BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF034I06

Length=733
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAD94991.1|  cytoplasmic aconitate hydratase                        304   5e-99   Arabidopsis thaliana [mouse-ear cress]
gb|EEC83021.1|  hypothetical protein OsI_28098                          310   9e-98   Oryza sativa Indica Group [Indian rice]
ref|XP_004158846.1|  PREDICTED: aconitate hydratase-like                295   1e-97   
gb|AFW61053.1|  hypothetical protein ZEAMMB73_482448                    307   9e-97   
ref|NP_001136484.1|  uncharacterized protein LOC100216599               305   1e-96   
ref|XP_008455442.1|  PREDICTED: aconitate hydratase, cytoplasmic        314   3e-96   Cucumis melo [Oriental melon]
ref|XP_010533008.1|  PREDICTED: aconitate hydratase 2, mitochondr...    305   2e-95   
gb|KCW88791.1|  hypothetical protein EUGRSUZ_A01129                     308   2e-95   Eucalyptus grandis [rose gum]
sp|Q6YZX6.1|ACOC_ORYSJ  RecName: Full=Putative aconitate hydratas...    310   3e-95   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009601350.1|  PREDICTED: aconitate hydratase, cytoplasmic        311   3e-95   Nicotiana tomentosiformis
ref|XP_006351962.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    311   4e-95   Solanum tuberosum [potatoes]
ref|XP_004144496.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    311   4e-95   Cucumis sativus [cucumbers]
ref|XP_004251517.2|  PREDICTED: aconitate hydratase, cytoplasmic        311   4e-95   Solanum lycopersicum
gb|EEE68177.1|  hypothetical protein OsJ_26310                          310   5e-95   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004159202.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    310   6e-95   
ref|XP_011100304.1|  PREDICTED: aconitate hydratase, cytoplasmic        310   7e-95   Sesamum indicum [beniseed]
ref|XP_002445174.1|  hypothetical protein SORBIDRAFT_07g005390          310   1e-94   Sorghum bicolor [broomcorn]
ref|XP_003540302.1|  PREDICTED: aconitate hydratase 2, mitochondr...    310   1e-94   Glycine max [soybeans]
gb|AFW61054.1|  hypothetical protein ZEAMMB73_482448                    306   1e-94   
gb|KDP22711.1|  hypothetical protein JCGZ_01813                         310   2e-94   Jatropha curcas
ref|XP_009770911.1|  PREDICTED: aconitate hydratase, cytoplasmic        309   2e-94   Nicotiana sylvestris
ref|XP_002321126.2|  hypothetical protein POPTR_0014s15170g             309   3e-94   Populus trichocarpa [western balsam poplar]
ref|XP_010100637.1|  Aconitate hydratase                                308   3e-94   
ref|XP_007149973.1|  hypothetical protein PHAVU_005G115100g             308   4e-94   Phaseolus vulgaris [French bean]
ref|NP_001159192.1|  uncharacterized protein LOC100304277               290   4e-94   
ref|XP_008230066.1|  PREDICTED: aconitate hydratase, cytoplasmic        308   4e-94   Prunus mume [ume]
ref|XP_011047264.1|  PREDICTED: aconitate hydratase, cytoplasmic        308   4e-94   Populus euphratica
ref|XP_007217144.1|  hypothetical protein PRUPE_ppa000812mg             308   4e-94   Prunus persica
dbj|BAE71240.1|  putative cytoplasmic aconitate hydratase               291   5e-94   Trifolium pratense [peavine clover]
gb|KJB62843.1|  hypothetical protein B456_009G439700                    294   5e-94   Gossypium raimondii
gb|KHN36531.1|  Aconitate hydratase, cytoplasmic                        308   5e-94   Glycine soja [wild soybean]
ref|XP_003543388.1|  PREDICTED: aconitate hydratase 2, mitochondr...    308   5e-94   Glycine max [soybeans]
ref|XP_010046497.1|  PREDICTED: aconitate hydratase, cytoplasmic        308   6e-94   Eucalyptus grandis [rose gum]
ref|XP_008676648.1|  PREDICTED: uncharacterized protein LOC100216...    307   1e-93   
gb|ADM34980.1|  cytosolic aconitase                                     305   2e-93   Pyrus pyrifolia [sha li]
gb|KHN21232.1|  Aconitate hydratase, cytoplasmic                        305   2e-93   Glycine soja [wild soybean]
emb|CDY18054.1|  BnaC07g04160D                                          306   2e-93   Brassica napus [oilseed rape]
gb|AAD25640.1|  cytoplasmic aconitate hydratase                         305   2e-93   Arabidopsis thaliana [mouse-ear cress]
gb|KFK39331.1|  hypothetical protein AALP_AA3G230700                    306   2e-93   Arabis alpina [alpine rockcress]
ref|XP_004287944.1|  PREDICTED: aconitate hydratase, cytoplasmic        306   2e-93   Fragaria vesca subsp. vesca
gb|KHG18502.1|  Aconitate hydratase 2, mitochondrial -like protein      305   2e-93   Gossypium arboreum [tree cotton]
dbj|BAG16527.1|  putative aconitase                                     306   3e-93   Capsicum chinense [bonnet pepper]
ref|XP_002883704.1|  hypothetical protein ARALYDRAFT_480186             306   3e-93   
ref|XP_008342002.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    306   3e-93   
ref|XP_003539865.1|  PREDICTED: aconitate hydratase 2, mitochondr...    306   3e-93   Glycine max [soybeans]
ref|XP_006396145.1|  hypothetical protein EUTSA_v10002387mg             306   3e-93   Eutrema salsugineum [saltwater cress]
gb|KHN41224.1|  Aconitate hydratase, cytoplasmic                        304   4e-93   Glycine soja [wild soybean]
gb|KJB60835.1|  hypothetical protein B456_009G327800                    305   4e-93   Gossypium raimondii
sp|O04916.1|ACOC_SOLTU  RecName: Full=Aconitate hydratase, cytopl...    298   4e-93   Solanum tuberosum [potatoes]
ref|XP_009353280.1|  PREDICTED: aconitate hydratase, cytoplasmic        305   6e-93   Pyrus x bretschneideri [bai li]
ref|XP_008804304.1|  PREDICTED: putative aconitate hydratase, cyt...    305   6e-93   Phoenix dactylifera
emb|CDX93088.1|  BnaA03g38100D                                          305   6e-93   
ref|XP_003527493.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    305   6e-93   Glycine max [soybeans]
ref|XP_010533007.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    305   7e-93   Tarenaya hassleriana [spider flower]
emb|CDX97969.1|  BnaA06g07200D                                          305   8e-93   
ref|NP_178634.2|  aconitate hydratase 3                                 305   8e-93   Arabidopsis thaliana [mouse-ear cress]
gb|KJB50479.1|  hypothetical protein B456_008G173400                    305   1e-92   Gossypium raimondii
gb|KHG08189.1|  hypothetical protein F383_11434                         303   1e-92   Gossypium arboreum [tree cotton]
ref|XP_002278138.1|  PREDICTED: aconitate hydratase, cytoplasmic        305   1e-92   Vitis vinifera
gb|KDO54658.1|  hypothetical protein CISIN_1g001917mg                   301   1e-92   Citrus sinensis [apfelsine]
ref|XP_010929878.1|  PREDICTED: putative aconitate hydratase, cyt...    304   1e-92   Elaeis guineensis
ref|XP_007045642.1|  Aconitase 3                                        304   2e-92   
gb|KJB30565.1|  hypothetical protein B456_005G149700                    302   2e-92   Gossypium raimondii
ref|XP_004517086.1|  PREDICTED: aconitate hydratase 2, mitochondr...    303   2e-92   Cicer arietinum [garbanzo]
emb|CAN62964.1|  hypothetical protein VITISV_029521                     293   2e-92   Vitis vinifera
emb|CDY50945.1|  BnaC03g74450D                                          303   2e-92   Brassica napus [oilseed rape]
ref|XP_011048785.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    303   3e-92   Populus euphratica
ref|XP_010488774.1|  PREDICTED: aconitate hydratase 2, mitochondrial    303   3e-92   Camelina sativa [gold-of-pleasure]
gb|KHG08190.1|  Aconitate hydratase 2, mitochondrial                    303   3e-92   Gossypium arboreum [tree cotton]
emb|CDP10817.1|  unnamed protein product                                303   3e-92   Coffea canephora [robusta coffee]
gb|ADZ57218.1|  aconitase protein                                       301   3e-92   Litchi chinensis [litchi]
gb|AAG28426.1|AF194945_1  cytosolic aconitase                           301   4e-92   Nicotiana tabacum [American tobacco]
ref|XP_008379632.1|  PREDICTED: aconitate hydratase, cytoplasmic        303   4e-92   
gb|KJB30569.1|  hypothetical protein B456_005G149700                    303   5e-92   Gossypium raimondii
ref|XP_010266897.1|  PREDICTED: aconitate hydratase 1                   301   6e-92   Nelumbo nucifera [Indian lotus]
gb|KJB30566.1|  hypothetical protein B456_005G149700                    302   6e-92   Gossypium raimondii
ref|XP_010412716.1|  PREDICTED: aconitate hydratase 2, mitochondr...    302   7e-92   
gb|KJB62847.1|  hypothetical protein B456_009G440000                    302   7e-92   Gossypium raimondii
ref|XP_009148490.1|  PREDICTED: aconitate hydratase 2, mitochondrial    302   7e-92   Brassica rapa
ref|XP_009769027.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    302   9e-92   Nicotiana sylvestris
ref|XP_010276105.1|  PREDICTED: aconitate hydratase, cytoplasmic        302   9e-92   Nelumbo nucifera [Indian lotus]
ref|XP_004243472.1|  PREDICTED: aconitate hydratase, cytoplasmic        302   1e-91   Solanum lycopersicum
emb|CBE71058.1|  aconitate hydratase 2                                  300   1e-91   Citrus clementina [clementine]
ref|XP_009599619.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    301   1e-91   Nicotiana tomentosiformis
gb|KDO62732.1|  hypothetical protein CISIN_1g001863mg                   298   2e-91   Citrus sinensis [apfelsine]
gb|KDO54656.1|  hypothetical protein CISIN_1g001917mg                   301   2e-91   Citrus sinensis [apfelsine]
ref|XP_011097878.1|  PREDICTED: putative aconitate hydratase, cyt...    300   2e-91   
gb|AAP30039.1|  aconitase                                               299   2e-91   Solanum pennellii
ref|XP_006376779.1|  aconitate hydratase family protein                 301   2e-91   Populus trichocarpa [western balsam poplar]
ref|XP_006447555.1|  hypothetical protein CICLE_v10014140mg             301   2e-91   Citrus clementina [clementine]
ref|XP_006296904.1|  hypothetical protein CARUB_v10012896mg             301   3e-91   Capsella rubella
ref|XP_010467089.1|  PREDICTED: aconitate hydratase 2, mitochondr...    300   3e-91   Camelina sativa [gold-of-pleasure]
ref|XP_003605929.1|  Aconitate hydratase                                300   4e-91   Medicago truncatula
ref|XP_008785076.1|  PREDICTED: putative aconitate hydratase, cyt...    287   4e-91   
emb|CBE71057.1|  aconitate hydratase 3                                  298   8e-91   Citrus clementina [clementine]
ref|XP_009136177.1|  PREDICTED: aconitate hydratase 2, mitochondrial    299   9e-91   Brassica rapa
gb|KEH27599.1|  cytoplasmic-like aconitate hydratase                    296   1e-90   Medicago truncatula
ref|NP_001159229.1|  uncharacterized protein LOC100304315               293   1e-90   
ref|XP_006452377.1|  hypothetical protein CICLE_v10007338mg             298   2e-90   Citrus clementina [clementine]
ref|XP_006828850.1|  hypothetical protein AMTR_s00001p00156400          298   2e-90   Amborella trichopoda
gb|EYU24785.1|  hypothetical protein MIMGU_mgv1a000742mg                298   2e-90   Erythranthe guttata [common monkey flower]
ref|XP_002524184.1|  aconitase, putative                                298   2e-90   Ricinus communis
gb|KHG02134.1|  hypothetical protein F383_25649                         298   3e-90   Gossypium arboreum [tree cotton]
gb|AAO62410.1|  aconitase                                               296   3e-90   Solanum pennellii
ref|XP_006366590.1|  PREDICTED: aconitate hydratase 2, mitochondr...    298   3e-90   Solanum tuberosum [potatoes]
gb|ADP03320.1|  aconitate hydratase                                     283   4e-90   Pinus pinaster [cluster pine]
ref|XP_010675721.1|  PREDICTED: putative aconitate hydratase, cyt...    298   4e-90   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO54657.1|  hypothetical protein CISIN_1g001917mg                   297   4e-90   Citrus sinensis [apfelsine]
ref|XP_003612247.1|  Aconitate hydratase                                296   4e-90   Medicago truncatula
ref|XP_008337967.1|  PREDICTED: aconitate hydratase 1                   295   7e-90   
sp|P49608.1|ACOC_CUCMA  RecName: Full=Aconitate hydratase, cytopl...    295   7e-90   Cucurbita maxima [Boston marrow]
gb|AAC26045.1|  aconitase-iron regulated protein 1                      295   8e-90   Citrus limon [lemon]
gb|KJB48278.1|  hypothetical protein B456_008G061900                    295   8e-90   Gossypium raimondii
ref|XP_010278679.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    296   9e-90   Nelumbo nucifera [Indian lotus]
ref|XP_002530635.1|  aconitase, putative                                295   9e-90   Ricinus communis
tpg|DAA43249.1|  TPA: hypothetical protein ZEAMMB73_889153              290   1e-89   
ref|XP_008344247.1|  PREDICTED: aconitate hydratase 1                   293   1e-89   
gb|EYU27339.1|  hypothetical protein MIMGU_mgv1a000710mg                296   1e-89   Erythranthe guttata [common monkey flower]
ref|XP_002870438.1|  predicted protein                                  296   1e-89   Arabidopsis lyrata subsp. lyrata
ref|XP_008393748.1|  PREDICTED: aconitate hydratase 1-like              293   1e-89   
gb|KHG25175.1|  Aconitate hydratase, cytoplasmic                        295   2e-89   Gossypium arboreum [tree cotton]
ref|XP_008363078.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    292   2e-89   
ref|XP_002279260.1|  PREDICTED: aconitate hydratase, cytoplasmic        296   2e-89   Vitis vinifera
ref|XP_010440740.1|  PREDICTED: aconitate hydratase 2, mitochondr...    296   2e-89   Camelina sativa [gold-of-pleasure]
gb|KGN48958.1|  Aconitase                                               294   2e-89   Cucumis sativus [cucumbers]
ref|XP_009363442.1|  PREDICTED: aconitate hydratase 1-like              294   2e-89   Pyrus x bretschneideri [bai li]
ref|XP_009337075.1|  PREDICTED: aconitate hydratase 1-like              294   2e-89   Pyrus x bretschneideri [bai li]
ref|XP_009344825.1|  PREDICTED: aconitate hydratase 1                   294   2e-89   Pyrus x bretschneideri [bai li]
gb|ABK25210.1|  unknown                                                 286   3e-89   Picea sitchensis
gb|KDO71349.1|  hypothetical protein CISIN_1g002610mg                   286   3e-89   Citrus sinensis [apfelsine]
ref|XP_004134842.1|  PREDICTED: aconitate hydratase 1-like              294   3e-89   Cucumis sativus [cucumbers]
gb|KHG25176.1|  Aconitate hydratase, cytoplasmic                        294   3e-89   Gossypium arboreum [tree cotton]
gb|ADP03120.1|  aconitate hydratase                                     280   3e-89   Pinus sylvestris [Scotch pine]
gb|EMS48231.1|  Putative aconitate hydratase, cytoplasmic               293   3e-89   Triticum urartu
ref|XP_008440877.1|  PREDICTED: aconitate hydratase                     293   4e-89   Cucumis melo [Oriental melon]
gb|ADP03151.1|  aconitate hydratase                                     280   4e-89   Pinus sylvestris [Scotch pine]
gb|ADP03123.1|  aconitate hydratase                                     280   4e-89   Pinus sylvestris [Scotch pine]
ref|XP_009598330.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    296   4e-89   Nicotiana tomentosiformis
gb|EMS45933.1|  Putative aconitate hydratase, cytoplasmic               293   4e-89   Triticum urartu
gb|ADP03134.1|  aconitate hydratase                                     280   5e-89   Pinus sylvestris [Scotch pine]
ref|XP_003596988.1|  Aconitate hydratase                                294   7e-89   Medicago truncatula
ref|XP_011095404.1|  PREDICTED: putative aconitate hydratase, cyt...    294   7e-89   Sesamum indicum [beniseed]
gb|ADP03144.1|  aconitate hydratase                                     279   7e-89   Pinus sylvestris [Scotch pine]
ref|XP_009787319.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    294   1e-88   Nicotiana sylvestris
ref|XP_010450391.1|  PREDICTED: aconitate hydratase 2, mitochondr...    293   1e-88   Camelina sativa [gold-of-pleasure]
ref|NP_001119125.1|  aconitate hydratase 1                              290   1e-88   Arabidopsis thaliana [mouse-ear cress]
gb|KDP23953.1|  hypothetical protein JCGZ_25341                         292   2e-88   Jatropha curcas
ref|XP_007046597.1|  Aconitase 1                                        291   2e-88   
gb|EMT33022.1|  Putative aconitate hydratase, cytoplasmic               292   2e-88   
ref|XP_002263337.1|  PREDICTED: aconitate hydratase 1                   291   2e-88   Vitis vinifera
ref|XP_009419582.1|  PREDICTED: putative aconitate hydratase, cyt...    293   2e-88   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008658754.1|  PREDICTED: uncharacterized protein LOC100304...    293   2e-88   
ref|XP_010918136.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    293   3e-88   Elaeis guineensis
emb|CBI24446.3|  unnamed protein product                                291   3e-88   Vitis vinifera
ref|XP_002532564.1|  aconitase, putative                                292   3e-88   
gb|ADP03143.1|  aconitate hydratase                                     278   3e-88   Pinus sylvestris [Scotch pine]
ref|XP_003573387.2|  PREDICTED: putative aconitate hydratase, cyt...    292   3e-88   Brachypodium distachyon [annual false brome]
sp|Q42669.1|ACOC_CUCMC  RecName: Full=Aconitate hydratase; Short=...    288   3e-88   Cucumis melo var. conomon [snake cucumber]
ref|XP_002465901.1|  hypothetical protein SORBIDRAFT_01g047850          292   3e-88   Sorghum bicolor [broomcorn]
gb|KDO71348.1|  hypothetical protein CISIN_1g002610mg                   286   4e-88   Citrus sinensis [apfelsine]
ref|XP_008800034.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    292   5e-88   Phoenix dactylifera
gb|AAL13084.1|  putative aconitase                                      290   6e-88   Prunus avium [gean]
gb|KFK30197.1|  hypothetical protein AALP_AA7G230700                    290   6e-88   Arabis alpina [alpine rockcress]
ref|XP_007203240.1|  hypothetical protein PRUPE_ppa001138mg             290   7e-88   Prunus persica
dbj|BAJ85661.1|  predicted protein                                      291   7e-88   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAA58046.1|  aconitase                                              290   9e-88   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195308.1|  aconitate hydratase 1                                 290   9e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004985790.1|  PREDICTED: putative aconitate hydratase, cyt...    291   1e-87   Setaria italica
dbj|BAJ92965.1|  predicted protein                                      291   1e-87   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010943467.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    291   1e-87   Elaeis guineensis
gb|ACK56134.1|  putative aconitase                                      269   1e-87   Dimocarpus longan [longan]
ref|XP_008242011.1|  PREDICTED: aconitate hydratase 1                   289   2e-87   Prunus mume [ume]
gb|KDO71347.1|  hypothetical protein CISIN_1g002610mg                   287   2e-87   Citrus sinensis [apfelsine]
ref|XP_009150005.1|  PREDICTED: aconitate hydratase 1                   288   2e-87   Brassica rapa
ref|XP_006285963.1|  hypothetical protein CARUB_v10007484mg             288   2e-87   Capsella rubella
emb|CDX69174.1|  BnaC01g02790D                                          288   2e-87   
ref|XP_011022256.1|  PREDICTED: aconitate hydratase 1                   288   3e-87   Populus euphratica
ref|XP_006383042.1|  aconitate hydratase family protein                 288   3e-87   Populus trichocarpa [western balsam poplar]
ref|XP_009109264.1|  PREDICTED: aconitate hydratase 1-like              288   5e-87   Brassica rapa
gb|KDP39136.1|  hypothetical protein JCGZ_00893                         289   5e-87   Jatropha curcas
ref|XP_009384004.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    289   6e-87   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006380559.1|  hypothetical protein POPTR_0007s09260g             288   6e-87   Populus trichocarpa [western balsam poplar]
ref|XP_003537655.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    288   6e-87   Glycine max [soybeans]
ref|XP_007157870.1|  hypothetical protein PHAVU_002G105000g             287   7e-87   Phaseolus vulgaris [French bean]
ref|XP_004487412.1|  PREDICTED: aconitate hydratase 2, mitochondr...    288   9e-87   Cicer arietinum [garbanzo]
gb|KDO71345.1|  hypothetical protein CISIN_1g002610mg                   287   9e-87   Citrus sinensis [apfelsine]
gb|EMT03129.1|  Putative aconitate hydratase, cytoplasmic               293   9e-87   
gb|KDO71344.1|  hypothetical protein CISIN_1g002610mg                   286   1e-86   Citrus sinensis [apfelsine]
gb|KDO71342.1|  hypothetical protein CISIN_1g002610mg                   287   1e-86   Citrus sinensis [apfelsine]
emb|CBE71056.1|  aconitate hydratase 1                                  287   1e-86   Citrus clementina [clementine]
gb|KDO71343.1|  hypothetical protein CISIN_1g002610mg                   287   1e-86   Citrus sinensis [apfelsine]
emb|CDY24823.1|  BnaA08g14870D                                          287   1e-86   Brassica napus [oilseed rape]
ref|XP_006425366.1|  hypothetical protein CICLE_v10024840mg             286   1e-86   Citrus clementina [clementine]
ref|XP_009382046.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    288   2e-86   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX75532.1|  BnaA01g01700D                                          287   2e-86   
gb|KHG24816.1|  Aconitate hydratase 1 -like protein                     285   2e-86   Gossypium arboreum [tree cotton]
gb|EEE58288.1|  hypothetical protein OsJ_09326                          286   2e-86   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006412056.1|  hypothetical protein EUTSA_v10024358mg             286   2e-86   Eutrema salsugineum [saltwater cress]
ref|XP_009399225.1|  PREDICTED: putative aconitate hydratase, cyt...    288   2e-86   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW56578.1|  hypothetical protein EUGRSUZ_I02307                     284   2e-86   Eucalyptus grandis [rose gum]
ref|XP_010438674.1|  PREDICTED: aconitate hydratase 3, mitochondr...    284   2e-86   Camelina sativa [gold-of-pleasure]
ref|XP_006283068.1|  hypothetical protein CARUB_v10004061mg             287   2e-86   Capsella rubella
ref|XP_003517155.1|  PREDICTED: aconitate hydratase 1                   286   3e-86   Glycine max [soybeans]
ref|XP_006467022.1|  PREDICTED: aconitate hydratase 1                   286   3e-86   Citrus sinensis [apfelsine]
ref|XP_006346211.1|  PREDICTED: aconitate hydratase 2, mitochondr...    287   3e-86   Solanum tuberosum [potatoes]
ref|NP_001048898.1|  Os03g0136900                                       286   4e-86   
gb|EEC74472.1|  hypothetical protein OsI_09921                          286   4e-86   Oryza sativa Indica Group [Indian rice]
ref|XP_006651017.1|  PREDICTED: putative aconitate hydratase, cyt...    285   4e-86   
ref|XP_010437416.1|  PREDICTED: aconitate hydratase 1-like              285   6e-86   Camelina sativa [gold-of-pleasure]
gb|KHN41868.1|  Aconitate hydratase 1                                   285   6e-86   Glycine soja [wild soybean]
ref|XP_008785050.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    286   8e-86   Phoenix dactylifera
ref|XP_010433420.1|  PREDICTED: aconitate hydratase 3, mitochondrial    286   8e-86   Camelina sativa [gold-of-pleasure]
ref|XP_006413121.1|  hypothetical protein EUTSA_v10024309mg             286   8e-86   Eutrema salsugineum [saltwater cress]
gb|KCW56576.1|  hypothetical protein EUGRSUZ_I02307                     284   9e-86   Eucalyptus grandis [rose gum]
ref|XP_010029634.1|  PREDICTED: aconitate hydratase 1                   284   9e-86   Eucalyptus grandis [rose gum]
emb|CDY41626.1|  BnaC03g62580D                                          285   9e-86   Brassica napus [oilseed rape]
ref|XP_003558862.1|  PREDICTED: putative aconitate hydratase, cyt...    285   1e-85   Brachypodium distachyon [annual false brome]
ref|XP_010448188.1|  PREDICTED: aconitate hydratase 3, mitochondr...    285   1e-85   Camelina sativa [gold-of-pleasure]
gb|KHN36000.1|  Aconitate hydratase, cytoplasmic                        284   1e-85   Glycine soja [wild soybean]
ref|XP_004512178.1|  PREDICTED: aconitate hydratase 1-like              284   2e-85   Cicer arietinum [garbanzo]
ref|XP_010446873.1|  PREDICTED: aconitate hydratase 1                   283   2e-85   Camelina sativa [gold-of-pleasure]
ref|XP_010432222.1|  PREDICTED: aconitate hydratase 1-like              283   2e-85   Camelina sativa [gold-of-pleasure]
gb|KFK29204.1|  hypothetical protein AALP_AA7G102800                    284   5e-85   Arabis alpina [alpine rockcress]
ref|XP_006413195.1|  hypothetical protein EUTSA_v10024325mg             283   6e-85   
ref|XP_010113288.1|  Aconitate hydratase 1                              283   6e-85   
ref|XP_010526818.1|  PREDICTED: aconitate hydratase 1                   281   1e-84   Tarenaya hassleriana [spider flower]
ref|XP_009109156.1|  PREDICTED: aconitate hydratase 3, mitochondrial    283   1e-84   Brassica rapa
emb|CDY66424.1|  BnaAnng22230D                                          283   1e-84   Brassica napus [oilseed rape]
ref|XP_004287770.1|  PREDICTED: aconitate hydratase 1                   281   2e-84   Fragaria vesca subsp. vesca
emb|CDY14291.1|  BnaA08g14220D                                          281   4e-84   Brassica napus [oilseed rape]
ref|XP_002869584.1|  hypothetical protein ARALYDRAFT_492099             281   4e-84   
emb|CAB36543.1|  putative aconitase                                     280   5e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010046453.1|  PREDICTED: aconitate hydratase, cytoplasmic        258   7e-84   
ref|XP_007020807.1|  Aconitase 3                                        279   8e-84   
ref|NP_567763.2|  aconitase 2                                           280   9e-84   Arabidopsis thaliana [mouse-ear cress]
emb|CDP05740.1|  unnamed protein product                                280   1e-83   Coffea canephora [robusta coffee]
gb|AAK91447.1|  AT4g26970/F10M23_310                                    277   1e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010529315.1|  PREDICTED: aconitate hydratase 1-like              275   3e-82   Tarenaya hassleriana [spider flower]
ref|XP_002460765.1|  hypothetical protein SORBIDRAFT_02g034590          275   5e-82   Sorghum bicolor [broomcorn]
gb|ACR36825.1|  unknown                                                 267   8e-82   Zea mays [maize]
ref|XP_008670444.1|  PREDICTED: putative aconitate hydratase, cyt...    275   1e-81   Zea mays [maize]
ref|XP_008670445.1|  PREDICTED: putative aconitate hydratase, cyt...    275   1e-81   Zea mays [maize]
ref|XP_002991024.1|  hypothetical protein SELMODRAFT_132907             272   3e-81   
ref|XP_007132547.1|  hypothetical protein PHAVU_011G1037000g            251   3e-81   Phaseolus vulgaris [French bean]
ref|XP_002991716.1|  hypothetical protein SELMODRAFT_133937             272   5e-81   
ref|XP_002866068.1|  hypothetical protein ARALYDRAFT_918634             254   7e-81   
ref|XP_007020811.1|  Aconitase 3                                        269   6e-80   
ref|XP_010033531.1|  PREDICTED: aconitate hydratase 1-like              268   2e-79   Eucalyptus grandis [rose gum]
gb|KCW53221.1|  hypothetical protein EUGRSUZ_J02488                     268   2e-79   Eucalyptus grandis [rose gum]
ref|XP_008669747.1|  PREDICTED: putative aconitate hydratase, cyt...    267   2e-79   Zea mays [maize]
ref|XP_008669746.1|  PREDICTED: putative aconitate hydratase, cyt...    266   7e-79   Zea mays [maize]
ref|NP_001147431.1|  aconitase2                                         265   1e-78   Zea mays [maize]
ref|XP_010443094.1|  PREDICTED: aconitate hydratase 3, mitochondr...    263   2e-78   
ref|XP_010443093.1|  PREDICTED: aconitate hydratase 3, mitochondr...    263   4e-78   
ref|XP_006830449.1|  hypothetical protein AMTR_s00115p00015570          263   4e-78   
gb|EMS62033.1|  Putative aconitate hydratase, cytoplasmic               264   5e-78   Triticum urartu
ref|XP_010443085.1|  PREDICTED: aconitate hydratase 3, mitochondr...    263   2e-77   Camelina sativa [gold-of-pleasure]
ref|XP_001780674.1|  predicted protein                                  262   2e-77   
ref|XP_009361096.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    257   2e-77   
gb|EMT24311.1|  Putative aconitate hydratase, cytoplasmic               263   3e-77   
tpg|DAA43248.1|  TPA: hypothetical protein ZEAMMB73_889153              257   5e-77   
ref|XP_010482909.1|  PREDICTED: putative aconitate hydratase, cyt...    261   7e-77   
ref|XP_002980554.1|  hypothetical protein SELMODRAFT_444572             259   2e-76   
ref|XP_002976825.1|  hypothetical protein SELMODRAFT_443331             259   2e-76   
ref|XP_001779205.1|  predicted protein                                  257   1e-75   
gb|AES61065.2|  cytoplasmic-like aconitate hydratase                    256   2e-75   Medicago truncatula
ref|XP_003590814.1|  Aconitate hydratase                                256   3e-75   
emb|CAN83844.1|  hypothetical protein VITISV_003004                     254   7e-75   Vitis vinifera
ref|XP_001770969.1|  predicted protein                                  251   1e-73   
gb|ACU19654.1|  unknown                                                 230   5e-73   Glycine max [soybeans]
ref|XP_008355339.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    243   7e-73   
gb|KJB17578.1|  hypothetical protein B456_003G006000                    248   2e-72   Gossypium raimondii
emb|CDY56501.1|  BnaAnng14360D                                          244   1e-70   Brassica napus [oilseed rape]
ref|XP_002867051.1|  aconitate hydratase, cytoplasmic                   236   2e-68   
ref|XP_008661884.1|  PREDICTED: aconitase2 isoform X1                   232   1e-66   
gb|KEH38306.1|  cytoplasmic-like aconitate hydratase                    230   6e-66   Medicago truncatula
gb|EPQ05177.1|  Cytoplasmic aconitate hydratase                         213   5e-65   Myotis brandtii
ref|XP_002784977.1|  aconitase, putative                                209   3e-64   Perkinsus marinus ATCC 50983
ref|XP_010290546.1|  PREDICTED: cytoplasmic aconitate hydratase         207   2e-63   Phaethon lepturus
gb|AAF29447.1|AF127457_1  aconitase                                     207   3e-63   
ref|XP_006108771.1|  PREDICTED: cytoplasmic aconitate hydratase-like    209   3e-63   
ref|XP_005862173.1|  PREDICTED: cytoplasmic aconitate hydratase-like    208   3e-63   
ref|XP_002766275.1|  Aconitate hydratase, cytoplasmic, putative         210   5e-63   
gb|AGC69746.1|  putative iron regulatory protein                        220   2e-62   
gb|EYC17817.1|  hypothetical protein Y032_0029g1886                     204   4e-62   
ref|XP_011404037.1|  PREDICTED: cytoplasmic aconitate hydratase         218   6e-62   
gb|ETN69391.1|  aconitase domain protein                                202   2e-61   
ref|XP_003884224.1|  Iron regulatory protein-like protein, related      218   2e-61   
ref|XP_008586142.1|  PREDICTED: cytoplasmic aconitate hydratase         205   3e-61   
ref|XP_001464867.1|  putative aconitase                                 214   2e-60   
gb|AAH90777.1|  LOC100150527 protein                                    199   2e-60   
ref|XP_001682457.1|  putative aconitase                                 214   4e-60   
dbj|BAM18054.1|  iron regulatory protein 1A                             204   9e-60   
emb|CCW61236.1|  unnamed protein product                                213   1e-59   
ref|XP_001016756.1|  aconitate hydratase                                212   1e-59   
ref|XP_003874065.1|  putative aconitase                                 211   2e-59   
ref|XP_001563981.1|  putative aconitase                                 211   2e-59   
pdb|3SNP|A  Chain A, Crystal Structure Analysis Of Iron Regulator...    211   3e-59   
emb|CCW69174.1|  unnamed protein product                                211   3e-59   
gb|AFI44047.1|  iron regulatory protein                                 211   3e-59   
ref|XP_008246563.1|  PREDICTED: cytoplasmic aconitate hydratase i...    211   3e-59   
gb|EGV97063.1|  Cytoplasmic aconitate hydratase                         211   3e-59   
ref|XP_002788756.1|  aconitase, putative                                210   3e-59   
ref|XP_002776365.1|  aconitase, putative                                211   3e-59   
ref|XP_004581280.1|  PREDICTED: cytoplasmic aconitate hydratase         210   4e-59   
ref|XP_003506017.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    211   5e-59   
ref|XP_010697897.1|  aconitase, putative                                210   6e-59   
gb|ERE84356.1|  cytoplasmic aconitate hydratase-like protein            210   7e-59   
ref|XP_007614514.1|  PREDICTED: cytoplasmic aconitate hydratase         210   7e-59   
ref|XP_006123150.1|  PREDICTED: cytoplasmic aconitate hydratase i...    210   9e-59   
ref|XP_006975385.1|  PREDICTED: cytoplasmic aconitate hydratase         209   1e-58   
gb|EGT30572.1|  CBN-ACO-1 protein                                       209   1e-58   
ref|XP_004905303.1|  PREDICTED: cytoplasmic aconitate hydratase i...    209   1e-58   
ref|XP_005326228.1|  PREDICTED: cytoplasmic aconitate hydratase         209   1e-58   
gb|ACF33175.1|  aconitase-1                                             209   1e-58   
ref|NP_001075784.1|  cytoplasmic aconitate hydratase                    209   2e-58   
ref|XP_004632076.1|  PREDICTED: cytoplasmic aconitate hydratase         209   2e-58   
ref|XP_010611189.1|  PREDICTED: cytoplasmic aconitate hydratase         209   2e-58   
ref|XP_010081789.1|  PREDICTED: cytoplasmic aconitate hydratase         206   2e-58   
ref|XP_010787894.1|  PREDICTED: cytoplasmic aconitate hydratase-like    199   2e-58   
gb|ELU03714.1|  hypothetical protein CAPTEDRAFT_153788                  208   2e-58   
ref|XP_005401176.1|  PREDICTED: cytoplasmic aconitate hydratase         209   2e-58   
ref|XP_010746424.1|  PREDICTED: cytoplasmic aconitate hydratase         209   2e-58   
gb|KFV01523.1|  Cytoplasmic aconitate hydratase                         205   2e-58   
gb|KHN74276.1|  putative cytoplasmic aconitate hydratase                209   2e-58   
ref|XP_003109738.1|  CRE-ACO-1 protein                                  209   2e-58   
ref|XP_002643981.1|  C. briggsae CBR-ACO-1 protein                      208   3e-58   
ref|XP_002126781.1|  PREDICTED: cytoplasmic aconitate hydratase         208   3e-58   
ref|XP_008849314.1|  PREDICTED: cytoplasmic aconitate hydratase         208   3e-58   
ref|XP_010724498.1|  PREDICTED: cytoplasmic aconitate hydratase         208   3e-58   
ref|XP_011164631.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    208   3e-58   
ref|XP_011164630.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    208   3e-58   
gb|EJY64435.1|  Aconitate hydratase 1 family protein                    208   3e-58   
ref|XP_003283928.1|  hypothetical protein DICPUDRAFT_45137              208   3e-58   
emb|CAP35039.2|  Protein CBR-ACO-1                                      208   4e-58   
ref|XP_005078925.1|  PREDICTED: cytoplasmic aconitate hydratase         208   4e-58   
gb|EPY31043.1|  aconitase                                               208   4e-58   
ref|XP_002366326.1|  aconitate hydratase, putative                      209   4e-58   
gb|ESS32610.1|  aconitate hydratase ACN/IRP                             209   4e-58   
gb|KFH13093.1|  aconitate hydratase ACN/IRP                             209   4e-58   
gb|KFG42597.1|  aconitate hydratase ACN/IRP                             209   4e-58   
gb|EPR62226.1|  aconitate hydratase ACN/IRP                             209   4e-58   
ref|XP_005425054.1|  PREDICTED: cytoplasmic aconitate hydratase         208   4e-58   
gb|EPY23614.1|  aconitate hydratase 1                                   208   4e-58   
ref|XP_006759955.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    208   4e-58   
gb|KFG60936.1|  aconitate hydratase ACN/IRP                             209   5e-58   
ref|XP_006759954.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    208   5e-58   
ref|XP_009927267.1|  PREDICTED: cytoplasmic aconitate hydratase         206   5e-58   
ref|XP_827883.1|  aconitase                                             207   5e-58   
ref|XP_002765934.1|  aconitase, putative                                207   5e-58   
ref|XP_005492744.1|  PREDICTED: cytoplasmic aconitate hydratase         207   5e-58   
emb|CBH16617.1|  aconitase, putative                                    207   5e-58   
gb|KFQ12070.1|  Cytoplasmic aconitate hydratase                         206   6e-58   
gb|KFO19757.1|  Cytoplasmic aconitate hydratase                         208   6e-58   
ref|XP_005362039.1|  PREDICTED: cytoplasmic aconitate hydratase         207   6e-58   
ref|XP_010136118.1|  PREDICTED: cytoplasmic aconitate hydratase i...    207   7e-58   
ref|XP_006759953.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    207   7e-58   
ref|XP_010136119.1|  PREDICTED: cytoplasmic aconitate hydratase i...    207   8e-58   
gb|ENN73657.1|  hypothetical protein YQE_09735                          195   9e-58   
ref|XP_008517260.1|  PREDICTED: cytoplasmic aconitate hydratase         207   9e-58   
ref|NP_001025707.1|  cytoplasmic aconitate hydratase                    207   9e-58   
ref|XP_004658446.1|  PREDICTED: cytoplasmic aconitate hydratase         207   9e-58   
gb|ELK33131.1|  Cytoplasmic aconitate hydratase                         207   1e-57   
ref|XP_004428436.1|  PREDICTED: cytoplasmic aconitate hydratase i...    207   1e-57   
ref|XP_003357777.1|  PREDICTED: cytoplasmic aconitate hydratase         207   1e-57   
ref|XP_010974111.1|  PREDICTED: cytoplasmic aconitate hydratase i...    206   1e-57   
ref|XP_004428435.1|  PREDICTED: cytoplasmic aconitate hydratase i...    207   1e-57   
gb|KFQ42707.1|  Cytoplasmic aconitate hydratase                         205   1e-57   
ref|XP_010965659.1|  PREDICTED: cytoplasmic aconitate hydratase i...    206   1e-57   
ref|XP_010013993.1|  PREDICTED: cytoplasmic aconitate hydratase         205   1e-57   
ref|XP_009898602.1|  PREDICTED: cytoplasmic aconitate hydratase         206   1e-57   
emb|CAA43455.1|  iron response element binding protein                  206   1e-57   
ref|XP_011148978.1|  PREDICTED: cytoplasmic aconitate hydratase-like    206   1e-57   
ref|XP_006216897.1|  PREDICTED: cytoplasmic aconitate hydratase         206   1e-57   
gb|AAH05454.1|  Aconitase 1                                             206   1e-57   
ref|NP_031412.2|  cytoplasmic aconitate hydratase                       206   1e-57   
gb|KFQ88200.1|  Cytoplasmic aconitate hydratase                         206   1e-57   
ref|NP_509898.1|  Protein ACO-1                                         206   1e-57   
ref|XP_008494051.1|  PREDICTED: cytoplasmic aconitate hydratase         206   1e-57   
ref|XP_004086812.1|  PREDICTED: cytoplasmic aconitate hydratase i...    206   2e-57   
ref|XP_011471732.1|  PREDICTED: cytoplasmic aconitate hydratase i...    206   2e-57   
ref|XP_008154889.1|  PREDICTED: cytoplasmic aconitate hydratase         206   2e-57   
emb|CAD20353.1|  cytoplasmic aconitase                                  206   2e-57   
ref|XP_009675962.1|  PREDICTED: cytoplasmic aconitate hydratase i...    206   2e-57   
ref|XP_006881316.1|  PREDICTED: cytoplasmic aconitate hydratase         206   2e-57   
ref|XP_009675961.1|  PREDICTED: cytoplasmic aconitate hydratase i...    206   2e-57   
emb|CAA04136.1|  iron regulatory protein                                196   2e-57   
ref|XP_005141537.1|  PREDICTED: cytoplasmic aconitate hydratase         206   2e-57   
ref|XP_004482427.1|  PREDICTED: cytoplasmic aconitate hydratase         206   2e-57   
ref|XP_003470870.1|  PREDICTED: cytoplasmic aconitate hydratase         206   2e-57   
ref|XP_004392229.1|  PREDICTED: cytoplasmic aconitate hydratase         206   2e-57   
ref|XP_010965658.1|  PREDICTED: cytoplasmic aconitate hydratase i...    206   2e-57   
ref|XP_009883571.1|  PREDICTED: cytoplasmic aconitate hydratase         206   2e-57   
ref|XP_010974110.1|  PREDICTED: cytoplasmic aconitate hydratase i...    206   2e-57   
ref|XP_005530013.1|  PREDICTED: cytoplasmic aconitate hydratase         206   3e-57   
ref|XP_009818682.1|  PREDICTED: cytoplasmic aconitate hydratase         204   3e-57   
ref|XP_009485700.1|  PREDICTED: cytoplasmic aconitate hydratase         206   3e-57   
ref|XP_008882045.1|  aconitate hydratase ACN/IRP                        207   3e-57   
ref|XP_004362727.1|  putative iron regulatory protein                   206   3e-57   
ref|XP_009872328.1|  PREDICTED: cytoplasmic aconitate hydratase         206   3e-57   
ref|XP_010576405.1|  PREDICTED: cytoplasmic aconitate hydratase         206   3e-57   
gb|KFP56261.1|  Cytoplasmic aconitate hydratase                         206   3e-57   
ref|XP_006143153.1|  PREDICTED: cytoplasmic aconitate hydratase         205   3e-57   
ref|XP_009968191.1|  PREDICTED: cytoplasmic aconitate hydratase         205   3e-57   
gb|KFV55230.1|  Cytoplasmic aconitate hydratase                         205   3e-57   
gb|EDL98627.1|  rCG55067                                                205   3e-57   
gb|EHJ78892.1|  iron regulatory protein 1                               197   3e-57   
gb|KFZ58431.1|  Cytoplasmic aconitate hydratase                         204   4e-57   
ref|XP_003407686.1|  PREDICTED: cytoplasmic aconitate hydratase         205   4e-57   
ref|XP_009573519.1|  PREDICTED: cytoplasmic aconitate hydratase         205   4e-57   
gb|AAA03251.1|  chimeric iron-responsive element-binding protein,...    205   4e-57   
ref|XP_007464993.1|  PREDICTED: cytoplasmic aconitate hydratase i...    205   4e-57   
gb|AJQ30117.1|  aconitate hydratase 1                                   205   4e-57   
gb|AAF99681.1|AF261088_1  iron regulatory protein 1                     204   4e-57   
emb|CDW89012.1|  aconitate hydratase 1 family protein                   205   4e-57   
gb|KIH47318.1|  putative aconitate hydratase 1                          204   4e-57   
ref|XP_009094283.1|  PREDICTED: cytoplasmic aconitate hydratase         205   4e-57   
ref|XP_005510592.1|  PREDICTED: cytoplasmic aconitate hydratase         205   4e-57   
gb|AAA69900.1|  iron-responsive regulatory protein/iron regulator...    204   4e-57   
ref|XP_009559475.1|  PREDICTED: cytoplasmic aconitate hydratase         205   4e-57   
ref|XP_009283305.1|  PREDICTED: cytoplasmic aconitate hydratase         205   4e-57   
ref|XP_007464992.1|  PREDICTED: cytoplasmic aconitate hydratase i...    205   4e-57   
ref|XP_005061122.1|  PREDICTED: cytoplasmic aconitate hydratase         205   4e-57   
ref|XP_009462533.1|  PREDICTED: cytoplasmic aconitate hydratase         205   5e-57   
ref|XP_009327206.1|  PREDICTED: cytoplasmic aconitate hydratase         205   5e-57   
pdb|2B3X|A  Chain A, Structure Of An Orthorhombic Crystal Form Of...    205   5e-57   
ref|NP_002188.1|  cytoplasmic aconitate hydratase                       205   5e-57   
ref|XP_003830146.1|  PREDICTED: cytoplasmic aconitate hydratase i...    205   5e-57   
ref|XP_008693317.1|  PREDICTED: cytoplasmic aconitate hydratase         205   5e-57   
ref|XP_008921492.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    205   5e-57   
ref|XP_010151037.1|  PREDICTED: cytoplasmic aconitate hydratase         205   5e-57   
ref|XP_007531304.1|  PREDICTED: cytoplasmic aconitate hydratase         205   5e-57   
ref|XP_004275114.1|  PREDICTED: cytoplasmic aconitate hydratase i...    205   5e-57   
ref|XP_005963977.1|  PREDICTED: cytoplasmic aconitate hydratase         204   5e-57   
ref|XP_004047955.1|  PREDICTED: cytoplasmic aconitate hydratase         204   6e-57   
ref|XP_006716840.1|  PREDICTED: cytoplasmic aconitate hydratase i...    204   6e-57   
ref|XP_003800343.1|  PREDICTED: cytoplasmic aconitate hydratase         204   6e-57   
ref|XP_005031316.1|  PREDICTED: cytoplasmic aconitate hydratase         204   6e-57   
gb|EZA62627.1|  Cytoplasmic aconitate hydratase                         204   6e-57   
ref|XP_009946591.1|  PREDICTED: cytoplasmic aconitate hydratase         204   6e-57   
ref|XP_006727401.1|  PREDICTED: cytoplasmic aconitate hydratase         204   7e-57   
ref|XP_010169631.1|  PREDICTED: cytoplasmic aconitate hydratase         204   7e-57   
ref|NP_001244794.1|  cytoplasmic aconitate hydratase                    204   7e-57   
ref|XP_007116533.1|  PREDICTED: cytoplasmic aconitate hydratase i...    204   7e-57   
ref|XP_008939123.1|  PREDICTED: cytoplasmic aconitate hydratase         204   7e-57   
gb|KFQ08457.1|  Cytoplasmic aconitate hydratase                         204   7e-57   
ref|XP_010224488.1|  PREDICTED: cytoplasmic aconitate hydratase         204   8e-57   
ref|XP_003225327.2|  PREDICTED: cytoplasmic aconitate hydratase         204   8e-57   
ref|XP_005909205.1|  PREDICTED: cytoplasmic aconitate hydratase         204   8e-57   
ref|XP_005209909.1|  PREDICTED: cytoplasmic aconitate hydratase i...    204   8e-57   
ref|XP_002928311.1|  PREDICTED: cytoplasmic aconitate hydratase         204   8e-57   
gb|EHH57327.1|  hypothetical protein EGM_06925                          204   8e-57   
ref|XP_007076652.1|  PREDICTED: cytoplasmic aconitate hydratase         204   8e-57   
ref|XP_010837907.1|  PREDICTED: cytoplasmic aconitate hydratase         204   8e-57   
gb|ACJ70654.1|  cytoplasmic aconitase/iron-regulatory protein           204   9e-57   
tpg|DAA27049.1|  TPA: cytoplasmic aconitate hydratase                   204   9e-57   
ref|NP_001069059.1|  cytoplasmic aconitate hydratase                    204   9e-57   
ref|XP_011347901.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    204   9e-57   
ref|XP_001952191.1|  PREDICTED: cytoplasmic aconitate hydratase-like    204   9e-57   
ref|XP_007116532.1|  PREDICTED: cytoplasmic aconitate hydratase i...    204   9e-57   
ref|XP_009646981.1|  PREDICTED: cytoplasmic aconitate hydratase         204   9e-57   
ref|XP_010398395.1|  PREDICTED: cytoplasmic aconitate hydratase         204   9e-57   
gb|KFP02434.1|  Cytoplasmic aconitate hydratase                         204   9e-57   
ref|XP_010806017.1|  PREDICTED: cytoplasmic aconitate hydratase i...    204   9e-57   
gb|EHH24050.1|  hypothetical protein EGK_07631                          204   9e-57   
ref|XP_009075233.1|  PREDICTED: cytoplasmic aconitate hydratase         204   1e-56   
ref|XP_011347824.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    204   1e-56   
gb|KFP65041.1|  Cytoplasmic aconitate hydratase                         204   1e-56   
ref|XP_003263352.1|  PREDICTED: cytoplasmic aconitate hydratase         204   1e-56   
ref|XP_009942226.1|  PREDICTED: cytoplasmic aconitate hydratase         204   1e-56   
ref|XP_009698540.1|  PREDICTED: cytoplasmic aconitate hydratase         204   1e-56   
ref|XP_011411873.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    204   1e-56   
ref|XP_010122172.1|  PREDICTED: cytoplasmic aconitate hydratase         202   1e-56   
ref|XP_009997773.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    204   1e-56   
ref|XP_003699654.1|  PREDICTED: cytoplasmic aconitate hydratase         204   1e-56   
ref|XP_004600431.1|  PREDICTED: cytoplasmic aconitate hydratase         204   1e-56   
ref|XP_010177495.1|  PREDICTED: cytoplasmic aconitate hydratase         204   1e-56   
ref|XP_003911667.1|  PREDICTED: cytoplasmic aconitate hydratase         204   1e-56   
ref|XP_004390991.1|  PREDICTED: cytoplasmic aconitate hydratase         204   1e-56   
ref|XP_011411874.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    203   1e-56   
ref|XP_010352748.1|  PREDICTED: cytoplasmic aconitate hydratase         204   1e-56   
ref|XP_006025029.1|  PREDICTED: cytoplasmic aconitate hydratase         204   1e-56   
gb|ELR46544.1|  Cytoplasmic aconitate hydratase                         204   1e-56   
ref|XP_002413165.1|  RNA-binding translational regulator IRP, put...    203   1e-56   
ref|XP_004677765.1|  PREDICTED: cytoplasmic aconitate hydratase         204   1e-56   
ref|XP_008632753.1|  PREDICTED: cytoplasmic aconitate hydratase         204   1e-56   
ref|XP_004765422.1|  PREDICTED: cytoplasmic aconitate hydratase         203   1e-56   
ref|XP_004004477.1|  PREDICTED: cytoplasmic aconitate hydratase i...    203   2e-56   
ref|XP_006265526.1|  PREDICTED: cytoplasmic aconitate hydratase         203   2e-56   
ref|XP_004004476.1|  PREDICTED: cytoplasmic aconitate hydratase i...    203   2e-56   
ref|XP_011411872.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    204   2e-56   
ref|XP_009986012.1|  PREDICTED: cytoplasmic aconitate hydratase         203   2e-56   
ref|XP_006809760.1|  PREDICTED: cytoplasmic aconitate hydratase-like    202   2e-56   
ref|XP_006939263.1|  PREDICTED: cytoplasmic aconitate hydratase         203   3e-56   
ref|XP_007065257.1|  PREDICTED: cytoplasmic aconitate hydratase         202   3e-56   
ref|XP_008996396.1|  PREDICTED: cytoplasmic aconitate hydratase         202   3e-56   
gb|KFB40343.1|  AGAP007258-PA-like protein                              203   3e-56   
ref|XP_008166967.1|  PREDICTED: cytoplasmic aconitate hydratase         202   3e-56   
ref|XP_001509375.1|  PREDICTED: cytoplasmic aconitate hydratase         202   3e-56   
gb|EKF31280.1|  aconitase, putative                                     202   3e-56   



