BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF034K14

Length=735
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009415939.1|  PREDICTED: adenosylhomocysteinase                  282   2e-88   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP39327.1|  hypothetical protein JCGZ_01084                         281   3e-88   Jatropha curcas
ref|XP_008794647.1|  PREDICTED: adenosylhomocysteinase-like             281   5e-88   Phoenix dactylifera
gb|AFV46215.1|  hypothetical protein                                    275   6e-88   Scutellaria baicalensis [Baikal skullcap]
emb|CDP11183.1|  unnamed protein product                                280   1e-87   Coffea canephora [robusta coffee]
ref|XP_010268032.1|  PREDICTED: adenosylhomocysteinase-like             280   2e-87   Nelumbo nucifera [Indian lotus]
gb|KJB72025.1|  hypothetical protein B456_011G154000                    272   2e-87   Gossypium raimondii
ref|XP_010247578.1|  PREDICTED: adenosylhomocysteinase                  279   2e-87   Nelumbo nucifera [Indian lotus]
ref|XP_009413566.1|  PREDICTED: adenosylhomocysteinase-like             279   2e-87   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010551666.1|  PREDICTED: adenosylhomocysteinase 1-like           278   5e-87   Tarenaya hassleriana [spider flower]
gb|KHG10896.1|  Adenosylhomocysteinase 1 -like protein                  278   6e-87   Gossypium arboreum [tree cotton]
ref|XP_002278000.1|  PREDICTED: adenosylhomocysteinase-like             278   7e-87   Vitis vinifera
gb|KJB72026.1|  hypothetical protein B456_011G154000                    273   9e-87   Gossypium raimondii
ref|XP_004953493.1|  PREDICTED: adenosylhomocysteinase-like             278   9e-87   Setaria italica
dbj|BAH57232.1|  AT4G13940                                              271   1e-86   Arabidopsis thaliana [mouse-ear cress]
gb|KJB19538.1|  hypothetical protein B456_003G108500                    277   1e-86   Gossypium raimondii
gb|EMT11613.1|  Adenosylhomocysteinase                                  271   2e-86   
ref|XP_010908558.1|  PREDICTED: adenosylhomocysteinase                  277   2e-86   
ref|XP_011102056.1|  PREDICTED: adenosylhomocysteinase                  276   3e-86   Sesamum indicum [beniseed]
ref|XP_003601687.1|  Adenosylhomocysteinase                             276   3e-86   Medicago truncatula
ref|XP_010527457.1|  PREDICTED: adenosylhomocysteinase 1                276   3e-86   Tarenaya hassleriana [spider flower]
ref|XP_009403608.1|  PREDICTED: adenosylhomocysteinase-like             276   3e-86   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB37873.1|  hypothetical protein B456_006G223900                    276   3e-86   Gossypium raimondii
ref|XP_011083449.1|  PREDICTED: adenosylhomocysteinase-like             276   4e-86   Sesamum indicum [beniseed]
emb|CAH69227.1|  putative adenosylhomocysteinase                        268   4e-86   Nicotiana glauca [glaucous tobacco]
sp|P50246.1|SAHH_MEDSA  RecName: Full=Adenosylhomocysteinase; Sho...    276   4e-86   Medicago sativa [alfalfa]
gb|AFK46472.1|  unknown                                                 269   6e-86   Lotus japonicus
gb|KJB72027.1|  hypothetical protein B456_011G154000                    273   7e-86   Gossypium raimondii
ref|XP_008222807.1|  PREDICTED: adenosylhomocysteinase isoform X1       275   7e-86   Prunus mume [ume]
ref|XP_007037836.1|  S-adenosyl-L-homocysteine hydrolase                275   7e-86   
gb|KJB28098.1|  hypothetical protein B456_005G027700                    275   7e-86   Gossypium raimondii
ref|XP_007222610.1|  hypothetical protein PRUPE_ppa004934mg             275   9e-86   Prunus persica
ref|XP_010673385.1|  PREDICTED: adenosylhomocysteinase                  275   9e-86   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008361486.1|  PREDICTED: adenosylhomocysteinase                  275   9e-86   Malus domestica [apple tree]
gb|KHN12344.1|  Adenosylhomocysteinase                                  273   1e-85   Glycine soja [wild soybean]
dbj|BAA03710.1|  cytokinin binding protein CBP57                        273   1e-85   Nicotiana sylvestris
ref|XP_004973012.1|  PREDICTED: adenosylhomocysteinase-like             275   1e-85   Setaria italica
gb|KHG19993.1|  Adenosylhomocysteinase 1 -like protein                  275   1e-85   Gossypium arboreum [tree cotton]
gb|EYU31514.1|  hypothetical protein MIMGU_mgv1a005403mg                274   2e-85   Erythranthe guttata [common monkey flower]
ref|XP_009373550.1|  PREDICTED: adenosylhomocysteinase                  274   2e-85   Pyrus x bretschneideri [bai li]
gb|ABA93500.1|  Adenosylhomocysteinase, putative, expressed             273   2e-85   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ11250.1|  S-adenosyl-L-homocystein hydrolase                      274   2e-85   Gossypium hirsutum [American cotton]
gb|AAO72664.1|  wheat adenosylhomocysteinase-like protein               274   2e-85   Oryza sativa Japonica Group [Japonica rice]
gb|KJB72029.1|  hypothetical protein B456_011G154000                    273   2e-85   Gossypium raimondii
ref|XP_002870350.1|  hypothetical protein ARALYDRAFT_915516             274   2e-85   Arabidopsis lyrata subsp. lyrata
ref|XP_010052042.1|  PREDICTED: adenosylhomocysteinase 1                274   2e-85   Eucalyptus grandis [rose gum]
gb|EMS57067.1|  Adenosylhomocysteinase                                  271   3e-85   Triticum urartu
gb|KJB72024.1|  hypothetical protein B456_011G154000                    274   3e-85   Gossypium raimondii
ref|XP_009787091.1|  PREDICTED: adenosylhomocysteinase-like             274   3e-85   Nicotiana sylvestris
ref|XP_010253338.1|  PREDICTED: adenosylhomocysteinase                  273   3e-85   Nelumbo nucifera [Indian lotus]
ref|XP_007163813.1|  hypothetical protein PHAVU_001G266500g             273   3e-85   Phaseolus vulgaris [French bean]
ref|NP_001031627.1|  adenosylhomocysteinase 1                           270   3e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004502244.1|  PREDICTED: adenosylhomocysteinase-like             273   3e-85   Cicer arietinum [garbanzo]
ref|XP_011102207.1|  PREDICTED: adenosylhomocysteinase-like             273   4e-85   Sesamum indicum [beniseed]
ref|XP_010466741.1|  PREDICTED: adenosylhomocysteinase 2-like iso...    267   4e-85   Camelina sativa [gold-of-pleasure]
ref|XP_010913095.1|  PREDICTED: adenosylhomocysteinase-like             273   4e-85   Elaeis guineensis
ref|XP_003524926.1|  PREDICTED: adenosylhomocysteinase-like             273   4e-85   
gb|KHG17040.1|  Adenosylhomocysteinase                                  273   4e-85   Gossypium arboreum [tree cotton]
ref|XP_010097949.1|  hypothetical protein L484_026840                   273   5e-85   Morus notabilis
gb|KFK28004.1|  hypothetical protein AALP_AA8G459100                    273   5e-85   Arabis alpina [alpine rockcress]
ref|XP_003577583.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    273   5e-85   
ref|NP_001031628.1|  adenosylhomocysteinase 1                           271   5e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008380474.1|  PREDICTED: adenosylhomocysteinase                  273   5e-85   Malus domestica [apple tree]
ref|XP_010905139.1|  PREDICTED: adenosylhomocysteinase-like             273   7e-85   Elaeis guineensis
tpg|DAA38860.1|  TPA: hypothetical protein ZEAMMB73_022938              265   8e-85   
gb|EPS72602.1|  adenosylhomocysteinase                                  275   9e-85   Genlisea aurea
ref|XP_006283635.1|  hypothetical protein CARUB_v10004693mg             272   9e-85   Capsella rubella
gb|AAV31755.1|  S-adenosyl-L-homocysteine hydrolase                     272   9e-85   Nicotiana tabacum [American tobacco]
ref|XP_009606591.1|  PREDICTED: adenosylhomocysteinase-like             272   9e-85   Nicotiana tomentosiformis
ref|XP_009349913.1|  PREDICTED: adenosylhomocysteinase-like             272   9e-85   Pyrus x bretschneideri [bai li]
ref|XP_006662925.1|  PREDICTED: adenosylhomocysteinase-like             272   1e-84   Oryza brachyantha
ref|NP_001148534.1|  adenosylhomocysteinase                             272   1e-84   
gb|AGT16642.1|  Adenosylhomocysteinase                                  272   1e-84   Saccharum hybrid cultivar R570
gb|KHN44476.1|  Adenosylhomocysteinase                                  266   1e-84   Glycine soja [wild soybean]
gb|ACN34730.1|  unknown                                                 272   1e-84   Zea mays [maize]
ref|XP_003531217.1|  PREDICTED: adenosylhomocysteinase-like             272   1e-84   Glycine max [soybeans]
dbj|BAP47516.1|  S-adenosylhomocysteine hydrolase                       272   1e-84   Gentiana triflora
ref|NP_001067845.2|  Os11g0455500                                       273   2e-84   
ref|XP_002522805.1|  adenosylhomocysteinase, putative                   271   2e-84   Ricinus communis
ref|XP_004247887.1|  PREDICTED: adenosylhomocysteinase                  271   2e-84   Solanum lycopersicum
gb|AGX26650.1|  S-adenosyl-l-homocysteine hydrolase A                   271   2e-84   Populus tomentosa [Chinese white poplar]
ref|XP_002987608.1|  hypothetical protein SELMODRAFT_158886             271   2e-84   Selaginella moellendorffii
ref|XP_002266154.1|  PREDICTED: adenosylhomocysteinase                  271   2e-84   Vitis vinifera
gb|KFK36278.1|  hypothetical protein AALP_AA4G101800                    271   2e-84   Arabis alpina [alpine rockcress]
gb|KJB72028.1|  hypothetical protein B456_011G154000                    271   2e-84   Gossypium raimondii
gb|AGX26665.1|  S-adenosyl-l-homocysteine hydrolase A                   271   2e-84   Populus tomentosa [Chinese white poplar]
ref|XP_006360925.1|  PREDICTED: adenosylhomocysteinase-like isofo...    271   2e-84   
gb|AGX26683.1|  S-adenosyl-l-homocysteine hydrolase A                   271   2e-84   Populus tomentosa [Chinese white poplar]
gb|AGW81844.1|  S-(5'-adenosyl)-l-homocysteine hydrolase A              271   2e-84   Populus tomentosa [Chinese white poplar]
gb|AGX26687.1|  S-adenosyl-l-homocysteine hydrolase A                   271   3e-84   Populus tomentosa [Chinese white poplar]
ref|XP_008776857.1|  PREDICTED: adenosylhomocysteinase-like             271   3e-84   Phoenix dactylifera
gb|AGX26663.1|  S-adenosyl-l-homocysteine hydrolase A                   271   3e-84   Populus tomentosa [Chinese white poplar]
gb|AGX26652.1|  S-adenosyl-l-homocysteine hydrolase A                   271   3e-84   Populus tomentosa [Chinese white poplar]
gb|AGX26646.1|  S-adenosyl-l-homocysteine hydrolase A                   271   3e-84   Populus tomentosa [Chinese white poplar]
gb|AGX26677.1|  S-adenosyl-l-homocysteine hydrolase A                   271   3e-84   Populus tomentosa [Chinese white poplar]
gb|AGX26671.1|  S-adenosyl-l-homocysteine hydrolase A                   271   3e-84   Populus tomentosa [Chinese white poplar]
gb|AGX26647.1|  S-adenosyl-l-homocysteine hydrolase A                   271   3e-84   Populus tomentosa [Chinese white poplar]
ref|XP_006349914.1|  PREDICTED: adenosylhomocysteinase-like             271   3e-84   Solanum tuberosum [potatoes]
gb|AGX26654.1|  S-adenosyl-l-homocysteine hydrolase A                   271   3e-84   Populus tomentosa [Chinese white poplar]
gb|AGX26674.1|  S-adenosyl-l-homocysteine hydrolase A                   271   3e-84   Populus tomentosa [Chinese white poplar]
gb|AGX26679.1|  S-adenosyl-l-homocysteine hydrolase A                   271   3e-84   Populus tomentosa [Chinese white poplar]
gb|AGX26676.1|  S-adenosyl-l-homocysteine hydrolase A                   271   3e-84   Populus tomentosa [Chinese white poplar]
ref|XP_008222808.1|  PREDICTED: adenosylhomocysteinase isoform X2       273   3e-84   
gb|AGX26662.1|  S-adenosyl-l-homocysteine hydrolase A                   271   3e-84   Populus tomentosa [Chinese white poplar]
ref|XP_011012490.1|  PREDICTED: adenosylhomocysteinase-like             271   3e-84   Populus euphratica
ref|XP_004296983.1|  PREDICTED: adenosylhomocysteinase                  271   3e-84   Fragaria vesca subsp. vesca
ref|XP_010532739.1|  PREDICTED: adenosylhomocysteinase 1                271   4e-84   Tarenaya hassleriana [spider flower]
gb|AAP92453.1|  S-adenosyl-L-homocystein hydrolase                      271   4e-84   Arabidopsis thaliana [mouse-ear cress]
gb|KCW59952.1|  hypothetical protein EUGRSUZ_H02678                     270   4e-84   Eucalyptus grandis [rose gum]
gb|AGX26673.1|  S-adenosyl-l-homocysteine hydrolase A                   271   4e-84   Populus tomentosa [Chinese white poplar]
gb|AGX26689.1|  S-adenosyl-l-homocysteine hydrolase A                   271   4e-84   Populus tomentosa [Chinese white poplar]
ref|NP_193130.1|  adenosylhomocysteinase 1                              271   4e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004252985.1|  PREDICTED: adenosylhomocysteinase-like             271   4e-84   Solanum lycopersicum
