BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF034I09

Length=744
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007034061.1|  S-adenosyl-L-methionine-dependent methyltran...    239   2e-73   
ref|XP_009781246.1|  PREDICTED: uncharacterized protein LOC104230205    236   2e-72   Nicotiana sylvestris
ref|XP_009588400.1|  PREDICTED: histidine protein methyltransfera...    236   2e-72   Nicotiana tomentosiformis
ref|XP_008453987.1|  PREDICTED: uncharacterized protein LOC103494545    233   3e-71   Cucumis melo [Oriental melon]
ref|XP_004152105.1|  PREDICTED: histidine protein methyltransfera...    233   5e-71   Cucumis sativus [cucumbers]
gb|KJB71894.1|  hypothetical protein B456_011G146300                    232   1e-70   Gossypium raimondii
gb|KHG16096.1|  Histidine methyltransferase 1                           232   1e-70   Gossypium arboreum [tree cotton]
gb|KHG29074.1|  Histidine methyltransferase 1                           232   1e-70   Gossypium arboreum [tree cotton]
gb|KJB27982.1|  hypothetical protein B456_005G020100                    232   1e-70   Gossypium raimondii
ref|XP_006347281.1|  PREDICTED: histidine protein methyltransfera...    231   3e-70   Solanum tuberosum [potatoes]
ref|XP_004241398.1|  PREDICTED: histidine protein methyltransfera...    230   7e-70   
ref|XP_002534114.1|  conserved hypothetical protein                     227   8e-69   Ricinus communis
ref|XP_002310441.1|  hypothetical protein POPTR_0007s02090g             223   3e-67   Populus trichocarpa [western balsam poplar]
ref|XP_006372889.1|  hypothetical protein POPTR_0017s06020g             223   5e-67   Populus trichocarpa [western balsam poplar]
ref|XP_011037077.1|  PREDICTED: uncharacterized protein LOC105134384    223   5e-67   Populus euphratica
gb|KDP42809.1|  hypothetical protein JCGZ_23751                         222   7e-67   Jatropha curcas
emb|CAN69477.1|  hypothetical protein VITISV_017347                     221   8e-67   Vitis vinifera
ref|XP_010097465.1|  hypothetical protein L484_024670                   222   8e-67   Morus notabilis
ref|XP_007223424.1|  hypothetical protein PRUPE_ppa010155mg             219   1e-66   
ref|XP_002264228.1|  PREDICTED: histidine protein methyltransfera...    221   1e-66   Vitis vinifera
ref|XP_011026390.1|  PREDICTED: uncharacterized protein LOC105127016    221   2e-66   Populus euphratica
ref|XP_004309612.1|  PREDICTED: histidine protein methyltransfera...    220   3e-66   Fragaria vesca subsp. vesca
ref|XP_008222628.1|  PREDICTED: uncharacterized protein LOC103322485    220   6e-66   Prunus mume [ume]
ref|XP_009363653.1|  PREDICTED: histidine protein methyltransfera...    217   5e-65   Pyrus x bretschneideri [bai li]
ref|XP_007150422.1|  hypothetical protein PHAVU_005G152300g             217   6e-65   Phaseolus vulgaris [French bean]
ref|XP_008372076.1|  PREDICTED: histidine protein methyltransfera...    217   7e-65   Malus domestica [apple tree]
gb|KHN33316.1|  Histidine protein methyltransferase 1 like              215   3e-64   Glycine soja [wild soybean]
ref|XP_006597006.1|  PREDICTED: uncharacterized protein LOC100786...    215   3e-64   Glycine max [soybeans]
ref|XP_009344374.1|  PREDICTED: histidine protein methyltransfera...    214   1e-63   Pyrus x bretschneideri [bai li]
ref|XP_003543558.1|  PREDICTED: uncharacterized protein LOC100810...    213   3e-63   Glycine max [soybeans]
gb|KDO43480.1|  hypothetical protein CISIN_1g018716mg                   210   4e-63   Citrus sinensis [apfelsine]
gb|KHN30105.1|  Histidine protein methyltransferase 1 like              212   5e-63   Glycine soja [wild soybean]
gb|KDO43477.1|  hypothetical protein CISIN_1g018716mg                   210   2e-62   Citrus sinensis [apfelsine]
ref|XP_006443065.1|  hypothetical protein CICLE_v10020882mg             210   3e-62   Citrus clementina [clementine]
ref|XP_010242753.1|  PREDICTED: histidine protein methyltransfera...    209   7e-62   Nelumbo nucifera [Indian lotus]
ref|XP_010671826.1|  PREDICTED: uncharacterized protein LOC104888516    209   7e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010525954.1|  PREDICTED: uncharacterized protein LOC104803653    207   3e-61   Tarenaya hassleriana [spider flower]
ref|XP_010520847.1|  PREDICTED: uncharacterized protein LOC104799618    207   4e-61   Tarenaya hassleriana [spider flower]
ref|XP_006397494.1|  hypothetical protein EUTSA_v10001523mg             204   1e-59   Eutrema salsugineum [saltwater cress]
ref|XP_003597494.1|  hypothetical protein MTR_2g098630                  199   2e-59   
ref|XP_010930203.1|  PREDICTED: histidine protein methyltransfera...    202   5e-59   Elaeis guineensis
ref|XP_004486926.1|  PREDICTED: uncharacterized protein LOC101511...    201   6e-59   Cicer arietinum [garbanzo]
ref|XP_008799945.1|  PREDICTED: histidine protein methyltransfera...    201   6e-59   Phoenix dactylifera
gb|AES67745.2|  histidine methyltransferase-like protein                198   7e-59   Medicago truncatula
ref|XP_009133591.1|  PREDICTED: histidine protein methyltransfera...    201   9e-59   Brassica rapa
emb|CDY44218.1|  BnaC03g24100D                                          200   2e-58   Brassica napus [oilseed rape]
ref|XP_009416014.1|  PREDICTED: histidine protein methyltransfera...    200   3e-58   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY23358.1|  BnaC04g48860D                                          199   6e-58   Brassica napus [oilseed rape]
ref|XP_003597492.1|  hypothetical protein MTR_2g098630                  198   9e-58   Medicago truncatula
ref|XP_009142187.1|  PREDICTED: uncharacterized protein LOC103866064    198   1e-57   Brassica rapa
ref|XP_003597493.1|  hypothetical protein MTR_2g098630                  199   1e-57   
ref|XP_002881896.1|  hypothetical protein ARALYDRAFT_483439             198   1e-57   
ref|NP_001242428.1|  uncharacterized protein LOC100786056               197   1e-57   
ref|XP_008798999.1|  PREDICTED: histidine protein methyltransfera...    198   1e-57   Phoenix dactylifera
ref|XP_008791776.1|  PREDICTED: histidine protein methyltransfera...    197   2e-57   Phoenix dactylifera
ref|XP_006294500.1|  hypothetical protein CARUB_v10023531mg             197   4e-57   Capsella rubella
ref|XP_010517889.1|  PREDICTED: histidine protein methyltransfera...    197   4e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010508446.1|  PREDICTED: histidine protein methyltransfera...    196   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010506201.1|  PREDICTED: histidine protein methyltransfera...    195   2e-56   Camelina sativa [gold-of-pleasure]
gb|AAL16294.1|AF428364_1  At2g43320/T1O24.6                             195   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565997.1|  S-adenosyl-L-methionine-dependent methyltransfe...    195   2e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CDY30401.1|  BnaA04g25020D                                          193   9e-56   Brassica napus [oilseed rape]
ref|XP_010907676.1|  PREDICTED: histidine protein methyltransfera...    189   5e-54   Elaeis guineensis
ref|XP_010907675.1|  PREDICTED: histidine protein methyltransfera...    189   6e-54   Elaeis guineensis
ref|XP_010912793.1|  PREDICTED: uncharacterized protein LOC105038627    187   3e-53   
ref|XP_010043656.1|  PREDICTED: uncharacterized protein LOC104432789    186   5e-53   Eucalyptus grandis [rose gum]
ref|XP_006858675.1|  hypothetical protein AMTR_s00066p00080930          185   2e-52   Amborella trichopoda
ref|NP_001063658.2|  Os09g0514300                                       179   6e-51   
dbj|BAD34426.1|  hypothetical protein                                   180   6e-51   Oryza sativa Japonica Group [Japonica rice]
gb|EEC77542.1|  hypothetical protein OsI_16443                          176   1e-50   Oryza sativa Indica Group [Indian rice]
gb|EEE70043.1|  hypothetical protein OsJ_29997                          179   2e-50   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001144579.1|  uncharacterized protein LOC100277589               177   1e-49   Zea mays [maize]
ref|XP_008667701.1|  PREDICTED: uncharacterized protein LOC100277...    177   1e-49   Zea mays [maize]
ref|XP_004976058.1|  PREDICTED: uncharacterized protein LOC101755614    177   1e-49   Setaria italica
ref|XP_009401143.1|  PREDICTED: histidine protein methyltransfera...    176   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAH67536.1|  H0425E08.4                                             176   3e-49   Oryza sativa [red rice]
gb|ACJ84505.1|  unknown                                                 169   5e-49   Medicago truncatula
gb|EEC84878.1|  hypothetical protein OsI_32028                          176   7e-49   Oryza sativa Indica Group [Indian rice]
ref|NP_001053176.1|  Os04g0492400                                       174   1e-48   
ref|XP_009405561.1|  PREDICTED: uncharacterized protein LOC103988679    175   1e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002446718.1|  hypothetical protein SORBIDRAFT_06g021130          173   4e-48   Sorghum bicolor [broomcorn]
ref|XP_006652451.1|  PREDICTED: uncharacterized protein LOC102711251    172   2e-47   Oryza brachyantha
ref|XP_004957334.1|  PREDICTED: histidine protein methyltransfera...    171   2e-47   Setaria italica
ref|XP_006660841.1|  PREDICTED: uncharacterized protein LOC102708742    169   2e-46   Oryza brachyantha
gb|EMT24897.1|  hypothetical protein F775_32531                         168   4e-46   
ref|XP_003580042.1|  PREDICTED: histidine protein methyltransfera...    167   1e-45   Brachypodium distachyon [annual false brome]
ref|XP_010238357.1|  PREDICTED: uncharacterized protein LOC100830260    164   9e-45   Brachypodium distachyon [annual false brome]
gb|EMS59379.1|  hypothetical protein TRIUR3_33843                       166   2e-44   Triticum urartu
gb|KJB27983.1|  hypothetical protein B456_005G020100                    133   2e-33   Gossypium raimondii
gb|ABR16574.1|  unknown                                                 129   2e-31   Picea sitchensis
ref|NP_001159150.1|  hypothetical protein                               124   2e-29   Zea mays [maize]
gb|ABK25033.1|  unknown                                                 122   1e-28   Picea sitchensis
ref|XP_001760682.1|  predicted protein                                  101   9e-22   
ref|XP_001769361.1|  predicted protein                                96.3    3e-20   
ref|XP_002960051.1|  hypothetical protein SELMODRAFT_73463            97.1    4e-20   
ref|XP_002984087.1|  hypothetical protein SELMODRAFT_180720           95.9    4e-20   
ref|XP_009625430.1|  PREDICTED: histidine protein methyltransfera...  89.7    1e-17   Nicotiana tomentosiformis
ref|XP_006349911.1|  PREDICTED: histidine protein methyltransfera...  89.4    2e-17   Solanum tuberosum [potatoes]
gb|EMS67427.1|  hypothetical protein TRIUR3_02638                     88.2    2e-17   Triticum urartu
ref|XP_010314745.1|  PREDICTED: histidine protein methyltransfera...  89.0    2e-17   
ref|XP_010258580.1|  PREDICTED: histidine protein methyltransfera...  89.0    3e-17   Nelumbo nucifera [Indian lotus]
ref|XP_007163808.1|  hypothetical protein PHAVU_001G266000g           88.6    3e-17   Phaseolus vulgaris [French bean]
ref|XP_004252981.2|  PREDICTED: histidine protein methyltransfera...  88.6    3e-17   Solanum lycopersicum
ref|XP_010258579.1|  PREDICTED: histidine protein methyltransfera...  88.6    4e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010258577.1|  PREDICTED: histidine protein methyltransfera...  88.6    4e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010673377.1|  PREDICTED: histidine protein methyltransfera...  87.0    1e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010068986.1|  PREDICTED: histidine protein methyltransfera...  86.7    1e-16   Eucalyptus grandis [rose gum]
gb|KDP32603.1|  hypothetical protein JCGZ_13153                       86.7    1e-16   Jatropha curcas
ref|XP_006841538.1|  hypothetical protein AMTR_s00003p00162530        86.3    2e-16   Amborella trichopoda
gb|KJB71880.1|  hypothetical protein B456_011G152100                  85.9    2e-16   Gossypium raimondii
ref|XP_004489174.1|  PREDICTED: histidine protein methyltransfera...  86.3    2e-16   Cicer arietinum [garbanzo]
ref|XP_004489175.1|  PREDICTED: histidine protein methyltransfera...  86.3    2e-16   Cicer arietinum [garbanzo]
ref|XP_009764705.1|  PREDICTED: histidine protein methyltransfera...  85.9    2e-16   Nicotiana sylvestris
gb|KHG01813.1|  Histidine protein methyltransferase 1                 85.5    3e-16   Gossypium arboreum [tree cotton]
gb|KJB71876.1|  hypothetical protein B456_011G152100                  85.5    3e-16   Gossypium raimondii
ref|XP_003552281.1|  PREDICTED: histidine protein methyltransfera...  85.5    3e-16   Glycine max [soybeans]
ref|XP_006601885.1|  PREDICTED: histidine protein methyltransfera...  85.5    3e-16   Glycine max [soybeans]
ref|XP_010910923.1|  PREDICTED: histidine protein methyltransfera...  84.7    6e-16   Elaeis guineensis
ref|NP_001062976.1|  Os09g0359900                                     84.3    7e-16   
ref|XP_006414825.1|  hypothetical protein EUTSA_v10025872mg           84.3    8e-16   Eutrema salsugineum [saltwater cress]
ref|XP_002269192.1|  PREDICTED: histidine protein methyltransfera...  84.3    8e-16   Vitis vinifera
gb|EYU32714.1|  hypothetical protein MIMGU_mgv1a010754mg              84.3    8e-16   Erythranthe guttata [common monkey flower]
gb|AFK36874.1|  unknown                                               84.3    9e-16   Medicago truncatula
ref|XP_002300145.1|  hypothetical protein POPTR_0001s32830g           83.2    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_006369821.1|  hypothetical protein POPTR_0001s32830g           82.0    2e-15   
ref|XP_011073784.1|  PREDICTED: histidine protein methyltransfera...  82.8    3e-15   Sesamum indicum [beniseed]
ref|XP_010527454.1|  PREDICTED: histidine protein methyltransfera...  82.4    3e-15   Tarenaya hassleriana [spider flower]
ref|XP_008792356.1|  PREDICTED: histidine protein methyltransfera...  82.0    4e-15   
ref|XP_006284234.1|  hypothetical protein CARUB_v10005396mg           82.0    4e-15   Capsella rubella
gb|KFK36305.1|  hypothetical protein AALP_AA4G105100                  82.0    4e-15   Arabis alpina [alpine rockcress]
ref|XP_008792354.1|  PREDICTED: histidine protein methyltransfera...  82.0    5e-15   Phoenix dactylifera
emb|CDP20792.1|  unnamed protein product                              82.0    6e-15   Coffea canephora [robusta coffee]
ref|XP_009373561.1|  PREDICTED: histidine protein methyltransfera...  81.6    6e-15   Pyrus x bretschneideri [bai li]
ref|XP_009139570.1|  PREDICTED: histidine protein methyltransfera...  81.3    9e-15   Brassica rapa
ref|XP_010435209.1|  PREDICTED: histidine protein methyltransfera...  80.9    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010450136.1|  PREDICTED: histidine protein methyltransfera...  80.5    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_008358052.1|  PREDICTED: histidine protein methyltransfera...  80.5    1e-14   Malus domestica [apple tree]
emb|CDY01181.1|  BnaA04g06380D                                        80.1    2e-14   
ref|XP_011003636.1|  PREDICTED: histidine protein methyltransfera...  80.1    2e-14   Populus euphratica
ref|XP_004296995.1|  PREDICTED: histidine protein methyltransfera...  80.1    2e-14   Fragaria vesca subsp. vesca
ref|XP_010450119.1|  PREDICTED: histidine protein methyltransfera...  79.7    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_008222747.1|  PREDICTED: histidine protein methyltransfera...  79.7    3e-14   Prunus mume [ume]
ref|XP_003578016.1|  PREDICTED: histidine protein methyltransfera...  79.3    4e-14   Brachypodium distachyon [annual false brome]
ref|XP_006661157.1|  PREDICTED: histidine protein methyltransfera...  79.0    7e-14   Oryza brachyantha
ref|XP_002870342.1|  hypothetical protein ARALYDRAFT_493511           78.6    7e-14   
gb|EAZ08782.1|  hypothetical protein OsI_31043                        80.1    7e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_009392918.1|  PREDICTED: histidine protein methyltransfera...  78.6    8e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK36303.1|  hypothetical protein AALP_AA4G104900                  74.7    2e-13   Arabis alpina [alpine rockcress]
gb|ACR38362.1|  unknown                                               73.9    3e-13   Zea mays [maize]
ref|XP_006492532.1|  PREDICTED: histidine protein methyltransfera...  77.0    3e-13   Citrus sinensis [apfelsine]
ref|XP_007034208.1|  Methyltransferase family protein                 77.0    3e-13   
ref|XP_008439038.1|  PREDICTED: histidine protein methyltransfera...  77.0    3e-13   Cucumis melo [Oriental melon]
gb|EMS62208.1|  hypothetical protein TRIUR3_09094                     75.5    4e-13   Triticum urartu
emb|CDY12725.1|  BnaC04g29160D                                        76.3    5e-13   Brassica napus [oilseed rape]
ref|XP_004160640.1|  PREDICTED: histidine protein methyltransfera...  75.9    8e-13   
ref|XP_004147645.1|  PREDICTED: histidine protein methyltransfera...  75.9    9e-13   Cucumis sativus [cucumbers]
ref|XP_002532519.1|  conserved hypothetical protein                   75.5    9e-13   Ricinus communis
ref|XP_002965969.1|  hypothetical protein SELMODRAFT_84048            74.3    1e-12   
gb|EPS60086.1|  hypothetical protein M569_14718                       74.7    2e-12   Genlisea aurea
ref|XP_004956645.1|  PREDICTED: histidine protein methyltransfera...  75.1    2e-12   Setaria italica
ref|NP_567417.1|  putative methyltransferase family protein           74.7    2e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63649.1|  unknown                                               74.3    2e-12   Arabidopsis thaliana [mouse-ear cress]
gb|EMT16017.1|  hypothetical protein F775_04000                       75.1    2e-12   
ref|XP_006421030.1|  hypothetical protein CICLE_v10005461mg           74.3    3e-12   
emb|CBI39375.3|  unnamed protein product                              70.1    3e-12   Vitis vinifera
ref|NP_001169409.1|  uncharacterized protein LOC100383278             73.9    3e-12   Zea mays [maize]
ref|XP_002460101.1|  hypothetical protein SORBIDRAFT_02g022780        71.2    7e-11   
ref|XP_008222847.1|  PREDICTED: LOW QUALITY PROTEIN: histidine pr...  68.6    9e-11   
gb|KJB71878.1|  hypothetical protein B456_011G152100                  69.7    1e-10   Gossypium raimondii
gb|KHG01812.1|  Histidine protein methyltransferase 1                 69.7    1e-10   Gossypium arboreum [tree cotton]
ref|XP_007222358.1|  hypothetical protein PRUPE_ppa009767mg           67.8    4e-10   
gb|KJB71879.1|  hypothetical protein B456_011G152100                  67.8    4e-10   Gossypium raimondii
ref|XP_002952933.1|  hypothetical protein VOLCADRAFT_105747           66.6    1e-09   Volvox carteri f. nagariensis
ref|XP_004352569.1|  methyltransferase domain containing protein      65.9    2e-09   Acanthamoeba castellanii str. Neff
ref|XP_005847578.1|  hypothetical protein CHLNCDRAFT_133833           63.2    4e-08   Chlorella variabilis
emb|CAB10179.1|  hypothetical protein                                 62.0    4e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CDY14698.1|  BnaC05g19550D                                        60.5    7e-08   Brassica napus [oilseed rape]
emb|CDX99963.1|  BnaC09g27420D                                        60.8    1e-07   
ref|XP_001694366.1|  hypothetical protein CHLREDRAFT_173838           59.3    4e-07   Chlamydomonas reinhardtii
gb|KHN00212.1|  hypothetical protein glysoja_047383                   55.5    3e-06   Glycine soja [wild soybean]
ref|XP_002740457.1|  PREDICTED: histidine protein methyltransfera...  54.3    3e-05   Saccoglossus kowalevskii
ref|XP_002605872.1|  hypothetical protein BRAFLDRAFT_90801            51.6    1e-04   Branchiostoma floridae
gb|ESA23413.1|  hypothetical protein GLOINDRAFT_342180                52.8    1e-04   
ref|XP_003727461.1|  PREDICTED: histidine protein methyltransfera...  49.7    1e-04   
ref|XP_006564114.1|  PREDICTED: histidine protein methyltransfera...  51.2    3e-04   Apis mellifera [bee]
ref|XP_005646641.1|  hypothetical protein COCSUDRAFT_83488            50.4    5e-04   Coccomyxa subellipsoidea C-169



>ref|XP_007034061.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007034062.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY04987.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY04988.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=350

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  ELPTVLSVVRND SE+  GMS SFSEED MDGCSSQDGSI+  E SSRRSRKL
Sbjct  192  FYAGDWEELPTVLSVVRNDVSEVTTGMSLSFSEEDFMDGCSSQDGSIIAQEISSRRSRKL  251

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERAS+ DQGE GYDVILMTEIPYSV+SLKKLY+LIKKCLRPPYGV+YLATK+NY
Sbjct  252  SGSRAWERASEIDQGEGGYDVILMTEIPYSVSSLKKLYALIKKCLRPPYGVLYLATKKNY  311

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VGFN+AARHLRSLVDEEG+FGAHL+ E+ DR+IW
Sbjct  312  VGFNNAARHLRSLVDEEGIFGAHLIKEVADRDIW  345



>ref|XP_009781246.1| PREDICTED: uncharacterized protein LOC104230205 [Nicotiana sylvestris]
Length=349

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G   ELPTVLSVVRND SE+P GMS S SEED MDGCSSQ+GSIL  ESS RRSRKL
Sbjct  191  FYAGEWEELPTVLSVVRNDISEVPTGMSLSLSEEDFMDGCSSQEGSILAQESSLRRSRKL  250

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERA+DAD GE GYDVILMTE+PYSV SLKKL+ LIKKCLRPPYGV+YLA KRNY
Sbjct  251  SGSRAWERANDADNGEGGYDVILMTELPYSVPSLKKLHGLIKKCLRPPYGVIYLAAKRNY  310

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            V FNSAARHLRS+VDEEGVFGAHLV ELTDREIW
Sbjct  311  VSFNSAARHLRSVVDEEGVFGAHLVKELTDREIW  344



>ref|XP_009588400.1| PREDICTED: histidine protein methyltransferase 1 homolog [Nicotiana 
tomentosiformis]
Length=349

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G   ELPTVLSVVRND SE+P GMS S SEED MDGCSSQ+GSIL  ESS RRSRKL
Sbjct  191  FYAGEWEELPTVLSVVRNDISEVPTGMSLSLSEEDFMDGCSSQEGSILAQESSLRRSRKL  250