>dbj|BAD94991.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
Length=328

 Score =   304 bits (778),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            ++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  168  MNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDTIILAGAEYGSGSSRDWAAKGPMLQGV  227

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP++I+EIRPGQDV
Sbjct  228  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISEIRPGQDV  287

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR LSKQ
Sbjct  288  TVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  328



>gb|EEC83021.1| hypothetical protein OsI_28098 [Oryza sativa Indica Group]
Length=621

 Score =   310 bits (793),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 157/161 (98%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVH+PTGEKLYVFDAA++YKSEG DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  461  LNGEVGPKTVHVPTGEKLYVFDAALKYKSEGHDTIVLAGAEYGSGSSRDWAAKGPMLLGV  520

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLTGHERY+IDLP+N++EIRPGQD+
Sbjct  521  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYTIDLPTNVSEIRPGQDI  580

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCT+RFDTEVELAYFNHGGILPYVIR L++ 
Sbjct  581  TVTTDNGKSFTCTLRFDTEVELAYFNHGGILPYVIRNLAQN  621



>ref|XP_004158846.1| PREDICTED: aconitate hydratase-like [Cucumis sativus]
Length=178

 Score =   295 bits (754),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIP+GEKL VFDAAMRYKSEG+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  16   LKGEVGPKTIHIPSGEKLSVFDAAMRYKSEGQDTIILAGAEYGSGSSRDWAAKGPMLLGV  75

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHER++IDLPSN+ EIRPGQDV
Sbjct  76   KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERFTIDLPSNVGEIRPGQDV  135

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
             V TD GK+F+C +RFDTEVELAYF+HGGIL YVIR L
Sbjct  136  AVVTDTGKSFSCILRFDTEVELAYFDHGGILQYVIRNL  173



>gb|AFW61053.1| hypothetical protein ZEAMMB73_482448 [Zea mays]
Length=617

 Score =   307 bits (786),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+H+PTGEKL VFDAAMRYKSEG  TIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  455  LNGEVGPKTIHVPTGEKLSVFDAAMRYKSEGHATIILAGAEYGSGSSRDWAAKGPMLLGV  514

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLTGHERYSIDLP+N++EIRPGQDV
Sbjct  515  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYSIDLPTNLSEIRPGQDV  574

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLS  257
            TV TDNGK+FTC VRFDTEVELAYFNHGGILPYVIR L+
Sbjct  575  TVTTDNGKSFTCIVRFDTEVELAYFNHGGILPYVIRNLA  613



>ref|NP_001136484.1| uncharacterized protein LOC100216599 [Zea mays]
 gb|ACF82029.1| unknown [Zea mays]
Length=565

 Score =   305 bits (782),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+H+PTGEKL VFDAAMRYKSEG  TIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  403  LNGEVGPKTIHVPTGEKLSVFDAAMRYKSEGHATIILAGAEYGSGSSRDWAAKGPMLLGV  462