emb|CCC55421.1|  S-adenosyl-L-homocysteine hydrolase                    270   5e-84   Pinus pinaster [cluster pine]
gb|AGX26649.1|  S-adenosyl-l-homocysteine hydrolase A                   270   5e-84   Populus tomentosa [Chinese white poplar]
gb|KDO43195.1|  hypothetical protein CISIN_1g011464mg                   269   5e-84   Citrus sinensis [apfelsine]
gb|AGX26669.1|  S-adenosyl-l-homocysteine hydrolase A                   270   6e-84   Populus tomentosa [Chinese white poplar]
emb|CAJ01707.1|  putative S-adenosylhomocystein hydrolase 2             270   6e-84   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010023650.1|  PREDICTED: adenosylhomocysteinase                  270   6e-84   Eucalyptus grandis [rose gum]
emb|CAB09795.1|  S-adenosyl-L-homocysteine hydrolase                    270   7e-84   Arabidopsis thaliana [mouse-ear cress]
gb|AFU51537.1|  S-adenosyl-homocysteine hydrolase protein               270   7e-84   Capsicum annuum
gb|EMT01272.1|  Adenosylhomocysteinase                                  270   7e-84   
gb|AAM62888.1|  adenosylhomocysteinase                                  270   8e-84   Arabidopsis thaliana [mouse-ear cress]
gb|AGX26685.1|  S-adenosyl-l-homocysteine hydrolase A                   270   9e-84   Populus tomentosa [Chinese white poplar]
gb|AGX26664.1|  S-adenosyl-l-homocysteine hydrolase A                   270   9e-84   Populus tomentosa [Chinese white poplar]
gb|AGX26655.1|  S-adenosyl-l-homocysteine hydrolase A                   270   9e-84   Populus tomentosa [Chinese white poplar]
gb|AGX26681.1|  S-adenosyl-l-homocysteine hydrolase A                   270   1e-83   Populus tomentosa [Chinese white poplar]
gb|KDO43194.1|  hypothetical protein CISIN_1g011464mg                   270   1e-83   Citrus sinensis [apfelsine]
gb|AFZ78657.1|  S-adenosyl-L-homocysteine hydrolase                     270   1e-83   Populus tomentosa [Chinese white poplar]
ref|XP_006492541.1|  PREDICTED: adenosylhomocysteinase-like             270   1e-83   Citrus sinensis [apfelsine]
gb|ABI95857.1|  S-adenosyl-homocysteine hydrolase                       270   1e-83   Nicotiana suaveolens
gb|AGX26667.1|  S-adenosyl-l-homocysteine hydrolase A                   269   1e-83   Populus tomentosa [Chinese white poplar]
dbj|BAP47515.1|  S-adenosylhomocysteine hydrolase                       269   1e-83   Gentiana triflora
gb|AGX26651.1|  S-adenosyl-l-homocysteine hydrolase A                   269   1e-83   Populus tomentosa [Chinese white poplar]
gb|AAV31754.1|  S-adenosyl-L-homocysteine hydrolase                     269   2e-83   Nicotiana tabacum [American tobacco]
ref|XP_006414844.1|  hypothetical protein EUTSA_v10024750mg             272   2e-83   
gb|AFK08605.1|  S-adenosyl homocysteine hydrolase                       269   2e-83   Nicotiana benthamiana
gb|AGX26684.1|  S-adenosyl-l-homocysteine hydrolase A                   269   2e-83   Populus tomentosa [Chinese white poplar]
ref|NP_001289538.1|  adenosylhomocysteinase                             269   2e-83   Nicotiana sylvestris
gb|AGX26657.1|  S-adenosyl-l-homocysteine hydrolase A                   269   2e-83   Populus tomentosa [Chinese white poplar]
emb|CAJ01706.1|  S-adenosyl-L-homocysteine hydrolase                    268   2e-83   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008803686.1|  PREDICTED: adenosylhomocysteinase                  269   2e-83   Phoenix dactylifera
emb|CDP15078.1|  unnamed protein product                                269   2e-83   Coffea canephora [robusta coffee]
ref|XP_006848518.1|  hypothetical protein AMTR_s00013p00261120          269   2e-83   Amborella trichopoda
gb|AAX16000.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            269   2e-83   Arabidopsis thaliana [mouse-ear cress]
gb|AGX26678.1|  S-adenosyl-l-homocysteine hydrolase A                   268   3e-83   Populus tomentosa [Chinese white poplar]
sp|P35007.1|SAHH_CATRO  RecName: Full=Adenosylhomocysteinase; Sho...    268   3e-83   Catharanthus roseus [chatas]
gb|AAX15998.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            268   3e-83   Arabidopsis thaliana [mouse-ear cress]
gb|AGX26656.1|  S-adenosyl-l-homocysteine hydrolase A                   268   3e-83   Populus tomentosa [Chinese white poplar]
gb|AGX26666.1|  S-adenosyl-l-homocysteine hydrolase A                   268   3e-83   Populus tomentosa [Chinese white poplar]
sp|Q9SP37.1|SAHH_LUPLU  RecName: Full=Adenosylhomocysteinase; Sho...    268   3e-83   Lupinus luteus
emb|CDY47309.1|  BnaAnng08830D                                          268   3e-83   Brassica napus [oilseed rape]
gb|AGX26672.1|  S-adenosyl-l-homocysteine hydrolase A                   268   3e-83   Populus tomentosa [Chinese white poplar]
pdb|3OND|A  Chain A, Crystal Structure Of Lupinus Luteus S-adenos...    268   4e-83   Lupinus luteus
ref|XP_009102577.1|  PREDICTED: adenosylhomocysteinase 2                268   4e-83   Brassica rapa
ref|XP_006373090.1|  adenosylhomocysteinase family protein              268   5e-83   Populus trichocarpa [western balsam poplar]
gb|EYU31513.1|  hypothetical protein MIMGU_mgv1a004058mg                270   5e-83   Erythranthe guttata [common monkey flower]
ref|XP_009135865.1|  PREDICTED: adenosylhomocysteinase 2-like           268   5e-83   Brassica rapa
gb|AGX26653.1|  S-adenosyl-l-homocysteine hydrolase A                   268   6e-83   Populus tomentosa [Chinese white poplar]
ref|XP_006418835.1|  hypothetical protein EUTSA_v10002505mg             268   6e-83   Eutrema salsugineum [saltwater cress]
gb|AAA33855.1|  S-adenosylhomocysteine hydrolase                        259   6e-83   Petroselinum crispum
gb|EMS57266.1|  Adenosylhomocysteinase                                  274   6e-83   Triticum urartu
gb|AGX26686.1|  S-adenosyl-l-homocysteine hydrolase A                   268   7e-83   Populus tomentosa [Chinese white poplar]
gb|AGX26682.1|  S-adenosyl-l-homocysteine hydrolase A                   268   7e-83   Populus tomentosa [Chinese white poplar]
gb|AGX26661.1|  S-adenosyl-l-homocysteine hydrolase A                   268   7e-83   Populus tomentosa [Chinese white poplar]
emb|CDY50423.1|  BnaCnng19320D                                          268   7e-83   Brassica napus [oilseed rape]
ref|XP_006421018.1|  hypothetical protein CICLE_v10004852mg             268   7e-83   Citrus clementina [clementine]
ref|NP_001234012.1|  adenosylhomocysteinase                             268   7e-83   
ref|XP_002883461.1|  S-adenosyl-L-homocysteine (sah) hydrolase 2        267   7e-83   
gb|AAX15999.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            267   8e-83   Arabidopsis thaliana [mouse-ear cress]
emb|CDY01177.1|  BnaA04g06420D                                          267   8e-83   
ref|NP_001265954.1|  adenosylhomocysteinase-like                        267   8e-83   Cicer arietinum [garbanzo]
gb|AEI54335.1|  adenosylhomocysteinase                                  267   9e-83   Glycine max [soybeans]
sp|Q01781.2|SAHH_PETCR  RecName: Full=Adenosylhomocysteinase; Sho...    267   9e-83   Petroselinum crispum
ref|XP_007153624.1|  hypothetical protein PHAVU_003G051200g             267   1e-82   Phaseolus vulgaris [French bean]
sp|P93253.1|SAHH_MESCR  RecName: Full=Adenosylhomocysteinase; Sho...    267   1e-82   Mesembryanthemum crystallinum
gb|KFK39678.1|  hypothetical protein AALP_AA3G275000                    266   1e-82   Arabis alpina [alpine rockcress]
ref|XP_009106322.1|  PREDICTED: adenosylhomocysteinase 2                266   2e-82   Brassica rapa
gb|AAM19782.1|  AT3g23810/MYM9_15                                       266   2e-82   Arabidopsis thaliana [mouse-ear cress]
gb|AAL16259.1|AF428329_1  AT3g23810/MYM9_15                             266   2e-82   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189023.1|  adenosylhomocysteinase 2                              266   2e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008457223.1|  PREDICTED: adenosylhomocysteinase 1                266   2e-82   Cucumis melo [Oriental melon]
ref|XP_010512939.1|  PREDICTED: adenosylhomocysteinase 2-like           266   2e-82   Camelina sativa [gold-of-pleasure]
ref|XP_010466740.1|  PREDICTED: adenosylhomocysteinase 2-like iso...    266   2e-82   Camelina sativa [gold-of-pleasure]
ref|XP_008671500.1|  PREDICTED: adenosylhomocysteinase-like             264   3e-82   
ref|XP_010488460.1|  PREDICTED: adenosylhomocysteinase 2                266   3e-82   Camelina sativa [gold-of-pleasure]
ref|XP_003538528.1|  PREDICTED: adenosylhomocysteinase-like             266   3e-82   Glycine max [soybeans]
gb|ACN40278.1|  unknown                                                 266   3e-82   Picea sitchensis
ref|XP_007034216.1|  S-adenosyl-L-homocysteine hydrolase                266   3e-82   
gb|ABR16547.1|  unknown                                                 266   4e-82   Picea sitchensis
ref|XP_006297468.1|  hypothetical protein CARUB_v10013488mg             266   4e-82   
gb|ABR17322.1|  unknown                                                 265   4e-82   Picea sitchensis
ref|XP_001755926.1|  predicted protein                                  265   4e-82   
ref|XP_009139575.1|  PREDICTED: adenosylhomocysteinase 1                265   4e-82   Brassica rapa
ref|XP_004166113.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    265   5e-82   
ref|XP_004133979.1|  PREDICTED: adenosylhomocysteinase-like             265   5e-82   Cucumis sativus [cucumbers]
ref|XP_001755929.1|  predicted protein                                  265   5e-82   
gb|ABR16573.1|  unknown                                                 265   5e-82   Picea sitchensis
gb|AHL20280.1|  S-adenosylhomocysteine hydrolase                        265   6e-82   Kalanchoe daigremontiana
ref|XP_003629610.1|  Adenosylhomocysteinase                             265   7e-82   Medicago truncatula
gb|AIG62173.1|  S-adenosyl-L-homocysteine hydrolase                     265   7e-82   Populus tomentosa [Chinese white poplar]
gb|AIG62161.1|  S-adenosyl-L-homocysteine hydrolase                     265   8e-82   Populus tomentosa [Chinese white poplar]
gb|AIG62171.1|  S-adenosyl-L-homocysteine hydrolase                     265   8e-82   Populus tomentosa [Chinese white poplar]
gb|AIG62149.1|  S-adenosyl-L-homocysteine hydrolase                     265   8e-82   Populus tomentosa [Chinese white poplar]
gb|ABR16616.1|  unknown                                                 263   9e-82   Picea sitchensis
gb|AIG62181.1|  S-adenosyl-L-homocysteine hydrolase                     265   9e-82   Populus tomentosa [Chinese white poplar]
gb|AIG62151.1|  S-adenosyl-L-homocysteine hydrolase                     265   9e-82   Populus tomentosa [Chinese white poplar]
gb|AIG62152.1|  S-adenosyl-L-homocysteine hydrolase                     265   9e-82   Populus tomentosa [Chinese white poplar]
gb|AIG62170.1|  S-adenosyl-L-homocysteine hydrolase                     265   9e-82   Populus tomentosa [Chinese white poplar]
gb|AIG62164.1|  S-adenosyl-L-homocysteine hydrolase                     265   9e-82   Populus tomentosa [Chinese white poplar]
gb|AIG62187.1|  S-adenosyl-L-homocysteine hydrolase                     265   9e-82   Populus tomentosa [Chinese white poplar]
gb|AIG62165.1|  S-adenosyl-L-homocysteine hydrolase                     265   9e-82   Populus tomentosa [Chinese white poplar]
dbj|BAE71233.1|  putative adenosylhomocysteinase                        265   1e-81   Trifolium pratense [peavine clover]
gb|AIG62182.1|  S-adenosyl-L-homocysteine hydrolase                     265   1e-81   Populus tomentosa [Chinese white poplar]
gb|AIG62184.1|  S-adenosyl-L-homocysteine hydrolase                     265   1e-81   Populus tomentosa [Chinese white poplar]
ref|XP_011003627.1|  PREDICTED: adenosylhomocysteinase                  265   1e-81   Populus euphratica
gb|AIG62168.1|  S-adenosyl-L-homocysteine hydrolase                     265   1e-81   Populus tomentosa [Chinese white poplar]
gb|AIG62166.1|  S-adenosyl-L-homocysteine hydrolase                     265   1e-81   Populus tomentosa [Chinese white poplar]
gb|AIG62190.1|  S-adenosyl-L-homocysteine hydrolase                     264   1e-81   Populus tomentosa [Chinese white poplar]
gb|AIG62176.1|  S-adenosyl-L-homocysteine hydrolase                     264   1e-81   Populus tomentosa [Chinese white poplar]
gb|AIG62160.1|  S-adenosyl-L-homocysteine hydrolase                     264   1e-81   Populus tomentosa [Chinese white poplar]
gb|AIG62158.1|  S-adenosyl-L-homocysteine hydrolase                     264   1e-81   Populus tomentosa [Chinese white poplar]
ref|XP_004138966.1|  PREDICTED: adenosylhomocysteinase-like             264   1e-81   