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERA+DAD GE GYDVILMTE+PYSV SLKKL+ LIKKCLRPPYGV+YLA KRNY
Sbjct  251  SGSRAWERANDADNGEGGYDVILMTELPYSVPSLKKLHGLIKKCLRPPYGVIYLAAKRNY  310

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            V FNSAARHLRS+VDEEGVFGAHLV ELTDREIW
Sbjct  311  VSFNSAARHLRSVVDEEGVFGAHLVKELTDREIW  344



>ref|XP_008453987.1| PREDICTED: uncharacterized protein LOC103494545 [Cucumis melo]
 ref|XP_008453988.1| PREDICTED: uncharacterized protein LOC103494545 [Cucumis melo]
 ref|XP_008453989.1| PREDICTED: uncharacterized protein LOC103494545 [Cucumis melo]
 ref|XP_008453990.1| PREDICTED: uncharacterized protein LOC103494545 [Cucumis melo]
Length=350

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  ELPTVLSVVR D  E P GMS SFSEED MDGCSSQDGSI+ HESSSRRSRKL
Sbjct  192  FYAGDWEELPTVLSVVRGDGFEAPTGMSLSFSEEDFMDGCSSQDGSIIGHESSSRRSRKL  251

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERAS+ADQGE GYD+ILM EIP+S+ SLKKLY+LIKKC+RPPYGV+YLATK+NY
Sbjct  252  SGSRAWERASEADQGEGGYDIILMAEIPFSLNSLKKLYALIKKCVRPPYGVLYLATKKNY  311

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VGFNS ARHLRSLVDEEGVFGAHLV E+TDR++W
Sbjct  312  VGFNSGARHLRSLVDEEGVFGAHLVKEMTDRDVW  345



>ref|XP_004152105.1| PREDICTED: histidine protein methyltransferase 1 homolog [Cucumis 
sativus]
 ref|XP_004156936.1| PREDICTED: histidine protein methyltransferase 1 homolog [Cucumis 
sativus]
 gb|KGN53072.1| hypothetical protein Csa_4G015130 [Cucumis sativus]
Length=350

 Score =   233 bits (594),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  ELPTVLSVVR D  E P GMS SFSEED MDGCSSQDGSI+ HESSSRRSRKL
Sbjct  192  FYAGDWEELPTVLSVVRGDGFEAPTGMSLSFSEEDFMDGCSSQDGSIIGHESSSRRSRKL  251

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERAS+ADQGE GYDVILM EIP+S+ SLKKLY+LIKKC+RPPYGV+YLATK+NY
Sbjct  252  SGSRAWERASEADQGEGGYDVILMAEIPFSLNSLKKLYALIKKCVRPPYGVLYLATKKNY  311

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VGFNS ARHLR+LVDEEGVFGAHLV E+TDR++W
Sbjct  312  VGFNSGARHLRNLVDEEGVFGAHLVKEMTDRDVW  345



>gb|KJB71894.1| hypothetical protein B456_011G146300 [Gossypium raimondii]
 gb|KJB71895.1| hypothetical protein B456_011G146300 [Gossypium raimondii]
Length=350

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  ELPTVLSVVRND SE+  GM  SFSEED MDGCSSQDGS +  E SSRRSRKL
Sbjct  192  FYAGDWEELPTVLSVVRNDVSEVTTGMRLSFSEEDFMDGCSSQDGSSITQEISSRRSRKL  251

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERAS+ DQGESGYD+ILMTEIPYSV+SLKKLY+LIKKC+RPPYGV+YL+TK+NY
Sbjct  252  SGSRAWERASETDQGESGYDIILMTEIPYSVSSLKKLYALIKKCVRPPYGVVYLSTKKNY  311

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VGFN+AARHLRSLVDEEG+FGAHL+ E+TD +IW
Sbjct  312  VGFNNAARHLRSLVDEEGIFGAHLIKEVTDVDIW  345



>gb|KHG16096.1| Histidine methyltransferase 1 [Gossypium arboreum]
Length=350

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  ELP+VLSVVRND SE+  G+S SFSEED +DGCSSQDGSIL  E S RRSR+L
Sbjct  192  FYAGDWEELPSVLSVVRNDVSEMTPGLSFSFSEEDFLDGCSSQDGSILAQELSLRRSRRL  251

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            S SRAWERAS+ DQGE GYDVILMTEIPY ++SLKKLY+LIKKCLRPPYGV+YLATK+NY
Sbjct  252  SRSRAWERASETDQGEGGYDVILMTEIPYPMSSLKKLYALIKKCLRPPYGVVYLATKKNY  311

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VGFN+AARHLRSLVDEEG+FGAHL+ E++DR+IW
Sbjct  312  VGFNTAARHLRSLVDEEGIFGAHLIKEVSDRDIW  345



>gb|KHG29074.1| Histidine methyltransferase 1 [Gossypium arboreum]
Length=350

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  ELPTVLSVVRND SE+  GM  SFSEED MDGCSSQDGS +  E SSRRSRKL
Sbjct  192  FYAGDWEELPTVLSVVRNDVSEVTTGMRLSFSEEDFMDGCSSQDGSSITQEISSRRSRKL  251

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERAS+ DQGESGYD+ILMTEIPYSV+SLKKLY+LIKKC+RPPYGV+YL+TK+NY
Sbjct  252  SGSRAWERASETDQGESGYDIILMTEIPYSVSSLKKLYALIKKCVRPPYGVVYLSTKKNY  311

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VGFN+AARHLRSLVDEEG+FGAHL+ E+TD +IW
Sbjct  312  VGFNNAARHLRSLVDEEGIFGAHLIKEVTDVDIW  345



>gb|KJB27982.1| hypothetical protein B456_005G020100 [Gossypium raimondii]
Length=350

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  ELP+VLSVVRND SE+  G+S SFSEED +DGCSSQDGSIL  E S RRSR+L
Sbjct  192  FYAGDWEELPSVLSVVRNDVSEMTPGLSFSFSEEDFLDGCSSQDGSILAQELSLRRSRRL  251

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            S SRAWERAS+ DQGE GYDVILMTEIPY ++SLKKLY+LIKKCLRPPYGV+YLATK+NY
Sbjct  252  SRSRAWERASETDQGEGGYDVILMTEIPYPMSSLKKLYALIKKCLRPPYGVVYLATKKNY  311

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VGFN+AARHLRSLVDEEG+FGAHL+ E++DR+IW
Sbjct  312  VGFNTAARHLRSLVDEEGIFGAHLIKEVSDRDIW  345



>ref|XP_006347281.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Solanum tuberosum]
 ref|XP_006347282.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Solanum tuberosum]
Length=346

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G   ELPTVLSVVRND SE+P G S S SEED MDGCSSQDGSIL  ESS RRSRKL
Sbjct  188  FYAGEWEELPTVLSVVRNDISEVPTGKSLSLSEEDFMDGCSSQDGSILGLESSLRRSRKL  247

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERA+DAD GE GYDVILMTE+PYSV SLKKLY LIKKCLRPPYGV+YLA KRNY
Sbjct  248  SGSRAWERANDADNGEGGYDVILMTELPYSVPSLKKLYVLIKKCLRPPYGVIYLAAKRNY  307

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            V FNSA RHLRS+VDEEGVFGAHLV EL DREIW
Sbjct  308  VSFNSATRHLRSVVDEEGVFGAHLVKELADREIW  341



>ref|XP_004241398.1| PREDICTED: histidine protein methyltransferase 1 homolog [Solanum 
lycopersicum]
 ref|XP_010322471.1| PREDICTED: histidine protein methyltransferase 1 homolog [Solanum 
lycopersicum]
 ref|XP_010322472.1| PREDICTED: histidine protein methyltransferase 1 homolog [Solanum 
lycopersicum]
Length=346

 Score =   230 bits (586),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G   ELPTVLSVVRND SE+P G S S SEED MDGCSSQDGSIL  ESS RRSRKL
Sbjct  188  FYAGEWEELPTVLSVVRNDISEVPTGKSLSLSEEDFMDGCSSQDGSILGLESSLRRSRKL  247

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERA+DAD GE GYDVIL+TE+PYSV SLKKLY LIKKCLRPPYGV+YLA KRNY
Sbjct  248  SGSRAWERANDADNGEGGYDVILLTELPYSVPSLKKLYGLIKKCLRPPYGVIYLAAKRNY  307

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            V FNSA RHLRS+VDEEGVFGAHLV EL DREIW
Sbjct  308  VSFNSATRHLRSVVDEEGVFGAHLVKELADREIW  341



>ref|XP_002534114.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28265.1| conserved hypothetical protein [Ricinus communis]
Length=350

 Score =   227 bits (579),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  ELPTVLS+VRNDA E   GMS SFSEED MDGCSSQDGSI+  E+SSRRSRKL
Sbjct  192  FYAGDWEELPTVLSIVRNDALEATPGMSLSFSEEDFMDGCSSQDGSIVGQETSSRRSRKL  251

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERA++ D GE GYDVILMT+IPYSV SLKKLY+LIKKCLRPPYGV+YLATKRNY
Sbjct  252  SGSRAWERANETDHGEGGYDVILMTDIPYSVTSLKKLYALIKKCLRPPYGVLYLATKRNY  311

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VGFN+ ARHL+SLVDEEG+FGAHLV E+ +R+IW
Sbjct  312  VGFNNGARHLKSLVDEEGIFGAHLVKEMAERDIW  345



>ref|XP_002310441.1| hypothetical protein POPTR_0007s02090g [Populus trichocarpa]
 gb|EEE90891.1| hypothetical protein POPTR_0007s02090g [Populus trichocarpa]
Length=351

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 129/155 (83%), Gaps = 1/155 (1%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G   ELPTVLSVVRND  E+  GMS SFSEED MDGCSS DGSI+  E+SSRR  + 
Sbjct  192  FYAGEWEELPTVLSVVRNDTFEVTTGMSLSFSEEDFMDGCSSLDGSIIGQETSSRRRSRK  251

Query  536  sg-sRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRN  360
               S+AWERAS+ D GE GYDVILMT+IPYS++SLKKLY+LIKKCLRPPYGV+YLATKRN
Sbjct  252  LSGSQAWERASETDHGEGGYDVILMTDIPYSISSLKKLYALIKKCLRPPYGVLYLATKRN  311

Query  359  YVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            YVGFN+ AR LRSLVDEEG+FGAHLV E+TDR++W
Sbjct  312  YVGFNNGARQLRSLVDEEGIFGAHLVKEMTDRDVW  346



>ref|XP_006372889.1| hypothetical protein POPTR_0017s06020g [Populus trichocarpa]
 gb|ERP50686.1| hypothetical protein POPTR_0017s06020g [Populus trichocarpa]
Length=356

 Score =   223 bits (567),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G   ELPTVLSVVR+D  E+  GMS SFSEED MDGCSSQDGSI+  E+SSRRSRKL
Sbjct  198  FYAGEWEELPTVLSVVRSDTFEVTTGMSLSFSEEDFMDGCSSQDGSIIGQETSSRRSRKL  257

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERAS+   GE GYDVILMT+IP+SV+SLKKLY+LIKKCLRPPYGV+YLATKRNY
Sbjct  258  SGSRAWERASETGHGEGGYDVILMTDIPHSVSSLKKLYALIKKCLRPPYGVLYLATKRNY  317

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VGF++ AR LRSLVDEEGVFGAHLV E+TDR++W
Sbjct  318  VGFSNGARQLRSLVDEEGVFGAHLVKEMTDRDVW  351



>ref|XP_011037077.1| PREDICTED: uncharacterized protein LOC105134384 [Populus euphratica]
Length=356

 Score =   223 bits (567),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G   ELPTVLS+VR+DA E+  GMS SFSEED MDGCSSQDGSI+  E+SSRRSRKL
Sbjct  198  FYAGEWEELPTVLSIVRSDAFEVTIGMSLSFSEEDFMDGCSSQDGSIIGQETSSRRSRKL  257

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERAS+   GE GYDVILMT+IP+SV+SLKKLY+LIKKCLRPPYGV+YLATKRNY
Sbjct  258  SGSRAWERASETGHGEGGYDVILMTDIPHSVSSLKKLYALIKKCLRPPYGVLYLATKRNY  317

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VGF++ AR LRSLVDEEG+FGAHLV E+TDR++W
Sbjct  318  VGFSNGARQLRSLVDEEGIFGAHLVKEMTDRDVW  351



>gb|KDP42809.1| hypothetical protein JCGZ_23751 [Jatropha curcas]
Length=350

 Score =   222 bits (566),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  ELPTVLS VRN+A E+  GMS SFSEED MDGCSSQDGSI+  E+SSRRSRKL
Sbjct  192  FYAGDWEELPTVLSTVRNEAFEVATGMSLSFSEEDFMDGCSSQDGSIIGQETSSRRSRKL  251

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERAS+ D GE GYDVILMT+IPYS+ SLKKLY+LIKKCLRPPYGV+Y ATKRNY
Sbjct  252  SGSRAWERASETDHGEGGYDVILMTDIPYSLTSLKKLYALIKKCLRPPYGVLYFATKRNY  311

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VGF++  RHL+ LVDEEG+FGAHLV E+T+R+IW
Sbjct  312  VGFSNGVRHLKGLVDEEGIFGAHLVKEMTERDIW  345



>emb|CAN69477.1| hypothetical protein VITISV_017347 [Vitis vinifera]
Length=328

 Score =   221 bits (564),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  ELPTVLS+VR + SE+P GM+ SFSEED MDGCSS DGS+  HE SSRRSRKL
Sbjct  170  FYAGDWEELPTVLSIVRTEGSEVPTGMNLSFSEEDFMDGCSSHDGSLTGHEFSSRRSRKL  229

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERAS+ D GE GYDVILMTEIPYSV SLKKLY+LIKKCLRPPYGV+YLATK+NY
Sbjct  230  SGSRAWERASEMDSGEGGYDVILMTEIPYSVTSLKKLYALIKKCLRPPYGVIYLATKKNY  289

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VGFN+ AR LR+LVDEEG FG HLV E++DR++W
Sbjct  290  VGFNNGARVLRNLVDEEGFFGVHLVKEMSDRDVW  323



>ref|XP_010097465.1| hypothetical protein L484_024670 [Morus notabilis]
 gb|EXB68656.1| hypothetical protein L484_024670 [Morus notabilis]
Length=350

 Score =   222 bits (565),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  ELPTVLSVVR +  E   GMS SFSEED MDGCSSQDGSIL  ESSSRRSRKL
Sbjct  192  FYAGDWEELPTVLSVVRGEGFEATTGMSLSFSEEDFMDGCSSQDGSILGQESSSRRSRKL  251

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERAS+ DQGE GYD+ILMT+IPYS+ SLKKLY+LIKKCLRPPYGV Y+ATK+NY
Sbjct  252  SGSRAWERASETDQGEGGYDIILMTDIPYSLTSLKKLYALIKKCLRPPYGVAYMATKKNY  311

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VGFNS ARHLRSLVDEE +FGAHLV E+ DR++W
Sbjct  312  VGFNSGARHLRSLVDEEAIFGAHLVKEMPDRDVW  345



>ref|XP_007223424.1| hypothetical protein PRUPE_ppa010155mg [Prunus persica]
 gb|EMJ24623.1| hypothetical protein PRUPE_ppa010155mg [Prunus persica]
Length=261

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 133/160 (83%), Gaps = 1/160 (1%)
 Frame = -2

Query  734  LLQQ*TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsss  555
            L Q   F  G+  ELPTVLS+VRND  E   GM  SFSEED MDGCSSQDGSIL  ESSS
Sbjct  98   LTQSVHFYAGDWEELPTVLSLVRNDGFEATTGMHLSFSEEDFMDGCSSQDGSILAQESSS  157

Query  554  rrsrklsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYL  375
            RRSRKLSGSRAWERAS+ +QG  GYD+ILMTEIPYS+ SLKK Y LIKKCLRPPYGV+YL
Sbjct  158  RRSRKLSGSRAWERASETEQG-GGYDIILMTEIPYSLTSLKKFYGLIKKCLRPPYGVLYL  216

Query  374  ATKRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            A K+NYVGFN AARHL+SLVDEEG+FGAHLV E++DR++W
Sbjct  217  AMKKNYVGFNGAARHLKSLVDEEGIFGAHLVKEMSDRDVW  256



>ref|XP_002264228.1| PREDICTED: histidine protein methyltransferase 1 homolog [Vitis 
vinifera]
 emb|CBI36649.3| unnamed protein product [Vitis vinifera]
Length=350

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  ELPTVLS+VR + SE+P GM+ SFSEED MDGCSS DGS+  HE SSRRSRKL
Sbjct  192  FYAGDWEELPTVLSIVRTEGSEVPTGMNLSFSEEDFMDGCSSHDGSLTGHEFSSRRSRKL  251

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERAS+ D GE GYDVILMTEIPYSV SLKKLY+LIKKCLRPPYGV+YLATK+NY
Sbjct  252  SGSRAWERASEMDSGEGGYDVILMTEIPYSVTSLKKLYALIKKCLRPPYGVIYLATKKNY  311

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VGFN+ AR LR+LVDEEG FG HLV E++DR++W
Sbjct  312  VGFNNGARVLRNLVDEEGFFGVHLVKEMSDRDVW  345



>ref|XP_011026390.1| PREDICTED: uncharacterized protein LOC105127016 [Populus euphratica]
 ref|XP_011026391.1| PREDICTED: uncharacterized protein LOC105127016 [Populus euphratica]
Length=349

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 129/155 (83%), Gaps = 1/155 (1%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G   ELPTVLSVVRND  E+  GMS SFSEED +DGCSS DGSI+  E+SSRR  + 
Sbjct  190  FYAGEWEELPTVLSVVRNDTFEVTTGMSLSFSEEDFLDGCSSLDGSIIGQETSSRRRSRK  249

Query  536  sg-sRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRN  360
               S+AWERAS+ D GE GYDVILMT+IPYS++SLKKLY+LIKKCLRPPYGV+YLATKRN
Sbjct  250  LSGSQAWERASETDHGEGGYDVILMTDIPYSLSSLKKLYALIKKCLRPPYGVLYLATKRN  309

Query  359  YVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            YVGFN+ AR LRSLVDEEG+FGAHLV E+TDR++W
Sbjct  310  YVGFNNGARQLRSLVDEEGIFGAHLVKEMTDRDVW  344



>ref|XP_004309612.1| PREDICTED: histidine protein methyltransferase 1 homolog [Fragaria 
vesca subsp. vesca]
 ref|XP_011470941.1| PREDICTED: histidine protein methyltransferase 1 homolog [Fragaria 
vesca subsp. vesca]
Length=349

 Score =   220 bits (561),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 132/154 (86%), Gaps = 1/154 (1%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  ELPTVLSVVRND  E+  GM+ SFSEED MDGCSSQDGSIL  ESS RRSRKL
Sbjct  192  FYAGDWEELPTVLSVVRNDGFEVTAGMNLSFSEEDFMDGCSSQDGSILGQESSPRRSRKL  251

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERAS+ +QG  GYD+ILMTEIPYS+ SLKKLY+LIKKC RPPYGV+YLATKRNY
Sbjct  252  SGSRAWERASETEQG-GGYDIILMTEIPYSLTSLKKLYTLIKKCSRPPYGVVYLATKRNY  310

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VGFN  ARHL+SLVDEEG+FGAHLV E+ DR++W
Sbjct  311  VGFNGGARHLKSLVDEEGIFGAHLVKEMADRDVW  344



>ref|XP_008222628.1| PREDICTED: uncharacterized protein LOC103322485 [Prunus mume]
 ref|XP_008222629.1| PREDICTED: uncharacterized protein LOC103322485 [Prunus mume]
 ref|XP_008222630.1| PREDICTED: uncharacterized protein LOC103322485 [Prunus mume]
Length=348

 Score =   220 bits (560),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = -2

Query  740  RLLLQQ*TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEs  561
            + L Q   F  G+  ELPTVLSVVRND  E   GM  SFSEED MDGCSSQDGSIL  ES
Sbjct  183  QTLTQSVHFYAGDWEELPTVLSVVRNDGFEATTGMHLSFSEEDFMDGCSSQDGSILAQES  242

Query  560  ssrrsrklsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVM  381
            SSRRSRKLSGSRAWERAS+ +QG  GYD+ILMTEIPYS+ SLKK Y LIKKCLRPPYGV+
Sbjct  243  SSRRSRKLSGSRAWERASETEQG-GGYDIILMTEIPYSLTSLKKFYGLIKKCLRPPYGVL  301

Query  380  YLATKRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            YLA K+NYVGFNS ARHL+SLVDEEG+FGAHLV E++DR++W
Sbjct  302  YLAMKKNYVGFNSGARHLKSLVDEEGIFGAHLVKEMSDRDVW  343



>ref|XP_009363653.1| PREDICTED: histidine protein methyltransferase 1 homolog [Pyrus 
x bretschneideri]
 ref|XP_009363654.1| PREDICTED: histidine protein methyltransferase 1 homolog [Pyrus 
x bretschneideri]
Length=348

 Score =   217 bits (553),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 135/154 (88%), Gaps = 2/154 (1%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  ELPTVLS+VRND SE   GM+ SFSEED MDGCSSQDGSIL  ESSSRRSRKL
Sbjct  192  FYAGDWEELPTVLSIVRND-SEASTGMNLSFSEEDFMDGCSSQDGSILARESSSRRSRKL  250

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERAS+ +QG  GYD+IL+TEIPYS+ SLKKLY+LIKKCLRPPYGV+YLATK+NY
Sbjct  251  SGSRAWERASETEQG-GGYDIILLTEIPYSLTSLKKLYALIKKCLRPPYGVLYLATKKNY  309

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VGFNS ARHLRSLVDEEG+FGAHLV E+ DR++W
Sbjct  310  VGFNSGARHLRSLVDEEGIFGAHLVKEMADRDVW  343



>ref|XP_007150422.1| hypothetical protein PHAVU_005G152300g [Phaseolus vulgaris]
 gb|ESW22416.1| hypothetical protein PHAVU_005G152300g [Phaseolus vulgaris]
Length=346

 Score =   217 bits (552),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 134/156 (86%), Gaps = 1/156 (1%)
 Frame = -2

Query  719  TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrk  540
             F  G+  ELPTVLS+V++D  E+  GMS SFSEED M+GCSSQDGSI+ HES SRRSRK
Sbjct  186  NFYAGDWEELPTVLSIVKSDGYEVMPGMSLSFSEEDFMEGCSSQDGSIIGHESYSRRSRK  245

Query  539  lsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLA-TKR  363
            LSGSRAWER S+ADQGE GYDVILMTEIPYS+ SLKKLY+LIKKCLRPPYGV+YLA TKR
Sbjct  246  LSGSRAWERGSEADQGEGGYDVILMTEIPYSITSLKKLYALIKKCLRPPYGVVYLAPTKR  305

Query  362  NYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            +YVGF++  R LRSL+DEEGVFGAHLV +L DR+IW
Sbjct  306  HYVGFSNGVRQLRSLIDEEGVFGAHLVKDLADRDIW  341



>ref|XP_008372076.1| PREDICTED: histidine protein methyltransferase 1 homolog [Malus 
domestica]
Length=348

 Score =   217 bits (552),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 134/154 (87%), Gaps = 2/154 (1%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  ELPTVLS+VRND  E   GM+ SFSEED MDGCSSQDGSIL  ESSSRRSRKL
Sbjct  192  FYAGDWEELPTVLSIVRNDG-EASTGMNLSFSEEDFMDGCSSQDGSILARESSSRRSRKL  250

