVFNAENKTVSYDITFSSVSSGWSSINSATFGSIEWSNGIHRV  757

Query  143  RSPIAFSWTQ  114
            RSPIA  W Q
Sbjct  758  RSPIAVKWRQ  767



>gb|AFB33380.1| hypothetical protein 2_4281_02, partial [Pinus mugo]
Length=114

 Score = 74.7 bits (182),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 63/106 (59%), Gaps = 6/106 (6%)
 Frame = -3

Query  419  LXYPSFXVLFGKSRIVR-QTRELTNVGAAGTLYEVAXEAPPSVTVTVKPTKLVFKNVGDR  243
            L YPSF V+F    +VR  TR +TNVG A ++Y++A E+PP+V + V+P+ L F    ++
Sbjct  1    LNYPSFSVVFKPLNLVRVATRTVTNVGGAPSVYKIAVESPPTVNIIVEPSTLTFGEKNEK  60

Query  242  LRYTVTFVSKK--GVVTPSNAAFGSVSWNNAQNQ---VRSPIAFSW  120
              +TVTF  K   G  +    +FG +SW   +     VRSP+A +W
Sbjct  61   ANFTVTFERKIAFGFKSRERQSFGQISWQCVKGGAQVVRSPVAITW  106



>gb|EYU29357.1| hypothetical protein MIMGU_mgv1a021077mg [Erythranthe guttata]
Length=719

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 52/120 (43%), Positives = 67/120 (56%), Gaps = 4/120 (3%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNP-AQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAX  312
            Q++  IVK   + C+KK S P AQL YPSF ++FG S     TR LTNVG A + Y+V  
Sbjct  597  QEVGIIVKC-KVDCSKKKSIPEAQLNYPSFSIIFG-STPQTYTRTLTNVGKANSSYDVEI  654

Query  311  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPI  132
             +   V V V+P KLVF  +GD+  Y+VTF         S    G + W  A + VRSPI
Sbjct  655  VSSHGVNVKVEPHKLVFPKLGDKSSYSVTFTRTTKEAMNSTTQ-GFIRWYTADHSVRSPI  713



>emb|CDP10007.1| unnamed protein product [Coffea canephora]
Length=744

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 59/98 (60%), Gaps = 4/98 (4%)
 Frame = -3

Query  422  QLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEAPPSVTVTVKPTKLVFKNVGDR  243
            QL YPSF ++ G S I + TR +TNVG A ++Y V  + P  V VTVKP  L F  V  +
Sbjct  642  QLNYPSFSIVVG-STIQKYTRTVTNVGDANSIYRVKIDQPGGVNVTVKPRILSFSKVNQK  700

Query  242  LRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
            L Y +TF       TPS+   GS++W +A+  VRSPIA
Sbjct  701  LSYDITFTPLSPYETPSD---GSLTWTSAKYSVRSPIA  735



>gb|AES80028.2| subtilisin-like serine protease [Medicago truncatula]
Length=774

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 67/120 (56%), Gaps = 2/120 (2%)
 Frame = -3

Query  473  IVKAPNITCAKK-LSNPAQLXYPSFXVLFGKS-RIVRQTRELTNVGAAGTLYEVAXEAPP  300
            I+   N  C+KK +     L YPSF VLF K+   V   R +TNVG + + Y V    P 
Sbjct  654  ILTKTNFKCSKKPVFQVGDLNYPSFSVLFSKTTHNVTYKRVVTNVGKSQSAYVVEVLEPH  713

Query  299  SVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             V V V+P KL F+  G +L Y VTF++        +++FGS+ W + + +VRSPIA +W
Sbjct  714  GVIVNVEPRKLKFEKFGQKLSYKVTFLAVGKARVTGSSSFGSIIWVSGKYKVRSPIAVTW  773



>ref|XP_003623810.1| Subtilisin-like protease [Medicago truncatula]
Length=786

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 67/120 (56%), Gaps = 2/120 (2%)
 Frame = -3

Query  473  IVKAPNITCAKK-LSNPAQLXYPSFXVLFGKS-RIVRQTRELTNVGAAGTLYEVAXEAPP  300
            I+   N  C+KK +     L YPSF VLF K+   V   R +TNVG + + Y V    P 
Sbjct  666  ILTKTNFKCSKKPVFQVGDLNYPSFSVLFSKTTHNVTYKRVVTNVGKSQSAYVVEVLEPH  725