gb|AIG62163.1|  S-adenosyl-L-homocysteine hydrolase                     264   1e-81   Populus tomentosa [Chinese white poplar]
gb|AIG62150.1|  S-adenosyl-L-homocysteine hydrolase                     264   1e-81   Populus tomentosa [Chinese white poplar]
gb|AIG62148.1|  S-adenosyl-L-homocysteine hydrolase                     264   1e-81   Populus tomentosa [Chinese white poplar]
gb|AIG62186.1|  S-adenosyl-L-homocysteine hydrolase                     264   1e-81   Populus tomentosa [Chinese white poplar]
gb|AIG62180.1|  S-adenosyl-L-homocysteine hydrolase                     264   1e-81   Populus tomentosa [Chinese white poplar]
gb|ABK24229.1|  unknown                                                 264   1e-81   Picea sitchensis
gb|AIG62185.1|  S-adenosyl-L-homocysteine hydrolase                     264   1e-81   Populus tomentosa [Chinese white poplar]
sp|P32112.1|SAHH_WHEAT  RecName: Full=Adenosylhomocysteinase; Sho...    264   2e-81   Triticum aestivum [Canadian hard winter wheat]
gb|ABR16138.1|  unknown                                                 264   2e-81   Picea sitchensis
gb|AIG62156.1|  S-adenosyl-L-homocysteine hydrolase                     264   2e-81   Populus tomentosa [Chinese white poplar]
gb|ABK25129.1|  unknown                                                 264   2e-81   Picea sitchensis
gb|AAK92718.1|  putative S-adenosyl-L-homocysteinas protein             264   2e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001755906.1|  predicted protein                                  264   2e-81   
gb|ABJ53283.1|  S-adenosyl-L-homocysteine hydrolase                     259   2e-81   
gb|AIG62177.1|  S-adenosyl-L-homocysteine hydrolase                     263   3e-81   Populus tomentosa [Chinese white poplar]
gb|AIG62188.1|  S-adenosyl-L-homocysteine hydrolase                     263   3e-81   Populus tomentosa [Chinese white poplar]
gb|AIG62157.1|  S-adenosyl-L-homocysteine hydrolase                     263   3e-81   Populus tomentosa [Chinese white poplar]
sp|P50249.1|SAHH_PHASS  RecName: Full=Adenosylhomocysteinase; Sho...    263   4e-81   Phalaenopsis sp.
gb|AIG62159.1|  S-adenosyl-L-homocysteine hydrolase                     263   5e-81   Populus tomentosa [Chinese white poplar]
gb|AIG62169.1|  S-adenosyl-L-homocysteine hydrolase                     263   5e-81   Populus tomentosa [Chinese white poplar]
gb|AAP92452.1|  S-adenosyl-L-homocystein hydrolase                      263   5e-81   Petunia x hybrida [garden petunia]
gb|AHA84211.1|  S-adenosyl-L-homocysteine hydrolase                     263   5e-81   Phaseolus vulgaris [French bean]
gb|AIG62191.1|  S-adenosyl-L-homocysteine hydrolase                     262   7e-81   Populus tomentosa [Chinese white poplar]
gb|EYU32710.1|  hypothetical protein MIMGU_mgv1a003606mg                265   7e-81   Erythranthe guttata [common monkey flower]
gb|AER92590.1|  putative S-adenosyl-L-homocysteinase                    264   8e-81   Linum usitatissimum
ref|XP_002300147.1|  adenosylhomocysteinase family protein              262   9e-81   Populus trichocarpa [western balsam poplar]
gb|AIG62155.1|  S-adenosyl-L-homocysteine hydrolase                     262   9e-81   Populus tomentosa [Chinese white poplar]
gb|AIG62178.1|  S-adenosyl-L-homocysteine hydrolase                     262   1e-80   Populus tomentosa [Chinese white poplar]
gb|AIG62154.1|  S-adenosyl-L-homocysteine hydrolase                     261   1e-80   Populus tomentosa [Chinese white poplar]
gb|AIG62174.1|  S-adenosyl-L-homocysteine hydrolase                     261   1e-80   Populus tomentosa [Chinese white poplar]
gb|AIG62179.1|  S-adenosyl-L-homocysteine hydrolase                     261   2e-80   Populus tomentosa [Chinese white poplar]
gb|ABQ18314.1|  S-adenosyl-L-homocysteine hydrolase                     261   2e-80   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADR30776.1|  S-adenosyl-L-homocysteine hydrolase                     261   2e-80   Cucumis sativus [cucumbers]
gb|ACI31554.1|  S-adenosyl homocysteine hydrolase                       251   5e-80   Nicotiana benthamiana
ref|XP_008438321.1|  PREDICTED: adenosylhomocysteinase-like             260   6e-80   Cucumis melo [Oriental melon]
gb|ABB55380.1|  S-adenosyl-L-homocysteine hydrolase-like                258   4e-79   Solanum tuberosum [potatoes]
gb|KFK36282.1|  hypothetical protein AALP_AA4G102500                    246   7e-79   Arabis alpina [alpine rockcress]
gb|ACE96401.1|  C-x8-C-x5-C-x3-H type Zn-finger                         236   8e-75   Populus tremula [European aspen]
gb|ACE96407.1|  C-x8-C-x5-C-x3-H type Zn-finger                         236   1e-74   Populus tremula [European aspen]
ref|XP_005843353.1|  S-adenosyl-L-homocysteine hydrolase                240   2e-72   Chlorella variabilis
ref|XP_003081254.1|  SAHH_PETCR Adenosylhomocysteinase (ISS)            238   2e-72   
gb|KIZ05177.1|  adenosylhomocysteinase                                  248   3e-72   Monoraphidium neglectum
ref|XP_001693339.1|  S-Adenosyl homocysteine hydrolase                  239   6e-72   Chlamydomonas reinhardtii
emb|CEF99088.1|  S-adenosyl-L-homocysteine hydrolase, conserved site    239   7e-72   Ostreococcus tauri
ref|XP_003057172.1|  adenosylhomocysteinase                             239   1e-71   Micromonas pusilla CCMP1545
ref|XP_002950429.1|  hypothetical protein VOLCADRAFT_74602              238   2e-71   Volvox carteri f. nagariensis
ref|XP_002505983.1|  adenosylhomocysteinase                             237   3e-71   Micromonas commoda
ref|XP_001419579.1|  predicted protein                                  237   3e-71   Ostreococcus lucimarinus CCE9901
emb|CDY58805.1|  BnaC08g46780D                                          236   4e-71   Brassica napus [oilseed rape]
gb|ADQ00183.1|  S-adenosyl homocysteine hydrolase                       236   6e-71   Chlamydomonas sp. ICE-L
emb|CDX85127.1|  BnaC07g07790D                                          236   6e-71   
gb|AJD09650.1|  SAHH1                                                   225   1e-70   Braya humilis
gb|AJD09657.1|  SAHH1                                                   224   2e-70   Lepidium campestre [bastard cress]
gb|AAL09400.1|AF307335_1  cytokinin binding protein                     234   2e-70   Petunia x hybrida [garden petunia]
gb|AJD09655.1|  SAHH1                                                   224   2e-70   Iberis amara [bitter candytuft]
ref|XP_009107496.1|  PREDICTED: adenosylhomocysteinase 1-like           234   3e-70   Brassica rapa
gb|AJD09647.1|  SAHH1                                                   224   4e-70   
gb|ADJ96635.1|  S-adenosyl homocysteine hydrolase                       234   4e-70   
gb|AJD09658.1|  SAHH1                                                   223   6e-70   
gb|AJD09648.1|  SAHH1                                                   223   9e-70   
gb|AJD09646.1|  SAHH1                                                   222   1e-69   
gb|AJD09654.1|  SAHH1                                                   222   2e-69   
gb|AJD09659.1|  SAHH1                                                   221   2e-69   
gb|KCW59951.1|  hypothetical protein EUGRSUZ_H02678                     233   4e-69   
gb|AJD09652.1|  SAHH1                                                   221   5e-69   
gb|AAP92454.1|  S-adenosyl-L-homocystein hydrolase                      229   2e-68   
gb|AJD09649.1|  SAHH1                                                   216   3e-67   
ref|XP_005708566.1|  adenosylhomocysteinase                             226   6e-67   
ref|XP_005643510.1|  S-Adenosyl homocysteine hydrolase                  226   8e-67   
emb|CBN20774.1|  S-Adenosyl homocysteine hydrolase                      224   5e-66   
gb|KDD76058.1|  S-adenosyl-L-homocysteine hydrolase                     223   1e-65   
ref|XP_007510486.1|  S-adenosyl-L-homocysteine hydrolase                224   1e-65   
ref|XP_011397211.1|  Adenosylhomocysteinase                             221   9e-65   
emb|CDY50106.1|  BnaC01g43540D                                          217   3e-63   
ref|XP_003884366.1|  hypothetical protein NCLIV_047660                  214   1e-62   
ref|XP_009493630.1|  adenosylhomocysteinase 1                           214   2e-62   
emb|CDY67319.1|  BnaA03g57570D                                          205   3e-62   
gb|EJY87176.1|  Adenosylhomocysteinase                                  214   3e-62   
gb|KFG60763.1|  putative adenosylhomocysteinase                         210   5e-62   
ref|XP_008881882.1|  adenosylhomocysteinase, putative                   212   9e-62   
emb|CDW86895.1|  s-adenosyl-l-homocysteine hydrolase                    212   2e-61   
gb|EJK64241.1|  hypothetical protein THAOC_15047                        204   2e-61   
ref|XP_002366178.1|  adenosylhomocysteinase, putative                   211   3e-61   
emb|CDX77483.1|  BnaA07g06210D                                          209   9e-61   
ref|XP_005716982.1|  S-adenosyl-L-homocysteine hydrolase                210   9e-61   
gb|EPT27008.1|  adenosylhomocysteinase, putative                        211   2e-60   
gb|KFH13893.1|  putative adenosylhomocysteinase                         211   2e-60   
ref|XP_008872075.1|  adenosylhomocysteinase 2                           209   2e-60   
gb|KFG55060.1|  putative adenosylhomocysteinase                         211   3e-60   
gb|KFG42936.1|  putative adenosylhomocysteinase                         211   3e-60   
gb|EPR62066.1|  putative adenosylhomocysteinase                         211   3e-60   
gb|ESS32583.1|  putative adenosylhomocysteinase                         211   3e-60   
gb|KDO17385.1|  hypothetical protein SPRG_17078                         198   5e-60   
emb|CDY53211.1|  BnaC03g74050D                                          206   2e-59   
ref|WP_036944508.1|  hypothetical protein                               205   6e-59   
gb|ETO08386.1|  hypothetical protein RFI_29000                          199   9e-59   
ref|XP_008611237.1|  adenosylhomocysteinase                             204   9e-59   
ref|XP_002177758.1|  adenosylhomocysteinase                             204   1e-58   
gb|ETO04662.1|  hypothetical protein RFI_32734                          196   2e-58   
ref|XP_009833581.1|  adenosylhomocysteinase 2                           204   2e-58   
gb|ADR18482.1|  adenosylhomocysteinase                                  201   1e-57   
dbj|GAE20305.1|  adenosylhomocysteinase                                 197   1e-57   
dbj|GAE21599.1|  adenosylhomocysteinase                                 197   1e-57   
ref|WP_041723781.1|  adenosylhomocysteinase                             201   1e-57   
gb|ABR16332.1|  unknown                                                 201   2e-57   
ref|XP_005830876.1|  hypothetical protein GUITHDRAFT_110013             201   3e-57   
gb|AHG90399.1|  Adenosylhomocysteinase                                  201   3e-57   
ref|XP_004025117.1|  hypothetical protein IMG5_191490                   199   6e-57   
ref|WP_022926989.1|  S-adenosyl-L-homocysteine hydrolase                199   7e-57   
ref|WP_017355275.1|  S-adenosyl-L-homocysteine hydrolase                199   7e-57   
ref|XP_001023087.1|  adenosylhomocysteinase family protein              199   7e-57   
ref|XP_002290951.1|  hypothetical protein THAPSDRAFT_28496              199   2e-56   
ref|WP_043581849.1|  adenosylhomocysteinase                             198   3e-56   
ref|WP_027325990.1|  adenosylhomocysteinase                             197   7e-56   
gb|AAX40985.1|  S-adenosyl-L-homocysteine hydrolase                     194   7e-56   
gb|EKE10711.1|  hypothetical protein ACD_15C00209G0001                  189   8e-56   
ref|XP_002788757.1|  conserved hypothetical protein                     196   1e-55   
ref|WP_018502367.1|  S-adenosyl-L-homocysteine hydrolase                196   1e-55   
ref|XP_002765933.1|  conserved hypothetical protein                     196   1e-55   
ref|WP_044656141.1|  adenosylhomocysteinase                             192   1e-55   
ref|XP_002781556.1|  adenosylhomocysteinase, putative                   186   1e-55   
emb|CCA20123.1|  unnamed protein product                                196   1e-55   
ref|WP_039007649.1|  S-adenosyl-L-homocysteine hydrolase                196   2e-55   
ref|WP_012157556.1|  S-adenosyl-L-homocysteine hydrolase                196   2e-55   
ref|WP_009947852.1|  S-adenosyl-L-homocysteine hydrolase                196   2e-55   
ref|WP_009576960.1|  Adenosylhomocysteinase                             196   2e-55   
ref|WP_003475714.1|  adenosylhomocysteinase                             196   2e-55   
ref|WP_013219512.1|  S-adenosyl-L-homocysteine hydrolase                194   2e-55   
ref|WP_008375899.1|  adenosylhomocysteinase                             196   3e-55   