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERAS+ +QG  GYD+IL+TEIPYS+ SLKKLY+LIKKCLRPPYGV+YLATKRNY
Sbjct  251  SGSRAWERASETEQG-GGYDIILLTEIPYSLTSLKKLYALIKKCLRPPYGVLYLATKRNY  309

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VGFNS ARHLRSLVDEEG+FGAHLV E+ DR++W
Sbjct  310  VGFNSGARHLRSLVDEEGIFGAHLVKEMADRDVW  343



>gb|KHN33316.1| Histidine protein methyltransferase 1 like [Glycine soja]
Length=346

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 133/156 (85%), Gaps = 1/156 (1%)
 Frame = -2

Query  719  TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrk  540
             F  G+  ELP+VLS+ ++D  E+  GMS SFSEED MDGCSSQDGSI+ HES SRRSRK
Sbjct  186  NFYAGDWEELPSVLSIAKSDGYEVMPGMSLSFSEEDFMDGCSSQDGSIIGHESHSRRSRK  245

Query  539  lsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLA-TKR  363
            LSGSRAWER S+ADQGE GYD+ILMTEIPYSV SLKKLY+LIKKCLRPPYGV+YLA TKR
Sbjct  246  LSGSRAWERGSEADQGEGGYDIILMTEIPYSVTSLKKLYALIKKCLRPPYGVVYLAPTKR  305

Query  362  NYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            +YVGF++  R LRSLVDEEG+FGAHLV +L DR++W
Sbjct  306  HYVGFSNGVRQLRSLVDEEGIFGAHLVKDLADRDVW  341



>ref|XP_006597006.1| PREDICTED: uncharacterized protein LOC100786056 isoform X1 [Glycine 
max]
 ref|XP_006597007.1| PREDICTED: uncharacterized protein LOC100786056 isoform X2 [Glycine 
max]
 ref|XP_006597008.1| PREDICTED: uncharacterized protein LOC100786056 isoform X3 [Glycine 
max]
 ref|XP_006597009.1| PREDICTED: uncharacterized protein LOC100786056 isoform X4 [Glycine 
max]
 ref|XP_006597010.1| PREDICTED: uncharacterized protein LOC100786056 isoform X5 [Glycine 
max]
 ref|XP_006597011.1| PREDICTED: uncharacterized protein LOC100786056 isoform X6 [Glycine 
max]
Length=346

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 133/156 (85%), Gaps = 1/156 (1%)
 Frame = -2

Query  719  TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrk  540
             F  G+  ELP+VLS+ ++D  E+  GMS SFSEED MDGCSSQDGSI+ HES SRRSRK
Sbjct  186  NFYAGDWEELPSVLSIAKSDGYEVMPGMSLSFSEEDFMDGCSSQDGSIIGHESHSRRSRK  245

Query  539  lsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLA-TKR  363
            LSGSRAWER S+ADQGE GYD+ILMTEIPYSV SLKKLY+LIKKCLRPPYGV+YLA TKR
Sbjct  246  LSGSRAWERGSEADQGEGGYDIILMTEIPYSVTSLKKLYALIKKCLRPPYGVVYLAPTKR  305

Query  362  NYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            +YVGF++  R LRSLVDEEG+FGAHLV +L DR++W
Sbjct  306  HYVGFSNGVRQLRSLVDEEGIFGAHLVKDLADRDVW  341



>ref|XP_009344374.1| PREDICTED: histidine protein methyltransferase 1 homolog [Pyrus 
x bretschneideri]
 ref|XP_009344375.1| PREDICTED: histidine protein methyltransferase 1 homolog [Pyrus 
x bretschneideri]
Length=348

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 133/154 (86%), Gaps = 2/154 (1%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  ELPTVLS+VRND  E   GM+ SFSEED MDGCSSQDGSIL  ESSSRRSRKL
Sbjct  192  FYAGDWEELPTVLSIVRNDG-EASTGMNLSFSEEDFMDGCSSQDGSILARESSSRRSRKL  250

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERAS+ +QG  GYD+IL+TEIPYS+ SLKKLY+LIKKCLRPPYGV+YLA K+NY
Sbjct  251  SGSRAWERASETEQG-GGYDIILLTEIPYSLTSLKKLYALIKKCLRPPYGVLYLAAKKNY  309

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VGFNS ARHLRSLVDEEG+FGAHLV E+ DR++W
Sbjct  310  VGFNSGARHLRSLVDEEGIFGAHLVKEMADRDVW  343



>ref|XP_003543558.1| PREDICTED: uncharacterized protein LOC100810964 isoform X1 [Glycine 
max]
 ref|XP_006595055.1| PREDICTED: uncharacterized protein LOC100810964 isoform X2 [Glycine 
max]
 ref|XP_006595056.1| PREDICTED: uncharacterized protein LOC100810964 isoform X3 [Glycine 
max]
Length=346

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 131/156 (84%), Gaps = 1/156 (1%)
 Frame = -2

Query  719  TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrk  540
             F  G+  ELP+VLS+V++D  E+  GMS SFSEED MDGCSSQDGSI+ HES SRRSRK
Sbjct  186  NFYAGDWEELPSVLSIVKSDGYEVMPGMSLSFSEEDFMDGCSSQDGSIIGHESYSRRSRK  245

Query  539  lsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLA-TKR  363
            LS SRAWER S+ADQGE GYDVILMTEI YSV SLKKLY+LIKKCLRPPYGV+YLA TKR
Sbjct  246  LSRSRAWERGSEADQGEGGYDVILMTEISYSVTSLKKLYALIKKCLRPPYGVLYLAPTKR  305

Query  362  NYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
             YVGF++  R LRSLVDEEG+FGAHLV +L DR+IW
Sbjct  306  PYVGFSNGVRQLRSLVDEEGIFGAHLVKDLADRDIW  341



>gb|KDO43480.1| hypothetical protein CISIN_1g018716mg [Citrus sinensis]
Length=269

 Score =   210 bits (534),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  ELPTVLSVVRND SE+  GMS SFSEED MDGCSSQDGSI+  +SSSRRSRKL
Sbjct  111  FYAGDWEELPTVLSVVRNDVSEVTTGMSLSFSEEDFMDGCSSQDGSIIGQDSSSRRSRKL  170

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERAS+ADQGE GYDVIL+TEIPYSV SLKKLY LIKKCLRPPYGV+YLATK+NY
Sbjct  171  SGSRAWERASEADQGEGGYDVILLTEIPYSVTSLKKLYLLIKKCLRPPYGVVYLATKKNY  230

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VGFN+AARHLRSLVDEEG+FGAHL+ E+TDR+IW
Sbjct  231  VGFNNAARHLRSLVDEEGIFGAHLIKEMTDRDIW  264



>gb|KHN30105.1| Histidine protein methyltransferase 1 like [Glycine soja]
Length=346

 Score =   212 bits (540),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 131/156 (84%), Gaps = 1/156 (1%)
 Frame = -2

Query  719  TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrk  540
             F  G+  ELP+VLS+V++D  E+  GMS SFSEED MDGCSSQDGSI+ HES SRRSRK
Sbjct  186  NFYAGDWEELPSVLSIVKSDGYEVMPGMSLSFSEEDFMDGCSSQDGSIIGHESYSRRSRK  245

Query  539  lsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLA-TKR  363
            LS SRAWER S+ADQGE GYDVILMTEI YSV SLKKLY+LIKKCLRPPYGV+YLA TKR
Sbjct  246  LSRSRAWERGSEADQGEGGYDVILMTEISYSVTSLKKLYALIKKCLRPPYGVVYLAPTKR  305

Query  362  NYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
             YVGF++  R LRSLVDEEG+FGAHLV +L DR+IW
Sbjct  306  PYVGFSNGVRQLRSLVDEEGIFGAHLVKDLADRDIW  341



>gb|KDO43477.1| hypothetical protein CISIN_1g018716mg [Citrus sinensis]
Length=330

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  ELPTVLSVVRND SE+  GMS SFSEED MDGCSSQDGSI+  +SSSRRSRKL
Sbjct  172  FYAGDWEELPTVLSVVRNDVSEVTTGMSLSFSEEDFMDGCSSQDGSIIGQDSSSRRSRKL  231

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERAS+ADQGE GYDVIL+TEIPYSV SLKKLY LIKKCLRPPYGV+YLATK+NY
Sbjct  232  SGSRAWERASEADQGEGGYDVILLTEIPYSVTSLKKLYLLIKKCLRPPYGVVYLATKKNY  291

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VGFN+AARHLRSLVDEEG+FGAHL+ E+TDR+IW
Sbjct  292  VGFNNAARHLRSLVDEEGIFGAHLIKEMTDRDIW  325



>ref|XP_006443065.1| hypothetical protein CICLE_v10020882mg [Citrus clementina]
 ref|XP_006443066.1| hypothetical protein CICLE_v10020882mg [Citrus clementina]
 ref|XP_006494175.1| PREDICTED: uncharacterized protein LOC102618219 isoform X1 [Citrus 
sinensis]
 ref|XP_006494176.1| PREDICTED: uncharacterized protein LOC102618219 isoform X2 [Citrus 
sinensis]
 ref|XP_006494177.1| PREDICTED: uncharacterized protein LOC102618219 isoform X3 [Citrus 
sinensis]
 ref|XP_006494178.1| PREDICTED: uncharacterized protein LOC102618219 isoform X4 [Citrus 
sinensis]
 gb|ESR56305.1| hypothetical protein CICLE_v10020882mg [Citrus clementina]
 gb|ESR56306.1| hypothetical protein CICLE_v10020882mg [Citrus clementina]
 gb|KDO43478.1| hypothetical protein CISIN_1g018716mg [Citrus sinensis]
 gb|KDO43479.1| hypothetical protein CISIN_1g018716mg [Citrus sinensis]
Length=351

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  ELPTVLSVVRND SE+  GMS SFSEED MDGCSSQDGSI+  +SSSRRSRKL
Sbjct  193  FYAGDWEELPTVLSVVRNDVSEVTTGMSLSFSEEDFMDGCSSQDGSIIGQDSSSRRSRKL  252

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERAS+ADQGE GYDVIL+TEIPYSV SLKKLY LIKKCLRPPYGV+YLATK+NY
Sbjct  253  SGSRAWERASEADQGEGGYDVILLTEIPYSVTSLKKLYLLIKKCLRPPYGVVYLATKKNY  312

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VGFN+AARHLRSLVDEEG+FGAHL+ E+TDR+IW
Sbjct  313  VGFNNAARHLRSLVDEEGIFGAHLIKEMTDRDIW  346



>ref|XP_010242753.1| PREDICTED: histidine protein methyltransferase 1 homolog [Nelumbo 
nucifera]
 ref|XP_010242754.1| PREDICTED: histidine protein methyltransferase 1 homolog [Nelumbo 
nucifera]
Length=351

 Score =   209 bits (532),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 128/154 (83%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  EL TVLSVV  +  E+  GMS SFSEED MDGCSSQDGSI+ HESSSRRSRKL
Sbjct  193  FYAGDWEELHTVLSVVLKEGFEMTAGMSLSFSEEDFMDGCSSQDGSIIGHESSSRRSRKL  252

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERAS+ D GE GYDVILM EIPYS+ASLKKLY+LIKKCLRPPYGVMYLA K+NY
Sbjct  253  SGSRAWERASETDSGEGGYDVILMAEIPYSIASLKKLYTLIKKCLRPPYGVMYLAVKKNY  312

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VG +  AR LR LVDEEG+FGAH+VTE+ D EIW
Sbjct  313  VGSSGGARQLRGLVDEEGIFGAHVVTEMADGEIW  346



>ref|XP_010671826.1| PREDICTED: uncharacterized protein LOC104888516 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010671827.1| PREDICTED: uncharacterized protein LOC104888516 [Beta vulgaris 
subsp. vulgaris]
Length=352

 Score =   209 bits (532),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 126/156 (81%), Gaps = 2/156 (1%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssr--rsr  543
            F  G+  ELPTVLSVVR D  E   G S  FSE+D  DGCSSQDGSI   E +++  RSR
Sbjct  192  FYAGDWEELPTVLSVVRPDVCEATPGFSLCFSEDDFNDGCSSQDGSITGQEPAAKPRRSR  251

Query  542  klsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKR  363
            KLSGSRAWERAS+AD GE GYDVILMTEIP SV SLKKLY+LIKKCLRPPYGV+YLATK+
Sbjct  252  KLSGSRAWERASEADHGEGGYDVILMTEIPCSVTSLKKLYALIKKCLRPPYGVLYLATKK  311

Query  362  NYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            NYVGFNS ARHLRS+VDEE +FG HLV E+ D+EIW
Sbjct  312  NYVGFNSGARHLRSIVDEESIFGVHLVNEIADKEIW  347



>ref|XP_010525954.1| PREDICTED: uncharacterized protein LOC104803653 [Tarenaya hassleriana]
Length=349

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 126/155 (81%), Gaps = 1/155 (1%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSIL-VHEsssrrsrk  540
            F  G+  ELPTVLS++R D SE   GMS SFSEED MDGCSSQDGS+   H+ S RRSRK
Sbjct  190  FYAGDWEELPTVLSIIRKDVSEPTTGMSLSFSEEDFMDGCSSQDGSVTGQHDFSFRRSRK  249

Query  539  lsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRN  360
            LSGSRAWERAS+ +QGE GYDVILMT IPYSV SLKKLY+LIKKC+RPPYGV+YLA K+ 
Sbjct  250  LSGSRAWERASETEQGECGYDVILMTVIPYSVTSLKKLYALIKKCVRPPYGVVYLAMKKQ  309

Query  359  YVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            YVGFN   RHLR+LV+EE +FGAHLV E  DR+IW
Sbjct  310  YVGFNCGGRHLRNLVEEEAIFGAHLVKETADRDIW  344



>ref|XP_010520847.1| PREDICTED: uncharacterized protein LOC104799618 [Tarenaya hassleriana]
Length=349

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 129/155 (83%), Gaps = 1/155 (1%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSIL-VHEsssrrsrk  540
            F  G+  ELPTVLS+VRND SE    M+ SFSEED MDGCSSQDGS +   + SSRRSRK
Sbjct  190  FYAGDWEELPTVLSIVRNDVSEPTTVMNLSFSEEDFMDGCSSQDGSAIGQQDFSSRRSRK  249

Query  539  lsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRN  360
            LSGSRAW RA++ DQGE GYD+ILMT+IPYSV SLKKLY+LIKKC+RPPYGV+YL+TK++
Sbjct  250  LSGSRAWARANETDQGECGYDIILMTDIPYSVTSLKKLYALIKKCVRPPYGVVYLSTKKH  309

Query  359  YVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            YVGFN  ARHLR+LVDEE +FGAHLV E  DR+IW
Sbjct  310  YVGFNCGARHLRNLVDEEAIFGAHLVKETADRDIW  344



>ref|XP_006397494.1| hypothetical protein EUTSA_v10001523mg [Eutrema salsugineum]
 gb|ESQ38947.1| hypothetical protein EUTSA_v10001523mg [Eutrema salsugineum]
Length=351

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 126/157 (80%), Gaps = 3/157 (2%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPR-GMSXSFSEEDLMDGCSSQDGSIL-VHEsssrrsr  543
            F  G   ELPTVLS++R D  E    GMS SFSEED MDGCSSQDGSI    E SSRRSR
Sbjct  190  FYAGEWEELPTVLSIIRTDVLEPANPGMSLSFSEEDFMDGCSSQDGSITGQQEFSSRRSR  249

Query  542  klsgsRAWERASDADQG-ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATK  366
            KLS SRAWERA++ DQG E GYDV+LMTEIPYS+ SLKKLYSLIKKCLRPPYGV+YLA K
Sbjct  250  KLSVSRAWERANETDQGGECGYDVMLMTEIPYSITSLKKLYSLIKKCLRPPYGVVYLAAK  309

Query  365  RNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            + YVGFNS ARHLR+LVDEE + GAHL+ E TDR+IW
Sbjct  310  KQYVGFNSGARHLRNLVDEETILGAHLIKETTDRDIW  346



>ref|XP_003597494.1| hypothetical protein MTR_2g098630 [Medicago truncatula]
Length=215

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 130/156 (83%), Gaps = 1/156 (1%)
 Frame = -2

Query  719  TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrk  540
             F  G+  ELP VLS V+ND  E   GMS SFSEED +D  SSQDGSI+ HESSSRRSRK
Sbjct  55   NFYAGDWEELPAVLSTVKNDGYEATPGMSLSFSEEDFLDVGSSQDGSIIGHESSSRRSRK  114

Query  539  lsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLA-TKR  363
            LSGSRAWERA++ADQG+ GYDVILMTEIPYSV SLKKLY+LIKKC+RPPYGV+YLA TK+
Sbjct  115  LSGSRAWERANEADQGDGGYDVILMTEIPYSVNSLKKLYALIKKCIRPPYGVVYLAPTKK  174

Query  362  NYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            +YVGF++  R LR+++DEEG+FG HLV +L DR+IW
Sbjct  175  HYVGFSNGVRQLRNVLDEEGIFGVHLVKDLADRDIW  210



>ref|XP_010930203.1| PREDICTED: histidine protein methyltransferase 1 homolog [Elaeis 
guineensis]
 ref|XP_010930204.1| PREDICTED: histidine protein methyltransferase 1 homolog [Elaeis 
guineensis]
Length=350

 Score =   202 bits (513),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  EL TVLSVV+ D  E   G S SFSE+D MDGCSSQDGSI  H+ SSRRSRKL
Sbjct  192  FYAGDWEELHTVLSVVQMDGFEPAPGTSLSFSEDDFMDGCSSQDGSITGHDPSSRRSRKL  251

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERA++ D G+ GYD+IL+TEIPYSV+SL+KLY+LI KCLRPPYGV+YLA K+N+
Sbjct  252  SGSRAWERANETDTGDGGYDIILITEIPYSVSSLRKLYALIAKCLRPPYGVLYLAAKKNF  311

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VG N  AR LR+LVDEEG+FGAH+VTEL DREIW
Sbjct  312  VGSNGGARQLRALVDEEGIFGAHMVTELADREIW  345



>ref|XP_004486926.1| PREDICTED: uncharacterized protein LOC101511699 isoform X1 [Cicer 
arietinum]
 ref|XP_004486927.1| PREDICTED: uncharacterized protein LOC101511699 isoform X2 [Cicer 
arietinum]
Length=346

 Score =   201 bits (512),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 128/156 (82%), Gaps = 1/156 (1%)
 Frame = -2

Query  719  TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrk  540
             F  G+  ELP VLS V+ND  E+  GMS SFSEED +DGCSSQDGSI+ HESSSRR RK
Sbjct  186  NFYAGDWEELPAVLSTVKNDGYEVTPGMSLSFSEEDFLDGCSSQDGSIIGHESSSRRFRK  245

Query  539  lsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLA-TKR  363
            LSGSRAWERA+ A+Q + GYDVILM EIP SV SLKKLY+LIKKCLRPPYGV+YLA TK+
Sbjct  246  LSGSRAWERANQANQVDGGYDVILMAEIPDSVTSLKKLYALIKKCLRPPYGVVYLAPTKK  305

Query  362  NYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            +YVGF++  R LR+LVDEEG+FG HLV +L DR+IW
Sbjct  306  HYVGFSNGVRQLRNLVDEEGIFGVHLVKDLNDRDIW  341



>ref|XP_008799945.1| PREDICTED: histidine protein methyltransferase 1 homolog [Phoenix 
dactylifera]
 ref|XP_008799953.1| PREDICTED: histidine protein methyltransferase 1 homolog [Phoenix 
dactylifera]
Length=350

 Score =   201 bits (512),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  EL TVLSVV+ D  E+  G S SFSE+D MDGCSSQDGSI  HE SSRRSRKL
Sbjct  192  FYAGDWEELHTVLSVVQMDGFELAPGTSLSFSEDDFMDGCSSQDGSITGHEPSSRRSRKL  251

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERA++ D  + GYD+IL+TEIPYSV+SLKKLY+LI KCLRPPYGV+YLA K+N+
Sbjct  252  SGSRAWERANETDARDGGYDIILITEIPYSVSSLKKLYALITKCLRPPYGVLYLAAKKNF  311

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VG N  AR LR++VDEEG+FGAH+VTEL DREIW
Sbjct  312  VGSNGGARQLRAMVDEEGIFGAHVVTELADREIW  345



>gb|AES67745.2| histidine methyltransferase-like protein [Medicago truncatula]
Length=256

 Score =   198 bits (504),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 130/156 (83%), Gaps = 1/156 (1%)
 Frame = -2

Query  719  TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrk  540
             F  G+  ELP VLS V+ND  E   GMS SFSEED +D  SSQDGSI+ HESSSRRSRK
Sbjct  96   NFYAGDWEELPAVLSTVKNDGYEATPGMSLSFSEEDFLDVGSSQDGSIIGHESSSRRSRK  155

Query  539  lsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLA-TKR  363
            LSGSRAWERA++ADQG+ GYDVILMTEIPYSV SLKKLY+LIKKC+RPPYGV+YLA TK+
Sbjct  156  LSGSRAWERANEADQGDGGYDVILMTEIPYSVNSLKKLYALIKKCIRPPYGVVYLAPTKK  215

Query  362  NYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            +YVGF++  R LR+++DEEG+FG HLV +L DR+IW
Sbjct  216  HYVGFSNGVRQLRNVLDEEGIFGVHLVKDLADRDIW  251



>ref|XP_009133591.1| PREDICTED: histidine protein methyltransferase 1-like [Brassica 
rapa]
 ref|XP_009133592.1| PREDICTED: histidine protein methyltransferase 1-like [Brassica 
rapa]
 emb|CDY69980.1| BnaA03g56760D [Brassica napus]
Length=351

 Score =   201 bits (511),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 129/157 (82%), Gaps = 3/157 (2%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASE-IPRGMSXSFSEEDLMDGCSSQDGSILVH-Esssrrsr  543
            F  G   ELPTVLS++R D  E + +GM+ SFSEED MDGCSSQ+GSI    + SSRRSR
Sbjct  190  FFAGEWEELPTVLSIIRTDVVEPVNQGMNLSFSEEDFMDGCSSQEGSITGQPDFSSRRSR  249

Query  542  klsgsRAWERASDADQG-ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATK  366
            KLSGSRAWERA++ +QG E GYDVILMTEIPYSV SLKKLYSLIKKCLRPPYGV+YLA K
Sbjct  250  KLSGSRAWERANETEQGGECGYDVILMTEIPYSVTSLKKLYSLIKKCLRPPYGVVYLAAK  309

Query  365  RNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            + YVGFNS ARHLR+LVDEE + GAHL+ E TDR++W
Sbjct  310  KQYVGFNSGARHLRNLVDEETILGAHLIKETTDRDVW  346



>emb|CDY44218.1| BnaC03g24100D [Brassica napus]
Length=351

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 129/157 (82%), Gaps = 3/157 (2%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASE-IPRGMSXSFSEEDLMDGCSSQDGSILVH-Esssrrsr  543
            F  G   ELPTVLS++R D  E + +GM+ SFSEED MDGCSSQ+GSI    + SSRRSR
Sbjct  190  FYAGEWEELPTVLSIIRTDVLEPVNQGMNLSFSEEDFMDGCSSQEGSITGQPDFSSRRSR  249

Query  542  klsgsRAWERASDADQG-ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATK  366
            KLSGSRAWERA++ +QG E GYDVILMTEIPYSV SLKKLYSLIKKCLRPPYGV+YLA K
Sbjct  250  KLSGSRAWERANETEQGGECGYDVILMTEIPYSVTSLKKLYSLIKKCLRPPYGVVYLAAK  309