Query  299  SVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             V V V+P KL F+  G +L Y VTF++        +++FGS+ W + + +VRSPIA +W
Sbjct  726  GVIVNVEPRKLKFEKFGQKLSYKVTFLAVGKARVTGSSSFGSIIWVSGKYKVRSPIAVTW  785



>ref|XP_007217156.1| hypothetical protein PRUPE_ppa001739mg [Prunus persica]
 gb|EMJ18355.1| hypothetical protein PRUPE_ppa001739mg [Prunus persica]
Length=772

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 68/129 (53%), Gaps = 7/129 (5%)
 Frame = -3

Query  488  QQIQAIVKAP---NITCAKKLSNPAQLXYPSFXVLFGKSR-IVRQTRELTNVGA-AGTLY  324
            +QI   V  P   ++     L++P  L YPSF V+    + +++  R  TNVG  A  +Y
Sbjct  638  RQIAVFVGKPTGSDMCTRNSLASPGDLNYPSFSVVLSSDQGLIKYKRIATNVGGDADAVY  697

Query  323  EVAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQV  144
            EV   AP  V ++V+P KLVF        Y VTF  K+GV       +GS+ W + ++ V
Sbjct  698  EVTVNAPAGVEISVEPRKLVFSAENQTQSYEVTF--KRGVGYDGGERYGSIEWTDGRHLV  755

Query  143  RSPIAFSWT  117
            RSP+A  W+
Sbjct  756  RSPVAVRWS  764



>ref|XP_011033844.1| PREDICTED: subtilisin-like protease SDD1 [Populus euphratica]
Length=766

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 68/120 (57%), Gaps = 3/120 (3%)
 Frame = -3

Query  476  AIVKAPNITCAKKLSNP-AQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEAPP  300
            +I+    + C++K S P  +L YPSF V  G S+    TR +TNVG   + YEVA  +PP
Sbjct  648  SIIVHEQVKCSEKPSIPEGELNYPSFAVTLGPSQTF--TRTVTNVGDVNSAYEVAIFSPP  705

Query  299  SVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             V VTVKP+KL F  V  +  Y+V F   +     S  A G + W +++  VRSPIA S+
Sbjct  706  GVDVTVKPSKLYFSKVNRKATYSVAFSRTEYGGKTSEIAQGHIVWASSKYIVRSPIAVSF  765



>ref|XP_010091819.1| Subtilisin-like protease SDD1 [Morus notabilis]
 gb|EXB46027.1| Subtilisin-like protease SDD1 [Morus notabilis]
Length=771

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 76/127 (60%), Gaps = 11/127 (9%)
 Frame = -3

Query  470  VKAPNITCAKKLS--NPAQLXYPSFXVLFGK---SRIVRQTRELTNVGAAGTLYEVAXEA  306
            V   N++C + L+      L YPS  V+F +   S++++  R LTNVG+  ++Y +  EA
Sbjct  645  VTHKNVSCREILTINKGFSLNYPSISVIFKRGTGSKMIK--RRLTNVGSPNSIYSLEIEA  702

Query  305  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNA-AFGSVSWNNAQN---QVRS  138
            P  V V VKP +LVF  +   L Y V F+S+K  V  S++ A G ++W NA+N   +VRS
Sbjct  703  PQDVKVRVKPRRLVFTRINQVLSYRVWFISRKRSVVQSHSYAQGHLTWVNAKNSLYRVRS  762

Query  137  PIAFSWT  117
            PI+ +WT
Sbjct  763  PISIAWT  769



>emb|CBI34784.3| unnamed protein product [Vitis vinifera]
Length=370

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 69/121 (57%), Gaps = 4/121 (3%)
 Frame = -3

Query  485  QIQAIVKAPNITCAKKLSNP-AQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXE  309
            Q++AI++   + C+K+ S P AQL YPSF V  G S +  Q R +TNVG A   Y V   
Sbjct  248  QVRAIIRH-KVQCSKESSIPEAQLNYPSFSVAMGSSALKLQ-RTVTNVGEAKASYIVKIS  305