ref|WP_026869144.1|  adenosylhomocysteinase                             194   3e-55   
ref|XP_010024044.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    194   3e-55   
ref|WP_027006534.1|  hypothetical protein                               195   5e-55   
ref|WP_026910859.1|  S-adenosyl-L-homocysteine hydrolase                195   5e-55   
ref|WP_027072847.1|  S-adenosyl-L-homocysteine hydrolase                194   5e-55   
ref|WP_019661087.1|  S-adenosyl-L-homocysteine hydrolase                194   6e-55   
ref|WP_033834449.1|  S-adenosyl-L-homocysteine hydrolase                194   6e-55   
ref|XP_010024043.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    193   7e-55   
ref|WP_021645958.1|  adenosylhomocysteinase                             194   8e-55   
ref|WP_003465484.1|  S-adenosyl-L-homocysteine hydrolase                194   8e-55   
ref|WP_027079175.1|  S-adenosyl-L-homocysteine hydrolase                194   9e-55   
ref|WP_008213996.1|  S-adenosyl-L-homocysteine hydrolase                194   1e-54   
ref|WP_005170542.1|  adenosylhomocysteinase                             194   1e-54   
ref|WP_010481888.1|  S-adenosyl-L-homocysteine hydrolase [              194   1e-54   
gb|KIG17698.1|  Adenosylhomocysteinase                                  192   1e-54   
ref|WP_007238886.1|  S-adenosyl-L-homocysteine hydrolase                194   1e-54   
ref|WP_043959717.1|  S-adenosyl-L-homocysteine hydrolase                193   2e-54   
gb|KCW60455.1|  hypothetical protein EUGRSUZ_H03174                     193   2e-54   
ref|WP_005415311.1|  S-adenosyl-L-homocysteine hydrolase                193   2e-54   
ref|WP_009155258.1|  S-adenosyl-L-homocysteine hydrolase                193   2e-54   
ref|WP_038690480.1|  S-adenosyl-L-homocysteine hydrolase                193   2e-54   
ref|WP_010568439.1|  S-adenosyl-L-homocysteine hydrolase                192   2e-54   
ref|WP_027069325.1|  S-adenosyl-L-homocysteine hydrolase                193   2e-54   
ref|WP_032576381.1|  adenosylhomocysteinase                             192   2e-54   
dbj|GAN45334.1|  S-adenosyl-L-homocysteine hydrolase                    193   2e-54   
ref|WP_005781763.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    192   2e-54   
ref|WP_028769932.1|  S-adenosyl-L-homocysteine hydrolase                192   2e-54   
ref|WP_044300351.1|  adenosylhomocysteinase                             192   2e-54   
emb|CBK23294.2|  unnamed protein product                                192   2e-54   
ref|XP_004344078.1|  Sadenosyl-L-homocysteine hydrolase, putative       192   3e-54   
ref|WP_026633760.1|  S-adenosyl-L-homocysteine hydrolase                192   3e-54   
emb|CDA85923.1|  adenosylhomocysteinase                                 191   3e-54   
ref|WP_039856658.1|  S-adenosyl-L-homocysteine hydrolase                193   3e-54   
ref|WP_008770078.1|  S-adenosyl-L-homocysteine hydrolase                192   3e-54   
ref|WP_006538559.1|  S-adenosyl-L-homocysteine hydrolase                192   3e-54   
ref|WP_006895565.1|  adenosylhomocysteinase                             192   4e-54   
ref|WP_010409859.1|  S-adenosyl-L-homocysteine hydrolase                191   4e-54   
ref|WP_025876541.1|  S-adenosyl-L-homocysteine hydrolase                192   4e-54   
emb|CCI50303.1|  unnamed protein product                                192   4e-54   
ref|WP_016551225.1|  adenosylhomocysteinase                             191   4e-54   
emb|CDJ37737.1|  adenosylhomocysteinase, putative                       192   4e-54   
ref|WP_026917209.1|  S-adenosyl-L-homocysteine hydrolase                192   4e-54   
ref|WP_006973217.1|  S-adenosyl-L-homocysteine hydrolase                191   4e-54   
ref|WP_028081726.1|  S-adenosyl-L-homocysteine hydrolase                192   5e-54   
ref|WP_022301900.1|  adenosylhomocysteinase                             191   5e-54   
ref|WP_009679225.1|  S-adenosyl-L-homocysteine hydrolase                192   5e-54   
gb|KFA30189.1|  S-adenosyl-L-homocysteine hydrolase                     189   5e-54   
ref|XP_009033133.1|  hypothetical protein AURANDRAFT_69644              192   6e-54   
ref|WP_030534490.1|  MULTISPECIES: adenosylhomocysteinase               192   6e-54   
ref|WP_033830371.1|  S-adenosyl-L-homocysteine hydrolase                192   6e-54   
ref|WP_008019385.1|  S-adenosyl-L-homocysteine hydrolase, NAD bin...    189   6e-54   
ref|WP_032974920.1|  S-adenosyl-L-homocysteine hydrolase                192   6e-54   
gb|KGK58630.1|  S-adenosyl-L-homocysteine hydrolase                     192   7e-54   
ref|WP_039564728.1|  S-adenosyl-L-homocysteine hydrolase                191   7e-54   
ref|WP_002775930.1|  S-adenosyl-L-homocysteine hydrolase                191   7e-54   
ref|WP_028061676.1|  hypothetical protein                               191   7e-54   
ref|WP_019182466.1|  S-adenosyl-L-homocysteine hydrolase                191   8e-54   
ref|WP_007322036.1|  S-adenosyl-L-homocysteine hydrolase                192   8e-54   
ref|WP_038031735.1|  adenosylhomocysteinase                             190   8e-54   
ref|WP_009741556.1|  S-adenosyl-L-homocysteine hydrolase                191   8e-54   
ref|WP_041448694.1|  adenosylhomocysteinase                             191   9e-54   
ref|WP_007315856.1|  S-adenosyl-L-homocysteine hydrolase                191   9e-54   
ref|WP_019878251.1|  S-adenosyl-L-homocysteine hydrolase                191   9e-54   
ref|WP_007081119.1|  S-adenosyl-L-homocysteine hydrolase                191   9e-54   
gb|ADK98228.1|  S-adenosyl-homocysteine hydrolase                       181   9e-54   
ref|WP_027493191.1|  S-adenosyl-L-homocysteine hydrolase                191   9e-54   
gb|ACF28652.1|  adenosylhomocysteinase                                  187   9e-54   
ref|WP_018636612.1|  S-adenosyl-L-homocysteine hydrolase                191   1e-53   
ref|WP_007661865.1|  S-adenosyl-L-homocysteine hydrolase                191   1e-53   
gb|ADK98229.1|  S-adenosyl-homocysteine hydrolase                       181   1e-53   
gb|ABS24379.1|  adenosylhomocysteinase                                  191   1e-53   
ref|WP_018180991.1|  S-adenosyl-L-homocysteine hydrolase                191   1e-53   
ref|WP_012917260.1|  S-adenosyl-L-homocysteine hydrolase                191   1e-53   
gb|ADK98240.1|  S-adenosyl-homocysteine hydrolase                       181   1e-53   
ref|WP_012501941.1|  S-adenosyl-L-homocysteine hydrolase                191   1e-53   
emb|CDJ69092.1|  adenosylhomocysteinase, putative                       191   1e-53   
dbj|GAB40911.1|  adenosylhomocysteinase                                 192   1e-53   
ref|WP_019466297.1|  S-adenosyl-L-homocysteine hydrolase                191   1e-53   
ref|WP_016268876.1|  adenosylhomocysteinase                             191   1e-53   
ref|WP_014036003.1|  S-adenosyl-L-homocysteine hydrolase                191   1e-53   
ref|WP_008765354.1|  S-adenosyl-L-homocysteine hydrolase                191   1e-53   
ref|WP_014645960.1|  S-adenosyl-L-homocysteine hydrolase                191   1e-53   
ref|WP_004154241.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    191   2e-53   
ref|WP_010535621.1|  S-adenosyl-L-homocysteine hydrolase                191   2e-53   
ref|WP_018046312.1|  S-adenosyl-L-homocysteine hydrolase                189   2e-53   
ref|WP_031421135.1|  S-adenosyl-L-homocysteine hydrolase                191   2e-53   
ref|WP_014089407.1|  S-adenosyl-L-homocysteine hydrolase                191   2e-53   
ref|WP_019338084.1|  S-adenosyl-L-homocysteine hydrolase                191   2e-53   
ref|WP_038614995.1|  S-adenosyl-L-homocysteine hydrolase                191   2e-53   
ref|WP_043397992.1|  S-adenosyl-L-homocysteine hydrolase                191   2e-53   
ref|WP_011346442.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    191   2e-53   
ref|WP_005910841.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    191   2e-53   
ref|WP_019737854.1|  S-adenosyl-L-homocysteine hydrolase                188   2e-53   
ref|WP_012936074.1|  S-adenosyl-L-homocysteine hydrolase                191   2e-53   
emb|CAJ65404.1|  Adenosylhomocysteinase (S-adenosyl-L-homocystein...    190   2e-53   
ref|WP_032850487.1|  adenosylhomocysteinase                             190   2e-53   
ref|WP_020651088.1|  S-adenosyl-L-homocysteine hydrolase                190   2e-53   
ref|WP_015679205.1|  adenosylhomocysteinase                             189   2e-53   
ref|WP_024957291.1|  S-adenosyl-L-homocysteine hydrolase                190   2e-53   
ref|WP_005942517.1|  adenosylhomocysteinase                             191   2e-53   
ref|WP_041939978.1|  S-adenosyl-L-homocysteine hydrolase                190   2e-53   
ref|WP_036194122.1|  S-adenosyl-L-homocysteine hydrolase                190   2e-53   
ref|WP_004302401.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    190   2e-53   
gb|EFI04196.1|  adenosylhomocysteinase                                  190   2e-53   
ref|WP_009132416.1|  adenosylhomocysteinase                             190   2e-53   
ref|WP_030509358.1|  S-adenosyl-L-homocysteine hydrolase                190   3e-53   
ref|WP_006370365.1|  S-adenosyl-L-homocysteine hydrolase                190   3e-53   
ref|WP_011438808.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    190   3e-53   
ref|WP_004296427.1|  S-adenosyl-L-homocysteine hydrolase                190   3e-53   
ref|WP_023840013.1|  MULTISPECIES: adenosylhomocysteinase               190   3e-53   
ref|WP_009000954.1|  S-adenosyl-L-homocysteine hydrolase                190   3e-53   
ref|WP_029219085.1|  S-adenosyl-L-homocysteine hydrolase                190   3e-53   
ref|WP_032839083.1|  adenosylhomocysteinase                             189   3e-53   
ref|WP_022275430.1|  adenosylhomocysteinase                             189   3e-53   
ref|WP_009514080.1|  S-adenosyl-L-homocysteine hydrolase                190   3e-53   
ref|WP_005991516.1|  S-adenosyl-L-homocysteine hydrolase                190   3e-53   
ref|WP_010572375.1|  S-adenosyl-L-homocysteine hydrolase                189   4e-53   
ref|WP_017912973.1|  S-adenosyl-L-homocysteine hydrolase                190   4e-53   
gb|EEX47469.1|  adenosylhomocysteinase                                  189   4e-53   
ref|WP_027490068.1|  S-adenosyl-L-homocysteine hydrolase                189   4e-53   
ref|WP_022391602.1|  adenosylhomocysteinase                             189   4e-53   
ref|WP_007509390.1|  S-adenosyl-L-homocysteine hydrolase                189   4e-53   
ref|WP_019815305.1|  S-adenosyl-L-homocysteine hydrolase                189   4e-53   
ref|WP_027484548.1|  S-adenosyl-L-homocysteine hydrolase                189   4e-53   
ref|WP_015448722.1|  S-adenosyl-L-homocysteine hydrolase                189   4e-53   
ref|WP_022478377.1|  adenosylhomocysteinase                             189   4e-53   
ref|WP_024987950.1|  adenosylhomocysteinase                             189   4e-53   
ref|WP_039404132.1|  S-adenosyl-L-homocysteine hydrolase                189   5e-53   
ref|WP_002149261.1|  S-adenosyl-L-homocysteine hydrolase, NAD bin...    181   5e-53   
ref|WP_002558259.1|  adenosylhomocysteinase                             189   5e-53   
ref|WP_039440812.1|  S-adenosyl-L-homocysteine hydrolase                189   5e-53   
ref|WP_029207109.1|  hypothetical protein                               181   5e-53   
ref|WP_026367128.1|  adenosylhomocysteinase                             189   6e-53   
ref|WP_022209421.1|  adenosylhomocysteinase                             189   6e-53   
ref|WP_044263997.1|  adenosylhomocysteinase                             189   6e-53   
ref|WP_020109343.1|  S-adenosyl-L-homocysteine hydrolase                189   6e-53   
ref|WP_007219288.1|  S-adenosyl-L-homocysteine hydrolase                189   6e-53   
ref|WP_007487570.1|  S-adenosyl-L-homocysteine hydrolase                189   6e-53   
ref|WP_004317528.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    189   6e-53   
ref|WP_010367570.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    189   6e-53   
gb|ADK98242.1|  S-adenosyl-homocysteine hydrolase                       179   6e-53   
ref|WP_008023149.1|  S-adenosyl-L-homocysteine hydrolase                189   6e-53   
ref|WP_015104941.1|  Adenosylhomocysteinase                             189   6e-53   
ref|WP_044606136.1|  hypothetical protein                               188   6e-53   
ref|WP_005928473.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    189   6e-53   
gb|EEZ06043.1|  adenosylhomocysteinase                                  189   6e-53   
ref|WP_007028966.1|  S-adenosyl-L-homocysteine hydrolase                189   7e-53   
ref|WP_025831901.1|  adenosylhomocysteinase                             189   7e-53   