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLTGHERYSIDLP+N++EIRPGQDV
Sbjct  463  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYSIDLPTNLSEIRPGQDV  522

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLS  257
            TV TDNGK+FTC VRFDTEVELAYFNHGGILPYVIR L+
Sbjct  523  TVTTDNGKSFTCIVRFDTEVELAYFNHGGILPYVIRNLA  561



>ref|XP_008455442.1| PREDICTED: aconitate hydratase, cytoplasmic [Cucumis melo]
Length=989

 Score =   314 bits (804),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/161 (93%), Positives = 156/161 (97%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKLYVFDAA RYKS G+DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  829  LNGEVGPKTVHIPTGEKLYVFDAAERYKSAGQDTIVLAGAEYGSGSSRDWAAKGPMLLGV  888

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLTGHERYSIDLPSNI+EIRPGQDV
Sbjct  889  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYSIDLPSNISEIRPGQDV  948

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD+GK+FTCTVRFDTEVELAYFNHGGILPYVIR L KQ
Sbjct  949  TVTTDSGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLIKQ  989



>ref|XP_010533008.1| PREDICTED: aconitate hydratase 2, mitochondrial isoform X2 [Tarenaya 
hassleriana]
Length=658

 Score =   305 bits (781),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL V+DAAMRYKS G+DT+ILAGAEYGSGSSRDWAAKGPML GV
Sbjct  498  LNGEVGPKTIHIPTGEKLSVYDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLQGV  557

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAD+LGLTGHERY+I LP+NI EIRPGQDV
Sbjct  558  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLTGHERYTIHLPTNILEIRPGQDV  617

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAY+NHGGILPYVIR LSKQ
Sbjct  618  TVTTDNGKSFTCTVRFDTEVELAYYNHGGILPYVIRNLSKQ  658



>gb|KCW88791.1| hypothetical protein EUGRSUZ_A01129 [Eucalyptus grandis]
Length=795

 Score =   308 bits (789),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/161 (90%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKLYVFDAAM+YKS G DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  635  LNGEVGPKTVHIPTGEKLYVFDAAMKYKSAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGV  694

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGED D+LGLTGHERYSIDLPSNI+EIRPGQDV
Sbjct  695  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDTDTLGLTGHERYSIDLPSNISEIRPGQDV  754

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD GK+FTCT RFDTEVELAYFNHGGILPYVIR L  Q
Sbjct  755  TVTTDTGKSFTCTARFDTEVELAYFNHGGILPYVIRNLINQ  795



>sp|Q6YZX6.1|ACOC_ORYSJ RecName: Full=Putative aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Oryza sativa 
Japonica Group]
 dbj|BAD05751.1| putative Aconitate hydratase [Oryza sativa Japonica Group]
Length=898

 Score =   310 bits (794),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 157/161 (98%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVH+PTGEKLYVFDAA++YKSEG DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LNGEVGPKTVHVPTGEKLYVFDAALKYKSEGHDTIVLAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLTGHERY+IDLP+N++EIRPGQD+
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYTIDLPTNVSEIRPGQDI  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCT+RFDTEVELAYFNHGGILPYVIR L++ 
Sbjct  858  TVTTDNGKSFTCTLRFDTEVELAYFNHGGILPYVIRNLAQN  898



>ref|XP_009601350.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana tomentosiformis]
Length=997

 Score =   311 bits (797),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 146/161 (91%), Positives = 157/161 (98%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKL VFDAAM+YKS G+DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  837  LNGEVGPKTVHIPTGEKLSVFDAAMKYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGV  896

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAD+LGLTGHERY+IDLP NI+EIRPGQDV
Sbjct  897  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLTGHERYTIDLPENISEIRPGQDV  956

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV+T+ GK+FTCTVRFDTEVELAYFNHGGILPYVIRQL+KQ
Sbjct  957  TVRTETGKSFTCTVRFDTEVELAYFNHGGILPYVIRQLTKQ  997



>ref|XP_006351962.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Solanum tuberosum]
Length=981

 Score =   311 bits (796),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 146/161 (91%), Positives = 156/161 (97%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIP+GEKL VFDAAM+YKS G+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  821  LNGEVGPKTIHIPSGEKLSVFDAAMKYKSAGQDTIILAGAEYGSGSSRDWAAKGPMLLGV  880

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERY+IDLP NI+EIRPGQDV
Sbjct  881  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYTIDLPDNISEIRPGQDV  940

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV+TD GK+FTC VRFDTEVELAYFNHGGILPYVIRQLS+Q
Sbjct  941  TVRTDTGKSFTCIVRFDTEVELAYFNHGGILPYVIRQLSQQ  981



>ref|XP_004144496.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
 gb|KGN43521.1| hypothetical protein Csa_7G043630 [Cucumis sativus]
Length=989

 Score =   311 bits (797),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 147/161 (91%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKLYVFDAA RYKS G+DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  829  LNGEVGPKTVHIPTGEKLYVFDAAERYKSAGQDTIVLAGAEYGSGSSRDWAAKGPMLLGV  888

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLTGHERYSIDLP NI+EIRPGQDV
Sbjct  889  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYSIDLPDNISEIRPGQDV  948

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            +V TD+GK+FTCTVRFDTEVELAYFNHGGILPYVIR L KQ
Sbjct  949  SVTTDSGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLIKQ  989



>ref|XP_004251517.2| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=981

 Score =   311 bits (796),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 146/161 (91%), Positives = 156/161 (97%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIP+GEKL VFDAAM+YKS G+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  821  LNGEVGPKTIHIPSGEKLSVFDAAMKYKSAGQDTIILAGAEYGSGSSRDWAAKGPMLLGV  880

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERY+IDLP NI+EIRPGQDV
Sbjct  881  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYTIDLPDNISEIRPGQDV  940

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV+TD GK+FTC VRFDTEVELAYFNHGGILPYVIRQLS+Q
Sbjct  941  TVQTDTGKSFTCVVRFDTEVELAYFNHGGILPYVIRQLSQQ  981



>gb|EEE68177.1| hypothetical protein OsJ_26310 [Oryza sativa Japonica Group]
Length=956

 Score =   310 bits (794),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 157/161 (98%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVH+PTGEKLYVFDAA++YKSEG DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  796  LNGEVGPKTVHVPTGEKLYVFDAALKYKSEGHDTIVLAGAEYGSGSSRDWAAKGPMLLGV  855

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLTGHERY+IDLP+N++EIRPGQD+
Sbjct  856  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYTIDLPTNVSEIRPGQDI  915

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCT+RFDTEVELAYFNHGGILPYVIR L++ 
Sbjct  916  TVTTDNGKSFTCTLRFDTEVELAYFNHGGILPYVIRNLAQN  956



>ref|XP_004159202.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
Length=989

 Score =   310 bits (795),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 146/161 (91%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKLYVFDAA RYKS G+DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  829  LNGEVGPKTVHIPTGEKLYVFDAAERYKSAGQDTIVLAGAEYGSGSSRDWAAKGPMLLGV  888

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLTGHERYSIDLP NI+EIRPGQDV
Sbjct  889  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYSIDLPDNISEIRPGQDV  948

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            ++ TD+GK+FTCTVRFDTEVELAYFNHGGILPYVIR L KQ
Sbjct  949  SITTDSGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLIKQ  989



>ref|XP_011100304.1| PREDICTED: aconitate hydratase, cytoplasmic [Sesamum indicum]
Length=1001

 Score =   310 bits (795),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 146/161 (91%), Positives = 156/161 (97%), Gaps = 0/161 (0%)
 Frame = -1

Query  733   LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
             L+GEVGPKTVHIPTGEKLYVFDAAM+YKS G+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  841   LNGEVGPKTVHIPTGEKLYVFDAAMKYKSAGQDTIILAGAEYGSGSSRDWAAKGPMLLGV  900

Query  553   KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
             KAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLTGHERY+IDLPS I++IRPGQDV
Sbjct  901   KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLTGHERYTIDLPSKISDIRPGQDV  960

Query  373   TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
             TV TD+GK FTCTVRFDTEVELAYFNHGGILPYVIRQL+KQ
Sbjct  961   TVVTDSGKQFTCTVRFDTEVELAYFNHGGILPYVIRQLTKQ  1001



>ref|XP_002445174.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
 gb|EES14669.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
Length=996

 Score =   310 bits (793),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+H+PTGEKLYVFDAAMRYKSEG  TIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  834  LNGEVGPKTIHVPTGEKLYVFDAAMRYKSEGHATIILAGAEYGSGSSRDWAAKGPMLLGV  893

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLTGHERYSIDLP+N++EIRPGQDV
Sbjct  894  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYSIDLPANLSEIRPGQDV  953

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLS  257
            TV TDNGK+FTCT+RFDTEVELAYFNHGGILPYVIR L+
Sbjct  954  TVITDNGKSFTCTLRFDTEVELAYFNHGGILPYVIRNLA  992



>ref|XP_003540302.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   310 bits (793),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/161 (91%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKLYVFDAA RYK+EG+DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  824  LNGEVGPKTVHIPTGEKLYVFDAAQRYKAEGQDTIVLAGAEYGSGSSRDWAAKGPMLLGV  883

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFK+GEDAD+LGLTGHERY+IDLPSNI+EIRPGQDV
Sbjct  884  KAVIAKSFERIHRSNLVGMGIVPLCFKSGEDADTLGLTGHERYTIDLPSNISEIRPGQDV  943

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T  GK+FTCTVRFDTEVELAYFNHGGILPYVIR L KQ
Sbjct  944  TVTTTTGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLIKQ  984



>gb|AFW61054.1| hypothetical protein ZEAMMB73_482448 [Zea mays]
Length=797

 Score =   306 bits (783),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+H+PTGEKL VFDAAMRYKSEG  TIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  635  LNGEVGPKTIHVPTGEKLSVFDAAMRYKSEGHATIILAGAEYGSGSSRDWAAKGPMLLGV  694

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLTGHERYSIDLP+N++EIRPGQDV
Sbjct  695  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYSIDLPTNLSEIRPGQDV  754

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLS  257
            TV TDNGK+FTC VRFDTEVELAYFNHGGILPYVIR L+
Sbjct  755  TVTTDNGKSFTCIVRFDTEVELAYFNHGGILPYVIRNLA  793



>gb|KDP22711.1| hypothetical protein JCGZ_01813 [Jatropha curcas]
Length=998

 Score =   310 bits (793),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 156/161 (97%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKLYVFDAAM+YK+ G DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  838  LNGEVGPKTIHIPTGEKLYVFDAAMKYKTAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGV  897

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAG+DAD+LGLTGHERY+IDLPSNI++IRPGQDV
Sbjct  898  KAVIAKSFERIHRSNLVGMGIIPLCFKAGQDADTLGLTGHERYTIDLPSNISDIRPGQDV  957

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR L K+
Sbjct  958  TVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLMKE  998



>ref|XP_009770911.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana sylvestris]
Length=996

 Score =   309 bits (792),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/161 (90%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKL VFDAAM+YKS G+DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  836  LNGEVGPKTVHIPTGEKLSVFDAAMKYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGV  895

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAD+LGLTGHERY+IDLP NI+EIRPGQDV
Sbjct  896  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLTGHERYTIDLPENISEIRPGQDV  955

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
             V+TD GK+FTC VRFDTEVELAYFNHGGILPYVIRQL+KQ
Sbjct  956  AVRTDTGKSFTCIVRFDTEVELAYFNHGGILPYVIRQLTKQ  996



>ref|XP_002321126.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
 gb|EEE99441.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
Length=999

 Score =   309 bits (791),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 146/161 (91%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKLYVFDAAMRYKS G DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  839  LNGEVGPKTVHIPTGEKLYVFDAAMRYKSAGYDTIVLAGAEYGSGSSRDWAAKGPMLLGV  898

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK G+DAD+LGLTGHERYSIDLPSNI EIRPGQDV
Sbjct  899  KAVIAKSFERIHRSNLVGMGIIPLCFKDGQDADTLGLTGHERYSIDLPSNIGEIRPGQDV  958

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+F CTVRFDTEVELAYFNHGGILPY IR L KQ
Sbjct  959  TVTTDNGKSFICTVRFDTEVELAYFNHGGILPYAIRNLMKQ  999



>ref|XP_010100637.1| Aconitate hydratase [Morus notabilis]
 gb|EXB83385.1| Aconitate hydratase [Morus notabilis]
Length=938

 Score =   308 bits (789),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 145/161 (90%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKLYVFDAA RYKS G DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  778  LNGEVGPKTVHIPTGEKLYVFDAATRYKSAGHDTIILAGAEYGSGSSRDWAAKGPMLLGV  837

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI KSFERIHRSNLVGMGI+PLCFKAGEDA++LGLTGHERY+IDLPSNI++IRPGQDV
Sbjct  838  KAVITKSFERIHRSNLVGMGIIPLCFKAGEDAETLGLTGHERYTIDLPSNISDIRPGQDV  897

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAYFNHGGILPY IR L KQ
Sbjct  898  TVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYAIRNLIKQ  938



>ref|XP_007149973.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
 gb|ESW21967.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
Length=983

 Score =   308 bits (790),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 145/161 (90%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVG KTVHIPTGEKLYVFDAA RYK+EGKDTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  823  LNGEVGAKTVHIPTGEKLYVFDAAQRYKAEGKDTIVLAGAEYGSGSSRDWAAKGPMLLGV  882

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLPS I+EIRPGQDV
Sbjct  883  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSKISEIRPGQDV  942

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCT RFDTEVELAYFNHGGILPYVIR L KQ
Sbjct  943  TVTTDNGKSFTCTARFDTEVELAYFNHGGILPYVIRNLIKQ  983



>ref|NP_001159192.1| uncharacterized protein LOC100304277 [Zea mays]
 gb|ACN25362.1| unknown [Zea mays]
Length=287

 Score =   290 bits (742),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+H+P+GEKL VFDAAM+YK+EG DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  127  LKGEVGPKTIHVPSGEKLAVFDAAMKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGV  186

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNL GMGI+PLC+KAGEDAD+LGLTGHERY++ LP+N++EI+PGQDV
Sbjct  187  KAVIAKSFERIHRSNLAGMGIIPLCYKAGEDADTLGLTGHERYTVHLPTNVSEIKPGQDV  246

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCT+RFDTEVELAY++HGGILPYV R++++Q
Sbjct  247  TVTTDNGKSFTCTLRFDTEVELAYYDHGGILPYVARKIAEQ  287



>ref|XP_008230066.1| PREDICTED: aconitate hydratase, cytoplasmic [Prunus mume]
Length=994

 Score =   308 bits (790),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 146/161 (91%), Positives = 156/161 (97%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKLYVFDAA RYK++G DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  834  LNGEVGPKTVHIPTGEKLYVFDAATRYKADGHDTIVLAGAEYGSGSSRDWAAKGPMLLGV  893

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAD+LGLTGHERY+IDLPS+I+EI+PGQDV
Sbjct  894  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLTGHERYTIDLPSSISEIKPGQDV  953

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAYFNHGGIL YVIR LSKQ
Sbjct  954  TVTTDNGKSFTCTVRFDTEVELAYFNHGGILHYVIRNLSKQ  994



>ref|XP_011047264.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047265.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047266.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
Length=1001

 Score =   308 bits (790),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 146/161 (91%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733   LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
             L+GEVGPKTVHIPTGEKLYVFDAAMRYKS G DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  841   LNGEVGPKTVHIPTGEKLYVFDAAMRYKSAGYDTIVLAGAEYGSGSSRDWAAKGPMLLGV  900

Query  553   KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
             KAVIAKSFERIHRSNLVGMGI+PLCFKAG+DAD+LGLTGHERYSIDLPSNI+EIRPGQDV
Sbjct  901   KAVIAKSFERIHRSNLVGMGIIPLCFKAGQDADTLGLTGHERYSIDLPSNIDEIRPGQDV  960

Query  373   TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
             TV TDNGK+F CTVRFDTEVELAYFNHGGIL Y IR L KQ
Sbjct  961   TVTTDNGKSFICTVRFDTEVELAYFNHGGILQYAIRNLMKQ  1001



>ref|XP_007217144.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
 gb|EMJ18343.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
Length=996

 Score =   308 bits (789),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 146/161 (91%), Positives = 156/161 (97%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKLYVFDAA RYK++G DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  836  LNGEVGPKTVHIPTGEKLYVFDAATRYKADGHDTIVLAGAEYGSGSSRDWAAKGPMLLGV  895

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAD+LGLTGHERY+IDLPS+I+EI+PGQDV
Sbjct  896  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLTGHERYTIDLPSSISEIKPGQDV  955

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAYFNHGGIL YVIR LSKQ
Sbjct  956  TVTTDNGKSFTCTVRFDTEVELAYFNHGGILHYVIRNLSKQ  996



>dbj|BAE71240.1| putative cytoplasmic aconitate hydratase [Trifolium pratense]
Length=316

 Score =   291 bits (744),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVH+PTGEKL+VFDAA RYK+ G  TI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  155  LNGEVGPKTVHVPTGEKLFVFDAAERYKAAGHATIVLAGAEYGSGSSRDWAAKGPMLLGV  214

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLP+ I+EI+PGQDV
Sbjct  215  KAVISKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPNKISEIKPGQDV  274

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TDNGK+FTCT RFDTEVEL YFNHGGILPYVIR L
Sbjct  275  TVTTDNGKSFTCTARFDTEVELEYFNHGGILPYVIRNL  312



>gb|KJB62843.1| hypothetical protein B456_009G439700, partial [Gossypium raimondii]
Length=417

 Score =   294 bits (752),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+H+PTGEKLYV+DAAMRYK+ G+DTI+LAGAEYGSGSSRDWAAKG MLLGV
Sbjct  257  LKGEVGPKTIHVPTGEKLYVYDAAMRYKAAGQDTIVLAGAEYGSGSSRDWAAKGQMLLGV  316

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI KSFERIHRSNLVGMGI+PLCFK GEDADSLGLTGHERYSIDLP+ I+EIRPGQDV
Sbjct  317  KAVITKSFERIHRSNLVGMGIIPLCFKPGEDADSLGLTGHERYSIDLPNKISEIRPGQDV  376

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T  GK+FTCTVRFDTEVELAYF+HGGILP+VIR L+K+
Sbjct  377  TVTTVTGKSFTCTVRFDTEVELAYFDHGGILPFVIRNLNKE  417



>gb|KHN36531.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=984

 Score =   308 bits (789),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 145/161 (90%), Positives = 156/161 (97%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKLYVFDAA RYK+EG+DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  824  LNGEVGPKTVHIPTGEKLYVFDAAQRYKAEGQDTIVLAGAEYGSGSSRDWAAKGPMLLGV  883

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFK+GEDAD+LGLTGHERY+IDLPSNI+EIRPGQDV
Sbjct  884  KAVIAKSFERIHRSNLVGMGIVPLCFKSGEDADTLGLTGHERYTIDLPSNISEIRPGQDV  943

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T+ GK+FTCTVRFDTEVELAYFN+GGILPYVIR L KQ
Sbjct  944  TVTTNTGKSFTCTVRFDTEVELAYFNNGGILPYVIRNLIKQ  984



>ref|XP_003543388.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   308 bits (788),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 145/161 (90%), Positives = 156/161 (97%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKLYVFDAA RYK+EG+DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  824  LNGEVGPKTVHIPTGEKLYVFDAAQRYKAEGQDTIVLAGAEYGSGSSRDWAAKGPMLLGV  883

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFK+GEDAD+LGLTGHERY+IDLPSNI+EIRPGQDV
Sbjct  884  KAVIAKSFERIHRSNLVGMGIVPLCFKSGEDADTLGLTGHERYTIDLPSNISEIRPGQDV  943

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T+ GK+FTCTVRFDTEVELAYFN+GGILPYVIR L KQ
Sbjct  944  TVTTNTGKSFTCTVRFDTEVELAYFNNGGILPYVIRNLIKQ  984



>ref|XP_010046497.1| PREDICTED: aconitate hydratase, cytoplasmic [Eucalyptus grandis]
Length=996

 Score =   308 bits (788),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 145/161 (90%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKLYVFDAAM+YKS G DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  836  LNGEVGPKTVHIPTGEKLYVFDAAMKYKSAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGV  895

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGED D+LGLTGHERYSIDLPSNI+EIRPGQDV
Sbjct  896  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDTDTLGLTGHERYSIDLPSNISEIRPGQDV  955

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD GK+FTCT RFDTEVELAYFNHGGILPYVIR L  Q
Sbjct  956  TVTTDTGKSFTCTARFDTEVELAYFNHGGILPYVIRNLINQ  996



>ref|XP_008676648.1| PREDICTED: uncharacterized protein LOC100216599 isoform X1 [Zea 
mays]
Length=987

 Score =   307 bits (786),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+H+PTGEKL VFDAAMRYKSEG  TIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  825  LNGEVGPKTIHVPTGEKLSVFDAAMRYKSEGHATIILAGAEYGSGSSRDWAAKGPMLLGV  884

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLTGHERYSIDLP+N++EIRPGQDV
Sbjct  885  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYSIDLPTNLSEIRPGQDV  944

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLS  257
            TV TDNGK+FTC VRFDTEVELAYFNHGGILPYVIR L+
Sbjct  945  TVTTDNGKSFTCIVRFDTEVELAYFNHGGILPYVIRNLA  983



>gb|ADM34980.1| cytosolic aconitase [Pyrus pyrifolia]
Length=898

 Score =   305 bits (781),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIP+GEKL+VFDAA RYK++G DTI++AGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LNGEVGPKTVHIPSGEKLFVFDAATRYKADGHDTIVIAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDAD+LGLTGHERY+IDLPSNI+EI+PGQDV
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSNISEIKPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVEL YFNHGGIL YVIR LSKQ
Sbjct  858  TVTTDNGKSFTCTVRFDTEVELEYFNHGGILQYVIRNLSKQ  898



>gb|KHN21232.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=918

 Score =   305 bits (782),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKLYVFDAA RYK+ G+DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  758  LNGEVGPKTIHIPTGEKLYVFDAATRYKASGQDTIVLAGAEYGSGSSRDWAAKGPMLLGV  817

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLTGHERY+I+LPS INEIRPGQDV
Sbjct  818  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLTGHERYTIELPSIINEIRPGQDV  877

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCT RFDTEVELAYFNHGGILPYVIR L KQ
Sbjct  878  TVTTDNGKSFTCTARFDTEVELAYFNHGGILPYVIRNLIKQ  918



>emb|CDY18054.1| BnaC07g04160D [Brassica napus]
Length=986

 Score =   306 bits (784),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            ++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  826  MNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDTIILAGAEYGSGSSRDWAAKGPMLQGV  885

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDADSLGLTGHERY+I LP++I+EIRPGQDV
Sbjct  886  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADSLGLTGHERYTIHLPTDISEIRPGQDV  945

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR LSKQ
Sbjct  946  TVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  986



>gb|AAD25640.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
Length=898

 Score =   305 bits (781),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            ++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  738  MNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDTIILAGAEYGSGSSRDWAAKGPMLQGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP++I+EIRPGQDV
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISEIRPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR LSKQ
Sbjct  858  TVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  898



>gb|KFK39331.1| hypothetical protein AALP_AA3G230700 [Arabis alpina]
Length=986

 Score =   306 bits (784),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIP+GEKL VFDAAMRYKS G+DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  826  LNGEVGPKTIHIPSGEKLSVFDAAMRYKSSGEDTIILAGAEYGSGSSRDWAAKGPMLQGV  885

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP+NI+EIRPGQDV
Sbjct  886  KAVISKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTNISEIRPGQDV  945

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR LSKQ
Sbjct  946  TVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  986



>ref|XP_004287944.1| PREDICTED: aconitate hydratase, cytoplasmic [Fragaria vesca subsp. 
vesca]
Length=990

 Score =   306 bits (784),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 156/161 (97%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVH+P+GEKL VFDAAM+YKS G+DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  830  LNGEVGPKTVHVPSGEKLSVFDAAMKYKSAGQDTIVLAGAEYGSGSSRDWAAKGPMLLGV  889

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFKAGEDAD+LGLTGHERY+IDLPSNI+EI+PGQDV
Sbjct  890  KAVISKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSNISEIKPGQDV  949

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD+GK+F CTVRFDTEVELAYFNHGGILPYVIR LSKQ
Sbjct  950  TVTTDSGKSFVCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  990



>gb|KHG18502.1| Aconitate hydratase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=933

 Score =   305 bits (782),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVH+PTGEKLYVFDAAMRYK  G DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  773  LNGEVGPKTVHVPTGEKLYVFDAAMRYKDAGYDTIVLAGAEYGSGSSRDWAAKGPMLLGV  832

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLPS I +IRPGQDV
Sbjct  833  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSKITDIRPGQDV  892

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAYFN+GGILPYVIR L KQ
Sbjct  893  TVTTDNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNLIKQ  933



>dbj|BAG16527.1| putative aconitase [Capsicum chinense]
Length=995

 Score =   306 bits (784),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 156/161 (97%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIP+GEKL VFDAAM+YKS G++TIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  835  LNGEVGPKTVHIPSGEKLSVFDAAMKYKSAGQNTIILAGAEYGSGSSRDWAAKGPMLLGV  894

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAD+LGLTGHERY+IDLP NI+EIRPGQDV
Sbjct  895  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLTGHERYTIDLPENISEIRPGQDV  954

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            +V+TD GK+FTCTVRFDTEVELAYFNHGGIL YVIRQL+KQ
Sbjct  955  SVQTDTGKSFTCTVRFDTEVELAYFNHGGILQYVIRQLTKQ  995



>ref|XP_002883704.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59963.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
Length=993

 Score =   306 bits (784),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 156/161 (97%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            ++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  833  MNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDTIILAGAEYGSGSSRDWAAKGPMLQGV  892

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I+LP++I+EIRPGQDV
Sbjct  893  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTINLPTDISEIRPGQDV  952

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR LSKQ
Sbjct  953  TVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  993



>ref|XP_008342002.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Malus domestica]
Length=992

 Score =   306 bits (783),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKL+VFDAA RYK++G DTI++AGAEYGSGSSRDWAAKGPMLLGV
Sbjct  832  LNGEVGPKTVHIPTGEKLFVFDAATRYKADGHDTIVIAGAEYGSGSSRDWAAKGPMLLGV  891

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDAD+LGLTGHERY+IDLPSNI+EI+PGQDV
Sbjct  892  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSNISEIKPGQDV  951

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK FTCTVRFDTEVEL YFNHGGIL YVIR LSKQ
Sbjct  952  TVTTDNGKAFTCTVRFDTEVELEYFNHGGILQYVIRNLSKQ  992



>ref|XP_003539865.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Glycine max]
Length=984

 Score =   306 bits (783),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKLYVFDAA RYK+ G+DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  824  LNGEVGPKTIHIPTGEKLYVFDAATRYKASGQDTIVLAGAEYGSGSSRDWAAKGPMLLGV  883

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLTGHERY+I+LPS INEIRPGQDV
Sbjct  884  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLTGHERYTIELPSIINEIRPGQDV  943

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCT RFDTEVELAYFNHGGILPYVIR L KQ
Sbjct  944  TVTTDNGKSFTCTARFDTEVELAYFNHGGILPYVIRNLIKQ  984



>ref|XP_006396145.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
 gb|ESQ36924.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
Length=995

 Score =   306 bits (783),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIP+GEKL VFDAAMRYKS G+DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  835  LNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDTIILAGAEYGSGSSRDWAAKGPMLQGV  894

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP++I+EIRPGQDV
Sbjct  895  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISEIRPGQDV  954

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR LSKQ
Sbjct  955  TVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  995