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNA-AFGSVSWNNAQNQVRSPI  132
            AP  V V+VKP KL F     +  YTVTF  K    T S   A G + W +A++ VRSPI
Sbjct  306  APQGVDVSVKPRKLDFTQTNQKKTYTVTFERKDDGKTGSKPFAQGFLEWVSAKHSVRSPI  365

Query  131  A  129
            +
Sbjct  366  S  366



>ref|NP_001050634.1| Os03g0605300 [Oryza sativa Japonica Group]
 gb|AAR87229.1| putaive subtilisin-like proteinase [Oryza sativa Japonica Group]
 gb|AAT78773.1| putative serine protease [Oryza sativa Japonica Group]
 gb|ABF97524.1| cucumisin-like serine protease, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12548.1| Os03g0605300 [Oryza sativa Japonica Group]
 gb|EAZ27735.1| hypothetical protein OsJ_11683 [Oryza sativa Japonica Group]
Length=765

 Score = 79.0 bits (193),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 51/136 (38%), Positives = 75/136 (55%), Gaps = 18/136 (13%)
 Frame = -3

Query  482  IQAIVKAPNITCAK-KLSNPAQLXYPSFXVLF------------GKSRIVRQTRELTNVG  342
            I A+ ++ +  C + K  +   L YPSF V +              +  V   R LTNVG
Sbjct  634  IAAVARSKSYGCTEGKAYSVYNLNYPSFAVAYSTASSQAAESSGAAATTVTHRRTLTNVG  693

Query  341  AAGTLYEVAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPS-NAAFGSVSW  165
            AAGT Y+V+  A P V V V+PT+L F + G++  YTV+F +K     PS  A FG + W
Sbjct  694  AAGT-YKVSAAAMPGVAVAVEPTELAFTSAGEKKSYTVSFTAKS---QPSGTAGFGRLVW  749

Query  164  NNAQNQVRSPIAFSWT  117
            ++ ++ V SP+AF+WT
Sbjct  750  SDGKHSVASPMAFTWT  765



>gb|AFB32955.1| hypothetical protein 0_744_01, partial [Larix decidua]
Length=148

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 3/97 (3%)
 Frame = -3

Query  452  TCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRE-LTNVGAAGTLYEVAXEAPPSVTVTVKP  276
            +C K  + P  L YPSF V+F    +VR TR  + NVG A + YE+A E+PP+V + V+P
Sbjct  43   SCPKLRARPGDLNYPSFSVVFKPRDLVRVTRRTVKNVGQAFSEYEMAVESPPNVNIIVEP  102

Query  275  TKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSW  165
            + L FK   ++  +TV F SK  + +     FG +SW
Sbjct  103  STLTFKKQNEKANFTVRFKSK--IASSGRPEFGQISW  137



>ref|XP_009593174.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=774

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 67/125 (54%), Gaps = 7/125 (6%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFG-KSRIVRQT---RELTNVGAAGTLYE  321
            + IQ I K+P + C  K   P  L YPS   LF   +R V      R +TNVG     Y 
Sbjct  643  KTIQVITKSP-VNCPMKKPLPENLNYPSIAALFSTAARGVSSKTFFRTVTNVGDTNAEYR  701

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRY--TVTFVSKKGVVTPSNAAFGSVSWNNAQNQ  147
            V  EAP  V V+VKP KLVF     +L Y  T+T  SK  V+  S A FGS+SW + ++ 
Sbjct  702  VKIEAPKGVRVSVKPDKLVFSEKVRKLSYYVTITVDSKNLVLNDSGAVFGSLSWIDGKHV  761

Query  146  VRSPI  132
            VRSPI
Sbjct  762  VRSPI  766



>ref|XP_008792869.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=781

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 44/113 (39%), Positives = 60/113 (53%), Gaps = 2/113 (2%)
 Frame = -3

Query  446  AKKLSNPAQLXYPSFXVLFGK-SRIVRQTRELTNVGAAG-TLYEVAXEAPPSVTVTVKPT  273
            A  L++P  L YP+F  +F   S +V  +R + NVG      YE     PP V VTV P+
Sbjct  663  ALTLASPGDLNYPAFSAVFSSASDVVTYSRVVRNVGGPDDAAYEAEVSCPPGVNVTVTPS  722