>ref|XP_009415939.1| PREDICTED: adenosylhomocysteinase [Musa acuminata subsp. malaccensis]
Length=485

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 148/157 (94%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPETKTGII
Sbjct  329  DIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETKTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKTTGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLTP QA YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTPSQADYISVPIEGPYKPAHYRY  485



>gb|KDP39327.1| hypothetical protein JCGZ_01084 [Jatropha curcas]
Length=485

 Score =   281 bits (719),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 146/157 (93%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPETKTGII
Sbjct  329  DIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETKTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW+EK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWREKATGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+ +QA YIS+PVEGPYKPPHYRY
Sbjct  449  ALHLGKLGARLTKLSKDQADYISVPVEGPYKPPHYRY  485



>ref|XP_008794647.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   281 bits (718),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 146/157 (93%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLTP QA YIS+P EGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLTPSQAEYISVPTEGPYKPPHYRY  485



>gb|AFV46215.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=302

 Score =   275 bits (702),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETK+GII
Sbjct  146  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETYPGVKRITIKPQTDRWVFPETKSGII  205

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDEKVA
Sbjct  206  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERTSGKYEKKVYVLPKHLDEKVA  265

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT +Q+ YISIPVEGPYKPPHYRY
Sbjct  266  ALHLGKLGAKLTKLTKDQSDYISIPVEGPYKPPHYRY  302



>emb|CDP11183.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/157 (94%), Positives = 154/157 (98%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMVSHMKKMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETK+GII
Sbjct  329  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ +QA YIS+PVEGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPVEGPYKPPHYRY  485



>ref|XP_010268032.1| PREDICTED: adenosylhomocysteinase-like [Nelumbo nucifera]
Length=485

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/157 (93%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T  GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTNRGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGTGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLTPEQAAYIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTPEQAAYISVPVEGPYKPAHYRY  485



>gb|KJB72025.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=265

 Score =   272 bits (695),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET TGII
Sbjct  109  DIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGII  168

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  169  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  228

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  229  ALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  265



>ref|XP_010247578.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LA+GRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLADGRLMNLGCATGHPSFVMSCSFTNQVIAQIELWKEKGTGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLTPEQAAYIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTPEQAAYISVPVEGPYKPAHYRY  485



>ref|XP_009413566.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/157 (93%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMVEHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERETGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLTP QA YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTPSQAEYISVPIEGPYKPAHYRY  485



>ref|XP_010551666.1| PREDICTED: adenosylhomocysteinase 1-like [Tarenaya hassleriana]
Length=485

 Score =   278 bits (711),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+TKTGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTKTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGTGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ +QA YIS+P+EGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLSTDQADYISVPIEGPYKPPHYRY  485



>gb|KHG10896.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   278 bits (711),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 147/157 (94%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETKTGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT +QA YIS+PVEGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLTKDQADYISVPVEGPYKPPHYRY  485



>ref|XP_002278000.1| PREDICTED: adenosylhomocysteinase-like [Vitis vinifera]
Length=485

 Score =   278 bits (710),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 147/157 (94%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HMK+MKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET +GII
Sbjct  329  DIIMVHHMKQMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+PEQAAYIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSPEQAAYISVPVEGPYKPTHYRY  485



>gb|KJB72026.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=345

 Score =   273 bits (698),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET TGII
Sbjct  189  DIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGII  248

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  249  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  308

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  309  ALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  345



>ref|XP_004953493.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   278 bits (710),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPETKTGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETKTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+  QA YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLSKSQADYISVPIEGPYKPAHYRY  485



>dbj|BAH57232.1| AT4G13940 [Arabidopsis thaliana]
Length=291

 Score =   271 bits (693),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETK GII
Sbjct  135  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKAGII  194

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  195  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVA  254

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
             LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  255  LLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  291



>gb|KJB19538.1| hypothetical protein B456_003G108500 [Gossypium raimondii]
Length=485

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMVSHMK+MKNNAIVCNIGHFDNEIDM GLETYPG+KRITIKPQTDR++FPET  GII
Sbjct  329  DIIMVSHMKQMKNNAIVCNIGHFDNEIDMLGLETYPGIKRITIKPQTDRWIFPETNRGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERGSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGAKLTKLTP+QAAYIS+PVEGPYKPPHYRY
Sbjct  449  SLHLGKLGAKLTKLTPDQAAYISVPVEGPYKPPHYRY  485



>gb|EMT11613.1| Adenosylhomocysteinase [Aegilops tauschii]
Length=292

 Score =   271 bits (692),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRITIKPQTDR+VFPET TGII
Sbjct  136  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRITIKPQTDRWVFPETNTGII  195

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  196  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  255

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKLT  Q+ YISIPVEGPYKP  YRY
Sbjct  256  ALHLGKLGARLTKLTKAQSEYISIPVEGPYKPAAYRY  292



>ref|XP_010908558.1| PREDICTED: adenosylhomocysteinase [Elaeis guineensis]
Length=485

 Score =   277 bits (708),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV+HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVNHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERASGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLTP QA YIS+P+EGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLTPAQAEYISVPIEGPYKPPHYRY  485



>ref|XP_011102056.1| PREDICTED: adenosylhomocysteinase [Sesamum indicum]
Length=485

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERATGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT EQA YIS+PVEGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLTKEQADYISVPVEGPYKPPHYRY  485



>ref|XP_003601687.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89238.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AES71938.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMVS MKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPETK+GII
Sbjct  329  DIIMVSDMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELWKEK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQIELWKEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLG+LGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGQLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_010527457.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+TKTGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTKTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+ +Q+ YIS+P+EGPYKPPHYRY
Sbjct  449  ALHLGKLGARLTKLSKDQSDYISVPIEGPYKPPHYRY  485



>ref|XP_009403608.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HMKKMKNNAIVCNIGHFDNEIDM GLETYPG+KRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMVDHMKKMKNNAIVCNIGHFDNEIDMQGLETYPGIKRITIKPQTDRWVFPETSTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERKTGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLTP QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTPSQAEYISVPVEGPYKPVHYRY  485



>gb|KJB37873.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=485

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 146/157 (93%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPETKTGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETKTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT +QA YIS+PVEGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLTKDQADYISVPVEGPYKPPHYRY  485



>ref|XP_011083449.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAI+CNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFP+TKTGII
Sbjct  329  DIIMVGHMRKMKNNAIICNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPDTKTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+ +QA YIS+P+EGPYKPPHYRY
Sbjct  449  ALHLGKLGARLTKLSKDQADYISVPIEGPYKPPHYRY  485



>emb|CAH69227.1| putative adenosylhomocysteinase [Nicotiana glauca]
Length=264

 Score =   268 bits (686),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T +GII
Sbjct  108  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTNSGII  167

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  168  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  227

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  228  ALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  264



>sp|P50246.1|SAHH_MEDSA RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Medicago sativa]
 gb|AAB41814.1| adenosylhomocysteinase [Medicago sativa]
Length=485

 Score =   276 bits (705),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMVS MKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPETK+GII
Sbjct  329  DIIMVSDMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELWKEK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQIELWKEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLG+LGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGQLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AFK46472.1| unknown [Lotus japonicus]
Length=290

 Score =   269 bits (688),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAI+ NIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFP+T +GII
Sbjct  134  DIIMVDHMRKMKNNAIISNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPDTNSGII  193

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK +GKYEKKVYVLPKHLDEKVA
Sbjct  194  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGSGKYEKKVYVLPKHLDEKVA  253

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL  +Q+ YISIP+EGPYKP HYRY
Sbjct  254  ALHLGKLGARLTKLRKDQSDYISIPIEGPYKPAHYRY  290



>gb|KJB72027.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=423

 Score =   273 bits (699),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET TGII
Sbjct  267  DIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGII  326

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  327  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  386

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  387  ALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  423



>ref|XP_008222807.1| PREDICTED: adenosylhomocysteinase isoform X1 [Prunus mume]
Length=485

 Score =   275 bits (704),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ EQA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKEQADYISVPVEGPYKPAHYRY  485



>ref|XP_007037836.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY22337.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=485

 Score =   275 bits (704),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HMK+MKNNAIVCNIGHFDNEIDM GLETYPG+KRITIKPQTDR+VFPET  GII
Sbjct  329  DIIMVCHMKQMKNNAIVCNIGHFDNEIDMLGLETYPGIKRITIKPQTDRWVFPETNRGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERGTGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLTPEQAAYIS+PVEGPYKPP YRY
Sbjct  449  ALHLGKLGAKLTKLTPEQAAYISVPVEGPYKPPRYRY  485



>gb|KJB28098.1| hypothetical protein B456_005G027700 [Gossypium raimondii]
Length=485

 Score =   275 bits (704),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HMKKMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFP+TKTGII
Sbjct  329  DIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPDTKTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK+TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWTEKSTGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHL KLGAKLTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  449  ALHLVKLGAKLTKLTKDQADYISVPIEGPYKPPHYRY  485



>ref|XP_007222610.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
 gb|EMJ23809.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
Length=485

 Score =   275 bits (703),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMVEHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT EQA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAHYRY  485



>ref|XP_010673385.1| PREDICTED: adenosylhomocysteinase [Beta vulgaris subsp. vulgaris]
 dbj|BAE07182.1| S-adenosyl-L-homocysteine hydrolase [Beta vulgaris]
Length=487

 Score =   275 bits (703),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYPG+KRITIKPQTDRFVFPETK+G+I
Sbjct  331  DIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGIKRITIKPQTDRFVFPETKSGVI  390

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  391  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVA  450

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHL KLGAKLTKLT +Q+ Y+SIPVEGPYKP HYRY
Sbjct  451  ALHLNKLGAKLTKLTKDQSDYLSIPVEGPYKPAHYRY  487



>ref|XP_008361486.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   275 bits (703),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ EQA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKEQADYISVPVEGPYKPAHYRY  485



>gb|KHN12344.1| Adenosylhomocysteinase [Glycine soja]
Length=408

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET TGII
Sbjct  252  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGII  311

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  312  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  371

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLT+L+  QA YIS+PVEGPYKP HYRY
Sbjct  372  ALHLGKLGAKLTQLSKSQADYISVPVEGPYKPAHYRY  408



>dbj|BAA03710.1| cytokinin binding protein CBP57 [Nicotiana sylvestris]
Length=450

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  294  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTNSGII  353

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  354  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  413

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+ +QA YIS+PVEGPYKPPHYRY
Sbjct  414  ALHLGKLGARLTKLSKDQADYISVPVEGPYKPPHYRY  450



>ref|XP_004973012.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+  Q+ YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKSQSDYISVPIEGPYKPAHYRY  485



>gb|KHG19993.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMVSHMK+MKNNA+VCNIGHFDNEIDM GLETYPG+KRITIKPQTDR++FPET  GII
Sbjct  329  DIIMVSHMKQMKNNAVVCNIGHFDNEIDMLGLETYPGIKRITIKPQTDRWIFPETNRGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDE V 
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERGSGKYEKKVYVLPKHLDEMVG  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGAKLTKLTP+QAAYIS+PVEGPYKPPHYRY
Sbjct  449  SLHLGKLGAKLTKLTPDQAAYISVPVEGPYKPPHYRY  485



>gb|EYU31514.1| hypothetical protein MIMGU_mgv1a005403mg [Erythranthe guttata]
Length=485

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPETKTGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETKTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKY K+VYVLPKHLDEKVA
Sbjct  389  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYGKEVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT EQ+ YISIPVEGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLTKEQSDYISIPVEGPYKPPHYRY  485



>ref|XP_009373550.1| PREDICTED: adenosylhomocysteinase [Pyrus x bretschneideri]
Length=485

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPET +GII
Sbjct  329  DIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT EQA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAHYRY  485



>gb|ABA93500.1| Adenosylhomocysteinase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA93501.1| Adenosylhomocysteinase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG93815.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99677.1| unnamed protein product [Oryza sativa Japonica Group]
Length=450

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET TGII
Sbjct  294  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNTGII  353

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  354  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  413

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  414  ALHLGKLGARLTKLSKSQADYISVPVEGPYKPAHYRY  450



>gb|ACJ11250.1| S-adenosyl-L-homocystein hydrolase [Gossypium hirsutum]
Length=485

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  449  ALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  485



>gb|AAO72664.1| wheat adenosylhomocysteinase-like protein [Oryza sativa Japonica 
Group]
 gb|EAY80818.1| hypothetical protein OsI_35998 [Oryza sativa Indica Group]
 gb|EEE52055.1| hypothetical protein OsJ_33804 [Oryza sativa Japonica Group]
 gb|AIR95993.1| adenosylhomocysteinase [Oryza sativa Japonica Group]
Length=485

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLSKSQADYISVPVEGPYKPAHYRY  485



>gb|KJB72029.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=456

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET TGII
Sbjct  300  DIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGII  359

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  360  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  419

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  420  ALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  456



>ref|XP_002870350.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46609.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETKTGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+ +Q+ YISIP+EGPYKPPHYRY
Sbjct  449  ALHLGKLGARLTKLSKDQSDYISIPIEGPYKPPHYRY  485



>ref|XP_010052042.1| PREDICTED: adenosylhomocysteinase 1 [Eucalyptus grandis]
 gb|KCW75898.1| hypothetical protein EUGRSUZ_D00281 [Eucalyptus grandis]
Length=485

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HMKKMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVHHMKKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ +QA YIS+PVEGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPVEGPYKPPHYRY  485



>gb|EMS57067.1| Adenosylhomocysteinase [Triticum urartu]
Length=416

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRITIKPQTDR+VFPETKTGII
Sbjct  260  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRITIKPQTDRWVFPETKTGII  319

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK TGKYEKKVYVLPKHLDEKVA
Sbjct  320  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKATGKYEKKVYVLPKHLDEKVA  379

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKLT  Q+ YISIPVEGPYKP  YRY
Sbjct  380  ALHLGKLGARLTKLTKSQSDYISIPVEGPYKPAAYRY  416



>gb|KJB72024.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=485

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  449  ALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  485



>ref|XP_009787091.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana sylvestris]
Length=485

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+ +QA YIS+PVEGPYKPPHYRY
Sbjct  449  ALHLGKLGARLTKLSKDQADYISVPVEGPYKPPHYRY  485



>ref|XP_010253338.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLE  PGVKRITIKPQTDR+VFP+T +G+I
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLEILPGVKRITIKPQTDRWVFPDTNSGVI  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGTGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT EQAAYIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTSEQAAYISVPVEGPYKPAHYRY  485



>ref|XP_007163813.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
 gb|ESW35807.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
Length=485