>gb|KHN41224.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=903

 Score =   304 bits (779),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIPTGEKLYVFDAA RY + G+DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  743  LKGEVGPKTVHIPTGEKLYVFDAATRYMASGQDTIVLAGAEYGSGSSRDWAAKGPMLLGV  802

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLTGHERYSIDLPS I+EIRPGQDV
Sbjct  803  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLTGHERYSIDLPSKISEIRPGQDV  862

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVEL YFNHGGILPYVIR L KQ
Sbjct  863  TVTTDNGKSFTCTVRFDTEVELDYFNHGGILPYVIRNLIKQ  903



>gb|KJB60835.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=990

 Score =   305 bits (782),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVH+PTGEKLYVFDAAMRYK  G DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  830  LNGEVGPKTVHVPTGEKLYVFDAAMRYKDAGYDTIVLAGAEYGSGSSRDWAAKGPMLLGV  889

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLPS I +IRPGQDV
Sbjct  890  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSKITDIRPGQDV  949

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAYFN+GGILPYVIR L KQ
Sbjct  950  TVTTDNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNLIKQ  990



>sp|O04916.1|ACOC_SOLTU RecName: Full=Aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase, partial [Solanum tuberosum]
 emb|CAA65735.1| aconitate hydratase [Solanum tuberosum]
Length=616

 Score =   298 bits (762),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVH+P+GEKL VFDAAM+YKS G+ TIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  456  LNGEVGPKTVHVPSGEKLSVFDAAMKYKSAGQSTIILAGAEYGSGSSRDWAAKGPMLLGV  515

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAD+LGLTG ERY+IDLP NI+EIRPGQDV
Sbjct  516  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLTGQERYTIDLPENISEIRPGQDV  575

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV+TD GK+FTC VRFDTEVELAYFNHGGIL YVIRQL+++
Sbjct  576  TVQTDTGKSFTCIVRFDTEVELAYFNHGGILQYVIRQLTQR  616



>ref|XP_009353280.1| PREDICTED: aconitate hydratase, cytoplasmic [Pyrus x bretschneideri]
Length=994

 Score =   305 bits (782),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIP+GEKL+VFDAA RYK++G DTI++AGAEYGSGSSRDWAAKGPMLLGV
Sbjct  834  LNGEVGPKTVHIPSGEKLFVFDAATRYKADGHDTIVIAGAEYGSGSSRDWAAKGPMLLGV  893

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDAD+LGLTGHERY+IDLPSNI+EI+PGQDV
Sbjct  894  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSNISEIKPGQDV  953

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVEL YFNHGGIL YVIR LSKQ
Sbjct  954  TVTTDNGKSFTCTVRFDTEVELEYFNHGGILQYVIRNLSKQ  994



>ref|XP_008804304.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Phoenix 
dactylifera]
Length=1010

 Score =   305 bits (782),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  733   LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
             L GEVGPKT+HIPTGEKLYVFD AMRYK++G DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  848   LKGEVGPKTIHIPTGEKLYVFDVAMRYKADGHDTIVLAGAEYGSGSSRDWAAKGPMLLGV  907

Query  553   KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
             KAVIAKSFERIHRSNLVGMG++PLCFK G+DADSLGLTGHERY+IDLPSNINEIRPGQDV
Sbjct  908   KAVIAKSFERIHRSNLVGMGVIPLCFKPGQDADSLGLTGHERYTIDLPSNINEIRPGQDV  967

Query  373   TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
             TV TD GK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  968   TVVTDAGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  1005



>emb|CDX93088.1| BnaA03g38100D [Brassica napus]
Length=994

 Score =   305 bits (781),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            ++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  834  MNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDTIILAGAEYGSGSSRDWAAKGPMLQGV  893

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP++I+EIRPGQDV
Sbjct  894  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISEIRPGQDV  953

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR LSKQ
Sbjct  954  TVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  994



>ref|XP_003527493.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=979

 Score =   305 bits (781),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIPTGEKLYVFDAA RY + G+DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  819  LKGEVGPKTVHIPTGEKLYVFDAATRYMASGQDTIVLAGAEYGSGSSRDWAAKGPMLLGV  878

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLTGHERYSIDLPS I+EIRPGQDV
Sbjct  879  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLTGHERYSIDLPSKISEIRPGQDV  938

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVEL YFNHGGILPYVIR L KQ
Sbjct  939  TVTTDNGKSFTCTVRFDTEVELDYFNHGGILPYVIRNLIKQ  979



>ref|XP_010533007.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Tarenaya 
hassleriana]
Length=998

 Score =   305 bits (781),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL V+DAAMRYKS G+DT+ILAGAEYGSGSSRDWAAKGPML GV
Sbjct  838  LNGEVGPKTIHIPTGEKLSVYDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLQGV  897

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAD+LGLTGHERY+I LP+NI EIRPGQDV
Sbjct  898  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLTGHERYTIHLPTNILEIRPGQDV  957

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAY+NHGGILPYVIR LSKQ
Sbjct  958  TVTTDNGKSFTCTVRFDTEVELAYYNHGGILPYVIRNLSKQ  998



>emb|CDX97969.1| BnaA06g07200D [Brassica napus]
Length=991

 Score =   305 bits (781),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            ++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  831  MNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDTIILAGAEYGSGSSRDWAAKGPMLQGV  890

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP++I+EIRPGQDV
Sbjct  891  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISEIRPGQDV  950

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR LSKQ
Sbjct  951  TVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  991



>ref|NP_178634.2| aconitate hydratase 3 [Arabidopsis thaliana]
 sp|Q9SIB9.2|ACO2M_ARATH RecName: Full=Aconitate hydratase 2, mitochondrial; Short=Aconitase 
2; AltName: Full=Citrate hydro-lyase 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAM97080.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
 gb|AAP68248.1| At2g05710 [Arabidopsis thaliana]
 gb|AEC05964.1| aconitate hydratase 3 [Arabidopsis thaliana]
Length=990

 Score =   305 bits (781),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            ++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  830  MNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDTIILAGAEYGSGSSRDWAAKGPMLQGV  889

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP++I+EIRPGQDV
Sbjct  890  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISEIRPGQDV  949

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR LSKQ
Sbjct  950  TVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  990



>gb|KJB50479.1| hypothetical protein B456_008G173400 [Gossypium raimondii]
Length=996

 Score =   305 bits (780),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+H+PTGEKLYVFDAAMRYK  G DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  836  LNGEVGPKTIHVPTGEKLYVFDAAMRYKDAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGV  895

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLP  I+EIRPGQDV
Sbjct  896  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPRKIDEIRPGQDV  955

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAYFN+GGILPYVIR L +Q
Sbjct  956  TVTTDNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNLIRQ  996



>gb|KHG08189.1| hypothetical protein F383_11434 [Gossypium arboreum]
Length=879

 Score =   303 bits (775),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+H+PTGEKLYVFDAAMRYK  G DTI+LAGA+YGSGSSRDWAAKGPMLLGV
Sbjct  719  LNGEVGPKTIHVPTGEKLYVFDAAMRYKDAGHDTIVLAGADYGSGSSRDWAAKGPMLLGV  778

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLP+ I++IRPGQDV
Sbjct  779  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPNKISDIRPGQDV  838

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAYFN+GGILPYVIR L KQ
Sbjct  839  TVTTDNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNLIKQ  879



>ref|XP_002278138.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI26642.3| unnamed protein product [Vitis vinifera]
Length=1009

 Score =   305 bits (780),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733   LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
             L+GEVGPKT+HIPTGEKLYVFDAAMRYK++G DTI+LAGAEYGSGSSRDWAAKGPML GV
Sbjct  849   LNGEVGPKTIHIPTGEKLYVFDAAMRYKADGHDTIVLAGAEYGSGSSRDWAAKGPMLQGV  908

Query  553   KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
             KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDAD+LGLTGHERY+IDLPS I+EIRPGQDV
Sbjct  909   KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLTGHERYNIDLPSKISEIRPGQDV  968

Query  373   TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
             TV TDNGK+FTCTVRFDTEVEL YFNHGGILPY IR L  Q
Sbjct  969   TVTTDNGKSFTCTVRFDTEVELEYFNHGGILPYAIRNLINQ  1009



>gb|KDO54658.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=795

 Score =   301 bits (770),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVH+PTGEKL VFDAAM+YKS G  TIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  635  LNGEVGPKTVHVPTGEKLSVFDAAMKYKSAGHGTIILAGAEYGSGSSRDWAAKGPMLLGV  694

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLTGHER+SIDLPS I+EIRPGQDV
Sbjct  695  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERFSIDLPSKISEIRPGQDV  754

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD+GK+FTCTVRFDTEVELAYF+HGGILP+VIR L KQ
Sbjct  755  TVTTDSGKSFTCTVRFDTEVELAYFDHGGILPFVIRNLIKQ  795



>ref|XP_010929878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Elaeis 
guineensis]
Length=1009

 Score =   304 bits (779),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  733   LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
             L GEVGPKT+HIPTGEKLYVFDAAMRYK++G DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  847   LKGEVGPKTIHIPTGEKLYVFDAAMRYKADGHDTIVLAGAEYGSGSSRDWAAKGPMLLGV  906

Query  553   KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
             KAVIAKSFERIHRSNLVGMGI+PLCFK G+DADSLGLTGHE Y+IDLPSNINEIRPGQDV
Sbjct  907   KAVIAKSFERIHRSNLVGMGIIPLCFKPGQDADSLGLTGHELYTIDLPSNINEIRPGQDV  966

Query  373   TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
             TV TD GK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  967   TVVTDAGKSFTCTVRFDTEVELAYFNHGGILPYVIRSL  1004



>ref|XP_007045642.1| Aconitase 3 [Theobroma cacao]
 gb|EOY01474.1| Aconitase 3 [Theobroma cacao]
Length=995

 Score =   304 bits (778),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVH+PTGEKLYVF+AAMRYK+ G DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  835  LNGEVGPKTVHVPTGEKLYVFEAAMRYKAAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGV  894

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLPSNI  IRPGQDV
Sbjct  895  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSNITHIRPGQDV  954

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            +V T+NGK+FTCTVRFDTEVELAYFN+GGILPYVIR L KQ
Sbjct  955  SVTTNNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNLIKQ  995



>gb|KJB30565.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30568.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=898

 Score =   302 bits (774),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+H+PTGEKLYVFDAAMRYK  G DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LNGEVGPKTIHVPTGEKLYVFDAAMRYKDAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLP+ I++IRPGQDV
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPNKISDIRPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T+NGK+FTCTVRFDTEVELAYFN+GGILPYVIR L KQ
Sbjct  858  TVTTNNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNLIKQ  898



>ref|XP_004517086.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=979

 Score =   303 bits (777),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTG+KLYVFDAAMRY + G+DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  819  LNGEVGPKTVHIPTGDKLYVFDAAMRYMTSGQDTIVLAGAEYGSGSSRDWAAKGPMLLGV  878

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLC+K+GEDAD+LGLTGHERY+IDLPS I+EIRPGQDV
Sbjct  879  KAVIAKSFERIHRSNLVGMGIIPLCYKSGEDADTLGLTGHERYTIDLPSKISEIRPGQDV  938

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
             V TDNGK+FTC VRFDTEVELAYFNHGGILPYVIR L KQ
Sbjct  939  KVTTDNGKSFTCIVRFDTEVELAYFNHGGILPYVIRNLIKQ  979



>emb|CAN62964.1| hypothetical protein VITISV_029521 [Vitis vinifera]
Length=520

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 149/161 (93%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+H+PTGEKL VFDAAM+YK+  + TIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  360  LNGEVGPKTIHVPTGEKLSVFDAAMKYKTANQGTIILAGAEYGSGSSRDWAAKGPMLLGV  419

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KA IAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLTGHERY+IDLPSNI+EIRPGQD+
Sbjct  420  KAXIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLTGHERYTIDLPSNIDEIRPGQDI  479

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T+ GK+F CT RFDTEVELAYFNHGGILPYVIR L KQ
Sbjct  480  TVTTNTGKSFICTARFDTEVELAYFNHGGILPYVIRNLIKQ  520



>emb|CDY50945.1| BnaC03g74450D [Brassica napus]
Length=995

 Score =   303 bits (777),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            ++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  835  MNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDTIILAGAEYGSGSSRDWAAKGPMLQGV  894

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP++I+EIRPGQDV
Sbjct  895  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISEIRPGQDV  954

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+F+CTVRFDTEVELAYFNHGGILPYVIR LSKQ
Sbjct  955  TVTTDNGKSFSCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  995



>ref|XP_011048785.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Populus euphratica]
Length=995

 Score =   303 bits (777),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKL V+DAAMRYK+ G DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  835  LNGEVGPKTVHIPTGEKLSVYDAAMRYKNAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGV  894

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAG+DAD+LGLTGHERY+IDLPSNI+EIRPGQDV
Sbjct  895  KAVIAKSFERIHRSNLVGMGIIPLCFKAGQDADTLGLTGHERYTIDLPSNISEIRPGQDV  954

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDT VEL YFNHGGILPY IR L KQ
Sbjct  955  TVTTDNGKSFTCTVRFDTAVELEYFNHGGILPYAIRNLMKQ  995



>ref|XP_010488774.1| PREDICTED: aconitate hydratase 2, mitochondrial [Camelina sativa]
Length=991

 Score =   303 bits (777),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            ++GEVGPKTVHIP+GEKL VFDAAM+YKS G+DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  831  MNGEVGPKTVHIPSGEKLSVFDAAMKYKSAGEDTIILAGAEYGSGSSRDWAAKGPMLQGV  890

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP++I+EIRPGQDV
Sbjct  891  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISEIRPGQDV  950

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR LSKQ
Sbjct  951  TVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  991



>gb|KHG08190.1| Aconitate hydratase 2, mitochondrial [Gossypium arboreum]
Length=973

 Score =   303 bits (776),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+H+PTGEKLYVFDAAMRYK  G DTI+LAGA+YGSGSSRDWAAKGPMLLGV
Sbjct  813  LNGEVGPKTIHVPTGEKLYVFDAAMRYKDAGHDTIVLAGADYGSGSSRDWAAKGPMLLGV  872

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLP+ I++IRPGQDV
Sbjct  873  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPNKISDIRPGQDV  932

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAYFN+GGILPYVIR L KQ
Sbjct  933  TVTTDNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNLIKQ  973



>emb|CDP10817.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   303 bits (777),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733   LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
             L  + GPKT+HIPTGEKLYVFDAAMRYK++G DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  849   LCSKDGPKTIHIPTGEKLYVFDAAMRYKADGHDTIILAGAEYGSGSSRDWAAKGPMLQGV  908

Query  553   KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
             KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDAD+LGLTGHERY+IDLPS I+EIRPGQDV
Sbjct  909   KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKIDEIRPGQDV  968

Query  373   TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
             TV TD GK+FTCT RFDTEVELAYFNHGGILPYV+RQL+KQ
Sbjct  969   TVTTDTGKSFTCTARFDTEVELAYFNHGGILPYVVRQLTKQ  1009



>gb|ADZ57218.1| aconitase protein [Litchi chinensis]
Length=883

 Score =   301 bits (771),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGP+TVH+PTGEKL+VFDAA RYK  G DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  723  LNGEVGPQTVHVPTGEKLFVFDAAQRYKDAGHDTIILAGAEYGSGSSRDWAAKGPMLLGV  782

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDAD+LGLTGHERY+IDLP++I+EIRPGQDV
Sbjct  783  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPNSISEIRPGQDV  842

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD GK+FTCTVRFDTEVELAYFNHGGILPYVIR L +Q
Sbjct  843  TVTTDTGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLIEQ  883



>gb|AAG28426.1|AF194945_1 cytosolic aconitase [Nicotiana tabacum]
Length=898

 Score =   301 bits (772),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL VFDAAM+YKS G+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LNGEVGPKTIHIPTGEKLSVFDAAMKYKSAGQDTIILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDA++LGLTGHERY+IDLP  I+EI PGQDV
Sbjct  798  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAETLGLTGHERYTIDLPEKISEIHPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV+TD GK+FTC VRFDTEVELAYFNHGGILPYVIRQL +Q
Sbjct  858  TVRTDTGKSFTCIVRFDTEVELAYFNHGGILPYVIRQLIQQ  898



>ref|XP_008379632.1| PREDICTED: aconitate hydratase, cytoplasmic [Malus domestica]
Length=994

 Score =   303 bits (776),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIP+GEKL+VFDAA RYK++G DTI++AGAEYGSGSSRDWAAKGPMLLGV
Sbjct  834  LNGEVGPKTVHIPSGEKLFVFDAATRYKADGHDTIVIAGAEYGSGSSRDWAAKGPMLLGV  893

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDAD+LGLTGHERY+IDLPS+I+EI+PGQDV
Sbjct  894  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSSISEIKPGQDV  953

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVEL YFNHGGIL YVIR LSKQ
Sbjct  954  TVTTDNGKSFTCTVRFDTEVELEYFNHGGILQYVIRNLSKQ  994



>gb|KJB30569.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=985

 Score =   303 bits (775),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+H+PTGEKLYVFDAAMRYK  G DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  825  LNGEVGPKTIHVPTGEKLYVFDAAMRYKDAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGV  884

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLP+ I++IRPGQDV
Sbjct  885  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPNKISDIRPGQDV  944

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T+NGK+FTCTVRFDTEVELAYFN+GGILPYVIR L KQ
Sbjct  945  TVTTNNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNLIKQ  985



>ref|XP_010266897.1| PREDICTED: aconitate hydratase 1 [Nelumbo nucifera]
Length=900

 Score =   301 bits (770),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIPTGEK+ VFDAAMRYKSEG+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LKGEVGPKTIHIPTGEKISVFDAAMRYKSEGQDTIILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++LGLTGHERYSI+LPSN++EIRPGQDV
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLTGHERYSINLPSNVSEIRPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TD+GK+FTCTVRFDTEVELAYF+HGGILPYVIR L
Sbjct  858  TVVTDSGKSFTCTVRFDTEVELAYFDHGGILPYVIRNL  895



>gb|KJB30566.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30567.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=992

 Score =   302 bits (774),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+H+PTGEKLYVFDAAMRYK  G DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  832  LNGEVGPKTIHVPTGEKLYVFDAAMRYKDAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGV  891

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLP+ I++IRPGQDV
Sbjct  892  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPNKISDIRPGQDV  951

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T+NGK+FTCTVRFDTEVELAYFN+GGILPYVIR L KQ
Sbjct  952  TVTTNNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNLIKQ  992



>ref|XP_010412716.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=991

 Score =   302 bits (774),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            ++GEVGPKTVHIP+GEKL VFDAAM+YKS G+DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  831  MNGEVGPKTVHIPSGEKLSVFDAAMKYKSAGEDTIILAGAEYGSGSSRDWAAKGPMLQGV  890

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP++I+EI+PGQDV
Sbjct  891  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISEIKPGQDV  950

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR LSKQ
Sbjct  951  TVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  991



>gb|KJB62847.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=993

 Score =   302 bits (774),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 139/161 (86%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+H+PTGEKLYV+DAAMRYK+ G+DTI+LAGAEYGSGSSRDWAAKGPML+GV
Sbjct  833  LKGEVGPKTIHVPTGEKLYVYDAAMRYKAAGQDTIVLAGAEYGSGSSRDWAAKGPMLVGV  892

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDADSLGLTGHERYSIDLP+ I+EIRPGQDV
Sbjct  893  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADSLGLTGHERYSIDLPNKISEIRPGQDV  952

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD GK+FTCTVRFDTEVELAYF+HGGILP+VIR L+K+
Sbjct  953  TVTTDTGKSFTCTVRFDTEVELAYFDHGGILPFVIRNLNKE  993



>ref|XP_009148490.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=991

 Score =   302 bits (774),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            ++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DTIILAGAEYGSGSS DWAAKGPML GV
Sbjct  831  MNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDTIILAGAEYGSGSSSDWAAKGPMLQGV  890

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP++I+EIRPGQDV
Sbjct  891  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISEIRPGQDV  950

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR LSKQ
Sbjct  951  TVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  991



>ref|XP_009769027.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana sylvestris]
Length=989

 Score =   302 bits (773),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL VFDAAM+YKS G+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  829  LNGEVGPKTIHIPTGEKLSVFDAAMKYKSAGQDTIILAGAEYGSGSSRDWAAKGPMLLGV  888

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDA++LGLTGHERY+IDLP  I+EI PGQDV
Sbjct  889  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAETLGLTGHERYTIDLPEKISEIHPGQDV  948

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV+TD GK+FTC VRFDTEVELAYFNHGGILPYVIRQL +Q
Sbjct  949  TVRTDTGKSFTCIVRFDTEVELAYFNHGGILPYVIRQLIQQ  989



>ref|XP_010276105.1| PREDICTED: aconitate hydratase, cytoplasmic [Nelumbo nucifera]
Length=992

 Score =   302 bits (773),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKLYVFDAAMRYK+ G+DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  832  LNGEVGPKTIHIPTGEKLYVFDAAMRYKAAGQDTIVLAGAEYGSGSSRDWAAKGPMLLGV  891

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLTG ERY+IDLPS ++EIRPGQDV
Sbjct  892  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLTGQERYTIDLPSKVSEIRPGQDV  951

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD GK+FTCTVRFDTEVELAYFNHGGILPYVIR L K 
Sbjct  952  TVVTDTGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLMKH  992



>ref|XP_004243472.1| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=995

 Score =   302 bits (773),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIP+GEKL VFDAAM+YKS G+ TIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  835  LNGEVGPKTVHIPSGEKLSVFDAAMKYKSAGQSTIILAGAEYGSGSSRDWAAKGPMLLGV  894

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAD+LGLTG ERY+IDLP NI+EIRPGQDV
Sbjct  895  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLTGQERYTIDLPENISEIRPGQDV  954

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV+TD GK+FTC VRFDTEVELAYFNHGGIL YVIRQL+KQ
Sbjct  955  TVQTDTGKSFTCVVRFDTEVELAYFNHGGILQYVIRQLTKQ  995



>emb|CBE71058.1| aconitate hydratase 2 [Citrus clementina]
Length=898

 Score =   300 bits (768),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVH+PTGEKL VFDAAM+YKS G  TIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LNGEVGPKTVHVPTGEKLSVFDAAMKYKSAGHGTIILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLTGHER+SIDLPS I+EIRPGQDV
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERFSIDLPSKISEIRPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD+GK+FTCTVRFDTEVELAYF+HGGILP+VIR L KQ
Sbjct  858  TVTTDSGKSFTCTVRFDTEVELAYFDHGGILPFVIRNLIKQ  898



>ref|XP_009599619.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana tomentosiformis]
Length=985

 Score =   301 bits (772),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL VFDAAM+YKS G+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  825  LNGEVGPKTIHIPTGEKLSVFDAAMKYKSAGQDTIILAGAEYGSGSSRDWAAKGPMLLGV  884

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDA++ GLTGHERY+IDLP NI+EIRPGQDV
Sbjct  885  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAETHGLTGHERYTIDLPKNISEIRPGQDV  944

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV+TD GK+FTC VRFDTEVELAYFNHGGILPYVIRQL
Sbjct  945  TVRTDTGKSFTCIVRFDTEVELAYFNHGGILPYVIRQL  982



>gb|KDO62732.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=795

 Score =   298 bits (762),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKLYVFDAAMRYK+ G +TI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  635  LNGEVGPKTVHIPTGEKLYVFDAAMRYKAAGHETIVLAGAEYGSGSSRDWAAKGPMLLGV  694

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGL GHERY+I+LP+ ++EIRPGQD+
Sbjct  695  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLAGHERYTINLPNKVSEIRPGQDI  754

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD GK+FTCTVRFDTEVELAYF+HGGILPYVIR L KQ
Sbjct  755  TVTTDTGKSFTCTVRFDTEVELAYFDHGGILPYVIRNLIKQ  795



>gb|KDO54656.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   301 bits (771),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVH+PTGEKL VFDAAM+YKS G  TIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  836  LNGEVGPKTVHVPTGEKLSVFDAAMKYKSAGHGTIILAGAEYGSGSSRDWAAKGPMLLGV  895

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLTGHER+SIDLPS I+EIRPGQDV
Sbjct  896  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERFSIDLPSKISEIRPGQDV  955

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD+GK+FTCTVRFDTEVELAYF+HGGILP+VIR L KQ
Sbjct  956  TVTTDSGKSFTCTVRFDTEVELAYFDHGGILPFVIRNLIKQ  996



>ref|XP_011097878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=898

 Score =   300 bits (767),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKLYV+DAAMRYKS G+DTI+LAGAEYGSGSSRDWAAKGPML GV
Sbjct  738  LNGEVGPKTIHIPTGEKLYVYDAAMRYKSAGQDTIVLAGAEYGSGSSRDWAAKGPMLQGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLTGHERY+IDLP+ I++IRPGQD+
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLTGHERYTIDLPTKISDIRPGQDI  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCT+RFDTEVELAYF+HGGIL YVIR L+KQ
Sbjct  858  TVTTDNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNLTKQ  898



>gb|AAP30039.1| aconitase [Solanum pennellii]
Length=898

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIP+GEKL VFDAAM+YKS G+ TIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LNGEVGPKTVHIPSGEKLSVFDAAMKYKSAGQSTIILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAD+LGLTG ERY+IDLP NI+EIRPGQDV
Sbjct  798  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLTGQERYTIDLPENISEIRPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV+TD GK+FTC VRFDTEVELAYFNHGGIL YVIRQL+K 
Sbjct  858  TVQTDTGKSFTCVVRFDTEVELAYFNHGGILQYVIRQLTKH  898



>ref|XP_006376779.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP54576.1| aconitate hydratase family protein [Populus trichocarpa]
Length=995

 Score =   301 bits (770),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKL V+DAAMRYK+ G DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  835  LNGEVGPKTVHIPTGEKLSVYDAAMRYKNAGLDTIVLAGAEYGSGSSRDWAAKGPMLLGV  894

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAG+DAD+LGLTGHERY+IDLPSNI+EIRPGQDV
Sbjct  895  KAVIAKSFERIHRSNLVGMGIIPLCFKAGQDADTLGLTGHERYTIDLPSNISEIRPGQDV  954

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCT RFDT VEL YFNHGGILPY IR L KQ
Sbjct  955  TVTTDNGKSFTCTARFDTAVELEYFNHGGILPYAIRSLMKQ  995



>ref|XP_006447555.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 ref|XP_006469685.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469686.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Citrus sinensis]
 gb|ESR60795.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=1000

 Score =   301 bits (771),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVH+PTGEKL VFDAAM+YKS G  TIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  840  LNGEVGPKTVHVPTGEKLSVFDAAMKYKSAGHGTIILAGAEYGSGSSRDWAAKGPMLLGV  899

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLTGHER+SIDLPS I+EIRPGQDV
Sbjct  900  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERFSIDLPSKISEIRPGQDV  959

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD+GK+FTCTVRFDTEVELAYF+HGGILP+VIR L KQ
Sbjct  960  TVTTDSGKSFTCTVRFDTEVELAYFDHGGILPFVIRNLIKQ  1000



>ref|XP_006296904.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
 gb|EOA29802.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
Length=988

 Score =   301 bits (770),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            ++GEVGPKTVHIP+GEKL VFDAAM+YKS G DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  828  MNGEVGPKTVHIPSGEKLSVFDAAMKYKSSGVDTIILAGAEYGSGSSRDWAAKGPMLQGV  887

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHER++I LP++I+EIRPGQDV
Sbjct  888  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERFTIHLPTDISEIRPGQDV  947

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR LSKQ
Sbjct  948  TVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  988



>ref|XP_010467089.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=994

 Score =   300 bits (769),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            ++GEVGPKTVHIP+GEKL VFDAAM+YKS G+DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  834  MNGEVGPKTVHIPSGEKLSVFDAAMKYKSAGEDTIILAGAEYGSGSSRDWAAKGPMLQGV  893