Query  272  KLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
            KLVF  V   L Y +T  S        + +FG +SW++  + VRSPIA SW +
Sbjct  723  KLVFDAVEQSLSYKITLASMADAAVAGSRSFGWISWSDGAHIVRSPIAVSWRE  775



>ref|XP_009407416.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=769

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 51/135 (38%), Positives = 71/135 (53%), Gaps = 16/135 (12%)
 Frame = -3

Query  485  QIQAIVKAPNITC-AKKLSNPAQLXYPSFXVLFGKSRI----------VRQTRELTNVGA  339
            QI ++ +  N  C  KK    + L YPSF V F  +            V+ TR LTNVGA
Sbjct  639  QIASVSRRSNFNCDNKKAYAVSDLNYPSFAVAFATASGAGGGGSAATTVKHTRTLTNVGA  698

Query  338  AGTLYEVAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPS-NAAFGSVSWN  162
             GT Y+    AP    VTV P++L F   G++  YTV F +      PS  AAFG + W+
Sbjct  699  PGT-YKATVSAPQEAKVTVDPSELSFAAAGEKKSYTVAFSAAS---QPSGTAAFGRLEWS  754

Query  161  NAQNQVRSPIAFSWT  117
            + ++ V SP++F+WT
Sbjct  755  DGKHVVASPLSFTWT  769



>gb|AFB32956.1| hypothetical protein 0_744_01, partial [Pinus mugo]
Length=152

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 55/99 (56%), Gaps = 3/99 (3%)
 Frame = -3

Query  452  TCAKKLSNPAQLXYPSFXVLFGKSRIVRQT-RELTNVGAAGTLYEVAXEAPPSVTVTVKP  276
            +C K  S P  L YPSF V+F    +VR T R +TNVG A  +YE+  E+P +V +TV+P
Sbjct  43   SCPKLRSAPGDLNYPSFSVVFKPRSLVRVTKRTVTNVGGAPCVYEMTVESPENVNITVEP  102

Query  275  TKLVFKNVGDRLRYTVTFVSKKGVVTPSNA--AFGSVSW  165
              L F+   D+  YTV F SK      S    AFG + W
Sbjct  103  MTLAFEKQNDKATYTVKFESKIAADNKSKGGQAFGQILW  141



>ref|XP_006342924.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=767

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 66/116 (57%), Gaps = 3/116 (3%)
 Frame = -3

Query  458  NITCAKK-LSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGA-AGTLYEVAXEAPPSVTVT  285
            ++ C++  L++P  L YPSF V+F    +V+  R + NVG  A  +Y+V   AP SV V 
Sbjct  645  SVNCSEHSLASPGDLNYPSFSVVFMSENVVKYKRVVKNVGRNANVVYKVKVNAPSSVEVK  704

Query  284  VKPTKLVFKNVGDRLRYTVTFVS-KKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            V P+KL F    + L Y ++F S     V    +AFGS+ W++  + VRSPIA  W
Sbjct  705  VTPSKLSFSEEKNSLSYEISFSSVGSERVKGLESAFGSIEWSDGIHSVRSPIAVRW  760



>emb|CDP09846.1| unnamed protein product [Coffea canephora]
Length=729

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 67/119 (56%), Gaps = 5/119 (4%)
 Frame = -3

Query  455  ITCAKKLSNP-AQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEAPPSVTVTVK  279
            + C  + S P AQL YPSF ++FG S I + TR +TNVG A ++Y V    P  V VTVK
Sbjct  613  VNCTAESSIPEAQLNYPSFSIVFGSS-IQKYTRTVTNVGEAKSVYTVKVAPPAGVNVTVK  671

Query  278  PTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA--FSWTQLF  108
            P  L F  V  +L Y VTF S       +  + GS++W +A+  VRSPI   F  TQ F
Sbjct  672  PNTLSFSEVNQKLTYEVTF-SLLASSANNTVSQGSLAWTSAKYSVRSPIVALFGATQRF  729



>emb|CDY63302.1| BnaCnng41810D [Brassica napus]
Length=748

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 66/121 (55%), Gaps = 5/121 (4%)
 Frame = -3