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMVSHMKKMKNNAIVCNIGHFDNEIDM GLETYPGVKR  IKPQTDR+VFPET TGII
Sbjct  329  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRTNIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGTGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLG+LGAKLTKLT EQA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGQLGAKLTKLTKEQADYISVPVEGPYKPVHYRY  485



>ref|NP_001031627.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83346.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=364

 Score =   270 bits (690),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETK GII
Sbjct  208  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKAGII  267

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  268  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVA  327

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
             LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  328  LLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  364



>ref|XP_004502244.1| PREDICTED: adenosylhomocysteinase-like [Cicer arietinum]
Length=485

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMVS MKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPET +GII
Sbjct  329  DIIMVSDMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELWKEK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQIELWKEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLG+LGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGQLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_011102207.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   273 bits (699),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAI+CNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+TKTGII
Sbjct  329  DIIMVGHMRKMKNNAIICNIGHFDNEIDMQGLETYPGVKRITIKPQTDRWVFPDTKTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+ +QA YIS+P+EGPYKPPHYRY
Sbjct  449  ALHLGKLGARLTKLSKDQADYISVPIEGPYKPPHYRY  485



>ref|XP_010466741.1| PREDICTED: adenosylhomocysteinase 2-like isoform X2 [Camelina 
sativa]
Length=291

 Score =   267 bits (682),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+TK+GII
Sbjct  135  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTKSGII  194

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  195  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  254

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP +YRY
Sbjct  255  ALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPANYRY  291



>ref|XP_010913095.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   273 bits (699),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLE YPGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLENYPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERASGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLTP QA YISIP+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTPSQAEYISIPIEGPYKPAHYRY  485



>ref|XP_003524926.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   273 bits (699),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HMKKMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET  GII
Sbjct  329  DIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNVGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+P QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSPAQADYISVPVEGPYKPAHYRY  485



>gb|KHG17040.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=485

 Score =   273 bits (699),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET TGI+
Sbjct  329  DIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGIV  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  449  ALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  485



>ref|XP_010097949.1| hypothetical protein L484_026840 [Morus notabilis]
 gb|EXB73679.1| hypothetical protein L484_026840 [Morus notabilis]
Length=485

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYEKKVYVLPKHLDEKVA
Sbjct  389  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERTTGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHL KLGAKLTKLT EQA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLSKLGAKLTKLTKEQADYISVPVEGPYKPAHYRY  485



>gb|KFK28004.1| hypothetical protein AALP_AA8G459100 [Arabis alpina]
Length=485

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETKTGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKLT +Q+ YISIP++GPYKPPHYRY
Sbjct  449  ALHLGKLGARLTKLTKDQSDYISIPIQGPYKPPHYRY  485



>ref|XP_003577583.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Brachypodium 
distachyon]
Length=485

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRITIKPQTDR+VFPET +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRITIKPQTDRWVFPETNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE++TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERSTGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT  QA YISIP+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKSQADYISIPIEGPYKPAHYRY  485



>ref|NP_001031628.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83347.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=440

 Score =   271 bits (694),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETK GII
Sbjct  284  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKAGII  343

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  344  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVA  403

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
             LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  404  LLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  440



>ref|XP_008380474.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPETK+GII
Sbjct  329  DIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT EQA YIS+PVEGPYKP  YRY
Sbjct  449  ALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAAYRY  485



>ref|XP_010905139.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   273 bits (697),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLE YPGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLENYPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERASGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLTP QA YISIP+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTPSQAEYISIPIEGPYKPAHYRY  485



>tpg|DAA38860.1| TPA: hypothetical protein ZEAMMB73_022938 [Zea mays]
Length=270

 Score =   265 bits (678),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQ DR+VFPET TGII
Sbjct  114  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQIDRWVFPETNTGII  173

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            ILAEGRLMNLGCATGHPSFVMSCSFTNQV+AQLELWKEKN+GKYEKKVYVLPKHLDEKV 
Sbjct  174  ILAEGRLMNLGCATGHPSFVMSCSFTNQVLAQLELWKEKNSGKYEKKVYVLPKHLDEKVN  233

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGK GAKLTKLT  QA YI +P+EGPYK  HYRY
Sbjct  234  ALHLGKHGAKLTKLTKSQADYIRVPIEGPYKLAHYRY  270



>gb|EPS72602.1| adenosylhomocysteinase, partial [Genlisea aurea]
Length=567

 Score =   275 bits (702),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGV+RITIKPQTDR+VFP+TKTGII
Sbjct  411  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVERITIKPQTDRYVFPDTKTGII  470

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+++GKYEKKVYVLPKHLDEKVA
Sbjct  471  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERSSGKYEKKVYVLPKHLDEKVA  530

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ EQA YIS+ VEGPYKP HYRY
Sbjct  531  ALHLGKLGAKLTKLSKEQADYISVAVEGPYKPAHYRY  567



>ref|XP_006283635.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
 ref|XP_010435212.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450125.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450146.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 gb|EOA16533.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
Length=485

 Score =   272 bits (696),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETKTGII
Sbjct  329  DIIMVDHMTKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  449  ALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>gb|AAV31755.1| S-adenosyl-L-homocysteine hydrolase, partial [Nicotiana tabacum]
Length=479

 Score =   272 bits (696),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  323  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTNSGII  382

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  383  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  442

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+ +QA YIS+PV+GPYKPPHYRY
Sbjct  443  ALHLGKLGARLTKLSKDQADYISVPVDGPYKPPHYRY  479



>ref|XP_009606591.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana tomentosiformis]
Length=485

 Score =   272 bits (696),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+ +QA YIS+PV+GPYKPPHYRY
Sbjct  449  ALHLGKLGARLTKLSKDQADYISVPVDGPYKPPHYRY  485



>ref|XP_009349913.1| PREDICTED: adenosylhomocysteinase-like [Pyrus x bretschneideri]
Length=485

 Score =   272 bits (696),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETY GVKRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYAGVKRITIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ EQA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKEQADYISVPVEGPYKPAHYRY  485



>ref|XP_006662925.1| PREDICTED: adenosylhomocysteinase-like [Oryza brachyantha]
Length=485

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK+TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSTGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKLT  QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLTKSQADYISVPVEGPYKPAHYRY  485



>ref|NP_001148534.1| adenosylhomocysteinase [Zea mays]
 gb|ACG31873.1| adenosylhomocysteinase [Zea mays]
Length=485

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT  QA YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKSQADYISVPIEGPYKPAHYRY  485



>gb|AGT16642.1| Adenosylhomocysteinase [Saccharum hybrid cultivar R570]
Length=485

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT  QA YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKSQADYISVPIEGPYKPAHYRY  485



>gb|KHN44476.1| Adenosylhomocysteinase [Glycine soja]
Length=291

 Score =   266 bits (679),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIM+ HMKKMKNNAIVCNIGHFDNEIDM GLET PGVKRI IKPQTDR+VFP+TK GII
Sbjct  135  DIIMLDHMKKMKNNAIVCNIGHFDNEIDMLGLETCPGVKRINIKPQTDRWVFPDTKRGII  194

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK +GKYEKKVYVLPKHLDEKVA
Sbjct  195  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGSGKYEKKVYVLPKHLDEKVA  254

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLG+LGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  255  SLHLGQLGARLTKLSKDQADYISVPVEGPYKPAHYRY  291



>gb|ACN34730.1| unknown [Zea mays]
 gb|AFW60832.1| adenosyl homocysteine hydrolase1 isoform 1 [Zea mays]
 gb|AFW60833.1| adenosyl homocysteine hydrolase1 isoform 2 [Zea mays]
Length=485

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT  QA YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKSQADYISVPIEGPYKPAHYRY  485



>ref|XP_003531217.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLT+L+  QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTQLSKSQADYISVPVEGPYKPAHYRY  485



>dbj|BAP47516.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVK+ITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKKITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPVEGPYKPLHYRY  485



>ref|NP_001067845.2| Os11g0455500 [Oryza sativa Japonica Group]
 dbj|BAF28208.2| Os11g0455500, partial [Oryza sativa Japonica Group]
Length=515

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET TGII
Sbjct  359  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNTGII  418

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  419  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  478

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  479  ALHLGKLGARLTKLSKSQADYISVPVEGPYKPAHYRY  515



>ref|XP_002522805.1| adenosylhomocysteinase, putative [Ricinus communis]
 gb|EEF39656.1| adenosylhomocysteinase, putative [Ricinus communis]
Length=485

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DI+MV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIVMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW+EK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWREKATGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_004247887.1| PREDICTED: adenosylhomocysteinase [Solanum lycopersicum]
Length=485

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26650.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_002987608.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
 ref|XP_002987645.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11220.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11444.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
Length=485

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HMKKMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETGTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHL KLGAKLTKL+ +QAAYI++PVEGPYKP HYRY
Sbjct  449  ALHLPKLGAKLTKLSADQAAYINVPVEGPYKPAHYRY  485



>ref|XP_002266154.1| PREDICTED: adenosylhomocysteinase [Vitis vinifera]
 emb|CAN64242.1| hypothetical protein VITISV_022595 [Vitis vinifera]
Length=485

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKASGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ +QA YIS+P+EGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPIEGPYKPPHYRY  485



>gb|KFK36278.1| hypothetical protein AALP_AA4G101800 [Arabis alpina]
Length=485

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETKTGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+ +Q+ YISIP+EGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY  485



>gb|KJB72028.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=487

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYR  268
            ALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYR
Sbjct  449  ALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYR  484



>gb|AGX26665.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_006360925.1| PREDICTED: adenosylhomocysteinase-like isoform X1 [Solanum tuberosum]
Length=485

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFPET +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPETNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26683.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGW81844.1| S-(5'-adenosyl)-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26660.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26687.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_008776857.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV  M+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDDMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERASGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLTP QA YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTPSQADYISVPIEGPYKPAHYRY  485



>gb|AGX26663.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+L KL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLAKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26652.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26646.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26648.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26658.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26659.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26668.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26670.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26675.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26680.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26688.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26677.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26671.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26647.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_006349914.1| PREDICTED: adenosylhomocysteinase-like [Solanum tuberosum]
Length=485

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKASGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLG+LG KLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGQLGVKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26654.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26674.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26679.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26676.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_008222808.1| PREDICTED: adenosylhomocysteinase isoform X2 [Prunus mume]
Length=547

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYR  268
            ALHLGKLGAKLTKL+ EQA YIS+PVEGPYKP HYR
Sbjct  449  ALHLGKLGAKLTKLSKEQADYISVPVEGPYKPAHYR  484



>gb|AGX26662.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_011012490.1| PREDICTED: adenosylhomocysteinase-like [Populus euphratica]
Length=485

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_004296983.1| PREDICTED: adenosylhomocysteinase [Fragaria vesca subsp. vesca]
Length=485

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIM+ HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGV+RITIKPQTDR+VFP+TKTGII
Sbjct  329  DIIMLEHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVQRITIKPQTDRWVFPDTKTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ EQA YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKEQADYISVPIEGPYKPAHYRY  485



>ref|XP_010532739.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKY+K+VYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGTGKYKKEVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ +QA YIS+P++GPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPIDGPYKPPHYRY  485



>gb|AAP92453.1| S-adenosyl-L-homocystein hydrolase [Arabidopsis thaliana]
Length=485

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPPHYRY  485



>gb|KCW59952.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=467

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV  MKKMKNNAIVCNIGHFDNEIDMHGLE +PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  311  DIIMVHDMKKMKNNAIVCNIGHFDNEIDMHGLENFPGVKRITIKPQTDRWVFPDTKSGII  370

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKY+K+VYVLPKHLDEKVA
Sbjct  371  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYKKEVYVLPKHLDEKVA  430

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ EQA YIS+PVEGPYKPPHYRY
Sbjct  431  ALHLGKLGAKLTKLSKEQADYISVPVEGPYKPPHYRY  467



>gb|AGX26673.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26689.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|NP_193130.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 sp|O23255.1|SAHH1_ARATH RecName: Full=Adenosylhomocysteinase 1; Short=AdoHcyase 1; AltName: 
Full=Protein EMBRYO DEFECTIVE 1395; AltName: Full=Protein 
HOMOLOGY-DEPENDENT GENE SILENCING 1; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase 1; Short=SAH hydrolase 1 [Arabidopsis 
thaliana]
 gb|AAG40389.1|AF325037_1 AT4g13940 [Arabidopsis thaliana]
 emb|CAB10173.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAC14714.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
 emb|CAB78436.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK68806.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK83621.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAL90945.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAM10030.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAO00764.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AEE83345.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETK GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKAGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
             LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  449  LLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>ref|XP_004252985.1| PREDICTED: adenosylhomocysteinase-like [Solanum lycopersicum]
Length=485

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+TK+GI+
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTKSGIL  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKASGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLG+LG KLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGQLGVKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>emb|CCC55421.1| S-adenosyl-L-homocysteine hydrolase [Pinus pinaster]
Length=485

 Score =   270 bits (691),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVK+ITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKKITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKKSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHL KLGA LTKL+PEQAAYI++PVEGPYKP HYRY
Sbjct  449  ALHLPKLGAHLTKLSPEQAAYINVPVEGPYKPAHYRY  485



>gb|AGX26649.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM++MKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRRMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|KDO43195.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=445

 Score =   269 bits (688),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HMKKMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET +GII
Sbjct  289  DIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNSGII  348

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  349  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  408

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLT+LT EQA YIS+  +GPYKP HYRY
Sbjct  409  ALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHYRY  445



>gb|AGX26669.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM++MKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRRMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>emb|CAJ01707.1| putative S-adenosylhomocystein hydrolase 2 [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ88218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   270 bits (691),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRITIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKLT  Q+ YISIPVEGPYKP  YRY
Sbjct  449  ALHLGKLGARLTKLTKAQSEYISIPVEGPYKPSAYRY  485



>ref|XP_010023650.1| PREDICTED: adenosylhomocysteinase [Eucalyptus grandis]
 gb|KCW59953.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=485