Query  365  RNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            + YVGFNS ARHLR+LVDEE + GAHL+ E TDR++W
Sbjct  310  KQYVGFNSGARHLRNLVDEETILGAHLIKETTDRDVW  346



>ref|XP_009416014.1| PREDICTED: histidine protein methyltransferase 1 homolog [Musa 
acuminata subsp. malaccensis]
 ref|XP_009416015.1| PREDICTED: histidine protein methyltransferase 1 homolog [Musa 
acuminata subsp. malaccensis]
Length=351

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  ELPTVLSVVR D  E+ +G S SFSE+D +D CSSQ+GS++ HE+ SRRSRKL
Sbjct  193  FYAGDWEELPTVLSVVRVDDFELAQGASLSFSEDDYLDACSSQEGSVIAHETCSRRSRKL  252

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERAS+ D G+ GYDVIL+TEIP+SV SLKKLY+LI KCLRPPYGV+YLA K+++
Sbjct  253  SGSRAWERASETDPGDGGYDVILVTEIPHSVNSLKKLYALITKCLRPPYGVLYLAVKKSF  312

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            +G N  AR LR++VDEEG+FG H+VTE++DREIW
Sbjct  313  IGSNGVARQLRAMVDEEGIFGIHVVTEVSDREIW  346



>emb|CDY23358.1| BnaC04g48860D [Brassica napus]
Length=350

 Score =   199 bits (506),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 126/157 (80%), Gaps = 4/157 (3%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEs--ssrrsr  543
            F  G   ELPTVLS++R D  E P  MS SFSEED  DGCSSQDGS+   +    SRRSR
Sbjct  190  FYAGEWEELPTVLSIIRTDVFE-PAAMSLSFSEEDFNDGCSSQDGSVTGQQQDFFSRRSR  248

Query  542  klsgsRAWERASDADQG-ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATK  366
            KLSGSRAWERA+++DQG E GYDVILMTEIPYSV SLKKLYSLIKKCLRPPYGV+YLA K
Sbjct  249  KLSGSRAWERANESDQGGECGYDVILMTEIPYSVTSLKKLYSLIKKCLRPPYGVVYLAAK  308

Query  365  RNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            + YVGF++ ARHLRSLVDEE + GAHL+ E TDR++W
Sbjct  309  KQYVGFSNGARHLRSLVDEETILGAHLIKETTDRDVW  345



>ref|XP_003597492.1| hypothetical protein MTR_2g098630 [Medicago truncatula]
 gb|AES67743.1| histidine methyltransferase-like protein [Medicago truncatula]
Length=346

 Score =   198 bits (504),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 130/156 (83%), Gaps = 1/156 (1%)
 Frame = -2

Query  719  TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrk  540
             F  G+  ELP VLS V+ND  E   GMS SFSEED +D  SSQDGSI+ HESSSRRSRK
Sbjct  186  NFYAGDWEELPAVLSTVKNDGYEATPGMSLSFSEEDFLDVGSSQDGSIIGHESSSRRSRK  245

Query  539  lsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLA-TKR  363
            LSGSRAWERA++ADQG+ GYDVILMTEIPYSV SLKKLY+LIKKC+RPPYGV+YLA TK+
Sbjct  246  LSGSRAWERANEADQGDGGYDVILMTEIPYSVNSLKKLYALIKKCIRPPYGVVYLAPTKK  305

Query  362  NYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            +YVGF++  R LR+++DEEG+FG HLV +L DR+IW
Sbjct  306  HYVGFSNGVRQLRNVLDEEGIFGVHLVKDLADRDIW  341



>ref|XP_009142187.1| PREDICTED: uncharacterized protein LOC103866064 [Brassica rapa]
Length=351

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 126/158 (80%), Gaps = 5/158 (3%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEss---srrs  546
            F  G   ELPTVLS++R D  E P  MS SFSEED  DGCSSQDGSI   +     SRRS
Sbjct  190  FYAGEWEELPTVLSIIRTDVFE-PAAMSLSFSEEDFNDGCSSQDGSITGQQQQDFFSRRS  248

Query  545  rklsgsRAWERASDADQG-ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLAT  369
            RKLSGSRAWERA+++DQG E GYDVILMTEIPYSV SLKKLYSLIKKCLRPPYGV+YLA 
Sbjct  249  RKLSGSRAWERANESDQGGECGYDVILMTEIPYSVTSLKKLYSLIKKCLRPPYGVVYLAA  308

Query  368  KRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            K+ YVGF++ ARHLR+LVDEE + GAHL+ E TDR++W
Sbjct  309  KKQYVGFSNGARHLRNLVDEETILGAHLIKETTDRDVW  346



>ref|XP_003597493.1| hypothetical protein MTR_2g098630 [Medicago truncatula]
 gb|AES67744.1| histidine methyltransferase-like protein [Medicago truncatula]
Length=362

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 130/156 (83%), Gaps = 1/156 (1%)
 Frame = -2

Query  719  TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrk  540
             F  G+  ELP VLS V+ND  E   GMS SFSEED +D  SSQDGSI+ HESSSRRSRK
Sbjct  202  NFYAGDWEELPAVLSTVKNDGYEATPGMSLSFSEEDFLDVGSSQDGSIIGHESSSRRSRK  261

Query  539  lsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLA-TKR  363
            LSGSRAWERA++ADQG+ GYDVILMTEIPYSV SLKKLY+LIKKC+RPPYGV+YLA TK+
Sbjct  262  LSGSRAWERANEADQGDGGYDVILMTEIPYSVNSLKKLYALIKKCIRPPYGVVYLAPTKK  321

Query  362  NYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            +YVGF++  R LR+++DEEG+FG HLV +L DR+IW
Sbjct  322  HYVGFSNGVRQLRNVLDEEGIFGVHLVKDLADRDIW  357



>ref|XP_002881896.1| hypothetical protein ARALYDRAFT_483439 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58155.1| hypothetical protein ARALYDRAFT_483439 [Arabidopsis lyrata subsp. 
lyrata]
Length=361

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 127/158 (80%), Gaps = 5/158 (3%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASE--IPRGMSXSFSEEDLMDGCSSQDGSIL-VHEsssrrs  546
            F  G   EL TVLS++R D  E  IP  M+ SFSEED MDGCSSQDGSI    + SSRRS
Sbjct  200  FYAGEWEELSTVLSIIRTDVFEPAIPT-MNLSFSEEDFMDGCSSQDGSIAGQQDFSSRRS  258

Query  545  rklsgsRAWERASDADQG-ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLAT  369
            RKLSGSRAWERA++ DQG E GYDVILMTEIPYSV SLKKLYSLIKKCLRPPYGVMYLA 
Sbjct  259  RKLSGSRAWERANETDQGGECGYDVILMTEIPYSVTSLKKLYSLIKKCLRPPYGVMYLAG  318

Query  368  KRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            K+ YVGFNS A+HLR+LVDEE + GAHLV E TDR+IW
Sbjct  319  KKQYVGFNSGAKHLRNLVDEETILGAHLVKETTDRDIW  356



>ref|NP_001242428.1| uncharacterized protein LOC100786056 [Glycine max]
 gb|ACU18508.1| unknown [Glycine max]
Length=330

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 124/145 (86%), Gaps = 1/145 (1%)
 Frame = -2

Query  719  TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrk  540
             F  G+  ELP+VLS+ ++D  E+  GMS SFSEED MDGCSSQDGSI+ HES SRRSRK
Sbjct  186  NFYAGDWEELPSVLSIAKSDGYEVMPGMSLSFSEEDFMDGCSSQDGSIIGHESHSRRSRK  245

Query  539  lsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLA-TKR  363
            LSGSRAWER S+ADQGE GYD+ILMTEIPYSV SLKKLY+LIKKCLRPPYGV++LA TKR
Sbjct  246  LSGSRAWERGSEADQGEGGYDIILMTEIPYSVTSLKKLYALIKKCLRPPYGVVHLAPTKR  305

Query  362  NYVGFNSAARHLRSLVDEEGVFGAH  288
            +YVGF++  R LRSLVDEEG+FGAH
Sbjct  306  HYVGFSNGVRQLRSLVDEEGIFGAH  330



>ref|XP_008798999.1| PREDICTED: histidine protein methyltransferase 1 homolog [Phoenix 
dactylifera]
 ref|XP_008799000.1| PREDICTED: histidine protein methyltransferase 1 homolog [Phoenix 
dactylifera]
Length=364

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  EL TVLSVV+ D  E+  G+   FSE+D MDGCSSQDGSI+ HE+SSRRSRKL
Sbjct  192  FYAGDWEELHTVLSVVQGDGFELAPGLGLGFSEDDFMDGCSSQDGSIIGHETSSRRSRKL  251

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERA++ D G+ GYD+IL+TEIPYS +SL+KLY+LIKKCLRPPYGV+YLA K+NY
Sbjct  252  SGSRAWERANETDPGDGGYDIILITEIPYSTSSLRKLYALIKKCLRPPYGVLYLAAKKNY  311

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            +G N  AR L++LVDEEG FG H+V EL+DREIW
Sbjct  312  IGSNGGARQLKALVDEEGNFGIHVVAELSDREIW  345



>ref|XP_008791776.1| PREDICTED: histidine protein methyltransferase 1 homolog [Phoenix 
dactylifera]
 ref|XP_008791777.1| PREDICTED: histidine protein methyltransferase 1 homolog [Phoenix 
dactylifera]
 ref|XP_008791778.1| PREDICTED: histidine protein methyltransferase 1 homolog [Phoenix 
dactylifera]
Length=350

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  EL TVLSV+  D  E+  G + SFSE+D MDGCSSQDGSI  HE SSRRSRKL
Sbjct  192  FYAGDWEELHTVLSVMHMDGFELAPGANLSFSEDDFMDGCSSQDGSITGHEPSSRRSRKL  251

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERA++ + G+ GYD+IL+TEIPYSV+S++KLY+LI KCLRPPYGV+Y+A K+N+
Sbjct  252  SGSRAWERANETNTGDGGYDIILITEIPYSVSSVRKLYALITKCLRPPYGVLYVAAKKNF  311

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VG N  AR LR+LVDEEGVFGAH+VTEL DREIW
Sbjct  312  VGSNGGARQLRALVDEEGVFGAHVVTELADREIW  345



>ref|XP_006294500.1| hypothetical protein CARUB_v10023531mg [Capsella rubella]
 gb|EOA27398.1| hypothetical protein CARUB_v10023531mg [Capsella rubella]
Length=351

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 126/158 (80%), Gaps = 5/158 (3%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASE--IPRGMSXSFSEEDLMDGCSSQDGSIL-VHEsssrrs  546
            F  G   EL TVLS++R D  E  IP   + SFSEED MDGCSSQDGSI    + SSRRS
Sbjct  190  FYAGEWEELSTVLSIIRTDVLEPAIP-ATNLSFSEEDFMDGCSSQDGSITGQQDFSSRRS  248

Query  545  rklsgsRAWERASDADQG-ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLAT  369
            RKLSGSRAWERA++ +QG E GYDVILMTEIPYSV SLKKLYSLIKKCLRPPYGVMYLA 
Sbjct  249  RKLSGSRAWERANETEQGGECGYDVILMTEIPYSVTSLKKLYSLIKKCLRPPYGVMYLAA  308

Query  368  KRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            K+ YVGFNS ARHLR+LVDEE + GAHLV E TDR+IW
Sbjct  309  KKQYVGFNSGARHLRNLVDEETILGAHLVKETTDRDIW  346



>ref|XP_010517889.1| PREDICTED: histidine protein methyltransferase 1 homolog [Camelina 
sativa]
Length=353

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 126/158 (80%), Gaps = 5/158 (3%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASE--IPRGMSXSFSEEDLMDGCSSQDGSILVH-Esssrrs  546
            F  G   EL TVLS++R D  E  IP  M+ SFSEED MDGCSSQDGSI    + SSR+S
Sbjct  192  FYAGEWEELSTVLSIIRTDVLEPAIP-AMNLSFSEEDFMDGCSSQDGSITGQPDLSSRQS  250

Query  545  rklsgsRAWERASDADQG-ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLAT  369
            RKLSGSRAWERA++ DQG E GYDVILMTEIPYSV SLKKLYSLIKKCLRPPYGVMYLA 
Sbjct  251  RKLSGSRAWERANETDQGGECGYDVILMTEIPYSVTSLKKLYSLIKKCLRPPYGVMYLAA  310

Query  368  KRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            K+ YVGF+S  RHLR+LVDEE + GAHLV E TDR+IW
Sbjct  311  KKQYVGFSSGTRHLRNLVDEETILGAHLVKETTDRDIW  348



>ref|XP_010508446.1| PREDICTED: histidine protein methyltransferase 1 homolog [Camelina 
sativa]
Length=353

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 126/158 (80%), Gaps = 5/158 (3%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASE--IPRGMSXSFSEEDLMDGCSSQDGSILVH-Esssrrs  546
            F  G   EL TVLS++R D  E  IP  ++ SFSEED MDGCSSQDGSI    + SSR+S
Sbjct  192  FYAGEWEELSTVLSIIRTDVLEPAIP-ALNLSFSEEDFMDGCSSQDGSITGQPDLSSRQS  250

Query  545  rklsgsRAWERASDADQG-ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLAT  369
            RKLSGSRAWERA++ DQG E GYDVILMTEIPYSV SLKKLYSLIKKCLRPPYGVMYLA 
Sbjct  251  RKLSGSRAWERANETDQGGECGYDVILMTEIPYSVTSLKKLYSLIKKCLRPPYGVMYLAA  310

Query  368  KRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            K+ YVGF+S  RHLR+LVDEE + GAHLV E TDR+IW
Sbjct  311  KKQYVGFSSGTRHLRNLVDEETILGAHLVKETTDRDIW  348



>ref|XP_010506201.1| PREDICTED: histidine protein methyltransferase 1 homolog [Camelina 
sativa]
Length=353

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 126/158 (80%), Gaps = 5/158 (3%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASE--IPRGMSXSFSEEDLMDGCSSQDGSILVH-Esssrrs  546
            F  G   EL TVLS++R D  E  IP  ++ SFSEED MDGCSSQDGSI    + SSR+S
Sbjct  192  FYAGEWEELSTVLSIIRTDVLEPAIP-ALNLSFSEEDFMDGCSSQDGSITGQPDLSSRQS  250

Query  545  rklsgsRAWERASDADQG-ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLAT  369
            RKLSGSRAWERA++ DQG E GYDVILMTEIPYS+ SLKKLYSLIKKCLRPPYGVMYLA 
Sbjct  251  RKLSGSRAWERANETDQGGECGYDVILMTEIPYSITSLKKLYSLIKKCLRPPYGVMYLAA  310

Query  368  KRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            K+ YVGF+S  RHLR+LVDEE + GAHLV E TDR+IW
Sbjct  311  KKQYVGFSSGTRHLRNLVDEETILGAHLVKETTDRDIW  348



>gb|AAL16294.1|AF428364_1 At2g43320/T1O24.6 [Arabidopsis thaliana]
Length=351

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 126/158 (80%), Gaps = 5/158 (3%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASE--IPRGMSXSFSEEDLMDGCSSQDGSILVH-Esssrrs  546
            F  G   EL TVLS++R D  E  IP  M+ SFSEED MDGCSSQDGSI    + SSRRS
Sbjct  190  FYAGEWEELSTVLSIIRTDVLEPSIP-AMNLSFSEEDFMDGCSSQDGSITGQPDFSSRRS  248

Query  545  rklsgsRAWERASDADQ-GESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLAT  369
            RKLSGSRAWERA++  Q GE GYDVILMTEIPYS+ SLKKLYSLIKKCLRPPYGVMYLA 
Sbjct  249  RKLSGSRAWERANETGQEGEYGYDVILMTEIPYSITSLKKLYSLIKKCLRPPYGVMYLAA  308

Query  368  KRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            K+ YVGFNS A+HLR+LVDEE + GAHLV E TDR+IW
Sbjct  309  KKQYVGFNSGAKHLRNLVDEETILGAHLVKETTDRDIW  346



>ref|NP_565997.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
 ref|NP_001078045.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
 gb|AAK62628.1| At2g43320/T1O24.6 [Arabidopsis thaliana]
 gb|AAB64311.2| expressed protein [Arabidopsis thaliana]
 gb|AAM14937.1| expressed protein [Arabidopsis thaliana]
 gb|AAM91070.1| At2g43320/T1O24.6 [Arabidopsis thaliana]
 gb|AEC10250.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
 gb|AEC10251.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
Length=351

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 126/158 (80%), Gaps = 5/158 (3%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASE--IPRGMSXSFSEEDLMDGCSSQDGSILVH-Esssrrs  546
            F  G   EL TVLS++R D  E  IP  M+ SFSEED MDGCSSQDGSI    + SSRRS
Sbjct  190  FYAGEWEELSTVLSIIRTDVLEPSIP-AMNLSFSEEDFMDGCSSQDGSITGQPDFSSRRS  248

Query  545  rklsgsRAWERASDADQ-GESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLAT  369
            RKLSGSRAWERA++  Q GE GYDVILMTEIPYS+ SLKKLYSLIKKCLRPPYGVMYLA 
Sbjct  249  RKLSGSRAWERANETGQEGEYGYDVILMTEIPYSITSLKKLYSLIKKCLRPPYGVMYLAA  308

Query  368  KRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            K+ YVGFNS A+HLR+LVDEE + GAHLV E TDR+IW
Sbjct  309  KKQYVGFNSGAKHLRNLVDEETILGAHLVKETTDRDIW  346



>emb|CDY30401.1| BnaA04g25020D [Brassica napus]
Length=351

 Score =   193 bits (491),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 123/158 (78%), Gaps = 5/158 (3%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEss---srrs  546
            F  G   ELP VLS++R D  E P  MS SFSEED  DGCSSQDGS+   +     SRRS
Sbjct  190  FYAGEWEELPAVLSIIRTDVFE-PAAMSLSFSEEDFNDGCSSQDGSVTGQQQQDFFSRRS  248

Query  545  rklsgsRAWERASDADQG-ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLAT  369
            RKLSGSRAWERA+ +DQG E GYDVILMTEIPYSV SLKKLYSLIKKCLRPPYGV+YLA 
Sbjct  249  RKLSGSRAWERANGSDQGGECGYDVILMTEIPYSVTSLKKLYSLIKKCLRPPYGVVYLAA  308

Query  368  KRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            K+ YVGF++ ARHLR+LVDEE + GAH + E TDR++W
Sbjct  309  KKQYVGFSNGARHLRNLVDEETILGAHFIKETTDRDVW  346



>ref|XP_010907676.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Elaeis guineensis]
Length=350

 Score =   189 bits (480),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  EL TVLSVV+ D  E+  GM   FSE+D M+GCSSQDGSI+ HE+SSRRSRKL
Sbjct  192  FYAGDWEELHTVLSVVQGDGFELAPGMGLGFSEDDFMEGCSSQDGSIIGHETSSRRSRKL  251

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERA++ D G+ GYD+IL+T+IPYS +SL+KLY+LIK+CLRPPYGV+YLA K+NY
Sbjct  252  SGSRAWERANETDPGDGGYDIILITDIPYSASSLRKLYALIKRCLRPPYGVLYLAAKKNY  311

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            +G +  AR L++LVDEEG FG H+V E ++REIW
Sbjct  312  IGSSGGARQLKALVDEEGDFGIHVVAEPSEREIW  345



>ref|XP_010907675.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Elaeis guineensis]
Length=355

 Score =   189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  EL TVLSVV+ D  E+  GM   FSE+D M+GCSSQDGSI+ HE+SSRRSRKL
Sbjct  197  FYAGDWEELHTVLSVVQGDGFELAPGMGLGFSEDDFMEGCSSQDGSIIGHETSSRRSRKL  256

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERA++ D G+ GYD+IL+T+IPYS +SL+KLY+LIK+CLRPPYGV+YLA K+NY
Sbjct  257  SGSRAWERANETDPGDGGYDIILITDIPYSASSLRKLYALIKRCLRPPYGVLYLAAKKNY  316

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            +G +  AR L++LVDEEG FG H+V E ++REIW
Sbjct  317  IGSSGGARQLKALVDEEGDFGIHVVAEPSEREIW  350



>ref|XP_010912793.1| PREDICTED: uncharacterized protein LOC105038627 [Elaeis guineensis]
Length=350

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 122/154 (79%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  EL  VLSV++ D  E+  G S SFSE+D +DGCSSQDGSI  H  S+RRSRKL
Sbjct  192  FYAGDWEELHMVLSVMQMDGFELAPGTSLSFSEDDFIDGCSSQDGSIACHGPSTRRSRKL  251

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERA +   G  GYD+IL+TEIPYS++SL+KLY+LI KCLRPPYGV+Y+A K+N+
Sbjct  252  SGSRAWERADETGTGNGGYDIILITEIPYSLSSLRKLYALITKCLRPPYGVLYVAAKKNF  311

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VG N+ AR LR+LVDEE VFGAH+VTEL D EIW
Sbjct  312  VGSNAGARQLRALVDEEAVFGAHVVTELADGEIW  345



>ref|XP_010043656.1| PREDICTED: uncharacterized protein LOC104432789 [Eucalyptus grandis]
 ref|XP_010043732.1| PREDICTED: uncharacterized protein LOC104432789 [Eucalyptus grandis]
 ref|XP_010043813.1| PREDICTED: uncharacterized protein LOC104432789 [Eucalyptus grandis]
 ref|XP_010059221.1| PREDICTED: uncharacterized protein LOC104447112 [Eucalyptus grandis]
 gb|KCW87686.1| hypothetical protein EUGRSUZ_A00073 [Eucalyptus grandis]
 gb|KCW87874.1| hypothetical protein EUGRSUZ_A00269 [Eucalyptus grandis]
Length=350

 Score =   186 bits (473),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  EL TVLSVVR++ SE   GM  SFSEED MDGCSSQ+GSI+  E +SRRSRKL
Sbjct  192  FYAGDWEELHTVLSVVRSEGSEPNTGMHLSFSEEDFMDGCSSQEGSIVGQEFTSRRSRKL  251

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERA++AD G+ GYDVILM EIPYS+ SLKKLY+L+KKCLRPPYGV YLATKRNY
Sbjct  252  SGSRAWERANEADHGDGGYDVILMAEIPYSLTSLKKLYALLKKCLRPPYGVAYLATKRNY  311

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VGFNSAARHLRSLVDE G+FG HLV E+ DR++W
Sbjct  312  VGFNSAARHLRSLVDEGGIFGVHLVKEMADRDVW  345



>ref|XP_006858675.1| hypothetical protein AMTR_s00066p00080930 [Amborella trichopoda]
 gb|ERN20142.1| hypothetical protein AMTR_s00066p00080930 [Amborella trichopoda]
Length=353

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 123/157 (78%), Gaps = 3/157 (2%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDAS-EIPRGMSXSFSEEDL-MDGCSSQDGSI-LVHEsssrrs  546
            F  G   EL T+LSVV  DA  E     S SFSEED  MDGCSS DGS  +V +SSS+R+
Sbjct  192  FFAGEWEELHTILSVVAKDAGFESMGAASLSFSEEDFAMDGCSSHDGSCSIVQDSSSQRT  251

Query  545  rklsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATK  366
            RKLSGSRAWER S+ D  E GYD+ILM +IPYSVASL+KLY+LIKKCLRPPYGV+++ATK
Sbjct  252  RKLSGSRAWERGSETDATEGGYDIILMADIPYSVASLRKLYALIKKCLRPPYGVLFMATK  311

Query  365  RNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            +NY+G N  AR LR LVDEEG+FGAH++TE+ DREIW
Sbjct  312  KNYIGLNGGARQLRGLVDEEGIFGAHMITEIGDREIW  348