Query  473  IVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIVRQTRELTNVGAAGTLYEVAXEAPPSV  294
            I+   N  C +K    A L YPSF V    S   + TR +TNVG AG+          +V
Sbjct  631  IISRGNYACPRKTHPAADLNYPSFAVNVKGSGTYKYTRTVTNVGGAGSYSVKVTSETTAV  690

Query  293  TVTVKPTKLVFKNVGDRLRYTVTF--VSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
             ++V+P  L FK V ++  Y+VTF  +S K    P + +FGS+ W++ ++ V SP+A SW
Sbjct  691  KISVEPAVLNFKEVNEKKSYSVTFTVISSK---APMSNSFGSIEWSDGKHVVASPVAISW  747

Query  119  T  117
            T
Sbjct  748  T  748



>ref|XP_008454764.1| PREDICTED: subtilisin-like protease [Cucumis melo]
 ref|XP_008454765.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=768

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 66/123 (54%), Gaps = 4/123 (3%)
 Frame = -3

Query  476  AIVKAPNITCAKKLS--NPAQLXYPSFXVLFGKSRIVRQT--RELTNVGAAGTLYEVAXE  309
            A+V     TC+ K +   P  L YPSF V   K + V  T  R +TNVG   + Y V   
Sbjct  645  ALVSRGKFTCSSKRTFFQPGDLNYPSFSVFMKKGKNVNSTFKRTVTNVGIPRSDYTVRIY  704

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P  + + VKP KL F  +G++L Y V+FV+     +  + +FGS+ W++    VRSPIA
Sbjct  705  NPKGIRIIVKPEKLSFVKLGEKLSYKVSFVALGKRKSLDDFSFGSLVWHSGTYVVRSPIA  764

Query  128  FSW  120
             +W
Sbjct  765  VTW  767



>gb|EMS49460.1| Subtilisin-like protease SDD1 [Triticum urartu]
Length=815

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 68/123 (55%), Gaps = 8/123 (7%)
 Frame = -3

Query  488  QQIQAIVK-APNITCAK--KLSNPAQLXYPSFXVLFGKSRI-VRQTRELTNVGAAGTLYE  321
            QQ+ +I+   P + C K  K+     L YPS  ++  K+   V  TR +TNVG A + YE
Sbjct  577  QQVNSIIHPEPAVDCTKITKIGE-KDLNYPSITIIIDKADTTVNATRAVTNVGVASSTYE  635

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVR  141
            +  E P SVTV V PTKL FK + + L YT   VS K    P  A  G + W ++++ VR
Sbjct  636  MEVEVPKSVTVEVTPTKLEFKELDEVLNYT---VSVKAAAVPEGAVEGQLKWVSSKHIVR  692

Query  140  SPI  132
            SPI
Sbjct  693  SPI  695



>ref|XP_004166310.1| PREDICTED: subtilisin-like protease SDD1-like [Cucumis sativus]
Length=768

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 71/126 (56%), Gaps = 9/126 (7%)
 Frame = -3

Query  473  IVKAPNITCAK--KLSNPAQLXYPSFXVLFGKSRIVRQ-TRELTNVGAAGTLYEVAXEAP  303
            I+   N++C K  +++    L YPS  V+F      +  +R LTNVG+  ++YEV   AP
Sbjct  642  IITHMNVSCHKILQMNKGFTLNYPSISVIFKHGTTSKMVSRRLTNVGSTNSIYEVKVTAP  701

Query  302  PSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAF--GSVSWNNAQN---QVRS  138
              V V VKP +LVFK+V + L Y V F+S+KG        F  G ++W + +N   +VRS
Sbjct  702  EGVRVRVKPRRLVFKHVNESLNYKVWFMSEKG-KEGRKVRFTEGDLTWIHCENSKYKVRS  760

Query  137  PIAFSW  120
            PI  +W
Sbjct  761  PIVVTW  766



>ref|XP_010919194.1| PREDICTED: subtilisin-like protease isoform X1 [Elaeis guineensis]
Length=774

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 63/118 (53%), Gaps = 9/118 (8%)
 Frame = -3

Query  458  NITCA--KKLSNPAQLXYPSFXVLFGKSR---IVRQTRELTNVGAAGTLYEVAXEAPPSV  294
            N +C   + L N   L YPSF VLF +      V QTR +TNVG A   Y V    P  V
Sbjct  660  NYSCPNNRILGNIRDLNYPSFSVLFDRGSPNFTVTQTRIVTNVGQARCRYTVKVHEPKGV  719