 Score =   270 bits (690),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV  MKKMKNNAIVCNIGHFDNEIDMHGLE +PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVHDMKKMKNNAIVCNIGHFDNEIDMHGLENFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKY+K+VYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYKKEVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ EQA YIS+PVEGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLSKEQADYISVPVEGPYKPPHYRY  485



>emb|CAB09795.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
Length=467

 Score =   270 bits (689),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETK GII
Sbjct  311  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKAGII  370

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LA+GRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  371  VLAQGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVA  430

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
             LHLGKLGA+L KL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  431  LLHLGKLGARLRKLSKDQSDYVSIPIEGPYKPPHYRY  467



>gb|AFU51537.1| S-adenosyl-homocysteine hydrolase protein [Capsicum annuum]
Length=485

 Score =   270 bits (690),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +G+I
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTNSGVI  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCA GHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCAAGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT EQA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAHYRY  485



>gb|EMT01272.1| Adenosylhomocysteinase [Aegilops tauschii]
Length=485

 Score =   270 bits (690),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRITIKPQTDR+VFPETKTGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRITIKPQTDRWVFPETKTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKATGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKLT  Q+ YISIPVEGPYKP  YRY
Sbjct  449  ALHLGKLGARLTKLTKSQSDYISIPVEGPYKPAAYRY  485



>gb|AAM62888.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   270 bits (690),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETK GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKAGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
             LHLGKLGA+LTKL+ +Q  Y+SIP+EGPYKPPHYRY
Sbjct  449  LLHLGKLGARLTKLSKDQXDYVSIPIEGPYKPPHYRY  485



>gb|AGX26685.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   270 bits (690),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
             LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  PLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26664.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   270 bits (689),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKH DEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHFDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26655.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   270 bits (689),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITI+PQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIEPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26681.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PG KRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGAKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|KDO43194.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=485

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HMKKMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET +GII
Sbjct  329  DIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLT+LT EQA YIS+  +GPYKP HYRY
Sbjct  449  ALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHYRY  485



>gb|AFZ78657.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AGX26645.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMK+NAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKSNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_006492541.1| PREDICTED: adenosylhomocysteinase-like [Citrus sinensis]
Length=485

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HMKKMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET +GII
Sbjct  329  DIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLT+LT EQA YIS+  +GPYKP HYRY
Sbjct  449  ALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHYRY  485



>gb|ABI95857.1| S-adenosyl-homocysteine hydrolase [Nicotiana suaveolens]
Length=485

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26667.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKV+VLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVHVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>dbj|BAP47515.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMVS MKKMKNNAIVCNIGHFDNEIDM GLETYPGVK+ITIKPQTDR+VFPETK+GII
Sbjct  329  DIIMVSDMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKKITIKPQTDRWVFPETKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT EQA YIS+PVEGPYKP  YRY
Sbjct  449  ALHLGKLGAKLTKLTKEQADYISVPVEGPYKPLAYRY  485



>gb|AGX26651.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWSEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR+
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRH  485



>gb|AAV31754.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_006414844.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
 gb|ESQ56297.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
Length=588

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETKTGII
Sbjct  432  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKTGII  491

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  492  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  551

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+ +Q+ YISIP+EGPYKP HYRY
Sbjct  552  ALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY  588



>gb|AFK08605.1| S-adenosyl homocysteine hydrolase [Nicotiana benthamiana]
Length=485

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26684.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPVTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|NP_001289538.1| adenosylhomocysteinase [Nicotiana sylvestris]
 ref|XP_009622119.1| PREDICTED: adenosylhomocysteinase [Nicotiana tomentosiformis]
 ref|XP_009800926.1| PREDICTED: adenosylhomocysteinase [Nicotiana sylvestris]
 sp|P68172.1|SAHH_NICSY RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana sylvestris]
 sp|P68173.1|SAHH_TOBAC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana tabacum]
 dbj|BAA03709.1| S-adenosyl-L-homocystein hydrolase [Nicotiana sylvestris]
 dbj|BAA08142.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 dbj|BAA23164.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 gb|AAV31756.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26657.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK + KYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSSKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>emb|CAJ01706.1| S-adenosyl-L-homocysteine hydrolase [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRITIKPQTDR+VFPETKTGII
Sbjct  294  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRITIKPQTDRWVFPETKTGII  353

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  354  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVA  413

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKLT  Q+ YISIP+EGPYKP  YRY
Sbjct  414  ALHLGKLGARLTKLTKSQSDYISIPIEGPYKPAAYRY  450



>ref|XP_008803686.1| PREDICTED: adenosylhomocysteinase [Phoenix dactylifera]
Length=485

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DI+MV HM+KMKNNAIVCNIGHFDNEIDMHGLE +PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DILMVGHMRKMKNNAIVCNIGHFDNEIDMHGLENFPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERASGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLTP QA YI++P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTPSQAEYINVPIEGPYKPAHYRY  485



>emb|CDP15078.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DII+V HMKKMKNNAIVCNIGHFDNEIDM GLE YPGVKR+TIKPQTDR++FPE +TGII
Sbjct  329  DIIIVDHMKKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRVTIKPQTDRWIFPENETGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            ILAEGRL NLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  ILAEGRLTNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT  QAAYI++PVEGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLTSGQAAYINVPVEGPYKPPHYRY  485



>ref|XP_006848518.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
 gb|ERN10099.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
Length=485

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKR TIKPQTDR+VFPET +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETYPGVKRNTIKPQTDRWVFPETNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKY+K+VYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGTGKYQKQVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA LTKL+P+QA YI++P+EGPYKPP YRY
Sbjct  449  SLHLGKLGAHLTKLSPDQAEYINVPIEGPYKPPQYRY  485



>gb|AAX16000.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETK GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKAGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHL+EKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLNEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
             LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  449  LLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>gb|AGX26678.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+  +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDISSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>sp|P35007.1|SAHH_CATRO RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
 emb|CAA81527.1| S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
Length=485

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT +QA YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKDQADYISVPIEGPYKPAHYRY  485



>gb|AAX15998.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETK GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKAGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSF NQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFINQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
             LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  449  LLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>gb|AGX26656.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLD KVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDGKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26666.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITI PQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITILPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>sp|Q9SP37.1|SAHH_LUPLU RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Lupinus luteus]
 gb|AAD56048.1|AF185635_1 S-adenosyl-L-homocysteinase [Lupinus luteus]
Length=485

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIM+ HMKKMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMLDHMKKMKNNAIVCNIGHFDNEIDMLGLETHPGVKRITIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHL KLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLEKLGAKLTKLSKDQADYISVPVEGPYKPFHYRY  485



>emb|CDY47309.1| BnaAnng08830D [Brassica napus]
Length=486

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  330  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKRITIKPQTDRWVFPDTKSGII  389

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  390  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  449

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKP HYRY
Sbjct  450  ALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPAHYRY  486



>gb|AGX26672.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEI MHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIGMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3OND|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3ONE|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONE|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONF|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
 pdb|3ONF|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
Length=488

 Score =   268 bits (686),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIM+ HMKKMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFPET TGII
Sbjct  332  DIIMLDHMKKMKNNAIVCNIGHFDNEIDMLGLETHPGVKRITIKPQTDRWVFPETNTGII  391

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  392  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  451

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHL KLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  452  ALHLEKLGAKLTKLSKDQADYISVPVEGPYKPFHYRY  488



>ref|XP_009102577.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   268 bits (685),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TKTGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  485



>ref|XP_006373090.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|ABK96105.1| unknown [Populus trichocarpa]
 gb|ERP50887.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   268 bits (685),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 136/157 (87%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+TK+GI+
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTKSGIL  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|EYU31513.1| hypothetical protein MIMGU_mgv1a004058mg [Erythranthe guttata]
Length=547

 Score =   270 bits (689),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  391  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTKSGII  450

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKY K+VYVLPKHLDEKVA
Sbjct  451  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYGKEVYVLPKHLDEKVA  510

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT +Q+ Y+SIPVEGPYKPPHYRY
Sbjct  511  ALHLGKLGAKLTKLTKDQSDYVSIPVEGPYKPPHYRY  547



>ref|XP_009135865.1| PREDICTED: adenosylhomocysteinase 2-like [Brassica rapa]
Length=485

 Score =   268 bits (684),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKLT +Q+ Y+SIP+EGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLTKDQSDYVSIPIEGPYKPGHYRY  485



>gb|AGX26653.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   268 bits (684),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGR MNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRPMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_006418835.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
 gb|ESQ37271.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
Length=485

 Score =   268 bits (684),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TKTGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKLT +Q+ Y+SIP+EGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLTKDQSDYVSIPIEGPYKPVHYRY  485



>gb|AAA33855.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=227

 Score =   259 bits (662),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMVS M+KMKNNAIV NIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T  GII
Sbjct  71   DIIMVSDMRKMKNNAIVDNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTGRGII  130

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYV PKHLDEKVA
Sbjct  131  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVCPKHLDEKVA  190

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  191  ALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  227



>gb|EMS57266.1| Adenosylhomocysteinase [Triticum urartu]
Length=752

 Score =   274 bits (701),  Expect = 6e-83, Method: Composition-based stats.
 Identities = 141/157 (90%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRITIKPQTDR+VFPET TGII
Sbjct  596  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRITIKPQTDRWVFPETNTGII  655

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK TGKYEKKVYVLPKHLDEKVA
Sbjct  656  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKATGKYEKKVYVLPKHLDEKVA  715

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKLT  Q+ YISIPV+GPYKP  YRY
Sbjct  716  ALHLGKLGARLTKLTKAQSEYISIPVDGPYKPAAYRY  752



>gb|AGX26686.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   268 bits (684),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHG ET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGPETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26682.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   268 bits (684),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ ELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQPELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26661.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   268 bits (684),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGR MNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRPMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>emb|CDY50423.1| BnaCnng19320D [Brassica napus]
Length=485

 Score =   268 bits (684),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPAHYRY  485



>ref|XP_006421018.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
 gb|ESR34258.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
Length=485

 Score =   268 bits (684),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HMKKMKNNAIVCNIGHFDNEID+ GLETYPGVKRITIKPQTDR+VFPET +GII
Sbjct  329  DIIMVDHMKKMKNNAIVCNIGHFDNEIDVLGLETYPGVKRITIKPQTDRWVFPETNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLT+LT EQA YIS+  +GPYKP HYRY
Sbjct  449  ALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHYRY  485



>ref|NP_001234012.1| adenosylhomocysteinase [Solanum lycopersicum]
 sp|Q9SWF5.1|SAHH_SOLLC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Solanum lycopersicum]
 gb|AAD50775.1|AF161705_1 S-adenosyl-l-homocysteine hydrolase [Solanum lycopersicum]
Length=485

 Score =   268 bits (684),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGK GAKLTKLT +QA YI +PVEGPYKP HYRY
Sbjct  449  ALHLGKFGAKLTKLTKDQADYIYVPVEGPYKPAHYRY  485



>ref|XP_002883461.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59720.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=485

 Score =   267 bits (683),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPVHYRY  485



>gb|AAX15999.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   267 bits (683),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETK  II
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKAEII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
             LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  449  LLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>emb|CDY01177.1| BnaA04g06420D [Brassica napus]
Length=485

 Score =   267 bits (683),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPAHYRY  485



>ref|NP_001265954.1| adenosylhomocysteinase-like [Cicer arietinum]
 emb|CAI56440.1| S-adenosyl-L-homocysteine hydrolase [Cicer arietinum]
Length=485

 Score =   267 bits (683),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV  M+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMVDDMRKMKNNAIVCNIGHFDNEIDMAGLENYPGVKRITIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+N+GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERNSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHL KLGAKLTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLNKLGAKLTKLSQSQADYISVPVEGPYKPAHYRY  485



>gb|AEI54335.1| adenosylhomocysteinase [Glycine max]
Length=485

 Score =   267 bits (683),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQL LWKEK+ GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLGLWKEKSIGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLT+L+  QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTQLSKSQADYISVPVEGPYKPAHYRY  485



>sp|Q01781.2|SAHH_PETCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Petroselinum crispum]
 gb|AAA33856.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=485

 Score =   267 bits (683),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMVS M+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T  GII
Sbjct  329  DIIMVSDMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTGRGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_007153624.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
 gb|ESW25618.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
Length=485

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET TGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+ +QA YIS+ VEGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLSKDQADYISVAVEGPYKPTHYRY  485



>sp|P93253.1|SAHH_MESCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Mesembryanthemum 
crystallinum]
 gb|AAB38499.1| S-adenosyl-L-homocystein hydrolase [Mesembryanthemum crystallinum]
Length=485

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDRFVFPET TGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRFVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLM LGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMKLGCATGHPSFVMSCSFTNQVIAQLELWNERASGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|KFK39678.1| hypothetical protein AALP_AA3G275000 [Arabis alpina]
Length=485

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPVHYRY  485



>ref|XP_009106322.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   266 bits (681),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETYPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP  YRY
Sbjct  449  ALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVSYRY  485



>gb|AAM19782.1| AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   266 bits (681),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  485



>gb|AAL16259.1|AF428329_1 AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  485



>ref|NP_189023.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
 sp|Q9LK36.1|SAHH2_ARATH RecName: Full=Adenosylhomocysteinase 2; Short=AdoHcyase 2; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase 1; AltName: 
Full=SAH hydrolase 2 [Arabidopsis thaliana]
 dbj|BAB01858.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAL24370.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAM13384.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAN12996.1| putative S-adenosyl-L-homocysteinase [Arabidopsis thaliana]
 gb|AEE76817.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
Length=485

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  485



>ref|XP_008457223.1| PREDICTED: adenosylhomocysteinase 1 [Cucumis melo]
Length=485

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET  GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNVGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERASGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ +QA YI++PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYINVPVEGPYKPAHYRY  485



>ref|XP_010512939.1| PREDICTED: adenosylhomocysteinase 2-like [Camelina sativa]
Length=485

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP +YRY
Sbjct  449  ALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPANYRY  485