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP++I+EIRPGQDV
Sbjct  894  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISEIRPGQDV  953

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            +V TDNGK+F CTVRFDTEVELAYFNHGGILPYVIR LSKQ
Sbjct  954  SVTTDNGKSFNCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  994



>ref|XP_003605929.1| Aconitate hydratase [Medicago truncatula]
 gb|AES88126.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   300 bits (768),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/161 (86%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKLYVFDAAMRYK+ G+DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  819  LNGEVGPKTVHIPTGEKLYVFDAAMRYKTSGQDTIVLAGAEYGSGSSRDWAAKGPMLLGV  878

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLC+K GEDAD+LGLTGHER++IDLPS I+EI+PGQDV
Sbjct  879  KAVIAKSFERIHRSNLVGMGIIPLCYKPGEDADTLGLTGHERFTIDLPSKISEIKPGQDV  938

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
             V TD+GK+FTC  RFDTEVELAYFNHGGILPYVIR L KQ
Sbjct  939  KVTTDSGKSFTCIARFDTEVELAYFNHGGILPYVIRNLIKQ  979



>ref|XP_008785076.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Phoenix 
dactylifera]
Length=437

 Score =   287 bits (735),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GE GPKT+HIP+GEKL VFDAAMRYKSEG DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  275  LKGEPGPKTIHIPSGEKLSVFDAAMRYKSEGHDTVILAGAEYGSGSSRDWAAKGPMLLGV  334

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAV+AKSFERIHRSNLVGMGI+PLCFK GEDA++LGLTGHERY+I+LP+++++I+PGQDV
Sbjct  335  KAVVAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLTGHERYTINLPNSVSDIKPGQDV  394

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TDNGK F CTVRFDTEVELAY+NHGGILP+VIR L
Sbjct  395  TVVTDNGKQFACTVRFDTEVELAYYNHGGILPFVIRNL  432



>emb|CBE71057.1| aconitate hydratase 3 [Citrus clementina]
Length=898

 Score =   298 bits (762),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKLYVFDAAMRYK+ G +TI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LNGEVGPKTVHIPTGEKLYVFDAAMRYKAAGHETIVLAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGL GHERY+I+LP+ ++EIRPGQD+
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLAGHERYTINLPNKVSEIRPGQDI  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD GK+FTCTVRFDTEVELAYF+HGGILPYVIR L KQ
Sbjct  858  TVTTDTGKSFTCTVRFDTEVELAYFDHGGILPYVIRNLIKQ  898



>ref|XP_009136177.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=995

 Score =   299 bits (766),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            ++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  835  MNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDTIILAGAEYGSGSSRDWAAKGPMLQGV  894

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP++I+EI P QDV
Sbjct  895  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISEISPCQDV  954

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR LSKQ
Sbjct  955  TVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  995



>gb|KEH27599.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=797

 Score =   296 bits (757),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+H+P+GEKL VFDAA +YKSEG DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  635  LNGEVGPKTIHVPSGEKLSVFDAANKYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGV  694

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLPS++NEIRPGQD+
Sbjct  695  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSSVNEIRPGQDI  754

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TDNGKTF+CT+RFDTEVELAYFNHGGIL Y IR L
Sbjct  755  TVVTDNGKTFSCTLRFDTEVELAYFNHGGILQYAIRNL  792



>ref|NP_001159229.1| uncharacterized protein LOC100304315 [Zea mays]
 gb|ACN25517.1| unknown [Zea mays]
 gb|AFW89612.1| hypothetical protein ZEAMMB73_646589 [Zea mays]
Length=685

 Score =   293 bits (749),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+H+P+G+KL VFDAAM+YK+EG DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  525  LKGEVGPKTIHVPSGDKLSVFDAAMKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGV  584

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNL GMGI+PLCFKAGEDAD+LGLTGHERY++ LP+N++EI+PGQDV
Sbjct  585  KAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLTGHERYTVHLPTNVSEIKPGQDV  644

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCT+RFDTEVELAY++HGGILPYVIR++++Q
Sbjct  645  TVTTDNGKSFTCTLRFDTEVELAYYDHGGILPYVIRKIAEQ  685



>ref|XP_006452377.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 ref|XP_006475065.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Citrus 
sinensis]
 gb|ESR65617.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 gb|KDO62731.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=1002

 Score =   298 bits (764),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733   LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
             L+GEVGPKTVHIPTGEKLYVFDAAMRYK+ G +TI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  842   LNGEVGPKTVHIPTGEKLYVFDAAMRYKAAGHETIVLAGAEYGSGSSRDWAAKGPMLLGV  901

Query  553   KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
             KAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGL GHERY+I+LP+ ++EIRPGQD+
Sbjct  902   KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLAGHERYTINLPNKVSEIRPGQDI  961

Query  373   TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
             TV TD GK+FTCTVRFDTEVELAYF+HGGILPYVIR L KQ
Sbjct  962   TVTTDTGKSFTCTVRFDTEVELAYFDHGGILPYVIRNLIKQ  1002



>ref|XP_006828850.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
 gb|ERM96266.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
Length=977

 Score =   298 bits (763),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL VFDAAMRY ++G+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  815  LNGEVGPKTIHIPTGEKLSVFDAAMRYNTQGQDTIILAGAEYGSGSSRDWAAKGPMLLGV  874

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFKAGEDAD+LGLTGHERY+IDLPS ++EIRPGQDV
Sbjct  875  KAVISKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSTVSEIRPGQDV  934

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TD+GK+FTCT RFDTEVELAYF+HGGILPYVIR L
Sbjct  935  TVVTDSGKSFTCTARFDTEVELAYFDHGGILPYVIRNL  972



>gb|EYU24785.1| hypothetical protein MIMGU_mgv1a000742mg [Erythranthe guttata]
Length=997

 Score =   298 bits (764),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/161 (86%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIP+GEKL VFDAAM+YKS G+DTIILAG EYGSGSSRDWAAKGPMLLGV
Sbjct  836  LNGEVGPKTIHIPSGEKLTVFDAAMKYKSAGQDTIILAGDEYGSGSSRDWAAKGPMLLGV  895

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFK+GEDAD+LGLTGHERY+IDLPS++++IRPGQD+
Sbjct  896  KAVIAKSFERIHRSNLVGMGIVPLCFKSGEDADTLGLTGHERYTIDLPSSVSDIRPGQDI  955

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TVKTD GK FTCTVRFDTEVELAYFNHGGIL YVIRQL+ +
Sbjct  956  TVKTDTGKQFTCTVRFDTEVELAYFNHGGILQYVIRQLAAK  996



>ref|XP_002524184.1| aconitase, putative [Ricinus communis]
 gb|EEF38199.1| aconitase, putative [Ricinus communis]
Length=997

 Score =   298 bits (763),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKLYVFDAA RY + G DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  836  LNGEVGPKTVHIPTGEKLYVFDAASRYMAAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGV  895

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK G+DAD+LGL+GHERY+IDLPSNI+EI+PGQDV
Sbjct  896  KAVIAKSFERIHRSNLVGMGIIPLCFKPGQDADTLGLSGHERYTIDLPSNISEIKPGQDV  955

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSK  254
            TV TDNGK+FTCT RFDTEVEL YFNHGGILPYVIR L K
Sbjct  956  TVTTDNGKSFTCTARFDTEVELEYFNHGGILPYVIRNLMK  995



>gb|KHG02134.1| hypothetical protein F383_25649 [Gossypium arboreum]
Length=993

 Score =   298 bits (763),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+ +PTGEKLYV+DAAMRYK+ G+DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  833  LKGEVGPKTILVPTGEKLYVYDAAMRYKAAGQDTIVLAGAEYGSGSSRDWAAKGPMLLGV  892

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDADSLGLTGHERYSIDLP+ I+EIRPGQDV
Sbjct  893  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADSLGLTGHERYSIDLPNKISEIRPGQDV  952

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD GK+FTCTVRFDTEVELAYF+HGGILP+VIR L+++
Sbjct  953  TVTTDTGKSFTCTVRFDTEVELAYFDHGGILPFVIRNLNRE  993



>gb|AAO62410.1| aconitase [Solanum pennellii]
Length=898

 Score =   296 bits (758),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            ++GEV PKTVHIP+GEKL VFDAAM+YKS G+ TIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  VNGEVAPKTVHIPSGEKLSVFDAAMKYKSAGQSTIILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAD+LGLTG ERY+IDLP NI+EIRPGQDV
Sbjct  798  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLTGQERYTIDLPENISEIRPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV+TD GK+FTC VRFDTEVELAYFNHGGIL YVIRQL+K 
Sbjct  858  TVQTDTGKSFTCVVRFDTEVELAYFNHGGILQYVIRQLTKH  898



>ref|XP_006366590.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=997

 Score =   298 bits (762),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVH+P+GEKL VFDAAM+YKS G+ TIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  837  LNGEVGPKTVHVPSGEKLSVFDAAMKYKSAGQSTIILAGAEYGSGSSRDWAAKGPMLLGV  896

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAD+LGLTG ERY+IDLP NI+EIRPGQDV
Sbjct  897  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLTGQERYTIDLPENISEIRPGQDV  956

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV+TD GK+FTC VRFDTEVELAYFNHGGIL YVIRQL+++
Sbjct  957  TVQTDTGKSFTCIVRFDTEVELAYFNHGGILQYVIRQLTQR  997



>gb|ADP03320.1| aconitate hydratase [Pinus pinaster]
Length=371

 Score =   283 bits (723),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL V+DAAMRYKS G DTI+LAGAEYGSGSSRDWAAKGPML GV
Sbjct  209  LNGEVGPKTIHIPTGEKLSVYDAAMRYKSAGHDTIVLAGAEYGSGSSRDWAAKGPMLQGV  268

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFK+GEDA+SLGLTGHERY+ID+P++I +++PGQD+
Sbjct  269  KAVISKSFERIHRSNLVGMGIIPLCFKSGEDAESLGLTGHERYTIDIPNDITQLKPGQDI  328

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TD GK+FTC  RFDT+VEL YFNH GILPYV+RQL
Sbjct  329  TVTTDTGKSFTCVARFDTQVELEYFNHAGILPYVMRQL  366



>ref|XP_010675721.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Beta vulgaris 
subsp. vulgaris]
Length=1015

 Score =   298 bits (762),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733   LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
             L+GEVGPKTVH+PTGEKLYVFDAAM+YK  G  TI+LAGAEYGSGSSRDWAAKGPML GV
Sbjct  855   LNGEVGPKTVHVPTGEKLYVFDAAMKYKEAGHQTIVLAGAEYGSGSSRDWAAKGPMLQGV  914

Query  553   KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
             KAVIAKSFERIHRSNLVGMG++PLCFKAGEDAD+LGLTGHERY+IDLPS ++EIRPGQD+
Sbjct  915   KAVIAKSFERIHRSNLVGMGVIPLCFKAGEDADTLGLTGHERYTIDLPSKVSEIRPGQDI  974

Query  373   TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
             TV TD GK+FTCT+RFDTEVELAYF+HGGILPYVIRQL K 
Sbjct  975   TVTTDTGKSFTCTLRFDTEVELAYFDHGGILPYVIRQLMKN  1015



>gb|KDO54657.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   297 bits (761),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVH+PTGEKL VFDAAM+YKS G  TIILAGAEYGSGSSRDWAAKGPMLL +
Sbjct  836  LNGEVGPKTVHVPTGEKLSVFDAAMKYKSAGHGTIILAGAEYGSGSSRDWAAKGPMLLVI  895

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLTGHER+SIDLPS I+EIRPGQDV
Sbjct  896  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERFSIDLPSKISEIRPGQDV  955

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD+GK+FTCTVRFDTEVELAYF+HGGILP+VIR L KQ
Sbjct  956  TVTTDSGKSFTCTVRFDTEVELAYFDHGGILPFVIRNLIKQ  996



>ref|XP_003612247.1| Aconitate hydratase [Medicago truncatula]
 gb|AES95205.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=901

 Score =   296 bits (758),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+H+P+GEKL VFDAA +YKSEG DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  739  LNGEVGPKTIHVPSGEKLSVFDAANKYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGV  798

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLPS++NEIRPGQD+
Sbjct  799  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSSVNEIRPGQDI  858

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TDNGKTF+CT+RFDTEVELAYFNHGGIL Y IR L
Sbjct  859  TVVTDNGKTFSCTLRFDTEVELAYFNHGGILQYAIRNL  896



>ref|XP_008337967.1| PREDICTED: aconitate hydratase 1 [Malus domestica]
Length=898

 Score =   295 bits (756),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIPTGEKL VFDAAMRYKSEG DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LKGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDADSLGLTG ERY+IDLPS+++EIRPGQD+
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADSLGLTGEERYTIDLPSSVSEIRPGQDI  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSK  254
            TV TDNGK+F CT+RFDTEVELAYF+HGGIL YVIR L K
Sbjct  858  TVVTDNGKSFICTLRFDTEVELAYFDHGGILQYVIRNLIK  897



>sp|P49608.1|ACOC_CUCMA RecName: Full=Aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Cucurbita maxima]
 pir||T10101 aconitate hydratase (EC 4.2.1.3) - cucurbit
 dbj|BAA06108.1| aconitase [Cucurbita cv. Kurokawa Amakuri]
Length=898

 Score =   295 bits (756),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 139/161 (86%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVH+PTGEKL VF+AA +YKS G+DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LDGEVGPKTVHVPTGEKLSVFEAAEKYKSAGQDTIVLAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDADSLGLTGHERY+IDLP +I++IRPGQDV
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADSLGLTGHERYTIDLPDDISKIRPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD+GK+FTCTVRFDTEVELAYFN+GGILPYVIR L KQ
Sbjct  858  TVTTDSGKSFTCTVRFDTEVELAYFNNGGILPYVIRNLIKQ  898



>gb|AAC26045.1| aconitase-iron regulated protein 1 [Citrus limon]
Length=898

 Score =   295 bits (756),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKLYVFDAAMRYK+ G DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LNGEVGPKTVHIPTGEKLYVFDAAMRYKAAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+ LCFK GEDAD+LGL GHERY+I+LP+ ++EIRPGQD+
Sbjct  798  KAVIAKSFERIHRSNLVGMGIILLCFKPGEDADTLGLAGHERYTINLPNKVSEIRPGQDI  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD GK+FTCTVRFDTEVELAYF+HGGILPYVIR L KQ
Sbjct  858  TVTTDTGKSFTCTVRFDTEVELAYFDHGGILPYVIRNLIKQ  898



>gb|KJB48278.1| hypothetical protein B456_008G061900 [Gossypium raimondii]
Length=900

 Score =   295 bits (756),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIPTGEKL V+DAAMRYK+ G+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LKGEVGPKTIHIPTGEKLSVYDAAMRYKTAGQDTIILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLPS ++EIRPGQDV
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSCVSEIRPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TD+G++FTCTVRFDTEVELAYFNHGGIL YVIR L
Sbjct  858  TVATDSGRSFTCTVRFDTEVELAYFNHGGILQYVIRNL  895



>ref|XP_010278679.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nelumbo nucifera]
Length=997

 Score =   296 bits (759),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKLYVFDAAMRYK+ G+DTI+LAG EYGSGSSRDWAAKGPMLLGV
Sbjct  837  LNGEVGPKTIHIPTGEKLYVFDAAMRYKTAGQDTIVLAGTEYGSGSSRDWAAKGPMLLGV  896

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            +AVIAKSFERIHRSNLVGMGI+PLCFK GEDA++LGLTGHERY+IDLPS I+EIRPGQDV
Sbjct  897  QAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLTGHERYTIDLPSKISEIRPGQDV  956

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD GK+FTCTVRFDTEVEL YFN+GGILPYVIR L K 
Sbjct  957  TVVTDTGKSFTCTVRFDTEVELEYFNNGGILPYVIRNLMKH  997



>ref|XP_002530635.1| aconitase, putative [Ricinus communis]
 gb|EEF31743.1| aconitase, putative [Ricinus communis]
Length=900

 Score =   295 bits (755),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIP+GEKL VFDAAMRYKSEG DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LGGEVGPKTVHIPSGEKLSVFDAAMRYKSEGHDTVILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++ GLTGHERY+IDLPS++ EIRPGQDV
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETFGLTGHERYNIDLPSSVAEIRPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TDNGK+FTCT+RFDTEVELAYF+HGGILP+VIR L
Sbjct  858  TVTTDNGKSFTCTLRFDTEVELAYFDHGGILPFVIRNL  895



>tpg|DAA43249.1| TPA: hypothetical protein ZEAMMB73_889153 [Zea mays]
Length=685

 Score =   290 bits (743),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+H+P+GEKL VFDAAM+YK+EG DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  525  LKGEVGPKTIHVPSGEKLAVFDAAMKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGV  584

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNL GMGI+PLC+KAGEDAD+LGLTGHERY++ LP+N++EI+PGQDV
Sbjct  585  KAVIAKSFERIHRSNLAGMGIIPLCYKAGEDADTLGLTGHERYTVHLPTNVSEIKPGQDV  644

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCT+RFDTEVELAY++HGGILPYV R++++Q
Sbjct  645  TVTTDNGKSFTCTLRFDTEVELAYYDHGGILPYVARKIAEQ  685



>ref|XP_008344247.1| PREDICTED: aconitate hydratase 1 [Malus domestica]
Length=779

 Score =   293 bits (749),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/161 (86%), Positives = 149/161 (93%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIPTGEKL VFDAAMRYKSEG DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  619  LKGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGV  678

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFK GEDADSLGLTG ERY+I+LPS ++EIRPGQDV
Sbjct  679  KAVISKSFERIHRSNLVGMGIIPLCFKTGEDADSLGLTGEERYTINLPSTVSEIRPGQDV  738

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+F CT+RFDTEVELAYF+HGGIL YVIR L K 
Sbjct  739  TVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNLIKS  779



>gb|EYU27339.1| hypothetical protein MIMGU_mgv1a000710mg [Erythranthe guttata]
Length=1010

 Score =   296 bits (759),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733   LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
             L+GEVGPKTVHIPTGEKLYV+DAAMRYKS G+DTI+LAGAEYGSGSSRDWAAKGPML GV
Sbjct  850   LNGEVGPKTVHIPTGEKLYVYDAAMRYKSSGQDTIVLAGAEYGSGSSRDWAAKGPMLQGV  909

Query  553   KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
             KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDA++LGLTGHERY+IDLP   ++I+PGQD+
Sbjct  910   KAVIAKSFERIHRSNLVGMGILPLCFKAGEDAETLGLTGHERYTIDLPEKTSDIKPGQDI  969

Query  373   TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
             TV TDNGK+FTCT+RFDTEVEL YF+HGGIL YVIR LSKQ
Sbjct  970   TVTTDNGKSFTCTLRFDTEVELTYFDHGGILQYVIRNLSKQ  1010



>ref|XP_002870438.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46697.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=977

 Score =   296 bits (758),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKL VFDAAMRYK+ G+ TIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  817  LNGEVGPKTVHIPTGEKLSVFDAAMRYKAAGEATIILAGAEYGSGSSRDWAAKGPMLQGV  876

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTG ERY+I LP++I+EIRPGQDV
Sbjct  877  KAVISKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGKERYTIHLPTDISEIRPGQDV  936

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD GK+FTCTVRFDTEVELAYFNHGGILPYVIR LSKQ
Sbjct  937  TVTTDTGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  977



>ref|XP_008393748.1| PREDICTED: aconitate hydratase 1-like [Malus domestica]
Length=795

 Score =   293 bits (749),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIPTGEKL VFDAAMRYKSEG DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  635  LKGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGV  694

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFK GEDADSLGLTG ERY+I+LPS ++EIRPGQDV
Sbjct  695  KAVISKSFERIHRSNLVGMGIIPLCFKTGEDADSLGLTGEERYTINLPSTVSEIRPGQDV  754

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSK  254
            TV TDNGK+F CT+RFDTEVELAYF+HGGIL YVIR L K
Sbjct  755  TVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNLIK  794



>gb|KHG25175.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=900

 Score =   295 bits (754),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 153/163 (94%), Gaps = 2/163 (1%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIPTGEKL V+DAAMRYK+ G+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LKGEVGPKTIHIPTGEKLSVYDAAMRYKTAGQDTIILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KA IAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLPS ++EIRPGQDV
Sbjct  798  KAAIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSCVSEIRPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL--SKQ  251
            TV TD+G++FTCTVRFDTEVELAYFNHGGIL YVIR L  SKQ
Sbjct  858  TVATDSGRSFTCTVRFDTEVELAYFNHGGILQYVIRNLIGSKQ  900



>ref|XP_008363078.1| PREDICTED: LOW QUALITY PROTEIN: aconitate hydratase 1-like [Malus 
domestica]
Length=795

 Score =   292 bits (748),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIPTGEKL VFDAAMRYKSEG DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  635  LKGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGV  694

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFK GEDADSLGLTG ERY+I+LPS ++EIRPGQDV
Sbjct  695  KAVISKSFERIHRSNLVGMGIIPLCFKTGEDADSLGLTGEERYTINLPSTVSEIRPGQDV  754

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSK  254
            TV TDNGK+F CT+RFDTEVELAYF+HGGIL YVIR L K
Sbjct  755  TVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNLIK  794



>ref|XP_002279260.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI28935.3| unnamed protein product [Vitis vinifera]
Length=987

 Score =   296 bits (757),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+H+PTGEKL VFDAAM+YK+  + TIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  827  LNGEVGPKTIHVPTGEKLSVFDAAMKYKTANQGTIILAGAEYGSGSSRDWAAKGPMLLGV  886

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLTGHERY+IDLPSNI+EIRPGQD+
Sbjct  887  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLTGHERYTIDLPSNIDEIRPGQDI  946

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T+ GK+F CT RFDTEVELAYFNHGGILPYVIR L KQ
Sbjct  947  TVTTNTGKSFICTARFDTEVELAYFNHGGILPYVIRNLIKQ  987



>ref|XP_010440740.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010440741.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=981

 Score =   296 bits (757),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKL VFDAAM+YK+ G+ TIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  821  LNGEVGPKTVHIPTGEKLSVFDAAMKYKAAGEATIILAGAEYGSGSSRDWAAKGPMLQGV  880

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFK+GEDADSLGLTG ERY+I LP++I+EIRPGQDV
Sbjct  881  KAVISKSFERIHRSNLVGMGIIPLCFKSGEDADSLGLTGKERYTIHLPTDISEIRPGQDV  940

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD GK+FTCTVRFDTEVELAYFNHGGILPYVIR LSKQ
Sbjct  941  TVTTDTGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  981



>gb|KGN48958.1| Aconitase [Cucumis sativus]
Length=881

 Score =   294 bits (752),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIP+GEKL VFDAAMRYKSEG+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  719  LKGEVGPKTIHIPSGEKLSVFDAAMRYKSEGQDTIILAGAEYGSGSSRDWAAKGPMLLGV  778

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHER++IDLPSN+ EIRPGQDV
Sbjct  779  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERFTIDLPSNVGEIRPGQDV  838

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
             V TD GK+F+C +RFDTEVELAYF+HGGIL YVIR L
Sbjct  839  AVVTDTGKSFSCILRFDTEVELAYFDHGGILQYVIRNL  876



>ref|XP_009363442.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score =   294 bits (753),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIPTGEKL VFD AMRYKSEG DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LKGEVGPKTIHIPTGEKLSVFDVAMRYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDADSLGLTG ERY+IDLPS+++EIRPGQD+
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADSLGLTGEERYTIDLPSSVSEIRPGQDI  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSK  254
            TV TDNGK+F CT+RFDTEVELAYF+HGGIL YVIR L K
Sbjct  858  TVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNLIK  897



>ref|XP_009337075.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score =   294 bits (752),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIPTGEKL VFD AMRYKSEG DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LKGEVGPKTIHIPTGEKLSVFDVAMRYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDADSLGLTG ERY+IDLPS+++EIRPGQD+
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADSLGLTGEERYTIDLPSSVSEIRPGQDI  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSK  254
            TV TDNGK+F CT+RFDTEVELAYF+HGGIL YVIR L K
Sbjct  858  TVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNLIK  897



>ref|XP_009344825.1| PREDICTED: aconitate hydratase 1 [Pyrus x bretschneideri]
Length=898

 Score =   294 bits (752),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIPTGEKL VFDAAMRYKSEG DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LKGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDADSLGLTG ERY+I+LPS ++EIRPGQDV
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADSLGLTGEERYTINLPSTVSEIRPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSK  254
            TV TDNGK+F CT+RFDTEVELAYF+HGGIL YVIR L K
Sbjct  858  TVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNLIK  897



>gb|ABK25210.1| unknown [Picea sitchensis]
Length=565

 Score =   286 bits (732),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL V+DAA+RYKS G+DTI+LAGAEYGSGSSRDWAAKGPML GV
Sbjct  403  LNGEVGPKTIHIPTGEKLSVYDAAIRYKSAGQDTIVLAGAEYGSGSSRDWAAKGPMLQGV  462

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFK+GEDA+SLGLTGHERYSIDLP++I +++PGQD+
Sbjct  463  KAVISKSFERIHRSNLVGMGIIPLCFKSGEDAESLGLTGHERYSIDLPNDIAQLKPGQDI  522

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TD GK+FTC  RFDT+VEL YFNHGGILPYVIRQL
Sbjct  523  TVTTDTGKSFTCVARFDTQVELEYFNHGGILPYVIRQL  560



>gb|KDO71349.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=565

 Score =   286 bits (732),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  403  LNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDTVILAGAEYGSGSSRDWAAKGPMLLGV  462

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++ GLTGHERY+IDLPS+++EIRPGQDV
Sbjct  463  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSEIRPGQDV  522

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
             V TD+GK+FTC +RFDTEVELAYF+HGGIL YVIR L
Sbjct  523  RVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  560



>ref|XP_004134842.1| PREDICTED: aconitate hydratase 1-like [Cucumis sativus]
Length=900

 Score =   294 bits (752),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIP+GEKL VFDAAMRYKSEG+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LKGEVGPKTIHIPSGEKLSVFDAAMRYKSEGQDTIILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHER++IDLPSN+ EIRPGQDV
Sbjct  798  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERFTIDLPSNVGEIRPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
             V TD GK+F+C +RFDTEVELAYF+HGGIL YVIR L
Sbjct  858  AVVTDTGKSFSCILRFDTEVELAYFDHGGILQYVIRNL  895



>gb|KHG25176.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=929

 Score =   294 bits (753),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 153/163 (94%), Gaps = 2/163 (1%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIPTGEKL V+DAAMRYK+ G+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  767  LKGEVGPKTIHIPTGEKLSVYDAAMRYKTAGQDTIILAGAEYGSGSSRDWAAKGPMLLGV  826

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KA IAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLPS ++EIRPGQDV
Sbjct  827  KAAIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSCVSEIRPGQDV  886

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL--SKQ  251
            TV TD+G++FTCTVRFDTEVELAYFNHGGIL YVIR L  SKQ
Sbjct  887  TVATDSGRSFTCTVRFDTEVELAYFNHGGILQYVIRNLIGSKQ  929



>gb|ADP03120.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03121.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03122.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03125.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03127.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03128.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03129.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03130.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03131.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03135.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03137.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03138.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03140.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03145.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03147.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03148.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03150.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   280 bits (716),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL V+DAAMRYKS G DTI+LAG+EYGSGSSRDWAAKGPML GV
Sbjct  209  LNGEVGPKTIHIPTGEKLSVYDAAMRYKSAGHDTIVLAGSEYGSGSSRDWAAKGPMLQGV  268

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNL GMGI+PLCFK+GEDA+SLGLTGHERY+ID+P++I++++PGQD+
Sbjct  269  KAVISKSFERIHRSNLAGMGIIPLCFKSGEDAESLGLTGHERYTIDIPNDISQLKPGQDI  328