Query  293  TVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            T+ V P +L F  +G +L Y V+F+  +G    ++ +FG + W   +  VRSP+A +W
Sbjct  720  TMNVDPKELDFVELGQKLSYKVSFLGLRG----TDTSFGELVWVCGEYSVRSPVAVTW  773



>ref|XP_010919195.1| PREDICTED: subtilisin-like protease isoform X2 [Elaeis guineensis]
Length=767

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 63/118 (53%), Gaps = 9/118 (8%)
 Frame = -3

Query  458  NITCA--KKLSNPAQLXYPSFXVLFGKSR---IVRQTRELTNVGAAGTLYEVAXEAPPSV  294
            N +C   + L N   L YPSF VLF +      V QTR +TNVG A   Y V    P  V
Sbjct  653  NYSCPNNRILGNIRDLNYPSFSVLFDRGSPNFTVTQTRIVTNVGQARCRYTVKVHEPKGV  712

Query  293  TVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            T+ V P +L F  +G +L Y V+F+  +G    ++ +FG + W   +  VRSP+A +W
Sbjct  713  TMNVDPKELDFVELGQKLSYKVSFLGLRG----TDTSFGELVWVCGEYSVRSPVAVTW  766



>tpg|DAA50265.1| TPA: putative subtilase family protein [Zea mays]
Length=764

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 53/133 (40%), Positives = 71/133 (53%), Gaps = 14/133 (11%)
 Frame = -3

Query  482  IQAIVKAPNITCAK-KLSNPAQLXYPSFXVLF--------GKSRIVRQTRELTNVGAAGT  330
            I A+ ++    CA+ K  +   L YPSF V +        G S  V  TR LTNVG AGT
Sbjct  635  IAAVARSREYACAENKTYSVGALNYPSFSVAYSTANGDGGGDSATVTHTRTLTNVGGAGT  694

Query  329  L-YEVAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPS-NAAFGSVSWNNA  156
                 +  A   V V V+P +L F +VG++  YTV F SK     PS  A FG + W++ 
Sbjct  695  YKASTSLAAAKGVAVDVEPAELEFTSVGEKKSYTVRFTSKS---QPSGTAGFGRLVWSDG  751

Query  155  QNQVRSPIAFSWT  117
            ++ V SPIAF+WT
Sbjct  752  KHSVASPIAFTWT  764



>ref|XP_006298979.1| hypothetical protein CARUB_v10015104mg [Capsella rubella]
 gb|EOA31877.1| hypothetical protein CARUB_v10015104mg [Capsella rubella]
Length=784

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 44/114 (39%), Positives = 62/114 (54%), Gaps = 5/114 (4%)
 Frame = -3

Query  440  KLSNPAQLXYPSFXVLFGKS-RIVRQTRELTNVGA-AGTLYEVAXEAPPSVTVTVKPTKL  267
            KL     L YPSF V+FG +  + +  R + NVG+    +YEV  ++P +V + V P+KL
Sbjct  664  KLRTAGDLNYPSFSVVFGSTGEVAKYRRVVKNVGSNVDAVYEVGVKSPANVEIEVSPSKL  723

Query  266  VFKNVGDRLRYTVTFVS---KKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  114
            VF      L Y VTF S     GV +     FGS+ W +  + V+SP+AF W Q
Sbjct  724  VFSKEKRELEYEVTFKSVVLGGGVGSMPGQEFGSIEWTDGDHVVKSPVAFQWGQ  777



>ref|XP_003605881.1| Subtilisin-like protease [Medicago truncatula]
 gb|KEH17073.1| subtilisin-like serine protease [Medicago truncatula]
Length=760

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 72/127 (57%), Gaps = 7/127 (6%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSRIV---RQTRELTNVGAAGTLYEV  318
             +I+ + +       KK  +   L YPSF V+F     V   + TR LTNVG  GT Y+V
Sbjct  635  NEIEMVARRKYTCDPKKQYSVENLNYPSFAVVFEDEHGVEEIKHTRTLTNVGVEGT-YKV  693