>ref|NP_001063658.2| Os09g0514300 [Oryza sativa Japonica Group]
 dbj|BAF25572.2| Os09g0514300 [Oryza sativa Japonica Group]
Length=285

 Score =   179 bits (454),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 121/160 (76%), Gaps = 0/160 (0%)
 Frame = -2

Query  734  LLQQ*TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsss  555
            L Q   F  G   EL TVLSV++ D  +   G++  F E+D +DGCSSQD S + HE+SS
Sbjct  121  LPQDIHFYAGEWEELHTVLSVIQEDEVDTSSGVALEFCEDDFLDGCSSQDASNICHETSS  180

Query  554  rrsrklsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYL  375
            RRSRKLSGSRAWER ++   G+ GYD++L+ EIPYS +SL+ LY L+KKCLRPPYGVMYL
Sbjct  181  RRSRKLSGSRAWERGNETTTGDGGYDILLVNEIPYSASSLQNLYLLVKKCLRPPYGVMYL  240

Query  374  ATKRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            A ++NY+G +SA R LRSLVDEEG FGAHLV+E  +REIW
Sbjct  241  AARKNYIGSSSAVRQLRSLVDEEGAFGAHLVSEPPEREIW  280



>dbj|BAD34426.1| hypothetical protein [Oryza sativa Japonica Group]
Length=315

 Score =   180 bits (456),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 121/160 (76%), Gaps = 0/160 (0%)
 Frame = -2

Query  734  LLQQ*TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsss  555
            L Q   F  G   EL TVLSV++ D  +   G++  F E+D +DGCSSQD S + HE+SS
Sbjct  151  LPQDIHFYAGEWEELHTVLSVIQEDEVDTSSGVALEFCEDDFLDGCSSQDASNICHETSS  210

Query  554  rrsrklsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYL  375
            RRSRKLSGSRAWER ++   G+ GYD++L+ EIPYS +SL+ LY L+KKCLRPPYGVMYL
Sbjct  211  RRSRKLSGSRAWERGNETTTGDGGYDILLVNEIPYSASSLQNLYLLVKKCLRPPYGVMYL  270

Query  374  ATKRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            A ++NY+G +SA R LRSLVDEEG FGAHLV+E  +REIW
Sbjct  271  AARKNYIGSSSAVRQLRSLVDEEGAFGAHLVSEPPEREIW  310



>gb|EEC77542.1| hypothetical protein OsI_16443 [Oryza sativa Indica Group]
Length=214

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 123/163 (75%), Gaps = 5/163 (3%)
 Frame = -2

Query  740  RLLLQQ*TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVH-E  564
            +LL     F  G+  ELPT+LSVV   A+      + SFSE+D MDGCSS DGS +V  +
Sbjct  51   QLLAPNVHFYAGDWEELPTILSVVHPPAAPT----NLSFSEDDFMDGCSSHDGSSIVGVD  106

Query  563  sssrrsrklsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGV  384
            +  RRSRKLSGSRAWERAS+ DQ + GYDVIL++E+PY+V SLKKLY+LI KCLRPPYGV
Sbjct  107  NCPRRSRKLSGSRAWERASETDQADGGYDVILISEVPYAVNSLKKLYALITKCLRPPYGV  166

Query  383  MYLATKRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            +Y+A+K+N VG N  AR LR+L++EEGV G H +TEL DREIW
Sbjct  167  LYVASKKNLVGSNGGARQLRALMEEEGVLGGHFLTELADREIW  209



>gb|EEE70043.1| hypothetical protein OsJ_29997 [Oryza sativa Japonica Group]
Length=351

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 121/160 (76%), Gaps = 0/160 (0%)
 Frame = -2

Query  734  LLQQ*TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsss  555
            L Q   F  G   EL TVLSV++ D  +   G++  F E+D +DGCSSQD S + HE+SS
Sbjct  187  LPQDIHFYAGEWEELHTVLSVIQEDEVDTSSGVALEFCEDDFLDGCSSQDASNICHETSS  246

Query  554  rrsrklsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYL  375
            RRSRKLSGSRAWER ++   G+ GYD++L+ EIPYS +SL+ LY L+KKCLRPPYGVMYL
Sbjct  247  RRSRKLSGSRAWERGNETTTGDGGYDILLVNEIPYSASSLQNLYLLVKKCLRPPYGVMYL  306

Query  374  ATKRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            A ++NY+G +SA R LRSLVDEEG FGAHLV+E  +REIW
Sbjct  307  AARKNYIGSSSAVRQLRSLVDEEGAFGAHLVSEPPEREIW  346



>ref|NP_001144579.1| uncharacterized protein LOC100277589 [Zea mays]
 gb|ACG41515.1| hypothetical protein [Zea mays]
Length=346

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 123/163 (75%), Gaps = 5/163 (3%)
 Frame = -2

Query  740  RLLLQQ*TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILV-HE  564
            +LL     F  G   ELPT+LSVV+  A+      + SFSE+D MDGCSS DGS +V H+
Sbjct  183  QLLAPNVHFYAGEWDELPTILSVVQPPAAP----TNLSFSEDDFMDGCSSHDGSSVVGHD  238

Query  563  sssrrsrklsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGV  384
               RRSRKLSGSRAWERAS+ DQ +SGYDVIL++++PY+  SLKKLY+LI KCLRPPYGV
Sbjct  239  YCPRRSRKLSGSRAWERASETDQADSGYDVILISDVPYAANSLKKLYALISKCLRPPYGV  298

Query  383  MYLATKRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            +Y+A+K+N VG N  AR LR+L++EEGV G H +TE+ DREIW
Sbjct  299  LYVASKKNLVGSNGGARQLRALMEEEGVLGGHFLTEVCDREIW  341



>ref|XP_008667701.1| PREDICTED: uncharacterized protein LOC100277589 isoform X1 [Zea 
mays]
 gb|ACN34078.1| unknown [Zea mays]
 tpg|DAA37175.1| TPA: hypothetical protein ZEAMMB73_004311 [Zea mays]
Length=346

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 123/163 (75%), Gaps = 5/163 (3%)
 Frame = -2

Query  740  RLLLQQ*TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILV-HE  564
            +LL     F  G   ELPT+LSVV+  A+      + SFSE+D MDGCSS DGS +V H+
Sbjct  183  QLLAPNVHFYAGEWDELPTILSVVQPPAAP----TNLSFSEDDFMDGCSSHDGSSVVGHD  238

Query  563  sssrrsrklsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGV  384
               RRSRKLSGSRAWERAS+ DQ +SGYDVIL++++PY+  SLKKLY+LI KCLRPPYGV
Sbjct  239  YCPRRSRKLSGSRAWERASETDQADSGYDVILISDVPYAANSLKKLYALISKCLRPPYGV  298

Query  383  MYLATKRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            +Y+A+K+N VG N  AR LR+L++EEGV G H +TE+ DREIW
Sbjct  299  LYVASKKNLVGSNGGARQLRALMEEEGVLGGHFLTEVCDREIW  341



>ref|XP_004976058.1| PREDICTED: uncharacterized protein LOC101755614 [Setaria italica]
Length=346

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 123/163 (75%), Gaps = 5/163 (3%)
 Frame = -2

Query  740  RLLLQQ*TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILV-HE  564
            +LL     F  G   ELPT+LSVV+  A+      + SFSE+D MDGCSS DGS +V H+
Sbjct  183  QLLAPNVHFYAGEWDELPTILSVVQPPAAP----TNLSFSEDDFMDGCSSHDGSSIVGHD  238

Query  563  sssrrsrklsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGV  384
               RRSRKLSGSRAWERAS+ DQ + GYDVIL++++PY+V SLKKLY+LI KCLRPPYGV
Sbjct  239  YCPRRSRKLSGSRAWERASETDQADGGYDVILISDVPYAVNSLKKLYALISKCLRPPYGV  298

Query  383  MYLATKRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            +Y+A+K+N V  N  AR LR+L++EEGV G H +TEL+DREIW
Sbjct  299  LYVASKKNLVSSNGGARQLRALMEEEGVLGGHFLTELSDREIW  341



>ref|XP_009401143.1| PREDICTED: histidine protein methyltransferase 1 homolog [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401145.1| PREDICTED: histidine protein methyltransferase 1 homolog [Musa 
acuminata subsp. malaccensis]
Length=344

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 123/154 (80%), Gaps = 7/154 (5%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  EL TVLSVVR DAS        SFSE+D MDGCSS DGSI+ HE+ SR+SRKL
Sbjct  193  FYAGDWEELCTVLSVVRMDAS-------LSFSEDDFMDGCSSHDGSIIAHETCSRQSRKL  245

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERASD D G+ GYDVIL+TEIP+S+ SL+KLY LI KCLRPPYGVMYLA K+N+
Sbjct  246  SGSRAWERASDGDTGDGGYDVILITEIPHSMNSLRKLYDLISKCLRPPYGVMYLAVKKNF  305

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VG +  AR LR++VDEEGV+G H+VTEL DREIW
Sbjct  306  VGSSGGARQLRAMVDEEGVYGVHMVTELVDREIW  339



>emb|CAH67536.1| H0425E08.4 [Oryza sativa Indica Group]
 gb|EAY94660.1| hypothetical protein OsI_16438 [Oryza sativa Indica Group]
Length=346

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 123/163 (75%), Gaps = 5/163 (3%)
 Frame = -2

Query  740  RLLLQQ*TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVH-E  564
            +LL     F  G+  ELPT+LSVV   A+      + SFSE+D MDGCSS DGS +V  +
Sbjct  183  QLLAPNVHFYAGDWEELPTILSVVHPPAAP----TNLSFSEDDFMDGCSSHDGSSIVGVD  238

Query  563  sssrrsrklsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGV  384
            +  RRSRKLSGSRAWERAS+ DQ + GYDVIL++E+PY+V SLKKLY+LI KCLRPPYGV
Sbjct  239  NCPRRSRKLSGSRAWERASETDQADGGYDVILISEVPYAVNSLKKLYALITKCLRPPYGV  298

Query  383  MYLATKRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            +Y+A+K+N VG N  AR LR+L++EEGV G H +TEL DREIW
Sbjct  299  LYVASKKNLVGSNGGARQLRALMEEEGVLGGHFLTELADREIW  341



>gb|ACJ84505.1| unknown [Medicago truncatula]
Length=149

 Score =   169 bits (429),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 112/126 (89%), Gaps = 1/126 (1%)
 Frame = -2

Query  638  MSXSFSEEDLMDGCSSQDGSILVHEsssrrsrklsgsRAWERASDADQGESGYDVILMTE  459
            MS SFSEED +D  SSQDGSI+ HESSSRRSRKLSGSRAWERA++ADQG+ GYDVILMTE
Sbjct  1    MSLSFSEEDFLDVDSSQDGSIIGHESSSRRSRKLSGSRAWERANEADQGDGGYDVILMTE  60

Query  458  IPYSVASLKKLYSLIKKCLRPPYGVMYLA-TKRNYVGFNSAARHLRSLVDEEGVFGAHLV  282
            IPYSV SLKKLY+LIKKC+RPPYGV+YLA TK++YVGF++  R LR+++DEEG+FG HLV
Sbjct  61   IPYSVNSLKKLYALIKKCIRPPYGVVYLAPTKKHYVGFSNGVRQLRNVLDEEGIFGVHLV  120

Query  281  TELTDR  264
             +L DR
Sbjct  121  KDLADR  126



>gb|EEC84878.1| hypothetical protein OsI_32028 [Oryza sativa Indica Group]
Length=366

 Score =   176 bits (445),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 120/160 (75%), Gaps = 0/160 (0%)
 Frame = -2

Query  734  LLQQ*TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsss  555
            L Q   F  G   EL TVLSV++ D  +   G++  F E+D +DGCSSQD S + HE+SS
Sbjct  202  LPQDIHFYAGEWEELHTVLSVIQEDEVDTSSGVALEFCEDDFLDGCSSQDASNICHETSS  261

Query  554  rrsrklsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYL  375
            RRSRKLSGSRAWER ++   G+ GYD++L+ EIP S +SL+ LY L+KKCLRPPYGVMYL
Sbjct  262  RRSRKLSGSRAWERGNETTTGDGGYDILLVNEIPCSASSLQNLYLLVKKCLRPPYGVMYL  321

Query  374  ATKRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            A ++NY+G +SA R LRSLVDEEG FGAHLV+E  +REIW
Sbjct  322  AARKNYIGSSSAVRQLRSLVDEEGAFGAHLVSEPPEREIW  361



>ref|NP_001053176.1| Os04g0492400 [Oryza sativa Japonica Group]
 emb|CAE02046.2| OJ990528_30.4 [Oryza sativa Japonica Group]
 dbj|BAF15090.1| Os04g0492400 [Oryza sativa Japonica Group]
 gb|EAZ31199.1| hypothetical protein OsJ_15298 [Oryza sativa Japonica Group]
 dbj|BAG93017.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94350.1| unnamed protein product [Oryza sativa Japonica Group]
Length=346

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 122/163 (75%), Gaps = 5/163 (3%)
 Frame = -2

Query  740  RLLLQQ*TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVH-E  564
            +LL     F  G+  ELPT+LSVV   A+      + SFSE+D MDGCSS DGS +V  +
Sbjct  183  QLLAPNVHFYAGDWEELPTILSVVHPPAAP----TNLSFSEDDFMDGCSSHDGSSIVGVD  238

Query  563  sssrrsrklsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGV  384
            +  RRSRKLSGSRAWERAS+ DQ + GYDVIL++E+PY+V SLKKLY+LI KCLRPPYGV
Sbjct  239  NCPRRSRKLSGSRAWERASETDQADGGYDVILISEVPYAVNSLKKLYALITKCLRPPYGV  298

Query  383  MYLATKRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            +Y+ +K+N VG N  AR LR+L++EEGV G H +TEL DREIW
Sbjct  299  LYVVSKKNLVGSNGGARQLRALMEEEGVLGGHFLTELADREIW  341



>ref|XP_009405561.1| PREDICTED: uncharacterized protein LOC103988679 [Musa acuminata 
subsp. malaccensis]
Length=352

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  ELP+VLSVVR D  E+  G S S SE+D +D CSSQ+GS++  E+SSRRSRKL
Sbjct  194  FYAGDWEELPSVLSVVRVDGFELASGASLSLSEDDYIDACSSQEGSVIAQETSSRRSRKL  253

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWERAS  D G+ GYDVIL+TEIP+SV SL+KLY+L+ KCLRPPYGV YLA K+ +
Sbjct  254  SGSRAWERASKTDPGDGGYDVILITEIPHSVTSLRKLYALMTKCLRPPYGVSYLAVKKKF  313

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VG N  AR L+++V E+ +F  H+V+  ++REIW
Sbjct  314  VGPNGVARQLKAMVHEDNIFSVHMVSRTSEREIW  347



>ref|XP_002446718.1| hypothetical protein SORBIDRAFT_06g021130 [Sorghum bicolor]
 gb|EES11046.1| hypothetical protein SORBIDRAFT_06g021130 [Sorghum bicolor]
Length=346

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 122/163 (75%), Gaps = 5/163 (3%)
 Frame = -2

Query  740  RLLLQQ*TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILV-HE  564
            +LL     F  G   ELPT+LSVV+  A+      + SFSE+D MD CSS DGS +V H+
Sbjct  183  QLLAPNVHFYAGEWDELPTILSVVQPPAAP----TNLSFSEDDFMDVCSSHDGSSIVGHD  238

Query  563  sssrrsrklsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGV  384
               RRSRKLSGSRAWERA++ DQ + GYDVIL++++PY+V SLKKLY+LI KCLRPPYGV
Sbjct  239  YCPRRSRKLSGSRAWERANETDQADGGYDVILISDVPYAVNSLKKLYALISKCLRPPYGV  298

Query  383  MYLATKRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            +Y+A+K+N VG N  AR LR+L++EEGV G H +TE+ DREIW
Sbjct  299  LYVASKKNLVGSNGGARQLRALMEEEGVLGGHFLTEVCDREIW  341



>ref|XP_006652451.1| PREDICTED: uncharacterized protein LOC102711251 [Oryza brachyantha]
Length=346

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 124/163 (76%), Gaps = 5/163 (3%)
 Frame = -2

Query  740  RLLLQQ*TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILV-HE  564
            +LL     F  G   EL T+LSVV+  A  +P  +S  FSE+D MDGCSS DGS +V  +
Sbjct  183  QLLAPNVHFYAGEWEELHTILSVVQPPA--VPTNLS--FSEDDFMDGCSSHDGSSIVGQD  238

Query  563  sssrrsrklsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGV  384
            +  RRSRKLSGSRAWERAS+ DQ + GYDVIL++E+PY+V SLKKLY+LI KCLRPPYG+
Sbjct  239  NIPRRSRKLSGSRAWERASETDQSDGGYDVILISELPYAVNSLKKLYALITKCLRPPYGI  298

Query  383  MYLATKRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            +Y+A+K+N VG N  AR LR+L++EEGV G H +TE++DREIW
Sbjct  299  LYVASKKNLVGSNGGARQLRALMEEEGVLGGHFLTEVSDREIW  341



>ref|XP_004957334.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Setaria italica]
 ref|XP_004957335.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Setaria italica]
Length=351

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 120/160 (75%), Gaps = 0/160 (0%)
 Frame = -2

Query  734  LLQQ*TFMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsss  555
            L Q   F  G   EL TVLS+++ D  +   G+   F E+DL+DG +SQDG+ + HE+SS
Sbjct  187  LPQDIHFYAGEWEELHTVLSIIQEDDVDASSGIGLGFCEDDLLDGYNSQDGNNICHETSS  246

Query  554  rrsrklsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYL  375
            RRSRKLS SRAWER ++   G+ GYD++L+ EIPYS +SL+ LY LIKKCLRPPYGV+YL
Sbjct  247  RRSRKLSSSRAWERGNETSTGDGGYDIVLVNEIPYSASSLQNLYLLIKKCLRPPYGVLYL  306

Query  374  ATKRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            A ++NY+G +SA R LR+LVDEEG+FG HLV+E  +REIW
Sbjct  307  AARKNYIGSSSAVRQLRALVDEEGIFGVHLVSEPPEREIW  346



>ref|XP_006660841.1| PREDICTED: uncharacterized protein LOC102708742 [Oryza brachyantha]
Length=351

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 115/154 (75%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G   EL TVLSV+  D  +   G+   F E+D++DG SSQD S +  E+SSRRSRKL
Sbjct  193  FYAGEWEELHTVLSVIHEDEVDASSGVGLEFCEDDILDGYSSQDASNICQETSSRRSRKL  252

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
            SGSRAWER ++   G+ GYD++L+ EIPYS  SL+ LY LIKKCLRPPYGVMYLA ++NY
Sbjct  253  SGSRAWERGNETTTGDGGYDIVLVNEIPYSANSLQNLYLLIKKCLRPPYGVMYLAARKNY  312

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            +G +SA R LR+LVDEEG FGAHLV+E  +REIW
Sbjct  313  IGSSSAVRQLRALVDEEGAFGAHLVSEPPEREIW  346



>gb|EMT24897.1| hypothetical protein F775_32531 [Aegilops tauschii]
Length=362

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 109/154 (71%), Gaps = 5/154 (3%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G   ELPT+LSVV   A    +  + SFSE+D MDGCSS DGS +V +   R  +  
Sbjct  209  FYAGEWDELPTILSVVHPPA----QPTNLSFSEDDFMDGCSSHDGSSIVGQDPRRSRKLS  264

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
                AWERAS+ D  + GYDVIL++EIP +V SL+KLY+LI KCLRPPYGV+Y+A+K+N 
Sbjct  265  GSR-AWERASETDPADGGYDVILISEIPNAVNSLRKLYALITKCLRPPYGVLYVASKKNL  323

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VG N  AR L+SL++EEGV G H +TE++DREIW
Sbjct  324  VGSNGGARQLKSLMEEEGVLGGHFLTEISDREIW  357



>ref|XP_003580042.1| PREDICTED: histidine protein methyltransferase 1 homolog [Brachypodium 
distachyon]
 ref|XP_010240064.1| PREDICTED: histidine protein methyltransferase 1 homolog [Brachypodium 
distachyon]
Length=344

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 109/154 (71%), Gaps = 5/154 (3%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G   EL T+LSVV   A  +P  +S  FSE+D MDGCSS DGS +V +   R  +  
Sbjct  191  FYAGEWEELHTILSVVHPPA--LPTNLS--FSEDDFMDGCSSHDGSSIVGQEHRRSRKLS  246

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
                AWERAS+ DQ + GYDVIL++E+PY+  SLKKLY+LI KCLRPPYGV+Y+A+K+N 
Sbjct  247  GSR-AWERASETDQADGGYDVILISEVPYATNSLKKLYALITKCLRPPYGVLYVASKKNL  305

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VG N + R L++L++EEGV G H +TEL DREIW
Sbjct  306  VGSNGSVRQLKALMEEEGVLGGHFLTELCDREIW  339



>ref|XP_010238357.1| PREDICTED: uncharacterized protein LOC100830260 [Brachypodium 
distachyon]
 ref|XP_010238358.1| PREDICTED: uncharacterized protein LOC100830260 [Brachypodium 
distachyon]
Length=353

 Score =   164 bits (416),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 116/155 (75%), Gaps = 1/155 (1%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G   EL TVLSV++ +  +    +   F ++D +DGCSSQDG+ + HE+SSRRSRKL
Sbjct  194  FYAGEWEELHTVLSVIQEEEVDSSPVVGLGFCDDDFLDGCSSQDGNNICHETSSRRSRKL  253

Query  536  sgsRAWERASDADQGESG-YDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRN  360
            SGSRAWER ++A  G+ G YD++L+ +IPYS  SL+ LYSLIKKCLRPPYGVMYLA ++N
Sbjct  254  SGSRAWERGNEASIGDGGGYDILLLNDIPYSANSLQNLYSLIKKCLRPPYGVMYLAARKN  313

Query  359  YVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            Y+G +SA R LR LVDEEG FGAHL  E  +REIW
Sbjct  314  YIGSSSAVRQLRVLVDEEGAFGAHLAAEPPEREIW  348



>gb|EMS59379.1| hypothetical protein TRIUR3_33843 [Triticum urartu]
Length=463

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 109/154 (71%), Gaps = 5/154 (3%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G   ELPT+LSVV   A    +  + SFSE+D MDGCSS DGS +V +   R  +  
Sbjct  310  FYAGEWDELPTILSVVHPPA----QPTNLSFSEDDFMDGCSSHDGSSIVGQDPRRSRKLS  365

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNY  357
                AWERAS+ D  + GYDVIL++EIP +V SL+KLY+LI KCLRPPYGV+Y+A+K+N 
Sbjct  366  GSR-AWERASETDPADGGYDVILISEIPNAVNSLRKLYALITKCLRPPYGVLYVASKKNM  424

Query  356  VGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            VG +  AR L+SL++EEGV G H +TE++DREIW
Sbjct  425  VGSSGGARQLKSLMEEEGVLGGHFLTEISDREIW  458


 Score = 44.7 bits (104),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 29/49 (59%), Gaps = 4/49 (8%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILV  570
            F  G   ELPT+LSVV   A    +  + SFSE+D MDGC   DGS +V
Sbjct  209  FYAGEWDELPTILSVVHPPA----QPTNLSFSEDDFMDGCRRHDGSSIV  253


 Score = 31.2 bits (69),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = -1

Query  744  RQTLAPTVNFYAGEW  700
            RQ LAP V+FYAGEW
Sbjct  200  RQLLAPVVHFYAGEW  214



>gb|KJB27983.1| hypothetical protein B456_005G020100 [Gossypium raimondii]
Length=314