>ref|XP_010466740.1| PREDICTED: adenosylhomocysteinase 2-like isoform X1 [Camelina 
sativa]
Length=485

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP +YRY
Sbjct  449  ALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPANYRY  485



>ref|XP_008671500.1| PREDICTED: adenosylhomocysteinase-like [Zea mays]
Length=426

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQ DR+VFPET TGII
Sbjct  270  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQIDRWVFPETNTGII  329

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            ILAEGRLMNLGCATGHPSFVMSCSFTNQV+AQLELWKEKN+GKYEKKVYVLPKHLDEKV 
Sbjct  330  ILAEGRLMNLGCATGHPSFVMSCSFTNQVLAQLELWKEKNSGKYEKKVYVLPKHLDEKVN  389

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGK GAKLTKLT  QA YI +P+EGPYK  HYRY
Sbjct  390  ALHLGKHGAKLTKLTKSQADYIRVPIEGPYKLAHYRY  426



>ref|XP_010488460.1| PREDICTED: adenosylhomocysteinase 2 [Camelina sativa]
Length=485

 Score =   266 bits (680),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP +YRY
Sbjct  449  ALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPANYRY  485



>ref|XP_003538528.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   266 bits (679),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIM+ HMKKMKNNAIVCNIGHFDNEIDM GLET PGVKRI IKPQTDR+VFP+TK GII
Sbjct  329  DIIMLDHMKKMKNNAIVCNIGHFDNEIDMLGLETCPGVKRINIKPQTDRWVFPDTKRGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLG+LGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGQLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|ACN40278.1| unknown [Picea sitchensis]
Length=485

 Score =   266 bits (679),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIM+ HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVK+ITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMLDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKKITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHL KLGA+LTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  449  ALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>ref|XP_007034216.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY05142.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=510

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMCGLENYPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKATGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYR  268
            ALHL KLGAKLTKL+ EQA YIS+PVEGPYKP HYR
Sbjct  449  ALHLPKLGAKLTKLSKEQADYISVPVEGPYKPAHYR  484



>gb|ABR16547.1| unknown [Picea sitchensis]
 gb|ABR18363.1| unknown [Picea sitchensis]
Length=485

 Score =   266 bits (679),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIM+ HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVK+ITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMLDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKKITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHL KLGA+LTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  449  ALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>ref|XP_006297468.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
 gb|EOA30366.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
Length=507

 Score =   266 bits (680),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  351  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  410

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  411  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  470

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP HYRY
Sbjct  471  ALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPVHYRY  507



>gb|ABR17322.1| unknown [Picea sitchensis]
Length=485

 Score =   265 bits (678),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIM+ HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVK+ITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMLDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKKITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHL KLGA+LTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  449  ALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>ref|XP_001755926.1| predicted protein [Physcomitrella patens]
 gb|EDQ79211.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   265 bits (678),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 136/157 (87%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMVS M+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+TK G+I
Sbjct  329  DIIMVSDMRKMKNNAIVCNIGHFDNEIDMEGLETYPGVKRITIKPQTDRWVFPDTKRGVI  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKKSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
             LHL KLGA+LTKL+ +QA+YI++PV GPYKP HYRY
Sbjct  449  LLHLEKLGARLTKLSEDQASYINVPVGGPYKPAHYRY  485



>ref|XP_009139575.1| PREDICTED: adenosylhomocysteinase 1 [Brassica rapa]
Length=485

 Score =   265 bits (678),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPAHYRY  485



>ref|XP_004166113.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Cucumis 
sativus]
Length=485

 Score =   265 bits (678),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMVS M+KMKNNAIV NIGHFDNEIDMHGLET+P VKRITIKPQTDR+VFP+TKTGII
Sbjct  329  DIIMVSDMRKMKNNAIVSNIGHFDNEIDMHGLETFPDVKRITIKPQTDRWVFPDTKTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ +QA YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPIEGPYKPAHYRY  485



>ref|XP_004133979.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN56709.1| hypothetical protein Csa_3G129660 [Cucumis sativus]
Length=485

 Score =   265 bits (678),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMVS M+KMKNNAIV NIGHFDNEIDMHGLET+P VKRITIKPQTDR+VFP+TKTGII
Sbjct  329  DIIMVSDMRKMKNNAIVSNIGHFDNEIDMHGLETFPDVKRITIKPQTDRWVFPDTKTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ +QA YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPIEGPYKPAHYRY  485



>ref|XP_001755929.1| predicted protein [Physcomitrella patens]
 gb|EDQ79214.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   265 bits (678),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 136/157 (87%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMVS M+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+TK G+I
Sbjct  329  DIIMVSDMRKMKNNAIVCNIGHFDNEIDMEGLETYPGVKRITIKPQTDRWVFPDTKRGVI  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKKSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
             LHL KLGA+LTKL+ +QA+YI++PV GPYKP HYRY
Sbjct  449  LLHLEKLGARLTKLSEDQASYINVPVGGPYKPAHYRY  485



>gb|ABR16573.1| unknown [Picea sitchensis]
Length=485

 Score =   265 bits (677),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIM+ HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVK+ITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMLDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKKITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHL KLGA+LTKL+P+QA YI++P+EGPYKP HYRY
Sbjct  449  ALHLPKLGARLTKLSPDQAEYINVPIEGPYKPAHYRY  485



>gb|AHL20280.1| S-adenosylhomocysteine hydrolase [Kalanchoe daigremontiana]
Length=485

 Score =   265 bits (677),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            D+IMVS MK+MKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET +GII
Sbjct  329  DVIMVSDMKRMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHL KLGAKLTKLT EQA YIS+P+EGPYKP  YRY
Sbjct  449  ALHLSKLGAKLTKLTKEQADYISVPIEGPYKPAAYRY  485



>ref|XP_003629610.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89237.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AET04086.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   265 bits (677),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV  M+KMKNNAIVCNIGHFDNEIDM GLE YPGVKR+TIKPQTDR+VFPET TGII
Sbjct  329  DIIMVDDMRKMKNNAIVCNIGHFDNEIDMSGLENYPGVKRVTIKPQTDRWVFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSQSQADYISVPVEGPYKPAHYRY  485



>gb|AIG62173.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   265 bits (677),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62161.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   265 bits (676),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62171.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   265 bits (676),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62149.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   265 bits (676),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|ABR16616.1| unknown [Picea sitchensis]
Length=450

 Score =   263 bits (673),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIM+ HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVK+ITIKPQTDR+VFP+T +GII
Sbjct  294  DIIMLDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKKITIKPQTDRWVFPDTNSGII  353

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  354  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  413

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHL KLGA+LTKL+P+QA YI++PV+GPYKP HYRY
Sbjct  414  ALHLPKLGARLTKLSPDQAEYINVPVDGPYKPAHYRY  450



>gb|AIG62181.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   265 bits (676),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62151.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   265 bits (676),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62152.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   265 bits (676),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62170.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   265 bits (676),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62164.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62189.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   265 bits (676),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62187.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   265 bits (676),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62165.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   265 bits (676),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGV+RITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVRRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +L LGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLRLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>dbj|BAE71233.1| putative adenosylhomocysteinase [Trifolium pratense]
 dbj|BAE71257.1| putative adenosylhomocysteinase [Trifolium pratense]
Length=485

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV  MKKMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR++FPET TGII
Sbjct  329  DIIMVDDMKKMKNNAIVCNIGHFDNEIDMSGLENYPGVKRITIKPQTDRWLFPETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSQSQADYISVPVEGPYKPAHYRY  485



>gb|AIG62182.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62184.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>ref|XP_011003627.1| PREDICTED: adenosylhomocysteinase [Populus euphratica]
Length=485

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62168.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62166.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62190.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62176.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62160.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62162.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62167.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62172.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62183.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62158.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>ref|XP_004138966.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 ref|XP_004162424.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN61486.1| hypothetical protein Csa_2G140370 [Cucumis sativus]
Length=485

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET  GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNVGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERASGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ +QA YI++PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYINVPVEGPYKPAHYRY  485



>gb|AIG62163.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62150.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62153.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62148.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62175.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62192.1| S-adenosyl-L-homocysteine hydrolase [Populus alba x Populus glandulosa]
Length=485

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LT+L+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTELSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62186.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62180.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|ABK24229.1| unknown [Picea sitchensis]
 gb|ACN40819.1| unknown [Picea sitchensis]
Length=485

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIM+ HM+KMKNNAIVCNIGHFDNEID+ GLE +PGVK+ITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMLDHMRKMKNNAIVCNIGHFDNEIDIQGLENFPGVKKITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHL KLGAKLTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  449  ALHLPKLGAKLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|AIG62185.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>sp|P32112.1|SAHH_WHEAT RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
 gb|AAA34303.1| S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
Length=485

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRITIKPQTDR+VFPETKTGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRITIKPQTDRWVFPETKTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKLT  Q+ YISIP+EGPYK   YRY
Sbjct  449  ALHLGKLGARLTKLTKSQSDYISIPIEGPYKLRLYRY  485



>gb|ABR16138.1| unknown [Picea sitchensis]
Length=485

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIM+ HM+K+KNNAIVCNIGHFDNEIDM GLET+PGVK+ITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMLDHMRKIKNNAIVCNIGHFDNEIDMQGLETFPGVKKITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHL KLGA+LTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  449  ALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|AIG62156.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGV+RITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVRRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|ABK25129.1| unknown [Picea sitchensis]
Length=485

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DI+M+ HM+KMKNNAIVCNIGHFDNEID+ GLE +PGVK+ITIKPQTDR+VFP+TK+GII
Sbjct  329  DIVMLDHMRKMKNNAIVCNIGHFDNEIDIQGLENFPGVKKITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHL KLGAKLTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  449  ALHLPKLGAKLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|AAK92718.1| putative S-adenosyl-L-homocysteinas protein [Arabidopsis thaliana]
Length=485

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPK LDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKRLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  485



>ref|XP_001755906.1| predicted protein [Physcomitrella patens]
 gb|EDQ79191.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMVS M+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK G+I
Sbjct  329  DIIMVSDMRKMKNNAIVCNIGHFDNEIDMEGLETFPGVKRITIKPQTDRWVFPDTKRGVI  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERTSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
             LHL KLGA+LTKL+ +QA+YI++PV GPYKP HYRY
Sbjct  449  LLHLEKLGARLTKLSDDQASYINVPVGGPYKPAHYRY  485



>gb|ABJ53283.1| S-adenosyl-L-homocysteine hydrolase [Ligularia fischeri]
Length=327

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMVS MKKMKNNAIVCNIGHFDNEIDM GLETYPGV+RITIKPQTDR+VFPETK GII
Sbjct  171  DIIMVSDMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVQRITIKPQTDRWVFPETKAGII  230

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKY+ +VYVLPKHLDEKVA
Sbjct  231  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYKNEVYVLPKHLDEKVA  290

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLT L+ +QA YI++PVEGPYKP +YRY
Sbjct  291  ALHLGKLGAKLTVLSKDQADYINVPVEGPYKPLNYRY  327



>gb|AIG62177.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   263 bits (673),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI+ PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINAPVEGPYKPAQYRY  485



>gb|AIG62188.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   263 bits (673),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP++K+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDSKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62157.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIM  HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMADHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>sp|P50249.1|SAHH_PHASS RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Phalaenopsis sp.]
 emb|CAA56278.1| S-adenosylhomocysteine hydrolase [Phalaenopsis sp. 'pSPORT1']
Length=485

 Score =   263 bits (671),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE++PGVKRITIKPQTDR VFP+T +GI+
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLESFPGVKRITIKPQTDRRVFPDTNSGIL  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMS SFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSSSFTNQVIAQLELWKERASGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLTP QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTPSQADYISVPVEGPYKPAHYRY  485



>gb|AIG62159.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   263 bits (671),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFT+QVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTDQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62169.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   263 bits (671),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFD+EIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDSEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSEDQADYINVPVEGPYKPAQYRY  485



>gb|AAP92452.1| S-adenosyl-L-homocystein hydrolase [Petunia x hybrida]
Length=485

 Score =   263 bits (671),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPS VMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSVVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKL+ +QA YI++PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYINVPVEGPYKPVHYRY  485



>gb|AHA84211.1| S-adenosyl-L-homocysteine hydrolase [Phaseolus vulgaris]
Length=485

 Score =   263 bits (671),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VF ET TGII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFLETNTGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGA+LTKL+ +QA YIS+ VEGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLSKDQADYISVAVEGPYKPTHYRY  485



>gb|AIG62191.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   262 bits (670),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGH DNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHLDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|EYU32710.1| hypothetical protein MIMGU_mgv1a003606mg [Erythranthe guttata]
Length=574

 Score =   265 bits (676),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV  MK+MKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPETK+GII
Sbjct  418  DIIMVDQMKRMKNNAIVCNIGHFDNEIDMQGLENYPGVKRITIKPQTDRWVFPETKSGII  477

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKY K+VYVLPKHLDEKVA
Sbjct  478  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYGKEVYVLPKHLDEKVA  537

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            ALHLGKLGAKLTKLT +Q+ YISIPVEGPYKPPHYRY
Sbjct  538  ALHLGKLGAKLTKLTKDQSDYISIPVEGPYKPPHYRY  574



>gb|AER92590.1| putative S-adenosyl-L-homocysteinase [Linum usitatissimum]
Length=561

 Score =   264 bits (675),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV  M+KMKNNAIVCNIGHFDNEIDM+GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  405  DIIMVDDMRKMKNNAIVCNIGHFDNEIDMNGLETFPGVKRITIKPQTDRWVFPDTKSGII  464

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  465  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERASGKYEKKVYVLPKHLDEKVA  524

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP  YRY
Sbjct  525  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAQYRY  561



>ref|XP_002300147.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|EEE84952.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   262 bits (669),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+T +GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTNSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++P+EGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPIEGPYKPAQYRY  485



>gb|AIG62155.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   262 bits (669),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  735  DIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGII  556
            DIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII
Sbjct  329  DIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGII  388

Query  555  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  376
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYV PKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVSPKHLDEKVA  448

Query  375  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  265
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1340626501500