Query  317  AXEAP-PSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVR  141
            + ++  PS+ ++V+P  L FK    +L YT++F S  G    S  +FGSV W+N +  VR
Sbjct  694  SVKSDAPSIKISVEPEVLSFKKNEKKL-YTISF-SSAGSKPNSTQSFGSVEWSNGKTIVR  751

Query  140  SPIAFSW  120
            SPIAFSW
Sbjct  752  SPIAFSW  758



>gb|EYU37942.1| hypothetical protein MIMGU_mgv1a001727mg [Erythranthe guttata]
Length=768

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 50/128 (39%), Positives = 68/128 (53%), Gaps = 7/128 (5%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLF--GKSRIVRQT--RELTNVGAAGTLYE  321
            + IQ I ++P + C  +        YPS   LF  G   +  +T  R +TNVG +  +Y 
Sbjct  637  KTIQVITRSP-VNCPARKPLSENFNYPSIAALFPSGSDGVSSKTFYRMVTNVGGSNDVYT  695

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRY--TVTFVSKKGVVTPSNAAFGSVSWNNAQNQ  147
            V  + P  V V+VKP KLVF     RL Y  TVT  SK  V+  S A FGS+SW + ++ 
Sbjct  696  VKVDPPKGVEVSVKPEKLVFSESSRRLGYYVTVTIDSKNLVLDDSGAVFGSISWVDGKHV  755

Query  146  VRSPIAFS  123
            VRSPI  +
Sbjct  756  VRSPIVVT  763



>ref|XP_003636375.1| Subtilisin-like protease [Medicago truncatula]
Length=742

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 69/116 (59%), Gaps = 8/116 (7%)
 Frame = -3

Query  452  TCA-KKLSNPAQLXYPSFXVLFGKSRIV---RQTRELTNVGAAGTLYEVAXEAP-PSVTV  288
            TC  KK  +   L YPSF V+F     V   + TR LTNVG  GT Y+V+ ++  PS+ +
Sbjct  628  TCDPKKQYSVENLNYPSFAVVFEDEHGVEEIKHTRTLTNVGVEGT-YKVSVKSDAPSIKI  686

Query  287  TVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  120
            +V+P  L FK    +L YT++F S  G    S  +FGSV W+N +  VRSPIAFSW
Sbjct  687  SVEPEVLSFKKNEKKL-YTISF-SSAGSKPNSTQSFGSVEWSNGKTIVRSPIAFSW  740



>ref|XP_011088593.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=791

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 67/125 (54%), Gaps = 7/125 (6%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLF--GKSRIVRQT--RELTNVGAAGTLYE  321
            + IQ I ++  + C  +   P  L YPS   LF  G + +  +T  R +TNVG    +Y 
Sbjct  660  KTIQVITRSA-VNCPMRKPLPENLNYPSIAALFPSGSTGVSSKTFFRMVTNVGETNAVYR  718

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRY--TVTFVSKKGVVTPSNAAFGSVSWNNAQNQ  147
            V  E P  V V VKP KLVF     RL Y  T+T  SK  V+  S A FGS+SW + ++ 
Sbjct  719  VKIEPPKGVNVGVKPGKLVFSETVRRLGYYVTITIDSKHLVLDDSGAVFGSLSWVDGKHV  778

Query  146  VRSPI  132
            VRSPI
Sbjct  779  VRSPI  783



>ref|NP_001151549.1| subtilisin-like protease precursor [Zea mays]
 gb|ACG43281.1| subtilisin-like protease precursor [Zea mays]
Length=764

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 53/133 (40%), Positives = 71/133 (53%), Gaps = 14/133 (11%)
 Frame = -3

Query  482  IQAIVKAPNITCAK-KLSNPAQLXYPSFXVLF--------GKSRIVRQTRELTNVGAAGT  330
            I A+ ++    CA+ K  +   L YPSF V +        G S  V  TR LTNVG AGT
Sbjct  635  IAAVARSREYACAENKTYSVGALNYPSFSVAYSTANGDGGGDSATVTHTRTLTNVGGAGT  694

Query  329  L-YEVAXEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPS-NAAFGSVSWNNA  156
                 +  A   V V V+P +L F +VG++  YTV F SK     PS  A FG + W++ 
Sbjct  695  YKASTSLAAAKGVAVDVEPAELEFTSVGEKKSYTVRFTSKS---QPSGTAGFGRLVWSDG  751