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEsssrrsrkl  537
            F  G+  ELP+VLSVVRND SE+  G+S SFSEED +DGCSSQDGSIL  E S RRSR+L
Sbjct  192  FYAGDWEELPSVLSVVRNDVSEMTPGLSFSFSEEDFLDGCSSQDGSILAQELSLRRSRRL  251

Query  536  sgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKK  408
            S SRAWERAS+ DQGE GYDVILMTEIPY ++SLKKLY+LIKK
Sbjct  252  SRSRAWERASETDQGEGGYDVILMTEIPYPMSSLKKLYALIKK  294



>gb|ABR16574.1| unknown [Picea sitchensis]
Length=368

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 97/168 (58%), Gaps = 14/168 (8%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEED-LMDGCSSQDGSILVHEsssrrsrk  540
            F  G+ GEL ++LSVV  D  ++   +   F EED L+D   SQDGS    E  +  ++ 
Sbjct  196  FYAGDWGELHSLLSVVATDQVDLAGEVDKIFLEEDVLLDDSGSQDGSSANQEIPASSNQI  255

Query  539  ls--------gsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGV  384
                         A E A D+D  E GYD+ILM E  YSV+S KKLY +IKKCLRPP GV
Sbjct  256  QQVRCTRRHSQCHACEWARDSDLSEGGYDIILMAETVYSVSSFKKLYGIIKKCLRPPNGV  315

Query  383  MYLATKRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTD-----REIW  255
            +YLA K++Y G     R  +S V+E+G+ GAHLV ++ D     REIW
Sbjct  316  VYLAAKKHYFGVGGGTRQFKSFVEEDGILGAHLVVDIADGASNVREIW  363



>ref|NP_001159150.1| hypothetical protein [Zea mays]
 ref|XP_008662080.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN25233.1| unknown [Zea mays]
 gb|AFW58696.1| hypothetical protein ZEAMMB73_692053 [Zea mays]
Length=352

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 102/160 (64%), Gaps = 10/160 (6%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRNDASEIPRGMSXSFSEEDLMDGCSSQDGSILVHEss----srr  549
            F  G   ELPTVLS V   A+        SFSE+D MDG SS      V         R 
Sbjct  192  FYAGEWDELPTVLSAVPPPAAP----ADLSFSEDDFMDGGSSSHDGSSVVVGQDYCPRRS  247

Query  548  srklsgsRAWERASD-ADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVM-YL  375
             +     RAWERA++  DQ + GYDVIL++++PY+  SLKKL++LI KCLRPPYGVM Y+
Sbjct  248  RKLSGSRRAWERANNETDQADGGYDVILVSDVPYAANSLKKLHALISKCLRPPYGVMYYV  307

Query  374  ATKRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            A+K++ VG N  AR LR+L++E GV G HL+TE+ DREIW
Sbjct  308  ASKKSSVGSNGGARQLRALMEEGGVLGGHLLTEVCDREIW  347



>gb|ABK25033.1| unknown [Picea sitchensis]
 gb|ACN39918.1| unknown [Picea sitchensis]
Length=370

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 107/172 (62%), Gaps = 22/172 (13%)
 Frame = -2

Query  716  FMQGNGGELPTVLSVVRND---ASEIPRGMSXSFSEEDL-MDGCSSQDGSIL--------  573
            F  G+ G+L T+LSVV  D   A +I    + SFSE+DL +D   S + S +        
Sbjct  198  FYAGDWGDLHTLLSVVEQDQLGACDI----NLSFSEDDLFLDRSLSHNSSGVNQETQIDS  253

Query  572  VHEsssrrsrklsgsRAWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPP  393
             H     R+RKLSGSRA ERA+D D  E GYD+ILM E  YS+ S++KLY LIKKCLRPP
Sbjct  254  SHGRQITRTRKLSGSRACERANDMDPSEGGYDIILMAETVYSLVSMRKLYGLIKKCLRPP  313

Query  392  YGVMYLATKRN-YVGFNSAARHLRSLVDEEGVFGAHLVTELTD-----REIW  255
            YGV+YLA K++ + G     R  RS+V+E G+ GAHLV E+ D     REIW
Sbjct  314  YGVVYLAAKKHSFCGGGGGTRQFRSIVEENGILGAHLVVEVADGSSNIREIW  365



>ref|XP_001760682.1| predicted protein [Physcomitrella patens]
 gb|EDQ74421.1| predicted protein [Physcomitrella patens]
Length=302

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 61/92 (66%), Gaps = 5/92 (5%)
 Frame = -2

Query  515  RASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAA  336
            R   +   E GYD+ILM+E  YS+ASL KLY LIKKC+ PPYGV+Y+A K++Y G     
Sbjct  206  RGHTSSAQECGYDIILMSETVYSLASLPKLYELIKKCICPPYGVVYVAGKKHYFGVGGGT  265

Query  335  RHLRSLVDEEGVFGAHLVTELTD-----REIW  255
            R  + LV+E+G+ GAHLV +  D     REIW
Sbjct  266  RQFKHLVEEDGIMGAHLVADFADGSSNVREIW  297



>ref|XP_001769361.1| predicted protein [Physcomitrella patens]
 gb|EDQ65730.1| predicted protein, partial [Physcomitrella patens]
Length=230

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 59/97 (61%), Gaps = 7/97 (7%)
 Frame = -2

Query  524  AWERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFN  345
            A +R       E GYD+ILM+E  YS+ SL KLY LIKKC RPPYGV+YLA K++YVG  
Sbjct  129  ACDRGHTNTTQEGGYDIILMSETVYSLTSLPKLYELIKKCTRPPYGVVYLAAKKHYVGVG  188

Query  344  SAARHLRSLV--DEEGVFGAHLVTELTD-----REIW  255
               R  + LV  DE G   AHLV +  D     RE+W
Sbjct  189  GGTRQFKRLVEEDEYGPMAAHLVADFADNSSNVREVW  225



>ref|XP_002960051.1| hypothetical protein SELMODRAFT_73463 [Selaginella moellendorffii]
 gb|EFJ37590.1| hypothetical protein SELMODRAFT_73463 [Selaginella moellendorffii]
Length=289

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 63/96 (66%), Gaps = 9/96 (9%)
 Frame = -2

Query  515  RASDADQGES----GYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGF  348
            RA D+ + ES    GYDV+LM+E  YSV+S  KLY+L+ KCLRP YGV Y+A K++Y G 
Sbjct  188  RACDSRREESVDEGGYDVVLMSETIYSVSSFPKLYALMAKCLRPYYGVAYVAGKKHYFGV  247

Query  347  NSAARHLRSLVDEEGVFGAHLVTELTD-----REIW  255
                R  + +V+E+GV GAHLV E  D     REIW
Sbjct  248  GGGTRLFKHMVEEQGVLGAHLVAEFADGSSNVREIW  283



>ref|XP_002984087.1| hypothetical protein SELMODRAFT_180720 [Selaginella moellendorffii]
 gb|EFJ15099.1| hypothetical protein SELMODRAFT_180720 [Selaginella moellendorffii]
Length=241

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 57/84 (68%), Gaps = 5/84 (6%)
 Frame = -2

Query  491  ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVD  312
            E GYDV+LM+E  YSV+S  KLY+L+ KCLRP YGV Y+A K++Y G     R  + +V+
Sbjct  152  EGGYDVVLMSETIYSVSSFPKLYALMAKCLRPYYGVAYVAGKKHYFGVGGGTRLFKHMVE  211

Query  311  EEGVFGAHLVTELTD-----REIW  255
            E+GV GAHLV E  D     REIW
Sbjct  212  EQGVLGAHLVAEFADGSSNVREIW  235



>ref|XP_009625430.1| PREDICTED: histidine protein methyltransferase 1 homolog [Nicotiana 
tomentosiformis]
Length=304

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 57/83 (69%), Gaps = 5/83 (6%)
 Frame = -2

Query  488  SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDE  309
            +GYD+ILM E  YSV++L  LY LIKKCL  P+G++YLA K++Y G    +R   S+V++
Sbjct  217  AGYDIILMAETVYSVSTLPTLYKLIKKCLHSPHGIVYLAAKKHYFGVGGGSRRFISIVEK  276

Query  308  EGVFGAHLVTELTD-----REIW  255
            +G+  A LV E+TD     REIW
Sbjct  277  DGILAASLVAEVTDGSSNVREIW  299



>ref|XP_006349911.1| PREDICTED: histidine protein methyltransferase 1 homolog [Solanum 
tuberosum]
Length=309

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 62/93 (67%), Gaps = 6/93 (6%)
 Frame = -2

Query  518  ERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSA  339
            ++    DQ  +GYD+ILM E  YSV++L  LY LIKKCL  P+G++YLA K++Y G    
Sbjct  213  KKGQTVDQA-AGYDIILMAETVYSVSTLPSLYKLIKKCLCSPHGIVYLAAKKHYFGVGGG  271

Query  338  ARHLRSLVDEEGVFGAHLVTELTD-----REIW  255
            +R   S+V+++GV  A L++E+TD     RE+W
Sbjct  272  SRRFISIVEKDGVLAASLISEVTDGSSNVREVW  304



>gb|EMS67427.1| hypothetical protein TRIUR3_02638 [Triticum urartu]
Length=214

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  416  IKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDEEGVFGAHLVTELTDREIW  255
            IK CLRPPYGVMYL  K+NY+G +SA R LR+LVDEEG FG HLV E  +REIW
Sbjct  156  IKACLRPPYGVMYLTAKKNYIGSSSAVRQLRALVDEEGAFGVHLVAEPPEREIW  209



>ref|XP_010314745.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Solanum lycopersicum]
Length=326

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 58/83 (70%), Gaps = 5/83 (6%)
 Frame = -2

Query  488  SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDE  309
            +GYD+ILM E  YS+++L  LY LIKKCL  P+G++YLA K++Y G    +R   S+V++
Sbjct  222  AGYDIILMAETVYSISTLPSLYKLIKKCLCSPHGILYLAAKKHYFGVGGGSRRFISIVEK  281

Query  308  EGVFGAHLVTELTD-----REIW  255
            +GV  A LV+E+TD     RE+W
Sbjct  282  DGVLAASLVSEVTDGSSNVREVW  304



>ref|XP_010258580.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X3 [Nelumbo nucifera]
Length=320

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 64/97 (66%), Gaps = 8/97 (8%)
 Frame = -2

Query  521  WERASDADQGE---SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVG  351
            +++ SD+  G+   +GYDVILM E  YS++SL+ LY LIKKCL  P+GV+Y+A K++Y G
Sbjct  219  YQKGSDSSSGQDPPAGYDVILMAETVYSISSLQNLYGLIKKCLSWPHGVVYMAGKKHYFG  278

Query  350  FNSAARHLRSLVDEEGVFGAHLVTELTD-----REIW  255
                 R   S+V+++G+  A L+ E+ D     RE+W
Sbjct  279  VGGGTRQFLSVVEKDGLMEASLIAEVADGLSNLREVW  315



>ref|XP_007163808.1| hypothetical protein PHAVU_001G266000g [Phaseolus vulgaris]
 gb|ESW35802.1| hypothetical protein PHAVU_001G266000g [Phaseolus vulgaris]
Length=289

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 59/90 (66%), Gaps = 5/90 (6%)
 Frame = -2

Query  509  SDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARH  330
            S  D    GYD ILM E  YSV+SL+ LY+L+KKCL+ P GV+Y+A K+ Y G    +R 
Sbjct  195  STDDNRSGGYDFILMAETVYSVSSLQILYNLVKKCLQHPDGVVYMAAKKYYFGVGGGSRR  254

Query  329  LRSLVDEEGVFGAHLVTELTD-----REIW  255
              SLV+++GVF + LV E+TD     RE+W
Sbjct  255  FLSLVEKDGVFTSSLVAEITDGSSNVREVW  284



>ref|XP_004252981.2| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Solanum lycopersicum]
Length=327

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 58/83 (70%), Gaps = 5/83 (6%)
 Frame = -2

Query  488  SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDE  309
            +GYD+ILM E  YS+++L  LY LIKKCL  P+G++YLA K++Y G    +R   S+V++
Sbjct  222  AGYDIILMAETVYSISTLPSLYKLIKKCLCSPHGILYLAAKKHYFGVGGGSRRFISIVEK  281

Query  308  EGVFGAHLVTELTD-----REIW  255
            +GV  A LV+E+TD     RE+W
Sbjct  282  DGVLAASLVSEVTDGSSNVREVW  304



>ref|XP_010258579.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Nelumbo nucifera]
Length=335

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 64/97 (66%), Gaps = 8/97 (8%)
 Frame = -2

Query  521  WERASDADQGE---SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVG  351
            +++ SD+  G+   +GYDVILM E  YS++SL+ LY LIKKCL  P+GV+Y+A K++Y G
Sbjct  234  YQKGSDSSSGQDPPAGYDVILMAETVYSISSLQNLYGLIKKCLSWPHGVVYMAGKKHYFG  293

Query  350  FNSAARHLRSLVDEEGVFGAHLVTELTD-----REIW  255
                 R   S+V+++G+  A L+ E+ D     RE+W
Sbjct  294  VGGGTRQFLSVVEKDGLMEASLIAEVADGLSNLREVW  330



>ref|XP_010258577.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Nelumbo nucifera]
Length=340

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 64/97 (66%), Gaps = 8/97 (8%)
 Frame = -2

Query  521  WERASDADQGE---SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVG  351
            +++ SD+  G+   +GYDVILM E  YS++SL+ LY LIKKCL  P+GV+Y+A K++Y G
Sbjct  239  YQKGSDSSSGQDPPAGYDVILMAETVYSISSLQNLYGLIKKCLSWPHGVVYMAGKKHYFG  298

Query  350  FNSAARHLRSLVDEEGVFGAHLVTELTD-----REIW  255
                 R   S+V+++G+  A L+ E+ D     RE+W
Sbjct  299  VGGGTRQFLSVVEKDGLMEASLIAEVADGLSNLREVW  335



>ref|XP_010673377.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=317

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 58/93 (62%), Gaps = 5/93 (5%)
 Frame = -2

Query  518  ERASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSA  339
            + AS  D    GYD+ILM E  YS+ +L  LYSLIKKC+  P+G++YLA K++Y G    
Sbjct  220  DAASSNDNATPGYDLILMAETVYSITTLPNLYSLIKKCVSRPHGIIYLAAKKHYFGVGGG  279

Query  338  ARHLRSLVDEEGVFGAHLVTELTD-----REIW  255
            +R   S+V+++G+    L+ E+ D     RE+W
Sbjct  280  SRRFLSIVEKDGILTTSLIAEVVDGSSNVREVW  312



>ref|XP_010068986.1| PREDICTED: histidine protein methyltransferase 1 homolog [Eucalyptus 
grandis]
 gb|KCW57204.1| hypothetical protein EUGRSUZ_H00019 [Eucalyptus grandis]
Length=299

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 59/95 (62%), Gaps = 7/95 (7%)
 Frame = -2

Query  518  ERASDADQG--ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFN  345
            E  S+ D G    GYDVILM E  YS++SL+ LY LIKKC+  P+GV Y+A K++Y G  
Sbjct  200  EEDSNRDNGLASGGYDVILMAETVYSISSLQNLYELIKKCMSHPHGVAYMAGKKHYFGVG  259

Query  344  SAARHLRSLVDEEGVFGAHLVTELTD-----REIW  255
               R   SLV+++G+  + +V E+ D     REIW
Sbjct  260  GGTRRFLSLVEKDGIMASSIVAEVADGSSNLREIW  294



>gb|KDP32603.1| hypothetical protein JCGZ_13153 [Jatropha curcas]
Length=301

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 56/88 (64%), Gaps = 5/88 (6%)
 Frame = -2

Query  503  ADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLR  324
            ++Q  SGYDVILM E  YS+++ + LY LIKKCLR P+GV+Y A K+ Y G     R   
Sbjct  209  SEQPVSGYDVILMAETIYSISAQQNLYGLIKKCLRRPHGVVYFAAKKYYFGVGGGTRQFL  268

Query  323  SLVDEEGVFGAHLVTELTD-----REIW  255
            S+V+++G+    LV E+ D     RE+W
Sbjct  269  SMVEKDGIMAGSLVAEVADGSSNVREVW  296



>ref|XP_006841538.1| hypothetical protein AMTR_s00003p00162530 [Amborella trichopoda]
 gb|ERN03213.1| hypothetical protein AMTR_s00003p00162530 [Amborella trichopoda]
Length=318

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 58/91 (64%), Gaps = 5/91 (5%)
 Frame = -2

Query  512  ASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAAR  333
            +S   +   GYD+ILM E  YS++SL+KLY+LIK CL  P G++YLA K++Y G     R
Sbjct  223  SSLKQESSGGYDIILMAETVYSLSSLQKLYNLIKMCLCWPNGLVYLAAKKHYFGVGGGTR  282

Query  332  HLRSLVDEEGVFGAHLVTELTD-----REIW  255
              RS+VD +GV  A LV E+ D     RE+W
Sbjct  283  QFRSIVDHDGVLVASLVMEVADGASNVREVW  313



>gb|KJB71880.1| hypothetical protein B456_011G152100 [Gossypium raimondii]
Length=286

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 59/92 (64%), Gaps = 6/92 (7%)
 Frame = -2

Query  512  ASDADQGE-SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAA  336
             S ++ G+ S YDVILM E  YS+++ + LY LIKKC+  P GV+YLA K++Y G     
Sbjct  190  TSSSEHGQASAYDVILMAETIYSISAQRNLYGLIKKCMNQPNGVVYLAGKKHYFGVGGGT  249

Query  335  RHLRSLVDEEGVFGAHLVTELTD-----REIW  255
            R   S++++EGV  A LVTE+ D     RE+W
Sbjct  250  RQFLSMLEKEGVMAATLVTEVADGSSNVREVW  281



>ref|XP_004489174.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Cicer arietinum]
Length=312

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 5/83 (6%)
 Frame = -2

Query  488  SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDE  309
            SGYD ILM E  YS+ SL+ LY+LIKKCL  P+GV+Y+A K+ Y G     R   S+V++
Sbjct  225  SGYDFILMAETVYSINSLQTLYNLIKKCLIHPHGVVYMAAKKYYFGVGGGTRRFLSVVEK  284

Query  308  EGVFGAHLVTELTD-----REIW  255
            +GV  ++LV E+TD     RE+W
Sbjct  285  DGVMTSNLVAEITDGSSNVREVW  307



>ref|XP_004489175.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Cicer arietinum]
Length=311

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 5/83 (6%)
 Frame = -2

Query  488  SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDE  309
            SGYD ILM E  YS+ SL+ LY+LIKKCL  P+GV+Y+A K+ Y G     R   S+V++
Sbjct  224  SGYDFILMAETVYSINSLQTLYNLIKKCLIHPHGVVYMAAKKYYFGVGGGTRRFLSVVEK  283

Query  308  EGVFGAHLVTELTD-----REIW  255
            +GV  ++LV E+TD     RE+W
Sbjct  284  DGVMTSNLVAEITDGSSNVREVW  306



>ref|XP_009764705.1| PREDICTED: histidine protein methyltransferase 1 homolog [Nicotiana 
sylvestris]
Length=305

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 56/83 (67%), Gaps = 5/83 (6%)
 Frame = -2

Query  488  SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDE  309
            +GYD+ILM E  YSV++L  LY LIKKCL  P+G++YLA K++Y G    +R   S+V++
Sbjct  218  TGYDIILMAETVYSVSTLPTLYKLIKKCLLSPHGIVYLAAKKHYFGVGGGSRRFISIVEK  277

Query  308  EGVFGAHLVTELTD-----REIW  255
            + +  A LV E+TD     RE+W
Sbjct  278  DSILAASLVAEVTDGSSNVREVW  300



>gb|KHG01813.1| Histidine protein methyltransferase 1 [Gossypium arboreum]
Length=296

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 59/92 (64%), Gaps = 6/92 (7%)
 Frame = -2

Query  512  ASDADQGE-SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAA  336
             S ++ G+ S YDVILM E  YS+++ + LY LIKKC+  P GV+YLA K++Y G     
Sbjct  200  TSSSEHGQASAYDVILMAETIYSISAQRNLYGLIKKCMNQPNGVVYLAGKKHYFGVGGGT  259

Query  335  RHLRSLVDEEGVFGAHLVTELTD-----REIW  255
            R   S++++EGV  A LVTE+ D     RE+W
Sbjct  260  RQFLSMLEKEGVMAATLVTEVADGSSNVREVW  291



>gb|KJB71876.1| hypothetical protein B456_011G152100 [Gossypium raimondii]
Length=296

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 59/92 (64%), Gaps = 6/92 (7%)
 Frame = -2

Query  512  ASDADQGE-SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAA  336
             S ++ G+ S YDVILM E  YS+++ + LY LIKKC+  P GV+YLA K++Y G     
Sbjct  200  TSSSEHGQASAYDVILMAETIYSISAQRNLYGLIKKCMNQPNGVVYLAGKKHYFGVGGGT  259

Query  335  RHLRSLVDEEGVFGAHLVTELTD-----REIW  255
            R   S++++EGV  A LVTE+ D     RE+W
Sbjct  260  RQFLSMLEKEGVMAATLVTEVADGSSNVREVW  291



>ref|XP_003552281.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Glycine max]
 gb|KHN24030.1| Histidine protein methyltransferase 1 like [Glycine soja]
Length=306

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 58/87 (67%), Gaps = 6/87 (7%)
 Frame = -2

Query  500  DQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRS  321
            +QG+ GYD ILM E  YS+ SL+ LY+LIKKCL+ P GV+Y+A K+ Y G     R   S
Sbjct  216  NQGD-GYDFILMAETVYSINSLQNLYNLIKKCLQHPDGVVYMAAKKYYFGVGGGTRRFLS  274

Query  320  LVDEEGVFGAHLVTELTD-----REIW  255
            +V+++GV  + LV E+TD     RE+W
Sbjct  275  VVEKDGVMTSSLVAEITDGSSNVREVW  301



>ref|XP_006601885.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Glycine max]
Length=302

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 58/87 (67%), Gaps = 6/87 (7%)
 Frame = -2

Query  500  DQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRS  321
            +QG+ GYD ILM E  YS+ SL+ LY+LIKKCL+ P GV+Y+A K+ Y G     R   S
Sbjct  212  NQGD-GYDFILMAETVYSINSLQNLYNLIKKCLQHPDGVVYMAAKKYYFGVGGGTRRFLS  270

Query  320  LVDEEGVFGAHLVTELTD-----REIW  255
            +V+++GV  + LV E+TD     RE+W
Sbjct  271  VVEKDGVMTSSLVAEITDGSSNVREVW  297



>ref|XP_010910923.1| PREDICTED: histidine protein methyltransferase 1 homolog [Elaeis 
guineensis]
Length=317

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 57/90 (63%), Gaps = 6/90 (7%)
 Frame = -2

Query  506  DADQ-GESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARH  330
            D++Q G  GYD+ILM E  YS++SL  LY LIKKCLR P GV+Y+A K++Y G     R 
Sbjct  223  DSEQKGCDGYDIILMAETVYSLSSLHSLYGLIKKCLRCPSGVIYMAGKKHYFGVGGGTRQ  282

Query  329  LRSLVDEEGVFGAHLVTELTD-----REIW  255
               LV E+G+  A L+ E+ D     RE+W
Sbjct  283  FLHLVKEDGIMEACLLAEVADGSSNVREVW  312