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TD GK+FTC  RFDT+VEL YFNH GILPYV+RQL
Sbjct  329  TVTTDTGKSFTCVARFDTQVELEYFNHAGILPYVMRQL  366



>gb|EMS48231.1| Putative aconitate hydratase, cytoplasmic [Triticum urartu]
Length=860

 Score =   293 bits (749),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGP+T+H+P+GEKL VFDAAM+YK+EG DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  699  LKGEVGPQTIHVPSGEKLAVFDAAMKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGV  758

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNL GMGIVPLCFKAGEDAD+LGLTGHERY+I LP+++NEI+PGQDV
Sbjct  759  KAVIAKSFERIHRSNLAGMGIVPLCFKAGEDADTLGLTGHERYTIQLPTDVNEIKPGQDV  818

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCT+RFDTEVELAY+ HGGILPYVIR+++ +
Sbjct  819  TVTTDNGKSFTCTLRFDTEVELAYYTHGGILPYVIRKIAAE  859



>ref|XP_008440877.1| PREDICTED: aconitate hydratase [Cucumis melo]
Length=900

 Score =   293 bits (751),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIP+GEKL VFDAAMRYKSEG+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LKGEVGPKTIHIPSGEKLSVFDAAMRYKSEGQDTIILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLTGHER++IDLPSN+ EIRPGQDV
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERFTIDLPSNVGEIRPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
             V TD GK+F+C +RFDTEVELAYF+HGGIL YVIR L
Sbjct  858  AVVTDTGKSFSCILRFDTEVELAYFDHGGILQYVIRNL  895



>gb|ADP03151.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   280 bits (716),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL V+DAAMRYKS G DTI+LAG+EYGSGSSRDWAAKGPML GV
Sbjct  209  LNGEVGPKTIHIPTGEKLSVYDAAMRYKSAGHDTIVLAGSEYGSGSSRDWAAKGPMLQGV  268

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNL GMGI+PLCFK+GEDA+SLGLTGHERY+ID+P++I +++PGQD+
Sbjct  269  KAVISKSFERIHRSNLAGMGIIPLCFKSGEDAESLGLTGHERYTIDIPNDITQLKPGQDI  328

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TD GK+FTC  RFDT+VEL YFNH GILPYV+RQL
Sbjct  329  TVTTDTGKSFTCVARFDTQVELEYFNHAGILPYVMRQL  366



>gb|ADP03123.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03124.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03126.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03132.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03133.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03136.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03141.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03142.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03146.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03149.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03152.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03153.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   280 bits (716),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL V+DAAMRYKS G DTI+LAG+EYGSGSSRDWAAKGPML GV
Sbjct  209  LNGEVGPKTIHIPTGEKLSVYDAAMRYKSAGHDTIVLAGSEYGSGSSRDWAAKGPMLQGV  268

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNL GMGI+PLCFK+GEDA+SLGLTGHERY+ID+P++I +++PGQD+
Sbjct  269  KAVISKSFERIHRSNLAGMGIIPLCFKSGEDAESLGLTGHERYTIDIPNDITQLKPGQDI  328

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TD GK+FTC  RFDT+VEL YFNH GILPYV+RQL
Sbjct  329  TVTTDTGKSFTCVARFDTQVELEYFNHAGILPYVMRQL  366



>ref|XP_009598330.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Nicotiana 
tomentosiformis]
Length=1063

 Score =   296 bits (757),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  733   LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
             L+GEV PKT+HIPTGEKLYV+DAAMRYKS G DTI++AGAEYGSGSSRDWAAKGPMLLGV
Sbjct  904   LNGEVSPKTIHIPTGEKLYVYDAAMRYKSAGHDTIVIAGAEYGSGSSRDWAAKGPMLLGV  963

Query  553   KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
             KAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++LGLTGHERY+IDLP  I++IRPGQD+
Sbjct  964   KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAEALGLTGHERYTIDLPQRISDIRPGQDL  1023

Query  373   TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSK  254
             TV TD+GK+FTCT+RFDTEVELAYF+HGGILPYVIR LSK
Sbjct  1024  TVTTDSGKSFTCTLRFDTEVELAYFDHGGILPYVIRNLSK  1063



>gb|EMS45933.1| Putative aconitate hydratase, cytoplasmic [Triticum urartu]
Length=858

 Score =   293 bits (749),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+H+PTGEKL VFDAA +YKSEG DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  696  LGGEVGPKTIHVPTGEKLSVFDAATKYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGV  755

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFKAGEDADSLGLTGHERY+I+LP++++EIRPGQDV
Sbjct  756  KAVISKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYTINLPTDVSEIRPGQDV  815

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLS  257
            T+ TDN K+FTC +RFDTEVELAY+NHGGILPYVIR ++
Sbjct  816  TISTDNDKSFTCILRFDTEVELAYYNHGGILPYVIRNMA  854



>gb|ADP03134.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03139.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   280 bits (715),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL V+DAAMRYKS G DTI+LAG+EYGSGSSRDWAAKGPML GV
Sbjct  209  LNGEVGPKTIHIPTGEKLSVYDAAMRYKSAGHDTIVLAGSEYGSGSSRDWAAKGPMLQGV  268

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNL GMGI+PLCFK+GEDA+SLGLTGHERY+ID+P++I +++PGQD+
Sbjct  269  KAVISKSFERIHRSNLAGMGIIPLCFKSGEDAESLGLTGHERYTIDIPNDITQLKPGQDI  328

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TD GK+FTC  RFDT+VEL YFNH GILPYV+RQL
Sbjct  329  TVTTDTGKSFTCVARFDTQVELEYFNHAGILPYVMRQL  366



>ref|XP_003596988.1| Aconitate hydratase [Medicago truncatula]
 gb|AES67239.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   294 bits (753),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKLYVFDAA RYK+ G  TI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  819  LNGEVGPKTVHIPTGEKLYVFDAAERYKASGHATIVLAGAEYGSGSSRDWAAKGPMLLGV  878

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLP+ I+EI+PGQDV
Sbjct  879  KAVISKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPNKISEIKPGQDV  938

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD GK+FTCT RFDTEVEL YFNHGGILPYVIR L K+
Sbjct  939  TVTTDTGKSFTCTARFDTEVELEYFNHGGILPYVIRNLIKK  979



>ref|XP_011095404.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=1011

 Score =   294 bits (753),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733   LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
             L+GEVGPKT+HIPTGEKLYV+DAAMRYKS G DTI+LAGAEYGSGSSRDWAAKGPML GV
Sbjct  851   LNGEVGPKTIHIPTGEKLYVYDAAMRYKSAGHDTIVLAGAEYGSGSSRDWAAKGPMLQGV  910

Query  553   KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
             KAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLTG ERY+IDLP+  ++IRPGQD+
Sbjct  911   KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLTGQERYTIDLPTKKSDIRPGQDI  970

Query  373   TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
             TV TDNGK+FTCT+RFDTEVELAYF+HGGIL YVIR LSKQ
Sbjct  971   TVTTDNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNLSKQ  1011



>gb|ADP03144.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   279 bits (714),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL V+DAAMRYKS G DTI+LAG+EYGSGSSRDWAAKGPML GV
Sbjct  209  LNGEVGPKTIHIPTGEKLSVYDAAMRYKSAGHDTIVLAGSEYGSGSSRDWAAKGPMLQGV  268

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNL GMGI+PLCFK+GEDA+SLGLTGHERY+ID+P++I +++PGQD+
Sbjct  269  KAVISKSFERIHRSNLAGMGIIPLCFKSGEDAESLGLTGHERYTIDIPNDITKLKPGQDI  328

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TD GK+FTC  RFDT+VEL YFNH GILPYV+RQL
Sbjct  329  TVTTDTGKSFTCVARFDTQVELEYFNHAGILPYVMRQL  366



>ref|XP_009787319.1| PREDICTED: aconitate hydratase, cytoplasmic-like isoform X1 [Nicotiana 
sylvestris]
Length=1017

 Score =   294 bits (752),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733   LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
             L+GEVGPKT+HIP+GEKLYV+DAAMRYKS G  TI++AGAEYGSGSSRDWAAKGPMLLGV
Sbjct  857   LNGEVGPKTIHIPSGEKLYVYDAAMRYKSAGHGTIVIAGAEYGSGSSRDWAAKGPMLLGV  916

Query  553   KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
             KAVIAKSFERIHRSNLVGMGI+PLCFK GED ++LGLTGHERY+IDLP +I++IRPGQD+
Sbjct  917   KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDTETLGLTGHERYTIDLPHSISDIRPGQDI  976

Query  373   TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
             TV TDNG++FTC +RFDTEVELAYF+HGGILPYVIR LSKQ
Sbjct  977   TVTTDNGRSFTCILRFDTEVELAYFDHGGILPYVIRNLSKQ  1017



>ref|XP_010450391.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=980

 Score =   293 bits (750),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEKL VFDAAM+YK+ G+ TIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  820  LNGEVGPKTVHIPTGEKLSVFDAAMKYKAAGEATIILAGAEYGSGSSRDWAAKGPMLQGV  879

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFK+GEDA+SLGLTG ERY+I LP++I+EIRPGQDV
Sbjct  880  KAVISKSFERIHRSNLVGMGIIPLCFKSGEDAESLGLTGKERYTIHLPTDISEIRPGQDV  939

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD GK+FTCTVRFDTEVELAYFNHGGILPYVIR LS+Q
Sbjct  940  TVTTDTGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSRQ  980



>ref|NP_001119125.1| aconitate hydratase 1 [Arabidopsis thaliana]
 gb|AEE86577.1| aconitate hydratase 1 [Arabidopsis thaliana]
Length=795

 Score =   290 bits (742),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIPTGEKL VFDAAM+Y++EG+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  635  LKGEVGPKTVHIPTGEKLSVFDAAMKYRNEGRDTIILAGAEYGSGSSRDWAAKGPMLLGV  694

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFKAGEDA++LGLTG E Y+I+LP+N++EI+PGQDV
Sbjct  695  KAVISKSFERIHRSNLVGMGIIPLCFKAGEDAETLGLTGQELYTIELPNNVSEIKPGQDV  754

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T+NGK+FTCT+RFDTEVELAYF+HGGIL YVIR L KQ
Sbjct  755  TVVTNNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNLIKQ  795



>gb|KDP23953.1| hypothetical protein JCGZ_25341 [Jatropha curcas]
Length=900

 Score =   292 bits (747),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIP+GEKL VFD AM+YKSEG DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LGGEVGPKTIHIPSGEKLSVFDVAMKYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLTGHERYSIDLP++++EIRPGQDV
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADTLGLTGHERYSIDLPNSVSEIRPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
             V TDNGK+FTCT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  858  KVLTDNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNL  895



>ref|XP_007046597.1| Aconitase 1 [Theobroma cacao]
 gb|EOX90754.1| Aconitase 1 [Theobroma cacao]
Length=900

 Score =   291 bits (746),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 151/163 (93%), Gaps = 2/163 (1%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIPTGEKL V+D AMRYK+ G+DTIILAG EYGSGSSRDWAAKGP+LLGV
Sbjct  738  LKGEVGPKTIHIPTGEKLSVYDVAMRYKAAGQDTIILAGVEYGSGSSRDWAAKGPVLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDAD+LGLTGHERY+IDLP+ ++EIRPGQDV
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPNTVSEIRPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL--SKQ  251
            TV TD GK+FTCTVRFDTEVELAYFNHGGIL YVIR L  SKQ
Sbjct  858  TVATDCGKSFTCTVRFDTEVELAYFNHGGILQYVIRNLIGSKQ  900



>gb|EMT33022.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=937

 Score =   292 bits (748),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+H+PTGEKL VFDAA +YKSEG DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  775  LGGEVGPKTIHVPTGEKLSVFDAATKYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGV  834

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFKAGEDADSLGLTGHERY+I+LP++++EIRPGQDV
Sbjct  835  KAVISKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYTINLPTDVSEIRPGQDV  894

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLS  257
            T+ TDN K+FTC +RFDTEVELAY+NHGGILPYVIR ++
Sbjct  895  TITTDNDKSFTCILRFDTEVELAYYNHGGILPYVIRNMA  933



>ref|XP_002263337.1| PREDICTED: aconitate hydratase 1 [Vitis vinifera]
Length=900

 Score =   291 bits (746),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIP+GEKL VFDAAMRYKSEG+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LKGEVGPKTLHIPSGEKLSVFDAAMRYKSEGQDTIILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK G+DA++LGLTGHERY+IDLPS+++EI+PGQD+
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKPGQDAETLGLTGHERYTIDLPSSVSEIKPGQDI  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TDNGK+FTCT+RFDTEVELAYF+HGGIL Y IR L
Sbjct  858  TVVTDNGKSFTCTMRFDTEVELAYFDHGGILQYAIRNL  895



>ref|XP_009419582.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=1003

 Score =   293 bits (750),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIPTG+KLYVF+ AMRYK++G DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  841  LKGEVGPKTVHIPTGDKLYVFEVAMRYKADGHDTIVLAGAEYGSGSSRDWAAKGPMLLGV  900

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++LGLTGHERY+IDLPS+I +IRPGQD+
Sbjct  901  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLTGHERYTIDLPSSITDIRPGQDI  960

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV  DNGK+FTCT+RFDTEVELAYFNHGGILP+VIR L
Sbjct  961  TVVVDNGKSFTCTLRFDTEVELAYFNHGGILPFVIRNL  998



>ref|XP_008658754.1| PREDICTED: uncharacterized protein LOC100304315 isoform X1 [Zea 
mays]
Length=989

 Score =   293 bits (749),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+H+P+G+KL VFDAAM+YK+EG DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  829  LKGEVGPKTIHVPSGDKLSVFDAAMKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGV  888

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNL GMGI+PLCFKAGEDAD+LGLTGHERY++ LP+N++EI+PGQDV
Sbjct  889  KAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLTGHERYTVHLPTNVSEIKPGQDV  948

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCT+RFDTEVELAY++HGGILPYVIR++++Q
Sbjct  949  TVTTDNGKSFTCTLRFDTEVELAYYDHGGILPYVIRKIAEQ  989



>ref|XP_010918136.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=992

 Score =   293 bits (749),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIPTGEKL VFDAA+RYKSEG DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  830  LKGEVGPKTIHIPTGEKLSVFDAALRYKSEGHDTVILAGAEYGSGSSRDWAAKGPMLLGV  889

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++LGLTGHERY+I+LPS++++I+PGQDV
Sbjct  890  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLTGHERYTINLPSSVSDIKPGQDV  949

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TDNGK+FTC VRFDTEVELAY+NHGGILP+VIR L
Sbjct  950  TVVTDNGKSFTCIVRFDTEVELAYYNHGGILPFVIRNL  987



>emb|CBI24446.3| unnamed protein product [Vitis vinifera]
Length=918

 Score =   291 bits (746),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIP+GEKL VFDAAMRYKSEG+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  756  LKGEVGPKTLHIPSGEKLSVFDAAMRYKSEGQDTIILAGAEYGSGSSRDWAAKGPMLLGV  815

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK G+DA++LGLTGHERY+IDLPS+++EI+PGQD+
Sbjct  816  KAVIAKSFERIHRSNLVGMGIIPLCFKPGQDAETLGLTGHERYTIDLPSSVSEIKPGQDI  875

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TDNGK+FTCT+RFDTEVELAYF+HGGIL Y IR L
Sbjct  876  TVVTDNGKSFTCTMRFDTEVELAYFDHGGILQYAIRNL  913



>ref|XP_002532564.1| aconitase, putative [Ricinus communis]
 gb|EEF29825.1| aconitase, putative [Ricinus communis]
Length=990

 Score =   292 bits (748),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL+VFDAAMRYK  G++TI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  830  LNGEVGPKTIHIPTGEKLHVFDAAMRYKEAGENTIVLAGAEYGSGSSRDWAAKGPMLLGV  889

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHR NLVGMGI+PLCFK GEDAD+LGLTGHERY+IDLP  I+EIRPGQ+V
Sbjct  890  KAVIAKSFERIHRGNLVGMGIIPLCFKPGEDADTLGLTGHERYTIDLPDKISEIRPGQEV  949

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
             VKTD GK+F C VRFDTEVELAYF+HGGILPYVIR LSK+
Sbjct  950  GVKTDTGKSFACRVRFDTEVELAYFDHGGILPYVIRNLSKE  990



>gb|ADP03143.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   278 bits (710),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT++IPTGEKL V+DAAMRYKS G DTI+LAG+EYGSGSSRDWAAKGPML GV
Sbjct  209  LNGEVGPKTIYIPTGEKLSVYDAAMRYKSAGHDTIVLAGSEYGSGSSRDWAAKGPMLQGV  268

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNL GMGI+PLCFK+GEDA+SLGLTGHERY+ID+P++I++++PGQD+
Sbjct  269  KAVISKSFERIHRSNLAGMGIIPLCFKSGEDAESLGLTGHERYTIDIPNDISQLKPGQDI  328

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TD GK+FTC  RFDT+VEL YFNH GILPYV+RQL
Sbjct  329  TVTTDTGKSFTCVARFDTQVELEYFNHAGILPYVMRQL  366



>ref|XP_003573387.2| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=987

 Score =   292 bits (748),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+H+P+GEKL VFDAA RYKSEG DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  825  LGGEVGPKTIHVPSGEKLSVFDAATRYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGV  884

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLC+K GEDADSLGLTGHER++I+LP+++++IRPGQDV
Sbjct  885  KAVISKSFERIHRSNLVGMGIIPLCYKTGEDADSLGLTGHERFTINLPTDVSKIRPGQDV  944

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            T+ TDNGK+F+CT+RFDTEVELAY+NHGGILPYVIR L+ Q
Sbjct  945  TITTDNGKSFSCTLRFDTEVELAYYNHGGILPYVIRSLAGQ  985



>sp|Q42669.1|ACOC_CUCMC RecName: Full=Aconitate hydratase; Short=Aconitase; AltName: 
Full=Citrate hydro-lyase, partial [Cucumis melo var. conomon]
 emb|CAA58047.1| aconitase [Cucumis melo]
Length=764

 Score =   288 bits (738),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIP+ EKL VFDAAMRYKSEG+DTIILAGAEYG GSSRDWAAKGPMLLGV
Sbjct  602  LKGEVGPKTIHIPSREKLSVFDAAMRYKSEGQDTIILAGAEYGIGSSRDWAAKGPMLLGV  661

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLTGHER++IDLPSN+ EIRPGQDV
Sbjct  662  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERFTIDLPSNVGEIRPGQDV  721

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
             V TD GK+F+C +RFDTEVELAYF+HGGIL YVIR L
Sbjct  722  AVVTDTGKSFSCILRFDTEVELAYFDHGGILQYVIRNL  759



>ref|XP_002465901.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
 gb|ABE77202.1| putative aconitate hydratase 1 [Sorghum bicolor]
 gb|EER92899.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
Length=991

 Score =   292 bits (748),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+H+P+GEKL VFDAAM+YK+EG DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  831  LKGEVGPKTIHVPSGEKLAVFDAAMKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGV  890

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNL GMGI+PLCFKAGEDAD+LGLTGHERY++ LP+N++EI+PGQDV
Sbjct  891  KAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLTGHERYTVHLPTNVSEIKPGQDV  950

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCT+RFDTEVELAY++HGGILPYV R++++Q
Sbjct  951  TVTTDNGKSFTCTLRFDTEVELAYYDHGGILPYVTRKIAEQ  991



>gb|KDO71348.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=702

 Score =   286 bits (733),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  540  LNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDTVILAGAEYGSGSSRDWAAKGPMLLGV  599

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++ GLTGHERY+IDLPS+++EIRPGQDV
Sbjct  600  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSEIRPGQDV  659

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
             V TD+GK+FTC +RFDTEVELAYF+HGGIL YVIR L
Sbjct  660  RVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  697



>ref|XP_008800034.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=997

 Score =   292 bits (747),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIPTGEKL VFDAA+RYKSEG DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  835  LKGEVGPKTIHIPTGEKLSVFDAAVRYKSEGHDTVILAGAEYGSGSSRDWAAKGPMLLGV  894

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++LGLTGHERY+I+LPS++++I+PGQDV
Sbjct  895  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLTGHERYTINLPSSVSDIKPGQDV  954

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TDNGK+FTC VRFDTEVELAY+NHGGILP+VIR L
Sbjct  955  TVVTDNGKSFTCIVRFDTEVELAYYNHGGILPFVIRNL  992



>gb|AAL13084.1| putative aconitase [Prunus avium]
Length=902

 Score =   290 bits (743),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIPTGEKL VFDAAMRYKSEG  TIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  742  LKGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHATIILAGAEYGSGSSRDWAAKGPMLLGV  801

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLTG ERY+IDLPS++ EI+PGQDV
Sbjct  802  KAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADTLGLTGEERYTIDLPSSVGEIKPGQDV  861

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSK  254
            TV TDNGK+F CT+RFDTEVELAYF+HGGIL YVIR L K
Sbjct  862  TVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNLIK  901



>gb|KFK30197.1| hypothetical protein AALP_AA7G230700 [Arabis alpina]
Length=898

 Score =   290 bits (743),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIP+GEKL VFDAAM+Y++EG+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LKGEVGPKTVHIPSGEKLSVFDAAMKYRNEGRDTIILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++LGLTG E Y+IDLP+N++EI+PGQD+
Sbjct  798  KAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLTGQELYTIDLPNNVSEIKPGQDI  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T+NGK+FTCT+RFDTEVELAYFNHGGIL YVIR L KQ
Sbjct  858  TVVTNNGKSFTCTLRFDTEVELAYFNHGGILQYVIRNLIKQ  898



>ref|XP_007203240.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
 gb|EMJ04439.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
Length=898

 Score =   290 bits (742),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIPTGEKL VFDAAMRYKSEG  TIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LKGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHATIILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLTG ERY+IDLPS++ EI+PGQDV
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADTLGLTGEERYTIDLPSSVGEIKPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSK  254
            TV TDNGK+F CT+RFDTEVELAYF+HGGIL YVIR L K
Sbjct  858  TVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNLIK  897



>dbj|BAJ85661.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=984

 Score =   291 bits (745),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+H+PTGEKL VFDAA++YKSEG DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  822  LGGEVGPKTIHVPTGEKLSVFDAALKYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGV  881

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+P+CFKAGEDADSLGLTGHERY+I+LP+++ +IRPGQDV
Sbjct  882  KAVIAKSFERIHRSNLVGMGIIPMCFKAGEDADSLGLTGHERYTINLPTDVGQIRPGQDV  941

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLS  257
            T+ T++GK+FTC +RFDTEVELAY+NHGGILPYVIR ++
Sbjct  942  TITTEDGKSFTCILRFDTEVELAYYNHGGILPYVIRNMA  980



>emb|CAA58046.1| aconitase [Arabidopsis thaliana]
Length=919

 Score =   290 bits (742),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIPTGEKL VFDAAM+Y++EG+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  759  LKGEVGPKTVHIPTGEKLSVFDAAMKYRNEGRDTIILAGAEYGSGSSRDWAAKGPMLLGV  818

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFKAGEDA++LGLTG E Y+I+LP+N++EI+PGQDV
Sbjct  819  KAVISKSFERIHRSNLVGMGIIPLCFKAGEDAETLGLTGQELYTIELPNNVSEIKPGQDV  878

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T+NGK+FTCT+RFDTEVELAYF+HGGIL YVIR L KQ
Sbjct  879  TVVTNNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNLIKQ  919



>ref|NP_195308.1| aconitate hydratase 1 [Arabidopsis thaliana]
 sp|Q42560.2|ACO1_ARATH RecName: Full=Aconitate hydratase 1; Short=Aconitase 1; AltName: 
Full=Citrate hydro-lyase 1 [Arabidopsis thaliana]
 emb|CAA21469.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 emb|CAB81492.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 gb|AAL32850.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE86576.1| aconitate hydratase 1 [Arabidopsis thaliana]
Length=898

 Score =   290 bits (741),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIPTGEKL VFDAAM+Y++EG+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LKGEVGPKTVHIPTGEKLSVFDAAMKYRNEGRDTIILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFKAGEDA++LGLTG E Y+I+LP+N++EI+PGQDV
Sbjct  798  KAVISKSFERIHRSNLVGMGIIPLCFKAGEDAETLGLTGQELYTIELPNNVSEIKPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T+NGK+FTCT+RFDTEVELAYF+HGGIL YVIR L KQ
Sbjct  858  TVVTNNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNLIKQ  898



>ref|XP_004985790.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Setaria 
italica]
Length=986

 Score =   291 bits (745),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIP+GEKL VFDAAM+YK+EG DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  826  LKGEVGPKTIHIPSGEKLAVFDAAMKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGV  885

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNL GMGI+PLCFKAGEDAD+LGLTGHERY+I LP+N++EI+PGQDV
Sbjct  886  KAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLTGHERYTIHLPTNVSEIKPGQDV  945

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD GK+FTCT+RFDTEVELAY++HGGILPYV R++++Q
Sbjct  946  TVTTDTGKSFTCTLRFDTEVELAYYDHGGILPYVTRKIAEQ  986



>dbj|BAJ92965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=999

 Score =   291 bits (745),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+H+P+GEKL VFDAAM+YK+EG DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  838  LKGEVGPKTIHVPSGEKLAVFDAAMKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGV  897

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNL GMGIVPLCFKAGEDAD+LGLTGHERY+I LP+++NEI+PGQDV
Sbjct  898  KAVISKSFERIHRSNLAGMGIVPLCFKAGEDADTLGLTGHERYTIQLPTDVNEIKPGQDV  957

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCT+RFDTEVE+AY+ HGGILPYVIR+++ +
Sbjct  958  TVTTDNGKSFTCTLRFDTEVEIAYYTHGGILPYVIRKIAAE  998



>ref|XP_010943467.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=995

 Score =   291 bits (744),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GE GPKT+HIP+GEKL VFDAAMRYKSE  DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  833  LKGEAGPKTIHIPSGEKLSVFDAAMRYKSEEHDTVILAGAEYGSGSSRDWAAKGPMLLGV  892

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++LGLTGHERY+I+LP N+++I+PGQDV
Sbjct  893  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLTGHERYTINLPDNVSDIKPGQDV  952

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TDNGK+FTCTVRFDTEVELAY+NHGGILP+VIR L
Sbjct  953  TVVTDNGKSFTCTVRFDTEVELAYYNHGGILPFVIRNL  990



>gb|ACK56134.1| putative aconitase, partial [Dimocarpus longan]
Length=167

 Score =   269 bits (687),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL VFDAAMRYKSEG +TIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  25   LNGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHNTIILAGAEYGSGSSRDWAAKGPMLLGV  84

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFK GEDA++L LTGHERY+IDLPS+++EIRPGQDV
Sbjct  85   KAVIAKSFERIHRSNLVGMGIVPLCFKPGEDAETLSLTGHERYTIDLPSSVSEIRPGQDV  144

Query  373  TVKTDNGKTFTCTVRFDTEVELA  305
            +V TDNGK+FTCTVRFDTEVELA
Sbjct  145  SVVTDNGKSFTCTVRFDTEVELA  167



>ref|XP_008242011.1| PREDICTED: aconitate hydratase 1 [Prunus mume]
Length=898

 Score =   289 bits (740),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIPTGEKL VFDAAMRY+SEG  TIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LKGEVGPKTIHIPTGEKLSVFDAAMRYRSEGHATIILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLTG ERY+IDLPS++ EI+PGQDV
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADTLGLTGEERYTIDLPSSVGEIKPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSK  254
            TV TDNGK+F CT+RFDTEVELAYF+HGGIL YVIR L K
Sbjct  858  TVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNLIK  897



>gb|KDO71347.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=797

 Score =   287 bits (734),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  635  LNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDTVILAGAEYGSGSSRDWAAKGPMLLGV  694