Query  155  QNQVRSPIAFSWT  117
            ++ V SPIAF+WT
Sbjct  752  KHSVASPIAFTWT  764



>gb|AEW07410.1| hypothetical protein 0_744_01, partial [Pinus radiata]
Length=152

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 55/99 (56%), Gaps = 3/99 (3%)
 Frame = -3

Query  452  TCAKKLSNPAQLXYPSFXVLFGKSRIVRQT-RELTNVGAAGTLYEVAXEAPPSVTVTVKP  276
            +C K  S P  L YPSF V+F    +VR T R +TNVG A  +YE+A E P +V +TV+P
Sbjct  43   SCPKLSSAPGDLNYPSFSVVFKPRSLVRVTKRTVTNVGGAPCVYEMAVENPENVNITVEP  102

Query  275  TKLVFKNVGDRLRYTVTFVSKKGVVTPSNA--AFGSVSW  165
            T L F+   D+  YTV   SK      S    AFG + W
Sbjct  103  TTLAFEKQNDKATYTVKSESKIAADNKSKGGQAFGQILW  141



>ref|XP_004171629.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease-like 
[Cucumis sativus]
Length=769

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 64/123 (52%), Gaps = 4/123 (3%)
 Frame = -3

Query  476  AIVKAPNITCAKK--LSNPAQLXYPSFXVLFGKSRIVRQT--RELTNVGAAGTLYEVAXE  309
            ++V     TC+ K   S P  L YPSF V   K + V  T  R +TNVG   + Y V   
Sbjct  646  SLVSRGKFTCSSKNTFSQPGDLNYPSFSVFMKKGKNVNSTFKRTVTNVGIPRSDYTVRIN  705

Query  308  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  129
             P  + + VKP KL F  +G++L Y V+F +     +    +FGS+ W++    VRSPIA
Sbjct  706  NPKGIRIIVKPEKLNFVKLGEKLSYKVSFYALGKRESLDEFSFGSLVWHSGTYAVRSPIA  765

Query  128  FSW  120
             +W
Sbjct  766  VTW  768



>gb|ABR18065.1| unknown [Picea sitchensis]
Length=783

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 59/109 (54%), Gaps = 6/109 (6%)
 Frame = -3

Query  428  PAQLXYPSFXVLFGKSRIVRQTRE-LTNVGAAGTLYEVAXEAPPSVTVTVKPTKLVFKNV  252
            P  L YPSF V+F    +VR  R  +TNVG A  +YEV+ E+PP V + V+P  LVFK  
Sbjct  674  PGDLNYPSFSVVFKPLNLVRALRRTVTNVGGAPCVYEVSMESPPGVNIIVEPRTLVFKEQ  733

Query  251  GDRLRYTVTFVSKKGVVTPSNA--AFGSVSWNNAQNQ---VRSPIAFSW  120
             ++  YTV F SK      S+    FG + W   +     VRSP+A  W
Sbjct  734  NEKASYTVRFESKTASHNKSSGRQEFGQIWWKCVKGGTQVVRSPVAIVW  782



>emb|CDO96926.1| unnamed protein product [Coffea canephora]
Length=775

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 69/125 (55%), Gaps = 7/125 (6%)
 Frame = -3

Query  488  QQIQAIVKAPNITCAKKLSNPAQLXYPSFXVLFGKSR--IVRQT--RELTNVGAAGTLYE  321
            + IQ I ++P + C  +   P  L YPS    F  +   +  +T  R +TNVG A  +Y 
Sbjct  644  KTIQVITRSP-VNCPARKPLPENLNYPSIAAPFSSASTGVSSKTFFRTVTNVGEANAVYS  702

Query  320  VAXEAPPSVTVTVKPTKLVFKNVGDRLRY--TVTFVSKKGVVTPSNAAFGSVSWNNAQNQ  147
            V  EAP  V V VKP+KLVF     +L Y  TVT  SK  V+  S A FGS+SW + ++ 
Sbjct  703  VKVEAPKGVGVAVKPSKLVFTEKVRKLSYFVTVTADSKNLVIGDSGAVFGSLSWVDGKHV  762

Query  146  VRSPI  132
            VRSPI
Sbjct  763  VRSPI  767



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557548962370