>ref|NP_001062976.1| Os09g0359900 [Oryza sativa Japonica Group]
 dbj|BAD23316.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF24890.1| Os09g0359900 [Oryza sativa Japonica Group]
 dbj|BAG97280.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE69556.1| hypothetical protein OsJ_29057 [Oryza sativa Japonica Group]
Length=312

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 54/87 (62%), Gaps = 5/87 (6%)
 Frame = -2

Query  500  DQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRS  321
            D   +GYD+ILM E  Y+V+SL  LY LIKKCLR P G++Y+A K++Y G     RH   
Sbjct  221  DTAYNGYDIILMAETVYAVSSLPNLYRLIKKCLRYPGGIVYMAGKKHYFGVGGGTRHFVR  280

Query  320  LVDEEGVFGAHLVTELTD-----REIW  255
            LV E+G   + L+ E+ D     RE+W
Sbjct  281  LVTEDGAMQSDLLAEVADGSSNVREVW  307



>ref|XP_006414825.1| hypothetical protein EUTSA_v10025872mg [Eutrema salsugineum]
 gb|ESQ56278.1| hypothetical protein EUTSA_v10025872mg [Eutrema salsugineum]
Length=294

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 59/89 (66%), Gaps = 6/89 (7%)
 Frame = -2

Query  506  DADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHL  327
            +AD+ + GYD+ILM E  YS+++ K LY+LIKKCL  P G +Y+A K+ Y G     R  
Sbjct  202  EADK-KGGYDIILMAETIYSISAQKSLYALIKKCLACPDGAVYMAAKKYYFGVGGGTRQF  260

Query  326  RSLVDEEGVFGAHLVTELTD-----REIW  255
             S++D++GV  + LV+E+TD     RE+W
Sbjct  261  LSMIDKDGVLASTLVSEVTDGSSNVREVW  289



>ref|XP_002269192.1| PREDICTED: histidine protein methyltransferase 1 homolog [Vitis 
vinifera]
Length=308

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 57/86 (66%), Gaps = 5/86 (6%)
 Frame = -2

Query  497  QGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSL  318
            Q  +GYD+ILM E  YS+++L  LY LIKK +  P+GVMY+A K++Y G    +R   S+
Sbjct  218  QSTAGYDIILMAETVYSISALPTLYELIKKTMSRPHGVMYMAAKKHYFGVGGGSRRFLSV  277

Query  317  VDEEGVFGAHLVTELTD-----REIW  255
            V+++G+  A LV E+TD     RE+W
Sbjct  278  VEKDGIMVASLVAEVTDGSSNVREVW  303



>gb|EYU32714.1| hypothetical protein MIMGU_mgv1a010754mg [Erythranthe guttata]
Length=302

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 61/94 (65%), Gaps = 8/94 (9%)
 Frame = -2

Query  512  ASDADQGES---GYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNS  342
            AS +++ E+   GYDVILM E  YS+++L  LY LIKKC+  P GV+Y+A K++Y G   
Sbjct  204  ASTSEEDEAKCCGYDVILMAETVYSISTLPNLYKLIKKCISIPNGVVYMAAKKHYFGVGG  263

Query  341  AARHLRSLVDEEGVFGAHLVTELTD-----REIW  255
             +R   SLV+++G   + LV E+TD     RE+W
Sbjct  264  GSRRFLSLVEKDGTMASSLVAEVTDGSSNVREVW  297



>gb|AFK36874.1| unknown [Medicago truncatula]
 gb|KEH21595.1| methyltransferase family protein [Medicago truncatula]
Length=311

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 58/92 (63%), Gaps = 6/92 (7%)
 Frame = -2

Query  512  ASDADQGES-GYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAA  336
             +DA   E  GYD ILM E  YS+ SL+ LY+LIKKCL  P GV+Y+A K+ Y G     
Sbjct  215  GTDAKHNEGFGYDFILMAETVYSINSLQNLYNLIKKCLLRPQGVVYMAAKKYYFGVGGGT  274

Query  335  RHLRSLVDEEGVFGAHLVTELTD-----REIW  255
            R   S+V+++G+  +++V E+TD     RE+W
Sbjct  275  RRFLSVVEKDGILTSNMVAEITDGSSNVREVW  306



>ref|XP_002300145.1| hypothetical protein POPTR_0001s32830g [Populus trichocarpa]
 gb|EEE84950.1| hypothetical protein POPTR_0001s32830g [Populus trichocarpa]
Length=301

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 53/83 (64%), Gaps = 5/83 (6%)
 Frame = -2

Query  488  SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDE  309
            SGYD++LM E  YS+++   LYSLIKKCL  P GV+Y+A K++Y G     R   S+V++
Sbjct  215  SGYDIVLMAETIYSISAQHNLYSLIKKCLSHPGGVVYMAAKKHYFGVGGGTRQFLSMVEK  274

Query  308  EGVFGAHLVTELTD-----REIW  255
            +G   A LV E+ D     RE+W
Sbjct  275  DGAMAASLVAEVADGSSNVREVW  297



>ref|XP_006369821.1| hypothetical protein POPTR_0001s32830g [Populus trichocarpa]
 gb|ERP66390.1| hypothetical protein POPTR_0001s32830g [Populus trichocarpa]
Length=213

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 53/84 (63%), Gaps = 5/84 (6%)
 Frame = -2

Query  491  ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVD  312
             SGYD++LM E  YS+++   LYSLIKKCL  P GV+Y+A K++Y G     R   S+V+
Sbjct  126  HSGYDIVLMAETIYSISAQHNLYSLIKKCLSHPGGVVYMAAKKHYFGVGGGTRQFLSMVE  185

Query  311  EEGVFGAHLVTELTD-----REIW  255
            ++G   A LV E+ D     RE+W
Sbjct  186  KDGAMAASLVAEVADGSSNVREVW  209



>ref|XP_011073784.1| PREDICTED: histidine protein methyltransferase 1 homolog [Sesamum 
indicum]
Length=308

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 55/83 (66%), Gaps = 5/83 (6%)
 Frame = -2

Query  488  SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDE  309
            +GYDVILM E  YS+++L  LY LIKKCL  P+GV+Y+A K+ Y G    +R   +LV++
Sbjct  221  AGYDVILMAETVYSISALPNLYKLIKKCLSYPHGVVYMAAKKYYFGVGGGSRRFLALVEK  280

Query  308  EGVFGAHLVTELTD-----REIW  255
            +G F + LV E+ D     RE+W
Sbjct  281  DGAFVSSLVAEVADGSSNVREVW  303



>ref|XP_010527454.1| PREDICTED: histidine protein methyltransferase 1 homolog [Tarenaya 
hassleriana]
Length=300

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 53/83 (64%), Gaps = 5/83 (6%)
 Frame = -2

Query  488  SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDE  309
            SGYD+ILM E  YS++  + LY LIKKCL  P GV+Y+A K+ Y G     R   S+++ 
Sbjct  213  SGYDIILMAETIYSISGQQSLYGLIKKCLACPNGVVYMAAKKYYFGVGGGTRQFLSMIER  272

Query  308  EGVFGAHLVTELTD-----REIW  255
            +GV  + LV+E+TD     RE+W
Sbjct  273  DGVLASTLVSEITDGSSNVREVW  295



>ref|XP_008792356.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Phoenix dactylifera]
Length=278

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 58/95 (61%), Gaps = 7/95 (7%)
 Frame = -2

Query  518  ERASD--ADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFN  345
            ++A+D    +G  GYD+ILM E  Y+++SL  LY LIKKCL  P GV+Y+A K++Y G  
Sbjct  179  QKATDDPEQKGCDGYDIILMAETVYALSSLHSLYGLIKKCLHHPSGVIYMAGKKHYFGVG  238

Query  344  SAARHLRSLVDEEGVFGAHLVTELTD-----REIW  255
               R    LV E+G+  A L+ E+ D     RE+W
Sbjct  239  GGTRQFLHLVKEDGIMEACLLAEVADGSSNVREVW  273



>ref|XP_006284234.1| hypothetical protein CARUB_v10005396mg [Capsella rubella]
 gb|EOA17132.1| hypothetical protein CARUB_v10005396mg [Capsella rubella]
Length=290

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 55/84 (65%), Gaps = 5/84 (6%)
 Frame = -2

Query  491  ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVD  312
            + GYD+ILM E  YS+++ K LY LIK+CL  P GV+Y+A K+ Y G     R   S+++
Sbjct  202  KGGYDIILMAETIYSISAQKSLYGLIKRCLAYPDGVVYMAAKKYYFGVGGGTRQFLSMIE  261

Query  311  EEGVFGAHLVTELTD-----REIW  255
            ++GV  + LV+E+TD     RE+W
Sbjct  262  KDGVLASTLVSEVTDGSSNVREVW  285



>gb|KFK36305.1| hypothetical protein AALP_AA4G105100 [Arabis alpina]
Length=285

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 56/88 (64%), Gaps = 6/88 (7%)
 Frame = -2

Query  500  DQGESG-YDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLR  324
            D  E G YD+ILM E  YS+++ K LY LIKKCL  P G +Y+A K+ Y G     R   
Sbjct  193  DGDEKGCYDIILMAETIYSISAQKSLYELIKKCLANPDGAVYMAAKKYYFGVGGGTRQFL  252

Query  323  SLVDEEGVFGAHLVTELTD-----REIW  255
            S+++++GVF + LV+E+TD     RE+W
Sbjct  253  SMIEKDGVFASTLVSEVTDGSSNVREVW  280



>ref|XP_008792354.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Phoenix dactylifera]
 ref|XP_008792355.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Phoenix dactylifera]
Length=318

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 58/95 (61%), Gaps = 7/95 (7%)
 Frame = -2

Query  518  ERASD--ADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFN  345
            ++A+D    +G  GYD+ILM E  Y+++SL  LY LIKKCL  P GV+Y+A K++Y G  
Sbjct  219  QKATDDPEQKGCDGYDIILMAETVYALSSLHSLYGLIKKCLHHPSGVIYMAGKKHYFGVG  278

Query  344  SAARHLRSLVDEEGVFGAHLVTELTD-----REIW  255
               R    LV E+G+  A L+ E+ D     RE+W
Sbjct  279  GGTRQFLHLVKEDGIMEACLLAEVADGSSNVREVW  313



>emb|CDP20792.1| unnamed protein product [Coffea canephora]
Length=310

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = -2

Query  509  SDADQGES-GYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAAR  333
            SD + G   GYDVILM E  Y++ +L  LY L+KKCL  P+GV+Y+A K++Y G    +R
Sbjct  215  SDQEVGNGVGYDVILMAETVYAIYALPMLYQLVKKCLTSPHGVVYMAAKKHYFGVGGGSR  274

Query  332  HLRSLVDEEGVFGAHLVTELTD-----REIW  255
               S+V+++GV  + +V E+ D     RE+W
Sbjct  275  RFLSIVEKDGVLASTMVAEIADGSSNLREVW  305



>ref|XP_009373561.1| PREDICTED: histidine protein methyltransferase 1 homolog [Pyrus 
x bretschneideri]
Length=301

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 53/81 (65%), Gaps = 5/81 (6%)
 Frame = -2

Query  482  YDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDEEG  303
            YD+ILM E  YS+++L  LY LIKKCL P +GV+Y+A K++Y G     R   S+V+++G
Sbjct  216  YDIILMAETVYSISTLPHLYELIKKCLTPSHGVVYMAAKKHYFGVGGGTRRFLSVVEKDG  275

Query  302  VFGAHLVTELTD-----REIW  255
            V  + LV E+ D     RE+W
Sbjct  276  VLASSLVAEVADGSSNVREVW  296



>ref|XP_009139570.1| PREDICTED: histidine protein methyltransferase 1 homolog [Brassica 
rapa]
Length=291

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 57/91 (63%), Gaps = 6/91 (7%)
 Frame = -2

Query  509  SDADQG-ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAAR  333
            +D + G + GYD+ILM E  YS+++ K LY LIK CL  P G +Y+A K+ Y G     R
Sbjct  196  NDGETGTKGGYDIILMAETIYSISAQKSLYELIKTCLANPNGAVYMAAKKYYFGVGGGTR  255

Query  332  HLRSLVDEEGVFGAHLVTELTD-----REIW  255
               S+V+++GV  + LV+E+TD     RE+W
Sbjct  256  QFLSMVEKDGVLASTLVSEVTDGSSNVREVW  286



>ref|XP_010435209.1| PREDICTED: histidine protein methyltransferase 1 homolog [Camelina 
sativa]
Length=290

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 54/84 (64%), Gaps = 5/84 (6%)
 Frame = -2

Query  491  ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVD  312
            + GYD+ILM E  YS+++ K LY LIK+CL  P G +Y+A K+ Y G     R   S+++
Sbjct  202  KGGYDIILMAETIYSISAQKSLYGLIKRCLAYPGGAVYMAAKKYYFGVGGGTRQFLSMIE  261

Query  311  EEGVFGAHLVTELTD-----REIW  255
            ++GV  + LV+E+TD     RE+W
Sbjct  262  DDGVLASTLVSEVTDGSSNVREVW  285



>ref|XP_010450136.1| PREDICTED: histidine protein methyltransferase 1 homolog [Camelina 
sativa]
Length=290

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 54/84 (64%), Gaps = 5/84 (6%)
 Frame = -2

Query  491  ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVD  312
            + GYD+ILM E  YS+++ K LY LIK+CL  P G +Y+A K+ Y G     R   S+++
Sbjct  202  KGGYDIILMAETIYSISAQKSLYGLIKRCLAYPDGAVYMAAKKYYFGVGGGTRQFLSMIE  261

Query  311  EEGVFGAHLVTELTD-----REIW  255
            ++GV  + LV+E+TD     RE+W
Sbjct  262  KDGVLASTLVSEVTDGSSNVREVW  285



>ref|XP_008358052.1| PREDICTED: histidine protein methyltransferase 1 homolog [Malus 
domestica]
Length=301

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 53/81 (65%), Gaps = 5/81 (6%)
 Frame = -2

Query  482  YDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDEEG  303
            YD+ILM E  YS+++L  LY LIKKCL P +GV+Y+A K++Y G     R   S+V+++G
Sbjct  216  YDIILMAETVYSISTLPHLYELIKKCLTPSHGVVYMAAKKHYFGVGGGTRRFLSVVEKDG  275

Query  302  VFGAHLVTELTD-----REIW  255
            V  + +V E+ D     RE+W
Sbjct  276  VLASCMVAEVADGSSNVREVW  296



>emb|CDY01181.1| BnaA04g06380D [Brassica napus]
Length=291

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 57/91 (63%), Gaps = 6/91 (7%)
 Frame = -2

Query  509  SDADQGE-SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAAR  333
            +D + G+  GYD+ILM E  YS+++ K LY LIK CL  P G +Y+A K+ Y G     R
Sbjct  196  NDGETGKKGGYDIILMAETIYSISAQKSLYELIKTCLANPNGAVYMAAKKYYFGVGGGTR  255

Query  332  HLRSLVDEEGVFGAHLVTELTD-----REIW  255
               S+++++GV  + LV+E+TD     RE+W
Sbjct  256  QFLSMIEKDGVLASTLVSEVTDGSSNVREVW  286



>ref|XP_011003636.1| PREDICTED: histidine protein methyltransferase 1 homolog [Populus 
euphratica]
Length=301

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 52/83 (63%), Gaps = 5/83 (6%)
 Frame = -2

Query  488  SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDE  309
            SGYD++LM E  YS+++   L+ LIKKCL  P GV+Y+A K++Y G     R   S+V++
Sbjct  215  SGYDIVLMAETIYSISAQHNLFGLIKKCLSHPDGVVYMAAKKHYFGVGGGTRQFLSIVEK  274

Query  308  EGVFGAHLVTELTD-----REIW  255
            +G   A LV E+ D     RE+W
Sbjct  275  DGAMAASLVAEVADGSSNVREVW  297



>ref|XP_004296995.1| PREDICTED: histidine protein methyltransferase 1 homolog [Fragaria 
vesca subsp. vesca]
Length=301

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 56/92 (61%), Gaps = 5/92 (5%)
 Frame = -2

Query  515  RASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAA  336
              S     +  YD+ILM E  YS+++L+ LY LIKKC+  P+GV+YLA K++Y G     
Sbjct  205  NVSSGQNPDPHYDIILMAETVYSISTLQHLYELIKKCITRPHGVVYLAAKKHYFGVGGGT  264

Query  335  RHLRSLVDEEGVFGAHLVTELTD-----REIW  255
            R   S+V+++GV  + +V E+ D     RE+W
Sbjct  265  RRFLSVVEKDGVLVSSMVAEVADGSSNVREVW  296



>ref|XP_010450119.1| PREDICTED: histidine protein methyltransferase 1 homolog [Camelina 
sativa]
Length=290

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 54/84 (64%), Gaps = 5/84 (6%)
 Frame = -2

Query  491  ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVD  312
            + GYD+ILM E  YS+++ K LY LIK+CL  P G +Y+A K+ Y G     R   S+++
Sbjct  202  KGGYDIILMAETIYSISAQKSLYGLIKRCLVYPDGAVYMAAKKYYFGVGGGTRQFLSMIE  261

Query  311  EEGVFGAHLVTELTD-----REIW  255
            ++GV  + LV+E+TD     RE+W
Sbjct  262  KDGVLASTLVSEVTDGSSNVREVW  285



>ref|XP_008222747.1| PREDICTED: histidine protein methyltransferase 1 homolog [Prunus 
mume]
Length=301

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 53/81 (65%), Gaps = 5/81 (6%)
 Frame = -2

Query  482  YDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDEEG  303
            YD+ILM E  YS+++L  LY LIKKC+ P +GV+Y+A K++Y G     R   S+V+++G
Sbjct  216  YDIILMAETVYSISALPHLYELIKKCITPSHGVVYMAAKKHYFGVGGGTRRFLSVVEKDG  275

Query  302  VFGAHLVTELTD-----REIW  255
            V  + +V E+ D     RE+W
Sbjct  276  VLASSMVAEVADGSSNVREVW  296



>ref|XP_003578016.1| PREDICTED: histidine protein methyltransferase 1 homolog [Brachypodium 
distachyon]
Length=306

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = -2

Query  500  DQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRS  321
            + G SGYD+ILM E  Y++ SL  LY LIKKCL  P GV+Y+A K++Y G     R    
Sbjct  215  NDGHSGYDIILMAETVYALDSLPSLYRLIKKCLHYPGGVVYMAGKKHYFGVGGGTRQFLR  274

Query  320  LVDEEGVFGAHLVTELTD-----REIW  255
            L  E+G   + L+ E+TD     RE+W
Sbjct  275  LAAEDGTMQSDLLAEVTDGSSNVREVW  301



>ref|XP_006661157.1| PREDICTED: histidine protein methyltransferase 1 homolog [Oryza 
brachyantha]
Length=310

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 57/101 (56%), Gaps = 16/101 (16%)
 Frame = -2

Query  509  SDADQGES-----------GYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKR  363
            +DADQ +S           GYD+ILM E  Y+V+SL  LY LIKKCL  P G++Y+A K+
Sbjct  205  ADADQDKSTNSHENNKAYNGYDIILMAETVYAVSSLPNLYRLIKKCLHYPGGIVYMAGKK  264

Query  362  NYVGFNSAARHLRSLVDEEGVFGAHLVTELTD-----REIW  255
            +Y G     R    LV E+G   + L+ E+ D     RE+W
Sbjct  265  HYFGVGGGTRQFVRLVTEDGAMQSDLLAEVADGSSNVREVW  305



>ref|XP_002870342.1| hypothetical protein ARALYDRAFT_493511 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46601.1| hypothetical protein ARALYDRAFT_493511 [Arabidopsis lyrata subsp. 
lyrata]
Length=295

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 56/92 (61%), Gaps = 6/92 (7%)
 Frame = -2

Query  515  RASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAA  336
            R  + D+ + GYDVILM E  YS+++ K LY LIK+CL  P G +Y+A K+ Y G     
Sbjct  200  RDGETDK-KGGYDVILMAETIYSISAQKSLYQLIKRCLAYPDGAVYMAAKKYYFGVGGGT  258

Query  335  RHLRSLVDEEGVFGAHLVTELTD-----REIW  255
            R   S+++++G   + LV E+TD     RE+W
Sbjct  259  RQFLSMIEKDGALASTLVAEVTDGSSNVREVW  290



>gb|EAZ08782.1| hypothetical protein OsI_31043 [Oryza sativa Indica Group]
Length=426

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -2

Query  500  DQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRS  321
            D   +GYD+ILM E  Y+V+SL  LY LIKKCLR P G++Y+A K++Y G     RH   
Sbjct  219  DTAYNGYDIILMAETVYAVSSLPNLYRLIKKCLRYPGGIVYMAGKKHYFGVGGGTRHFVR  278

Query  320  LVDEEGVFGAHLVTELTD  267
            LV E+G   + L+ E+ D
Sbjct  279  LVTEDGAMQSDLLAEVAD  296



>ref|XP_009392918.1| PREDICTED: histidine protein methyltransferase 1 homolog [Musa 
acuminata subsp. malaccensis]
Length=316

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 53/82 (65%), Gaps = 5/82 (6%)
 Frame = -2

Query  485  GYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDEE  306
            GYDVILM E  Y+++SL  LY LIK+C+  P GV+Y+A K++Y G     R   +LV+E+
Sbjct  230  GYDVILMAETVYALSSLHCLYELIKRCMHRPSGVVYMAGKKHYFGVGGGTRQFVNLVEED  289

Query  305  GVFGAHLVTELTD-----REIW  255
            G+  A L+ E+ D     RE+W
Sbjct  290  GILTACLLAEVADGSSNVREVW  311



>gb|KFK36303.1| hypothetical protein AALP_AA4G104900 [Arabis alpina]
Length=126

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 56/91 (62%), Gaps = 6/91 (7%)
 Frame = -2

Query  509  SDADQGESG-YDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAAR  333
            +D +  + G Y +ILM E  YS+++ K LY LIKKCL  P G + +A K+ Y G     R
Sbjct  31   NDGETDKKGCYGIILMAETIYSISAQKSLYELIKKCLANPDGAVCMAAKKYYFGVGGGTR  90

Query  332  HLRSLVDEEGVFGAHLVTELTD-----REIW  255
               S+++++GVF + +V+E+TD     RE+W
Sbjct  91   QFLSMIEKDGVFASTMVSEVTDGSSNVREVW  121



>gb|ACR38362.1| unknown [Zea mays]
Length=113

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 50/83 (60%), Gaps = 5/83 (6%)
 Frame = -2

Query  488  SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDE  309
            +GYD+ILM E  Y+V+ L  LY LIKKCLR P GV+Y+A K++Y G     R    LV++
Sbjct  26   NGYDIILMAETVYAVSCLPNLYRLIKKCLRYPGGVVYMAGKKHYFGVGGGTRQFLRLVEK  85

Query  308  EGVFGAHLVTELTD-----REIW  255
            +G      + ++ D     RE+W
Sbjct  86   DGAMHPERLNDVADGSSNVREVW  108



>ref|XP_006492532.1| PREDICTED: histidine protein methyltransferase 1 homolog [Citrus 
sinensis]
Length=289

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 53/88 (60%), Gaps = 5/88 (6%)
 Frame = -2

Query  503  ADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLR  324
             D   SGYD+ILM E  YSV++ + LY LIKK +  P+GV+YLA K++Y G     R   
Sbjct  197  GDGPTSGYDIILMAETIYSVSAHQSLYGLIKKSISRPHGVVYLAAKKHYFGVGGGTRRFL  256

Query  323  SLVDEEGVFGAHLVTELTD-----REIW  255
            S+V+ +G   A LV E+ D     RE+W
Sbjct  257  SMVENDGSMDACLVAEVADGSSNVREVW  284