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++ GLTGHERY+IDLPS+++EIRPGQDV
Sbjct  695  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSEIRPGQDV  754

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
             V TD+GK+FTC +RFDTEVELAYF+HGGIL YVIR L
Sbjct  755  RVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  792



>ref|XP_009150005.1| PREDICTED: aconitate hydratase 1 [Brassica rapa]
Length=898

 Score =   288 bits (738),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIP+GEKL VFDAAM+Y++EG+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LKGEVGPKTVHIPSGEKLSVFDAAMKYRNEGRDTIILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++LGLTG E Y+I+LP+N++EI+PGQDV
Sbjct  798  KAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLTGEELYTIELPNNVSEIKPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T+NGK+FTCT+RFDTEVELAYFNHGGIL YVIR L KQ
Sbjct  858  TVVTNNGKSFTCTLRFDTEVELAYFNHGGILQYVIRNLIKQ  898



>ref|XP_006285963.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
 gb|EOA18861.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
Length=898

 Score =   288 bits (738),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIPTGEKL VFDAA++Y++EG+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LKGEVGPKTVHIPTGEKLSVFDAALKYRNEGRDTIILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++LGLTG E Y+I+LP+N++EI+PGQDV
Sbjct  798  KAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLTGQELYTIELPNNVSEIKPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T+NGK+FTCT+RFDTEVELAYFNHGGIL YVIR L KQ
Sbjct  858  TVITNNGKSFTCTLRFDTEVELAYFNHGGILQYVIRNLIKQ  898



>emb|CDX69174.1| BnaC01g02790D [Brassica napus]
Length=901

 Score =   288 bits (738),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIP+GEKL VFDAAM+Y++EG+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  741  LKGEVGPKTVHIPSGEKLSVFDAAMKYRNEGRDTIILAGAEYGSGSSRDWAAKGPMLLGV  800

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++LGLTG E Y+I+LP+N++EI+PGQDV
Sbjct  801  KAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLTGEELYTIELPNNVSEIKPGQDV  860

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T+NGK+FTCT+RFDTEVELAYFNHGGIL YVIR L KQ
Sbjct  861  TVVTNNGKSFTCTLRFDTEVELAYFNHGGILQYVIRNLIKQ  901



>ref|XP_011022256.1| PREDICTED: aconitate hydratase 1 [Populus euphratica]
Length=899

 Score =   288 bits (738),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HI TGEKL VFDAAMR KSEG+DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  737  LGGEVGPKTIHISTGEKLSVFDAAMRCKSEGRDTVILAGAEYGSGSSRDWAAKGPMLLGV  796

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++LGLTGHE YSIDLPSN++EIRPGQDV
Sbjct  797  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLTGHECYSIDLPSNVSEIRPGQDV  856

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TDNGK+FTCT+RFDTEVELAYF+HGGIL Y IR L
Sbjct  857  TVVTDNGKSFTCTLRFDTEVELAYFDHGGILQYAIRNL  894



>ref|XP_006383042.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP60839.1| aconitate hydratase family protein [Populus trichocarpa]
Length=899

 Score =   288 bits (738),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HI TGEKL VFD AMRYKSEG+DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  737  LGGEVGPKTIHISTGEKLSVFDVAMRYKSEGRDTVILAGAEYGSGSSRDWAAKGPMLLGV  796

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++LGLTGHE YSIDLPSN++EIRPGQDV
Sbjct  797  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLTGHECYSIDLPSNVSEIRPGQDV  856

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TDNGK+F CT+RFDTEVELAYF+HGGIL Y IR L
Sbjct  857  TVVTDNGKSFACTLRFDTEVELAYFDHGGILQYAIRNL  894



>ref|XP_009109264.1| PREDICTED: aconitate hydratase 1-like [Brassica rapa]
Length=898

 Score =   288 bits (736),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIP+GEKL VFDAAM+YK+EG+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LKGEVGPKTVHIPSGEKLSVFDAAMKYKNEGRDTIILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++L LTG E Y+I+LPSN++EI+PGQDV
Sbjct  798  KAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLRLTGEELYTIELPSNVSEIKPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T+NGK+FTCT+RFDTEVELAYFNHGGIL YVIR L KQ
Sbjct  858  TVITNNGKSFTCTLRFDTEVELAYFNHGGILQYVIRNLIKQ  898



>gb|KDP39136.1| hypothetical protein JCGZ_00893 [Jatropha curcas]
Length=1002

 Score =   289 bits (740),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKLYVFDAAMRYK  G+DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  839  LNGEVGPKTIHIPTGEKLYVFDAAMRYKEAGQDTIVLAGAEYGSGSSRDWAAKGPMLLGV  898

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFE IHRSNLVGMGI+PLCFK GEDAD+LGLTG+ERY+IDLP  I+EIRPGQDV
Sbjct  899  KAVIAKSFETIHRSNLVGMGIIPLCFKPGEDADTLGLTGNERYTIDLPDKISEIRPGQDV  958

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNG +FTC  RFDT+VELAYF+HGGIL YVIR L K+
Sbjct  959  TVTTDNGNSFTCIARFDTQVELAYFDHGGILQYVIRNLIKE  999



>ref|XP_009384004.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384006.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=977

 Score =   289 bits (739),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIP+GEKL VFD AMRYK EG DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  815  LKGEVGPKTIHIPSGEKLSVFDTAMRYKDEGHDTIILAGAEYGSGSSRDWAAKGPMLQGV  874

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFK GEDAD+LGLTGHERY+I+LPSN+++I+PGQDV
Sbjct  875  KAVIAKSFERIHRSNLVGMGIVPLCFKPGEDADTLGLTGHERYTINLPSNVSDIKPGQDV  934

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TD GK FTCTVRFDTEVELAY+ HGGILPYV+R L
Sbjct  935  TVTTDTGKLFTCTVRFDTEVELAYYGHGGILPYVVRSL  972



>ref|XP_006380559.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
 gb|ERP58356.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
Length=899

 Score =   288 bits (736),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+H PT EKL VFD AMRYKSEG DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  737  LGGEVGPKTIHFPTREKLSVFDVAMRYKSEGHDTVILAGAEYGSGSSRDWAAKGPMLLGV  796

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAV+AKSFERIHRSNLVGMGI+PLCFK+GEDA++LGLTGHERYS+DLPSN++EIRPGQDV
Sbjct  797  KAVMAKSFERIHRSNLVGMGIIPLCFKSGEDAETLGLTGHERYSLDLPSNVSEIRPGQDV  856

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TDNGK FTCT+R+DTEVELAYF+HGGIL Y IR L
Sbjct  857  TVVTDNGKQFTCTLRYDTEVELAYFDHGGILQYAIRNL  894



>ref|XP_003537655.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=901

 Score =   288 bits (736),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIP+GEKL VFDAA +YKSEG D IILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  739  LNGEVGPKTIHIPSGEKLSVFDAAEKYKSEGHDMIILAGAEYGSGSSRDWAAKGPMLLGV  798

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK G+DADSLGLTGHERY+IDLPSN+NEIRPGQDV
Sbjct  799  KAVIAKSFERIHRSNLVGMGIIPLCFKPGDDADSLGLTGHERYTIDLPSNVNEIRPGQDV  858

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TD GK+F  T+RFDTEVELAYFNHGGIL YVIR +
Sbjct  859  TVVTDAGKSFVSTLRFDTEVELAYFNHGGILQYVIRNM  896



>ref|XP_007157870.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
 gb|ESW29864.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
Length=901

 Score =   287 bits (735),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIP+GEKL VFDAA +YK+EG D IILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  739  LNGEVGPKTIHIPSGEKLSVFDAAEKYKNEGHDMIILAGAEYGSGSSRDWAAKGPMLLGV  798

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDADSLGLTGHERY+IDLPS++NEIRPGQDV
Sbjct  799  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADSLGLTGHERYTIDLPSDVNEIRPGQDV  858

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TD GKTF  T+RFDTEVELAYFNHGGIL Y IR L
Sbjct  859  TVVTDTGKTFVSTLRFDTEVELAYFNHGGILQYAIRNL  896



>ref|XP_004487412.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=984

 Score =   288 bits (738),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVG KTVH+PTGEKLYVFDAA RYK+ G DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  825  LNGEVGAKTVHVPTGEKLYVFDAAERYKAAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGV  884

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLTG ERY+IDLP  I+EI+PGQDV
Sbjct  885  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGRERYTIDLPDKISEIKPGQDV  944

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSK  254
            TV TD GK+FTC  RFDTEVEL YFNHGGILPYVIR L+K
Sbjct  945  TVTTDTGKSFTCKARFDTEVELEYFNHGGILPYVIRNLAK  984



>gb|KDO71345.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=889

 Score =   287 bits (734),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  727  LNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDTVILAGAEYGSGSSRDWAAKGPMLLGV  786

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++ GLTGHERY+IDLPS+++EIRPGQDV
Sbjct  787  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSEIRPGQDV  846

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
             V TD+GK+FTC +RFDTEVELAYF+HGGIL YVIR L
Sbjct  847  RVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  884



>gb|EMT03129.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=1967

 Score =   293 bits (750),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733   LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
             L GEVGP+T+H+P+GEKL VFDAAM+YK+EG DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  1806  LKGEVGPQTIHVPSGEKLAVFDAAMKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGV  1865

Query  553   KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
             KAVIAKSFERIHRSNL GMGIVPLCFKAGEDAD+LGLTGHERY+I LP+++NEI+PGQDV
Sbjct  1866  KAVIAKSFERIHRSNLAGMGIVPLCFKAGEDADTLGLTGHERYTIQLPTDVNEIKPGQDV  1925

Query  373   TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
             TV TDNGK+FTCT+RFDTEVELAY+ HGGILPYVIR+++ +
Sbjct  1926  TVTTDNGKSFTCTLRFDTEVELAYYTHGGILPYVIRKIAAE  1966



>gb|KDO71344.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=881

 Score =   286 bits (733),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  719  LNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDTVILAGAEYGSGSSRDWAAKGPMLLGV  778

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++ GLTGHERY+IDLPS+++EIRPGQDV
Sbjct  779  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSEIRPGQDV  838

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
             V TD+GK+FTC +RFDTEVELAYF+HGGIL YVIR L
Sbjct  839  RVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  876



>gb|KDO71342.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=900

 Score =   287 bits (734),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDTVILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++ GLTGHERY+IDLPS+++EIRPGQDV
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSEIRPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
             V TD+GK+FTC +RFDTEVELAYF+HGGIL YVIR L
Sbjct  858  RVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  895



>emb|CBE71056.1| aconitate hydratase 1 [Citrus clementina]
Length=900

 Score =   287 bits (734),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDTVILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++ GLTGHERY+IDLPS+++EIRPGQDV
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSEIRPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
             V TD+GK+FTC +RFDTEVELAYF+HGGIL YVIR L
Sbjct  858  RVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  895



>gb|KDO71343.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=898

 Score =   287 bits (734),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  736  LNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDTVILAGAEYGSGSSRDWAAKGPMLLGV  795

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++ GLTGHERY+IDLPS+++EIRPGQDV
Sbjct  796  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSEIRPGQDV  855

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
             V TD+GK+FTC +RFDTEVELAYF+HGGIL YVIR L
Sbjct  856  RVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  893



>emb|CDY24823.1| BnaA08g14870D [Brassica napus]
Length=922

 Score =   287 bits (735),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIP+GEKL VFDAAM+YK+EG+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  762  LKGEVGPKTVHIPSGEKLSVFDAAMKYKNEGRDTIILAGAEYGSGSSRDWAAKGPMLLGV  821

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++L LTG E Y+I+LPSN++EI+PGQDV
Sbjct  822  KAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLRLTGEELYTIELPSNVSEIKPGQDV  881

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T+NGK+FTCT+RFDTEVELAYFNHGGIL YVIR L KQ
Sbjct  882  TVITNNGKSFTCTLRFDTEVELAYFNHGGILQYVIRNLIKQ  922



>ref|XP_006425366.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
 gb|ESR38606.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
Length=900

 Score =   286 bits (733),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDTVILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++ GLTGHERY+IDLPS+++EIRPGQDV
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSEIRPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
             V TD+GK+FTC +RFDTEVELAYF+HGGIL YVIR L
Sbjct  858  RVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  895



>ref|XP_009382046.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=986

 Score =   288 bits (736),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+H+P+GEKL  FDAA RYKSEG DTI+LAG EYGSGSSRDWAAKGPML GV
Sbjct  824  LKGEVGPKTIHVPSGEKLSAFDAATRYKSEGHDTIVLAGEEYGSGSSRDWAAKGPMLQGV  883

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDA++LGLTGHERY+I LPSN+++I+PGQDV
Sbjct  884  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDAETLGLTGHERYTIHLPSNVSDIKPGQDV  943

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSK  254
            TV TD GK+FTCTVRFDTEVELAY+NHGGILPYVIR L K
Sbjct  944  TVTTDTGKSFTCTVRFDTEVELAYYNHGGILPYVIRSLIK  983



>emb|CDX75532.1| BnaA01g01700D [Brassica napus]
Length=925

 Score =   287 bits (734),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIP+GEKL VFDAAM+Y++EG+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  765  LKGEVGPKTVHIPSGEKLSVFDAAMKYRNEGRDTIILAGAEYGSGSSRDWAAKGPMLLGV  824

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++LGLTG E Y+I+LP+N++EI+PGQDV
Sbjct  825  KAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLTGEELYTIELPNNVSEIKPGQDV  884

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T+NGK+FTCT+RFDTEVELAYF+HGGIL YVIR L KQ
Sbjct  885  TVVTNNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNLIKQ  925



>gb|KHG24816.1| Aconitate hydratase 1 -like protein [Gossypium arboreum]
Length=813

 Score =   285 bits (728),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 151/163 (93%), Gaps = 2/163 (1%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIPTGEKL V+DAAMRY + G+DTIILAGAEYGSGSSRDWAAKGPM+LG+
Sbjct  651  LEGEVGPKTIHIPTGEKLSVYDAAMRYNTAGQDTIILAGAEYGSGSSRDWAAKGPMMLGI  710

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFE+IHRSNLVGMGI+PLCFK G+DAD+LGLTGHERY+I+LP++++EIRPGQDV
Sbjct  711  KAVIAKSFEQIHRSNLVGMGIIPLCFKPGDDADTLGLTGHERYTINLPNSVSEIRPGQDV  770

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL--SKQ  251
            TV TD  K+F+CTVRFDTEVELAYFNHGGIL YVIR L  SKQ
Sbjct  771  TVATDTSKSFSCTVRFDTEVELAYFNHGGILQYVIRNLVGSKQ  813



>gb|EEE58288.1| hypothetical protein OsJ_09326 [Oryza sativa Japonica Group]
Length=907

 Score =   286 bits (733),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIP+GEKL VFDAA +YK+EG DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  747  LKGEVGPKTIHIPSGEKLSVFDAATKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGV  806

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNL GMGI+PLCFK+GEDAD+LGLTGHER+++ LP+N++EI+PGQDV
Sbjct  807  KAVIAKSFERIHRSNLAGMGIIPLCFKSGEDADTLGLTGHERFTVHLPANVSEIKPGQDV  866

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCT+RFDTEVELAY+++GGILPYVIR++++Q
Sbjct  867  TVTTDNGKSFTCTLRFDTEVELAYYDNGGILPYVIRKIAEQ  907



>ref|XP_006412056.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53509.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
Length=898

 Score =   286 bits (732),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIP+GEKL VFDAAM+Y++EG+DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LKGEVGPKTVHIPSGEKLSVFDAAMKYRNEGRDTVILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++LGLTG E Y+I+LP+N++EI+PGQDV
Sbjct  798  KAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLTGQELYTIELPNNVSEIKPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T+NGK+FTCT+RFDTEVEL YFNHGGIL YVIR L KQ
Sbjct  858  TVITNNGKSFTCTLRFDTEVELEYFNHGGILQYVIRNLIKQ  898



>ref|XP_009399225.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=993

 Score =   288 bits (736),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIPTG+KLYVF+AAMRYK++G DTI+LAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  831  LKGEVGPKTIHIPTGDKLYVFEAAMRYKADGYDTIVLAGAEYGSGSSRDWAAKGPMLLGV  890

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++LGLTG+E Y+IDLPS I++IRPGQD+
Sbjct  891  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLTGYESYTIDLPSCISDIRPGQDI  950

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TD+GK+FTCT+RFDTEVELAYFNHGGILP+VIR L
Sbjct  951  TVVTDSGKSFTCTLRFDTEVELAYFNHGGILPFVIRNL  988



>gb|KCW56578.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=797

 Score =   284 bits (727),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIP+GEKL V+D AMRYKSEG  TIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  635  LKGEVGPKTIHIPSGEKLSVYDVAMRYKSEGHATIILAGAEYGSGSSRDWAAKGPMLLGV  694

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDA++LGLTGHERY+I+LP++++EIRPGQD+
Sbjct  695  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDAETLGLTGHERYTINLPNSVSEIRPGQDI  754

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV+TDNGK+F CT+RFDTEVELAYF+HGGIL Y IR L
Sbjct  755  TVETDNGKSFVCTLRFDTEVELAYFDHGGILQYAIRNL  792



>ref|XP_010438674.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=795

 Score =   284 bits (727),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIPTGEKL VFDAA +YK+ G+DTIILAGAEYGSGSSRDWAAKGP+LLGV
Sbjct  635  LKGEVGPKTVHIPTGEKLSVFDAASKYKTAGQDTIILAGAEYGSGSSRDWAAKGPLLLGV  694

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNL GMGI+PLCFKAGEDA++LGLTGHERY++ LP+ +++IRPGQDV
Sbjct  695  KAVIAKSFERIHRSNLAGMGIIPLCFKAGEDAETLGLTGHERYTVHLPTKVSDIRPGQDV  754

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD+GK+F CT+RFDTEVELAY++HGGILPYVIR LS +
Sbjct  755  TVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSTK  795



>ref|XP_006283068.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
 gb|EOA15966.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
Length=995

 Score =   287 bits (735),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIPTGEKL VFDAA +YK+ G+DTIILAGAEYGSGSSRDWAAKGP+LLGV
Sbjct  835  LKGEVGPKTVHIPTGEKLSVFDAASKYKTAGQDTIILAGAEYGSGSSRDWAAKGPLLLGV  894

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNL GMGI+PLCFKAGEDA+SLGLTGHERY++ LP+ ++EIRPGQDV
Sbjct  895  KAVIAKSFERIHRSNLAGMGIIPLCFKAGEDAESLGLTGHERYTVHLPTKVSEIRPGQDV  954

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD+GK+F CT+RFDTEVELAY++HGGILPYVIR LS +
Sbjct  955  TVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSTK  995



>ref|XP_003517155.1| PREDICTED: aconitate hydratase 1 [Glycine max]
Length=901

 Score =   286 bits (731),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIP+GEKL VFD A +YKSEG D IILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  739  LNGEVGPKTIHIPSGEKLSVFDVAEKYKSEGHDMIILAGAEYGSGSSRDWAAKGPMLLGV  798

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDADSLGLTG ERY+IDLPSN+NEIRPGQDV
Sbjct  799  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADSLGLTGQERYTIDLPSNVNEIRPGQDV  858

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TD GK+F  T+RFDTEVELAYFNHGGIL YVIR L
Sbjct  859  TVVTDTGKSFVSTLRFDTEVELAYFNHGGILQYVIRNL  896



>ref|XP_006467022.1| PREDICTED: aconitate hydratase 1 [Citrus sinensis]
Length=900

 Score =   286 bits (731),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDTVILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++ GLTGHERY+IDLP++++EIRPGQDV
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPNSVSEIRPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
             V TD+GK+FTC +RFDTEVELAYF+HGGIL YVIR L
Sbjct  858  RVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  895



>ref|XP_006346211.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=980

 Score =   287 bits (734),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 149/161 (93%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIPTGEKLYV+DAAMRYKSEG DTI++AGAEYGSGSSRDWAAKGPMLLGV
Sbjct  820  LNGEVGPKTIHIPTGEKLYVYDAAMRYKSEGHDTIVVAGAEYGSGSSRDWAAKGPMLLGV  879

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMG++PL FK GEDA++LGLTGHE Y+IDLP  I++IRPGQDV
Sbjct  880  KAVIAKSFERIHRSNLVGMGLIPLSFKHGEDAETLGLTGHECYTIDLPQKISDIRPGQDV  939

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
             V TD+GK+F CT+RFDTEVEL YF HGGILPYVIR L+KQ
Sbjct  940  AVTTDSGKSFICTLRFDTEVELTYFEHGGILPYVIRNLTKQ  980



>ref|NP_001048898.1| Os03g0136900 [Oryza sativa Japonica Group]
 gb|ABF93861.1| Aconitate hydratase, cytoplasmic, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF10812.1| Os03g0136900 [Oryza sativa Japonica Group]
Length=986

 Score =   286 bits (733),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIP+GEKL VFDAA +YK+EG DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  826  LKGEVGPKTIHIPSGEKLSVFDAATKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGV  885

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNL GMGI+PLCFK+GEDAD+LGLTGHER+++ LP+N++EI+PGQDV
Sbjct  886  KAVIAKSFERIHRSNLAGMGIIPLCFKSGEDADTLGLTGHERFTVHLPANVSEIKPGQDV  945

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCT+RFDTEVELAY+++GGILPYVIR++++Q
Sbjct  946  TVTTDNGKSFTCTLRFDTEVELAYYDNGGILPYVIRKIAEQ  986



>gb|EEC74472.1| hypothetical protein OsI_09921 [Oryza sativa Indica Group]
Length=986

 Score =   286 bits (733),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIP+GEKL VFDAA +YK+EG DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  826  LKGEVGPKTIHIPSGEKLSVFDAATKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGV  885

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNL GMGI+PLCFK+GEDAD+LGLTGHER+++ LP+N++EI+PGQDV
Sbjct  886  KAVIAKSFERIHRSNLAGMGIIPLCFKSGEDADTLGLTGHERFTVHLPANVSEIKPGQDV  945

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCT+RFDTEVELAY+++GGILPYVIR++++Q
Sbjct  946  TVTTDNGKSFTCTLRFDTEVELAYYDNGGILPYVIRKIAEQ  986



>ref|XP_006651017.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Oryza 
brachyantha]
Length=906

 Score =   285 bits (730),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIP+GEKL VFDAA +YK+EG DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  746  LKGEVGPKTIHIPSGEKLSVFDAATKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGV  805

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNL GMGI+PLCFK+GEDAD+LGLTGHER+++ LP+N+++I+PGQDV
Sbjct  806  KAVIAKSFERIHRSNLAGMGIIPLCFKSGEDADTLGLTGHERFTVHLPANVSDIKPGQDV  865

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TDNGK+FTCT+RFDTEVELAY+++GGILPYVIR++++Q
Sbjct  866  TVTTDNGKSFTCTLRFDTEVELAYYDNGGILPYVIRKIAEQ  906



>ref|XP_010437416.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score =   285 bits (729),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIPTGEKL VFDAAM+Y++EG+DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LKGEVGPKTVHIPTGEKLSVFDAAMKYRNEGRDTVILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++LGLTG E Y+I+LP+ ++EI+PGQDV
Sbjct  798  KAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLTGQELYTIELPNKVSEIKPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T+NGK+FTCT+RFDTEVELAYF+HGGIL YVIR L KQ
Sbjct  858  TVITNNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNLIKQ  898



>gb|KHN41868.1| Aconitate hydratase 1 [Glycine soja]
Length=901

 Score =   285 bits (729),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIP+GEKL VFDAA +YKSEG D IILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  739  LNGEVGPKTIHIPSGEKLSVFDAAEKYKSEGHDMIILAGAEYGSGSSRDWAAKGPMLLGV  798

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK G+DADSLGLTG ERY+IDLPSN+NEIRPGQDV
Sbjct  799  KAVIAKSFERIHRSNLVGMGIIPLCFKPGDDADSLGLTGQERYTIDLPSNVNEIRPGQDV  858

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TD GK+F  T+RFDTEVELAYFNHGGIL YVIR +
Sbjct  859  TVVTDAGKSFVSTLRFDTEVELAYFNHGGILQYVIRNM  896



>ref|XP_008785050.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=998

 Score =   286 bits (732),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GE GPKT+HIP+GEKL VFDA MRYKSEG DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  836  LKGEPGPKTIHIPSGEKLSVFDATMRYKSEGHDTVILAGAEYGSGSSRDWAAKGPMLLGV  895

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAV+AKSFERIHRSNLVGMGI+PLCFK GEDA++LGLTGHERY+I+LP+++++I+PGQDV
Sbjct  896  KAVVAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLTGHERYTINLPNSVSDIKPGQDV  955

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TDNGK F CTVRFDTEVELAY+NHGGILP+VIR L
Sbjct  956  TVVTDNGKQFACTVRFDTEVELAYYNHGGILPFVIRNL  993



>ref|XP_010433420.1| PREDICTED: aconitate hydratase 3, mitochondrial [Camelina sativa]
Length=997

 Score =   286 bits (731),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIPTGEKL VFDAA +YK++G+DTIILAGAEYGSGSSRDWAAKGP+LLGV
Sbjct  837  LKGEVGPKTVHIPTGEKLSVFDAASKYKTDGQDTIILAGAEYGSGSSRDWAAKGPLLLGV  896

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNL GMGI+PLCFKAGEDA++LGLTGHERY++ LP+ +++IRPGQDV
Sbjct  897  KAVIAKSFERIHRSNLAGMGIIPLCFKAGEDAETLGLTGHERYTVHLPTKVSDIRPGQDV  956

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD+GK+F CT+RFDTEVELAY++HGGILPYVIR LS +
Sbjct  957  TVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSTK  997



>ref|XP_006413121.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
 gb|ESQ54574.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
Length=999

 Score =   286 bits (731),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 149/161 (93%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            + GEVGPKTVHIPTGEKL VFDAA RYK+ G+DT+ILAGAEYGSGSSRDWAAKGP+LLGV
Sbjct  839  VDGEVGPKTVHIPTGEKLSVFDAASRYKTAGQDTVILAGAEYGSGSSRDWAAKGPLLLGV  898

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNL GMGI+PLCFKAGEDAD+LGLTGHERY++ LP+ +++IRPGQDV
Sbjct  899  KAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLTGHERYTVHLPTKVSDIRPGQDV  958

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD GK+F CT+RFDTEVELAY++HGGILPYVIR LS +
Sbjct  959  TVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSTK  999



>gb|KCW56576.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=898

 Score =   284 bits (727),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIP+GEKL V+D AMRYKSEG  TIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  736  LKGEVGPKTIHIPSGEKLSVYDVAMRYKSEGHATIILAGAEYGSGSSRDWAAKGPMLLGV  795

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDA++LGLTGHERY+I+LP++++EIRPGQD+
Sbjct  796  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDAETLGLTGHERYTINLPNSVSEIRPGQDI  855

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV+TDNGK+F CT+RFDTEVELAYF+HGGIL Y IR L
Sbjct  856  TVETDNGKSFVCTLRFDTEVELAYFDHGGILQYAIRNL  893



>ref|XP_010029634.1| PREDICTED: aconitate hydratase 1 [Eucalyptus grandis]
 gb|KCW56577.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=900

 Score =   284 bits (727),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIP+GEKL V+D AMRYKSEG  TIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LKGEVGPKTIHIPSGEKLSVYDVAMRYKSEGHATIILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDA++LGLTGHERY+I+LP++++EIRPGQD+
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDAETLGLTGHERYTINLPNSVSEIRPGQDI  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV+TDNGK+F CT+RFDTEVELAYF+HGGIL Y IR L
Sbjct  858  TVETDNGKSFVCTLRFDTEVELAYFDHGGILQYAIRNL  895