>ref|XP_007034208.1| Methyltransferase family protein [Theobroma cacao]
 gb|EOY05134.1| Methyltransferase family protein [Theobroma cacao]
Length=303

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 55/82 (67%), Gaps = 1/82 (1%)
 Frame = -2

Query  509  SDADQGE-SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAAR  333
            S ++ G+ +GYDVILM E  YS+ + + LY LIKKC+  P+GV+++A K++Y G     R
Sbjct  201  SSSEHGQATGYDVILMAETIYSIPAQRNLYRLIKKCMSHPHGVVFMAGKKHYFGVGGGTR  260

Query  332  HLRSLVDEEGVFGAHLVTELTD  267
               S+++++G   A L+TE+ D
Sbjct  261  QFLSMLEKDGAMTASLITEVAD  282



>ref|XP_008439038.1| PREDICTED: histidine protein methyltransferase 1 homolog [Cucumis 
melo]
Length=308

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 5/82 (6%)
 Frame = -2

Query  485  GYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDEE  306
            GYD++LM E  YS+++LK LY LI +CL  P+GV+YLA K++Y G     R   S++++E
Sbjct  222  GYDIVLMAETVYSLSTLKTLYKLITQCLSRPHGVVYLAGKKHYFGVGGGTRRFLSVLEKE  281

Query  305  GVFGAHLVTELTD-----REIW  255
            G   + L+ E+ D     RE+W
Sbjct  282  GEMVSKLIVEVADGSSNVREVW  303



>gb|EMS62208.1| hypothetical protein TRIUR3_09094 [Triticum urartu]
Length=229

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  500  DQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRS  321
            ++G  GY++ILM E  Y++ SL  LY LIKKCL  P GV+Y+A K++Y G     R    
Sbjct  77   NEGHRGYNIILMAETVYALDSLPSLYRLIKKCLHYPSGVVYMAGKKHYFGVGGGTRQFLR  136

Query  320  LVDEEGVFGAHLVTELTD  267
            LV E+G   + L+ E+TD
Sbjct  137  LVTEDGAMQSDLLAEVTD  154



>emb|CDY12725.1| BnaC04g29160D [Brassica napus]
Length=291

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 53/84 (63%), Gaps = 5/84 (6%)
 Frame = -2

Query  491  ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVD  312
            + GYD+ILM E  YS+++ K L  LIK+CL  P G +Y+A K+ Y G     R   S+++
Sbjct  203  KGGYDIILMAETIYSISAQKSLCELIKRCLAYPDGAVYMAAKKYYFGVGGGTRQFLSMIE  262

Query  311  EEGVFGAHLVTELTD-----REIW  255
            ++GV  + LV+E+TD     RE+W
Sbjct  263  KDGVLASTLVSEVTDGSSNVREVW  286



>ref|XP_004160640.1| PREDICTED: histidine protein methyltransferase 1 homolog [Cucumis 
sativus]
Length=308

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 53/82 (65%), Gaps = 5/82 (6%)
 Frame = -2

Query  485  GYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDEE  306
            GYD++LM E  Y++++LK LY LI +CL  P+GV+YLA K++Y G     R   S++++E
Sbjct  222  GYDIVLMAETVYALSTLKTLYKLITQCLSRPHGVVYLAGKKHYFGVGGGTRRFLSVLEKE  281

Query  305  GVFGAHLVTELTD-----REIW  255
            G   + L+ E+ D     RE+W
Sbjct  282  GEMVSKLIVEVADGSSNVREVW  303



>ref|XP_004147645.1| PREDICTED: histidine protein methyltransferase 1 homolog [Cucumis 
sativus]
 gb|KGN57226.1| hypothetical protein Csa_3G171830 [Cucumis sativus]
Length=308

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 53/82 (65%), Gaps = 5/82 (6%)
 Frame = -2

Query  485  GYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDEE  306
            GYD++LM E  Y++++LK LY LI +CL  P+GV+YLA K++Y G     R   S++++E
Sbjct  222  GYDIVLMAETVYALSTLKTLYKLITQCLSRPHGVVYLAGKKHYFGVGGGTRRFLSVLEKE  281

Query  305  GVFGAHLVTELTD-----REIW  255
            G   + L+ E+ D     RE+W
Sbjct  282  GEMVSKLIVEVADGSSNVREVW  303



>ref|XP_002532519.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29871.1| conserved hypothetical protein [Ricinus communis]
Length=303

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 52/83 (63%), Gaps = 5/83 (6%)
 Frame = -2

Query  488  SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDE  309
            S YDVILM E  YS+++ + LY LIKKC+R   GV++++ K++Y G     R   S+V++
Sbjct  216  SAYDVILMAETIYSISAQQCLYGLIKKCIRHSCGVVFMSAKKHYFGVGGGTRQFLSMVEK  275

Query  308  EGVFGAHLVTELTD-----REIW  255
            +G   A LV E+ D     RE+W
Sbjct  276  DGAMAASLVAEVADGSSNVREVW  298



>ref|XP_002965969.1| hypothetical protein SELMODRAFT_84048, partial [Selaginella moellendorffii]
 gb|EFJ33389.1| hypothetical protein SELMODRAFT_84048, partial [Selaginella moellendorffii]
Length=251

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 60/82 (73%), Gaps = 5/82 (6%)
 Frame = -2

Query  485  GYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDEE  306
            GYD+ILM++  YS +SL KLY+L+KKCLRP YGV+Y+A K++Y G    +R  +++V+++
Sbjct  165  GYDIILMSDTIYSSSSLSKLYTLLKKCLRPYYGVVYVAAKKHYFGRGGGSRQFKNMVEDD  224

Query  305  GVFGAHLVTELTD-----REIW  255
            G+ GAHLV E  D     RE+W
Sbjct  225  GILGAHLVAEFPDGYSSTREVW  246



>gb|EPS60086.1| hypothetical protein M569_14718, partial [Genlisea aurea]
Length=281

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 56/90 (62%), Gaps = 5/90 (6%)
 Frame = -2

Query  509  SDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARH  330
            +++++ +  YD+ILM+E  YS++SL  L+ LIKK LR   GV+Y+A K+ Y G     R 
Sbjct  187  ANSNESDGRYDIILMSETVYSISSLPNLFKLIKKRLRKSGGVVYMAAKKYYFGVGGGTRQ  246

Query  329  LRSLVDEEGVFGAHLVTELTD-----REIW  255
              S+V+E+G F   L+ E+T      RE+W
Sbjct  247  FISMVEEDGDFCCSLIAEITSGSSNIREVW  276



>ref|XP_004956645.1| PREDICTED: histidine protein methyltransferase 1 homolog [Setaria 
italica]
Length=313

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = -2

Query  500  DQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRS  321
            D+  +GYD+ILM E  Y+++SL  LY LIKKCL  P GV+Y+A K++Y G     R    
Sbjct  222  DKTYNGYDIILMAETVYALSSLPNLYRLIKKCLHYPGGVVYMAGKKHYFGVGGGTRQFLR  281

Query  320  LVDEEGVFGAHLVTELTD-----REIW  255
            L++E+G      + ++ D     RE+W
Sbjct  282  LIEEDGTMQTERLNDVADGSSNVREVW  308



>ref|NP_567417.1| putative methyltransferase family protein [Arabidopsis thaliana]
 gb|AAL62409.1| unknown protein [Arabidopsis thaliana]
 gb|AAM48033.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83359.1| putative methyltransferase family protein [Arabidopsis thaliana]
Length=290

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 52/84 (62%), Gaps = 5/84 (6%)
 Frame = -2

Query  491  ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVD  312
            + GYD+ILM E  YS+++ K  Y LIK+CL  P G +Y+A K+ Y G     R   S+++
Sbjct  202  KGGYDIILMAETIYSISAQKSQYELIKRCLAYPDGAVYMAAKKYYFGVGGGTRQFLSMIE  261

Query  311  EEGVFGAHLVTELTD-----REIW  255
            ++G   + LV+++TD     RE+W
Sbjct  262  KDGALASTLVSQVTDGSSNVREVW  285



>gb|AAM63649.1| unknown [Arabidopsis thaliana]
Length=290

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 52/84 (62%), Gaps = 5/84 (6%)
 Frame = -2

Query  491  ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVD  312
            + GYD+ILM E  YS+++ K  Y LIK+CL  P G +Y+A K+ Y G     R   S+++
Sbjct  202  KGGYDIILMAETIYSISAQKSQYELIKRCLAYPDGAVYMAAKKYYFGVGGGTRQFLSMIE  261

Query  311  EEGVFGAHLVTELTD-----REIW  255
            ++G   + LV+++TD     RE+W
Sbjct  262  KDGALASTLVSQVTDGSSNVREVW  285



>gb|EMT16017.1| hypothetical protein F775_04000 [Aegilops tauschii]
Length=335

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  500  DQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRS  321
            ++G  GYD+ILM E  Y++ SL  LY L+KKCL  P GV+Y+A K++Y G     R    
Sbjct  132  NEGYRGYDIILMAETVYALDSLPSLYRLVKKCLHYPSGVVYMAGKKHYFGVGGGTRQFLR  191

Query  320  LVDEEGVFGAHLVTELTD  267
            LV E+G   + L+ E+TD
Sbjct  192  LVREDGAMQSDLLAEVTD  209



>ref|XP_006421030.1| hypothetical protein CICLE_v10005461mg [Citrus clementina]
 gb|ESR34270.1| hypothetical protein CICLE_v10005461mg [Citrus clementina]
Length=317

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 52/88 (59%), Gaps = 5/88 (6%)
 Frame = -2

Query  503  ADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLR  324
             D   SGYD+ILM E  YSV++ + LY LIKK +  P+GV+YLA K++Y G     R   
Sbjct  225  GDGPTSGYDIILMAETIYSVSAHQSLYGLIKKSISRPHGVVYLAAKKHYFGVGGGTRRFL  284

Query  323  SLVDEEGVFGAHLVTELTD-----REIW  255
            S+V+ +    A LV E+ D     RE+W
Sbjct  285  SMVENDSSMDACLVAEVADGSSNVREVW  312



>emb|CBI39375.3| unnamed protein product [Vitis vinifera]
Length=81

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 5/76 (7%)
 Frame = -2

Query  467  MTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDEEGVFGAH  288
            M E  YS+++L  LY LIKK +  P+GVMY+A K++Y G    +R   S+V+++G+  A 
Sbjct  1    MAETVYSISALPTLYELIKKTMSRPHGVMYMAAKKHYFGVGGGSRRFLSVVEKDGIMVAS  60

Query  287  LVTELTD-----REIW  255
            LV E+TD     RE+W
Sbjct  61   LVAEVTDGSSNVREVW  76



>ref|NP_001169409.1| uncharacterized protein LOC100383278 [Zea mays]
 gb|ACN33665.1| unknown [Zea mays]
 tpg|DAA39939.1| TPA: hypothetical protein ZEAMMB73_125262 [Zea mays]
Length=310

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 50/83 (60%), Gaps = 5/83 (6%)
 Frame = -2

Query  488  SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDE  309
            +GYD+ILM E  Y+V+ L  LY LIKKCLR P GV+Y+A K++Y G     R    LV++
Sbjct  223  NGYDIILMAETVYAVSCLPNLYRLIKKCLRYPGGVVYMAGKKHYFGVGGGTRQFLRLVEK  282

Query  308  EGVFGAHLVTELTD-----REIW  255
            +G      + ++ D     RE+W
Sbjct  283  DGAMHPERLNDVADGSSNVREVW  305



>ref|XP_002460101.1| hypothetical protein SORBIDRAFT_02g022780 [Sorghum bicolor]
 gb|EER96622.1| hypothetical protein SORBIDRAFT_02g022780 [Sorghum bicolor]
Length=440

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  488  SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDE  309
            +GYD+ILM E  Y+++SL  LY LIKKCLR P GV+Y+A K++Y G     R    LV++
Sbjct  226  NGYDIILMAETVYALSSLPNLYRLIKKCLRYPGGVVYMAGKKHYFGVGGGTRQFLRLVEK  285

Query  308  EGV  300
            +GV
Sbjct  286  DGV  288



>ref|XP_008222847.1| PREDICTED: LOW QUALITY PROTEIN: histidine protein methyltransferase 
1 homolog [Prunus mume]
Length=200

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  491  ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVD  312
            ++ YD+ILM E  YS+++L  LY LIKKC+ P +GV+Y+A K++Y G     R   S+V+
Sbjct  135  DAQYDIILMAETVYSISALPHLYELIKKCITPSHGVVYMAAKKHYFGVGGGTRRFLSIVE  194

Query  311  EEG  303
            ++G
Sbjct  195  KDG  197



>gb|KJB71878.1| hypothetical protein B456_011G152100 [Gossypium raimondii]
Length=291

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = -2

Query  512  ASDADQGE-SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAA  336
             S ++ G+ S YDVILM E  YS+++ + LY LIKKC+  P GV+YLA K++Y G     
Sbjct  200  TSSSEHGQASAYDVILMAETIYSISAQRNLYGLIKKCMNQPNGVVYLAGKKHYFGVGGGT  259

Query  335  RHLRSLVDEEG  303
            R   S++++EG
Sbjct  260  RQFLSMLEKEG  270



>gb|KHG01812.1| Histidine protein methyltransferase 1 [Gossypium arboreum]
Length=330

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = -2

Query  512  ASDADQGE-SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAA  336
             S ++ G+ S YDVILM E  YS+++ + LY LIKKC+  P GV+YLA K++Y G     
Sbjct  200  TSSSEHGQASAYDVILMAETIYSISAQRNLYGLIKKCMNQPNGVVYLAGKKHYFGVGGGT  259

Query  335  RHLRSLVDEEG  303
            R   S++++EG
Sbjct  260  RQFLSMLEKEG  270



>ref|XP_007222358.1| hypothetical protein PRUPE_ppa009767mg [Prunus persica]
 gb|EMJ23557.1| hypothetical protein PRUPE_ppa009767mg [Prunus persica]
Length=278

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -2

Query  482  YDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDEEG  303
            YD+ILM E  YS+++L  LY LIKKC+ P +GV+Y+A K++Y G     R   S+V+++G
Sbjct  216  YDIILMAETVYSISALPHLYELIKKCITPSHGVVYMAAKKHYFGVGGGTRRFLSIVEKDG  275



>gb|KJB71879.1| hypothetical protein B456_011G152100 [Gossypium raimondii]
Length=277

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = -2

Query  512  ASDADQGE-SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAA  336
             S ++ G+ S YDVILM E  YS+++ + LY LIKKC+  P GV+YLA K++Y G     
Sbjct  200  TSSSEHGQASAYDVILMAETIYSISAQRNLYGLIKKCMNQPNGVVYLAGKKHYFGVGGGT  259

Query  335  RHLRSLVDEE  306
            R   S++++E
Sbjct  260  RQFLSMLEKE  269



>ref|XP_002952933.1| hypothetical protein VOLCADRAFT_105747 [Volvox carteri f. nagariensis]
 gb|EFJ45855.1| hypothetical protein VOLCADRAFT_105747 [Volvox carteri f. nagariensis]
Length=304

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = -2

Query  482  YDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDEEG  303
            YD+IL +E  YSV + ++L   IK+ L+PP+GV  +A+KR Y G     +  RSLV+ +G
Sbjct  210  YDLILSSETIYSVPAQERLLECIKQLLQPPHGVALIASKRYYFGVGGGMKSFRSLVERDG  269

Query  302  VFGAHLVTELTDR  264
            +F A +V ++ D+
Sbjct  270  IFEASIVAQVGDK  282



>ref|XP_004352569.1| methyltransferase domain containing protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR23092.1| methyltransferase domain containing protein [Acanthamoeba castellanii 
str. Neff]
Length=264

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = -2

Query  482  YDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDEEG  303
            YDVIL  E  Y+V SL +L++LIK CL+PP+GV Y+A K  Y       R    +V ++G
Sbjct  176  YDVILTAETIYNVQSLPRLFALIKHCLKPPHGVCYVAAKNYYFSVGGGCRQFEEMVKKDG  235

Query  302  VF  297
            +F
Sbjct  236  LF  237



>ref|XP_005847578.1| hypothetical protein CHLNCDRAFT_133833 [Chlorella variabilis]
 gb|EFN55476.1| hypothetical protein CHLNCDRAFT_133833 [Chlorella variabilis]
Length=364

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 0/72 (0%)
 Frame = -2

Query  482  YDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDEEG  303
            YD++L  E  YS+ +++ LY  IK CLRP  GV Y+A K  Y G        R LV+ +G
Sbjct  262  YDMVLTAETIYSLEAMRSLYRCIKACLRPGAGVAYVAAKSYYFGVGGGTAAFRQLVEADG  321

Query  302  VFGAHLVTELTD  267
            VF    V  + D
Sbjct  322  VFACRAVAVVDD  333



>emb|CAB10179.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78442.1| hypothetical protein [Arabidopsis thaliana]
Length=269

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -2

Query  491  ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVD  312
            + GYD+ILM E  YS+++ K  Y LIK+CL  P G +Y+A K+ Y G     R   S+++
Sbjct  185  KGGYDIILMAETIYSISAQKSQYELIKRCLAYPDGAVYMAAKKYYFGVGGGTRQFLSMIE  244

Query  311  EEG  303
            ++G
Sbjct  245  KDG  247



>emb|CDY14698.1| BnaC05g19550D [Brassica napus]
Length=195

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -2

Query  491  ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVD  312
            + GYD+ILM E  YS+++ K LY LIK+CL    G +Y+A K+ Y G     R   S+++
Sbjct  102  KGGYDIILMAETLYSISAQKSLYELIKRCLAYHDGAVYMAAKKYYFGVGGGTRQFLSMIE  161

Query  311  EEGVFG  294
            ++G  G
Sbjct  162  KDGKNG  167



>emb|CDX99963.1| BnaC09g27420D [Brassica napus]
Length=235

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -2

Query  491  ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVD  312
            + GYD+ILM E  YS+++ K+LY LIK+CL    G +Y+A K+ Y G     R   S+++
Sbjct  155  KGGYDIILMAETLYSISAQKRLYELIKRCLAYHDGAVYMAAKKYYFGVGGGTRQFLSMIE  214

Query  311  EEGVFG  294
            ++G  G
Sbjct  215  KDGKNG  220



>ref|XP_001694366.1| hypothetical protein CHLREDRAFT_173838 [Chlamydomonas reinhardtii]
 gb|EDP02799.1| predicted protein [Chlamydomonas reinhardtii]
Length=260

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = -2

Query  482  YDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDEEG  303
            YD+IL +E  YSV + ++L   IK+ L+PP+GV  +A KR Y G    ++  + LV+ +G
Sbjct  169  YDLILSSETIYSVPAQERLLECIKRLLQPPHGVALVAAKRYYFGVGGGSKSFKELVERDG  228

Query  302  VFGAHLVTE  276
            +F   +V E
Sbjct  229  IFETSVVEE  237



>gb|KHN00212.1| hypothetical protein glysoja_047383, partial [Glycine soja]
Length=178

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = -2

Query  500  DQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAAR  333
            +QG+ GY+ I+M E  YS+  L+ LY LIKKCL+ P GV+Y+A K+ Y G     +
Sbjct  124  NQGD-GYEFIVMAETVYSINRLQNLYDLIKKCLQHPDGVVYMAAKKYYFGVGGGTQ  178



>ref|XP_002740457.1| PREDICTED: histidine protein methyltransferase 1 homolog [Saccoglossus 
kowalevskii]
Length=305

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 45/87 (52%), Gaps = 4/87 (5%)
 Frame = -2

Query  509  SDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARH  330
            S+    E  +DVIL +E  Y+V SL KL+ +IK  L+   GV+YLA K +Y G     R 
Sbjct  213  SNMPNDEDKFDVILTSETIYNVDSLDKLHQIIKSTLKID-GVVYLAAKTHYFGVGGGTRL  271

Query  329  LRSLVDEEGVFGAHLVTELTD---REI  258
               LV  EG F   +    +D   REI
Sbjct  272  FEELVQREGYFTITVCKTCSDGVQREI  298



>ref|XP_002605872.1| hypothetical protein BRAFLDRAFT_90801 [Branchiostoma floridae]
 gb|EEN61882.1| hypothetical protein BRAFLDRAFT_90801 [Branchiostoma floridae]
Length=188

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 4/78 (5%)
 Frame = -2

Query  482  YDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDEEG  303
            YDVIL +E  Y+ AS +KL+ L+K  L P  G +YLA K +Y G     R     + +E 
Sbjct  104  YDVILTSETIYNTASYQKLHDLMKSVLAPN-GTVYLAAKTHYFGVGGGTRLFEEFLRKED  162

Query  302  VFGAHLV---TELTDREI  258
            VF + +    +E  +REI
Sbjct  163  VFSSEVCKVYSEGVNREI  180



>gb|ESA23413.1| hypothetical protein GLOINDRAFT_342180 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX78032.1| Hpm1p [Rhizophagus irregularis DAOM 197198w]
Length=336

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 39/69 (57%), Gaps = 0/69 (0%)
 Frame = -2

Query  491  ESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVD  312
            +  YD+IL +E  Y+  SL KLY++IK  L+ P GV  +A K  Y G        R L++
Sbjct  246  QEKYDLILSSETIYNTDSLPKLYNVIKYSLKRPSGVALIAAKSIYFGVGGGVLPFRQLIE  305

Query  311  EEGVFGAHL  285
            ++ VFG  +
Sbjct  306  QDKVFGIKI  314



>ref|XP_003727461.1| PREDICTED: histidine protein methyltransferase 1 homolog [Strongylocentrotus 
purpuratus]
Length=99

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 4/80 (5%)
 Frame = -2

Query  488  SGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDE  309
            S YDVIL +E  YS+ S  +LY++I+  L+P  G ++LA K +Y G     R     V E
Sbjct  6    SRYDVILTSETIYSLDSQPRLYNIIRSLLKPN-GKVFLAAKTHYFGVGGGTRQFEDFVRE  64

Query  308  EGVF---GAHLVTELTDREI  258
            +G F      ++++   REI
Sbjct  65   KGEFEIESIKVISQGVRREI  84



>ref|XP_006564114.1| PREDICTED: histidine protein methyltransferase 1 homolog [Apis 
mellifera]
Length=281

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 44/83 (53%), Gaps = 4/83 (5%)
 Frame = -2

Query  521  WE---RASDADQGESGYDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVG  351
            WE   +  + D+G  GYD+I  +E  Y+  + KKLY + K+ L    GV ++A K  Y G
Sbjct  183  WESFTKLCNDDKGFIGYDLIFTSETIYNPNNHKKLYEVFKQKLNQN-GVGFIAGKSYYFG  241

Query  350  FNSAARHLRSLVDEEGVFGAHLV  282
                 R   +L+ E+G+F   +V
Sbjct  242  VGGGMRQFENLIIEDGIFDVKIV  264



>ref|XP_005646641.1| hypothetical protein COCSUDRAFT_83488, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22097.1| hypothetical protein COCSUDRAFT_83488, partial [Coccomyxa subellipsoidea 
C-169]
Length=319

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 38/72 (53%), Gaps = 0/72 (0%)
 Frame = -2

Query  482  YDVILMTEIPYSVASLKKLYSLIKKCLRPPYGVMYLATKRNYVGFNSAARHLRSLVDEEG  303
            YD++L  E  YS+ S ++L + I++CL+P  G  ++A K  Y G          LV ++G
Sbjct  234  YDIVLSAETVYSLDSQQQLLNCIRQCLKPDVGKAWIAAKSYYFGVGGGTASFTRLVKQDG  293

Query  302  VFGAHLVTELTD  267
             F   +V  + D
Sbjct  294  TFEVKVVDVIDD  305



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1360982043420