>emb|CDY41626.1| BnaC03g62580D [Brassica napus]
Length=905

 Score =   285 bits (728),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIP+GEKL VFDAAM+Y++EG+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  745  LKGEVGPKTVHIPSGEKLSVFDAAMKYRNEGRDTIILAGAEYGSGSSRDWAAKGPMLLGV  804

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++LGLTG E Y+I+LP+N++EI+PGQDV
Sbjct  805  KAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLTGEELYTIELPNNVSEIKPGQDV  864

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T+NGK+FT T+RFDTEVELAYFNHGGIL YVIR L KQ
Sbjct  865  TVITNNGKSFTSTLRFDTEVELAYFNHGGILQYVIRNLIKQ  905



>ref|XP_003558862.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=994

 Score =   285 bits (730),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIP+GEKL VFDAAM+YK+EG DTIILAGAEYGSGSSRDWAAKGPML GV
Sbjct  833  LKGEVGPKTIHIPSGEKLAVFDAAMKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGV  892

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNL GMGI+PLCFKAGEDAD+LGLTGHER++I LP+N+++I+PGQDV
Sbjct  893  KAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLTGHERFTIQLPTNVSDIKPGQDV  952

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD GK+FTCT+RFDTEVELAY+ +GGILPYVIR+++ +
Sbjct  953  TVTTDAGKSFTCTLRFDTEVELAYYTNGGILPYVIRKIAAE  993



>ref|XP_010448188.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=998

 Score =   285 bits (730),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIPTGEKL VFDAA +YK+ G+DTIILAGAEYGSGSSRDWAAKGP+LLGV
Sbjct  838  LKGEVGPKTVHIPTGEKLSVFDAASKYKTAGQDTIILAGAEYGSGSSRDWAAKGPLLLGV  897

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNL GMGI+PLCFKAGEDA++LGLTGHERY++ LP+ +++IRPGQDV
Sbjct  898  KAVIAKSFERIHRSNLAGMGIIPLCFKAGEDAETLGLTGHERYTVHLPTKVSDIRPGQDV  957

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLS  257
            TV TD+GK+F CT+RFDTEVELAY++HGGILPYVIR LS
Sbjct  958  TVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLS  996



>gb|KHN36000.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=908

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+HIP+GEKL VFD A +YKSEG D IILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  746  LNGEVGPKTIHIPSGEKLSVFDVAEKYKSEGHDMIILAGAEYGSGSSRDWAAKGPMLLGV  805

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAK FERIHRSNLVGMGI+PLCFK GEDADSLGLTG ERY+IDLPSN+NEIRPGQDV
Sbjct  806  KAVIAKGFERIHRSNLVGMGIIPLCFKPGEDADSLGLTGQERYTIDLPSNVNEIRPGQDV  865

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV TD GK+F  T+RFDTEVELAYFNHGGIL YVIR L
Sbjct  866  TVVTDTGKSFVSTLRFDTEVELAYFNHGGILQYVIRNL  903



>ref|XP_004512178.1| PREDICTED: aconitate hydratase 1-like [Cicer arietinum]
Length=901

 Score =   284 bits (726),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            ++GEVGPKT+HIP+GEKL VFDAA +YK+EG D IILAGAEYGSGSSRDWAAKGP LLGV
Sbjct  739  MNGEVGPKTIHIPSGEKLSVFDAATKYKTEGHDMIILAGAEYGSGSSRDWAAKGPKLLGV  798

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++LGLTGHER++IDLPSN+NEIRPGQD+
Sbjct  799  KAVISKSFERIHRSNLVGMGIIPLCFKDGEDAETLGLTGHERFTIDLPSNVNEIRPGQDI  858

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
             V TDNGKTF CT+RFDTEVELAYFNHGGIL Y IR L
Sbjct  859  AVVTDNGKTFLCTLRFDTEVELAYFNHGGILQYAIRNL  896



>ref|XP_010446873.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
 ref|XP_010446874.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
Length=898

 Score =   283 bits (725),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIP+GEKL VFDAAM+Y++EG+DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LKGEVGPKTVHIPSGEKLSVFDAAMKYRNEGRDTVILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++LGLTG E Y+I+LP+ ++EI+PGQDV
Sbjct  798  KAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLTGQELYTIELPNKVSEIKPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T+NGK+FTCT+RFDTEVELAYF+HGGIL YVIR L KQ
Sbjct  858  TVITNNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNLIKQ  898



>ref|XP_010432222.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score =   283 bits (725),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIP+GEKL VFDAAM+Y++EG+DT+ILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  738  LKGEVGPKTVHIPSGEKLSVFDAAMKYRNEGRDTVILAGAEYGSGSSRDWAAKGPMLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++LGLTG E Y+I+LP+ ++EI+PGQDV
Sbjct  798  KAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLTGQELYTIELPNKVSEIKPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T+NGK+FTCT+RFDTEVELAYF+HGGIL YVIR L KQ
Sbjct  858  TVITNNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNLIKQ  898



>gb|KFK29204.1| hypothetical protein AALP_AA7G102800 [Arabis alpina]
Length=999

 Score =   284 bits (726),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIPTGEKL VFDAA RY + G+DT+ILAGAEYGSGSSRDWAAKGP+LLGV
Sbjct  839  LKGEVGPKTVHIPTGEKLSVFDAASRYMNAGQDTVILAGAEYGSGSSRDWAAKGPLLLGV  898

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNL GMGI+PLCFKAGEDA++LGLTGHERY++ LP+ ++EIRPGQDV
Sbjct  899  KAVISKSFERIHRSNLAGMGIIPLCFKAGEDAETLGLTGHERYTVHLPTKVSEIRPGQDV  958

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD GK+F CT+RFDTEVELAY++HGGILPYVIR LS +
Sbjct  959  TVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSTK  999



>ref|XP_006413195.1| hypothetical protein EUTSA_v10024325mg [Eutrema salsugineum]
 gb|ESQ54648.1| hypothetical protein EUTSA_v10024325mg [Eutrema salsugineum]
Length=962

 Score =   283 bits (724),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -1

Query  727  GEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGVKA  548
            GEVGPKTVHIPTGEKL VFDAA RYK+ G+DT+ILAGAEYGSGSSRDWAAKGP+LLGVKA
Sbjct  804  GEVGPKTVHIPTGEKLTVFDAASRYKTAGQDTVILAGAEYGSGSSRDWAAKGPLLLGVKA  863

Query  547  VIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDVTV  368
            V AKSFERIHRSNL GMGI+PLCFKAGEDAD+LGLTGHERY++ LP+ +++IRPGQDVTV
Sbjct  864  VTAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLTGHERYTVHLPTKVSDIRPGQDVTV  923

Query  367  KTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
             TD GK+F CT+RFDTEVELAY++HGGILPYVIR LS +
Sbjct  924  TTDTGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSTK  962



>ref|XP_010113288.1| Aconitate hydratase 1 [Morus notabilis]
 gb|EXC35295.1| Aconitate hydratase 1 [Morus notabilis]
Length=977

 Score =   283 bits (724),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 152/177 (86%), Gaps = 17/177 (10%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAM-----------------RYKSEGKDTIILAGAEYG  605
            L GEVGPKT+HIPTGEKL VFD AM                 RYKSEG DTIILAGAEYG
Sbjct  798  LKGEVGPKTIHIPTGEKLSVFDTAMVDCISIDCLKLYVWLLQRYKSEGHDTIILAGAEYG  857

Query  604  SGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERY  425
            SGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMG++PLCFK GEDA++LGLTGHERY
Sbjct  858  SGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGVIPLCFKPGEDAETLGLTGHERY  917

Query  424  SIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSK  254
            +IDLPS+++EI+PGQDVT+ TD+GK+FTCT+RFDTEVELAYF+HGGILPYVIR L K
Sbjct  918  TIDLPSSVSEIKPGQDVTMVTDDGKSFTCTLRFDTEVELAYFDHGGILPYVIRNLIK  974



>ref|XP_010526818.1| PREDICTED: aconitate hydratase 1 [Tarenaya hassleriana]
Length=899

 Score =   281 bits (720),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+H+P+GE L VFD AM+Y S+G+DT+ILAGAEYGSGSSRDWAAKGP LLGV
Sbjct  738  LGGEVGPKTIHVPSGETLSVFDVAMKYNSDGQDTVILAGAEYGSGSSRDWAAKGPKLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDA++LGLTGHE+Y+I+LPSN+ EI+PGQDV
Sbjct  798  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAETLGLTGHEQYNIELPSNVGEIKPGQDV  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
            TV T+NGK+F+CT+RFDTEVELAYFNHGGIL YVIR L
Sbjct  858  TVVTNNGKSFSCTLRFDTEVELAYFNHGGILQYVIRNL  895



>ref|XP_009109156.1| PREDICTED: aconitate hydratase 3, mitochondrial [Brassica rapa]
Length=995

 Score =   283 bits (723),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVH+PTGEKL VFDAA RY + G+DT+ILAGAEYGSGSSRDWAAKGP+LLGV
Sbjct  835  LKGEVGPKTVHVPTGEKLSVFDAASRYMNAGQDTVILAGAEYGSGSSRDWAAKGPLLLGV  894

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNL GMGI+PLCFKAGEDAD+LGLTGHERY++ LP+ +++I+PGQDV
Sbjct  895  KAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLTGHERYTVHLPTKVSDIKPGQDV  954

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD GK+F CT+RFDTEVELAY++HGGILPYVIR LS +
Sbjct  955  TVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSAK  995



>emb|CDY66424.1| BnaAnng22230D [Brassica napus]
Length=995

 Score =   283 bits (723),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVH+PTGEKL VFDAA RY + G+DT+ILAGAEYGSGSSRDWAAKGP+LLGV
Sbjct  835  LKGEVGPKTVHVPTGEKLSVFDAASRYMNAGQDTVILAGAEYGSGSSRDWAAKGPLLLGV  894

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNL GMGI+PLCFKAGEDAD+LGLTGHERY++ LP+ +++I+PGQDV
Sbjct  895  KAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLTGHERYTVHLPTKVSDIKPGQDV  954

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD GK+F CT+RFDTEVELAY++HGGILPYVIR LS +
Sbjct  955  TVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSAK  995



>ref|XP_004287770.1| PREDICTED: aconitate hydratase 1 [Fragaria vesca subsp. vesca]
Length=898

 Score =   281 bits (719),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+H PTG+K+ VFDAAM+YKSEG DTIILAGAEYGSGSSRDWAAKGP LLGV
Sbjct  738  LKGEVGPKTIHHPTGDKVSVFDAAMKYKSEGHDTIILAGAEYGSGSSRDWAAKGPKLLGV  797

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDA++LGLTG ERY+IDLPS ++EI+PGQD+
Sbjct  798  KAVIAKSFERIHRSNLVGMGIIPLCFKAGEDAETLGLTGEERYTIDLPSTVSEIKPGQDI  857

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSK  254
            TV T NGK+F CT+RFDTEVELAYF+HGGIL YVIR L K
Sbjct  858  TVVTSNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNLIK  897



>emb|CDY14291.1| BnaA08g14220D [Brassica napus]
Length=995

 Score =   281 bits (719),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVH+PTGEKL VFDAA RY + G+DT+ILAGAEYGSGSSRDWAAKGP+LLGV
Sbjct  835  LKGEVGPKTVHVPTGEKLSVFDAASRYMNAGQDTVILAGAEYGSGSSRDWAAKGPLLLGV  894

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVI+KSFERIHRSNL GMGI+PLCFKAGEDAD+LGLTGHERY++ LP+ +++I+PGQDV
Sbjct  895  KAVISKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLTGHERYTVHLPTKVSDIKPGQDV  954

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD GK+F CT+RFDTEVELAY++HGGILPYVIR LS +
Sbjct  955  TVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSAK  995



>ref|XP_002869584.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45843.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
Length=995

 Score =   281 bits (719),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKTVHIPTGEKL VFDAA +YK+  +DTIILAGAEYGSGSSRDWAAKGP+LLGV
Sbjct  835  LKGEVGPKTVHIPTGEKLSVFDAASKYKTAEQDTIILAGAEYGSGSSRDWAAKGPLLLGV  894

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNL GMGI+PLCFK+GEDA++LGLTGHERY++ LP+ +++IRPGQDV
Sbjct  895  KAVIAKSFERIHRSNLAGMGIIPLCFKSGEDAETLGLTGHERYTVHLPTKVSDIRPGQDV  954

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD GK+F CT+RFDTEVELAY++HGGILPYVIR LS +
Sbjct  955  TVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSAK  995



>emb|CAB36543.1| putative aconitase [Arabidopsis thaliana]
 emb|CAB79552.1| putative aconitase [Arabidopsis thaliana]
Length=907

 Score =   280 bits (715),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGP TVHIPTGEKL VFDAA +YK+  +DTIILAGAEYGSGSSRDWAAKGP+LLGV
Sbjct  747  LKGEVGPNTVHIPTGEKLSVFDAASKYKTAEQDTIILAGAEYGSGSSRDWAAKGPLLLGV  806

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNL GMGI+PLCFKAGEDA++LGLTGHERY++ LP+ +++IRPGQDV
Sbjct  807  KAVIAKSFERIHRSNLAGMGIIPLCFKAGEDAETLGLTGHERYTVHLPTKVSDIRPGQDV  866

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD+GK+F CT+RFDTEVELAY++HGGILPYVIR LS +
Sbjct  867  TVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSAK  907



>ref|XP_010046453.1| PREDICTED: aconitate hydratase, cytoplasmic [Eucalyptus grandis]
Length=137

 Score =   258 bits (660),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -1

Query  661  MRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPL  482
            M+YKS G DTI+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PL
Sbjct  1    MKYKSAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPL  60

Query  481  CFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAY  302
            CFKAGEDAD+LGLTGHERYSIDLPSNI+EIRPGQDVTV TD GK+F CT RF+TEVELAY
Sbjct  61   CFKAGEDADTLGLTGHERYSIDLPSNISEIRPGQDVTVTTDTGKSFICTARFETEVELAY  120

Query  301  FNHGGILPYVIRQLSKQ  251
            FNHGGILPYVIR L  Q
Sbjct  121  FNHGGILPYVIRNLFNQ  137



>ref|XP_007020807.1| Aconitase 3 [Theobroma cacao]
 gb|EOY12332.1| Aconitase 3 [Theobroma cacao]
Length=883

 Score =   279 bits (713),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIPTG+KL V+DAA RYK+ G+DTIILAG +YGSGSSRDWAAKG MLLGV
Sbjct  723  LKGEVGPKTIHIPTGDKLNVYDAATRYKATGQDTIILAGEDYGSGSSRDWAAKGSMLLGV  782

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD LGLTGHERY+IDLPS I EIRPGQDV
Sbjct  783  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADFLGLTGHERYTIDLPSKIKEIRPGQDV  842

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSK  254
            T+ TD GK+FTCT  FDT+VEL YF+HGGILPYVIR L+K
Sbjct  843  TITTDTGKSFTCTAWFDTKVELEYFDHGGILPYVIRNLNK  882



>ref|NP_567763.2| aconitase 2 [Arabidopsis thaliana]
 sp|Q94A28.3|ACO3M_ARATH RecName: Full=Aconitate hydratase 3, mitochondrial; Short=Aconitase 
3; AltName: Full=Citrate hydro-lyase 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE85279.1| aconitase 2 [Arabidopsis thaliana]
Length=995

 Score =   280 bits (717),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGP TVHIPTGEKL VFDAA +YK+  +DTIILAGAEYGSGSSRDWAAKGP+LLGV
Sbjct  835  LKGEVGPNTVHIPTGEKLSVFDAASKYKTAEQDTIILAGAEYGSGSSRDWAAKGPLLLGV  894

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNL GMGI+PLCFKAGEDA++LGLTGHERY++ LP+ +++IRPGQDV
Sbjct  895  KAVIAKSFERIHRSNLAGMGIIPLCFKAGEDAETLGLTGHERYTVHLPTKVSDIRPGQDV  954

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD+GK+F CT+RFDTEVELAY++HGGILPYVIR LS +
Sbjct  955  TVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSAK  995



>emb|CDP05740.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   280 bits (716),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -1

Query  718   GPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIA  539
              PKT+HIPTGE+LYV+DAAMRYKS G+DTIILAG EYGSGSSRDWAAKGPML GVKAVIA
Sbjct  855   APKTIHIPTGEELYVYDAAMRYKSAGQDTIILAGTEYGSGSSRDWAAKGPMLQGVKAVIA  914

Query  538   KSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDVTVKTD  359
             KSFERIHRSNLVGMGI+PLCFK GEDAD+LGLTG+ERYSIDLP  ++++RPGQD+TV TD
Sbjct  915   KSFERIHRSNLVGMGIIPLCFKPGEDADTLGLTGYERYSIDLPKKVSDVRPGQDITVTTD  974

Query  358   NGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSK  254
             +GK+FTC VRFDT+VEL YF+HGGILPYVIR L+K
Sbjct  975   DGKSFTCVVRFDTQVELTYFDHGGILPYVIRNLAK  1009



>gb|AAK91447.1| AT4g26970/F10M23_310 [Arabidopsis thaliana]
 gb|AAN18061.1| At4g26970/F10M23_310 [Arabidopsis thaliana]
Length=995

 Score =   277 bits (709),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGP TVHIPTGEKL VFDAA +YK+  +DTIILAGAEYGSGSSRDWAAKGP+LLGV
Sbjct  835  LKGEVGPNTVHIPTGEKLSVFDAASKYKTAEQDTIILAGAEYGSGSSRDWAAKGPLLLGV  894

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSF RIHRSNL GMGI+PLCFKAGEDA++LGLTGHERY++ LP+ +++IRPGQDV
Sbjct  895  KAVIAKSFGRIHRSNLAGMGIIPLCFKAGEDAETLGLTGHERYTVHLPTKVSDIRPGQDV  954

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV TD+GK+F CT+RFDTEVELAY++HGGILPYVIR LS +
Sbjct  955  TVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSAK  995



>ref|XP_010529315.1| PREDICTED: aconitate hydratase 1-like [Tarenaya hassleriana]
Length=901

 Score =   275 bits (703),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGP+T+HIPTG+KL VFDAA +YKSEG+DTIILAG+EYGSGSSRDWAAKGP LLGV
Sbjct  740  LRGEVGPETIHIPTGQKLSVFDAATKYKSEGQDTIILAGSEYGSGSSRDWAAKGPKLLGV  799

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGIVPLCFK GEDA++LGLTG E+Y+++LP+ INEI+PGQDV
Sbjct  800  KAVIAKSFERIHRSNLVGMGIVPLCFKVGEDAETLGLTGFEQYNVELPNEINEIKPGQDV  859

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
             V TD+GK+F CT+RFDTEVELAYFNHGGIL YVIR L
Sbjct  860  KVITDDGKSFVCTLRFDTEVELAYFNHGGILQYVIRNL  897



>ref|XP_002460765.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
 gb|EER97286.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
Length=979

 Score =   275 bits (704),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+H+PT +KL+VFDAAMRYK++G  TI+LAG EYGSGSSRDWAAKGPMLLGV
Sbjct  815  LNGEVGPKTIHVPTSDKLFVFDAAMRYKADGHHTIVLAGEEYGSGSSRDWAAKGPMLLGV  874

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMG++PLCFK GEDADSLGLTGHERY+I LP+N++EI+PGQDV
Sbjct  875  KAVIAKSFERIHRSNLVGMGVLPLCFKPGEDADSLGLTGHERYTIRLPTNVSEIQPGQDV  934

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ*ATQ  239
             V TD GK+FTC +R DT VELAYF+HGGIL YV+R L KQ   Q
Sbjct  935  QVVTDTGKSFTCKLRIDTLVELAYFDHGGILHYVLRNLVKQQQQQ  979



>gb|ACR36825.1| unknown [Zea mays]
Length=565

 Score =   267 bits (682),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GE GP T+H+PTGEKLYV+DAAM+YKSEG D +I+AG+EYGSGSSRD AAKGPMLLGV
Sbjct  403  LNGEAGPWTIHVPTGEKLYVYDAAMKYKSEGHDMVIIAGSEYGSGSSRDSAAKGPMLLGV  462

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            K+VIAKSFERIHRSNLVGMGI+PLCF+AGEDADSLGLTG ERY+I LP++  EI PGQDV
Sbjct  463  KSVIAKSFERIHRSNLVGMGIIPLCFQAGEDADSLGLTGRERYTIHLPTSTAEISPGQDV  522

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T +G++FTCT+R DT++E+ YFNHGGILPY++R L+ Q
Sbjct  523  TVTTHDGRSFTCTLRLDTQLEVTYFNHGGILPYMVRNLAAQ  563



>ref|XP_008670444.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X1 [Zea mays]
Length=982

 Score =   275 bits (702),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+H+PT EKL+VFDAAMRYK++G  TI+LAG EYGSGSSRDWAAKGPMLLGV
Sbjct  819  LNGEVGPKTIHVPTNEKLFVFDAAMRYKADGHHTIVLAGEEYGSGSSRDWAAKGPMLLGV  878

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMG++PLCFK GEDADSLGLTGHERY+I LP+N++EI+PGQDV
Sbjct  879  KAVIAKSFERIHRSNLVGMGVLPLCFKPGEDADSLGLTGHERYTIRLPTNVSEIQPGQDV  938

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
             V +D GK+FTC +R DT VELAYF+HGGIL YV+R L +Q
Sbjct  939  QVLSDTGKSFTCKLRIDTMVELAYFDHGGILHYVLRNLVRQ  979



>ref|XP_008670445.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X2 [Zea mays]
 tpg|DAA40969.1| TPA: hypothetical protein ZEAMMB73_742994 [Zea mays]
Length=980

 Score =   275 bits (702),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKT+H+PT EKL+VFDAAMRYK++G  TI+LAG EYGSGSSRDWAAKGPMLLGV
Sbjct  817  LNGEVGPKTIHVPTNEKLFVFDAAMRYKADGHHTIVLAGEEYGSGSSRDWAAKGPMLLGV  876

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMG++PLCFK GEDADSLGLTGHERY+I LP+N++EI+PGQDV
Sbjct  877  KAVIAKSFERIHRSNLVGMGVLPLCFKPGEDADSLGLTGHERYTIRLPTNVSEIQPGQDV  936

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
             V +D GK+FTC +R DT VELAYF+HGGIL YV+R L +Q
Sbjct  937  QVLSDTGKSFTCKLRIDTMVELAYFDHGGILHYVLRNLVRQ  977



>ref|XP_002991024.1| hypothetical protein SELMODRAFT_132907 [Selaginella moellendorffii]
 gb|EFJ07832.1| hypothetical protein SELMODRAFT_132907 [Selaginella moellendorffii]
Length=907

 Score =   272 bits (696),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIP+GEKL VFDAA +Y+ EG DTIILAGAEYGSGSSRDWAAKGP L GV
Sbjct  746  LKGEVGPKTIHIPSGEKLSVFDAAKKYQDEGHDTIILAGAEYGSGSSRDWAAKGPYLQGV  805

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDA+SLGLTG+ER++ID+PS+I +I+PGQDV
Sbjct  806  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDAESLGLTGYERFTIDIPSDIKDIKPGQDV  865

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
             VKTD GK+FTCT+RFDT+VEL YF +GGIL YVIRQL
Sbjct  866  VVKTDKGKSFTCTLRFDTQVELTYFENGGILHYVIRQL  903



>ref|XP_007132547.1| hypothetical protein PHAVU_011G1037000g, partial [Phaseolus vulgaris]
 gb|ESW04541.1| hypothetical protein PHAVU_011G1037000g, partial [Phaseolus vulgaris]
Length=135

 Score =   251 bits (642),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -1

Query  658  RYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLC  479
            RY + G+DTI+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLC
Sbjct  1    RYMASGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLC  60

Query  478  FKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYF  299
            FK+GEDAD+LGLTG ERY+ID+PS I++IRPGQDVTV TDNGK+FTCTVRFDTEVE+AYF
Sbjct  61   FKSGEDADTLGLTGQERYTIDIPSKISDIRPGQDVTVTTDNGKSFTCTVRFDTEVEIAYF  120

Query  298  NHGGILPYVIRQLSK  254
            NHGGILPYVIR L K
Sbjct  121  NHGGILPYVIRNLIK  135



>ref|XP_002991716.1| hypothetical protein SELMODRAFT_133937 [Selaginella moellendorffii]
 gb|EFJ07287.1| hypothetical protein SELMODRAFT_133937 [Selaginella moellendorffii]
Length=907

 Score =   272 bits (695),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIP+GEKL VFDAA +Y+ EG DTIILAGAEYGSGSSRDWAAKGP L GV
Sbjct  746  LKGEVGPKTIHIPSGEKLSVFDAAKKYQDEGHDTIILAGAEYGSGSSRDWAAKGPYLQGV  805

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK+GEDA+SLGLTG+ER++ID+PS+I +I+PGQDV
Sbjct  806  KAVIAKSFERIHRSNLVGMGIIPLCFKSGEDAESLGLTGYERFTIDIPSDIKDIKPGQDV  865

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
             VKTD GK+FTCT+RFDT+VEL YF +GGIL YVIRQL
Sbjct  866  LVKTDKGKSFTCTLRFDTQVELTYFENGGILHYVIRQL  903



>ref|XP_002866068.1| hypothetical protein ARALYDRAFT_918634 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42327.1| hypothetical protein ARALYDRAFT_918634 [Arabidopsis lyrata subsp. 
lyrata]
Length=244

 Score =   254 bits (650),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 143/187 (76%), Gaps = 26/187 (14%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GEVGPKTVHIPTGEK+ ++DAA RYK+ G+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  58   LNGEVGPKTVHIPTGEKICIYDAASRYKTAGQDTIILAGAEYGSGSSRDWAAKGPMLLGV  117

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KA+IAKSF R+HRSNL  + IVPLCFK+GEDA++LGLTGHERY+I LPSN+NEI+PGQD+
Sbjct  118  KAIIAKSFNRVHRSNLASIRIVPLCFKSGEDAETLGLTGHERYTIHLPSNVNEIKPGQDI  177

Query  373  TVKTDNGKTFTCTVRFDTE--------------------------VELAYFNHGGILPYV  272
            TV TD   +F CT+R DTE                          VELA +NHGG+L Y+
Sbjct  178  TVTTDTANSFVCTLRLDTEVITKALSRFDCDHIFDGLTWLIGIDQVELACYNHGGMLSYI  237

Query  271  IRQLSKQ  251
            IR LS +
Sbjct  238  IRSLSNE  244



>ref|XP_007020811.1| Aconitase 3 [Theobroma cacao]
 gb|EOY12336.1| Aconitase 3 [Theobroma cacao]
Length=951

 Score =   269 bits (688),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGPKT+HIPTG+KL+V+DAAMRYK+ G+DTIILAGAEYGSGSSRDWAAKGPMLLGV
Sbjct  809  LQGEVGPKTIHIPTGDKLHVYDAAMRYKTAGQDTIILAGAEYGSGSSRDWAAKGPMLLGV  868

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            KAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGL+GHERYSIDLPS I+EIRPGQDV
Sbjct  869  KAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLSGHERYSIDLPSKISEIRPGQDV  928

Query  373  TVKTDNGKTFTCTVRFDTEVELA  305
            TV TD GK+FTCTVRFDTEVELA
Sbjct  929  TVTTDTGKSFTCTVRFDTEVELA  951



>ref|XP_010033531.1| PREDICTED: aconitate hydratase 1-like [Eucalyptus grandis]
Length=903

 Score =   268 bits (684),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGP+T+HIP+GEK++VFDAAMRYK+EG+DTI+LAG+EYG GSSRD AAKGPML+GV
Sbjct  739  LEGEVGPRTIHIPSGEKMHVFDAAMRYKNEGQDTIVLAGSEYGVGSSRDGAAKGPMLVGV  798

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            +AVIAKSFE+IHRSNLVGMGI+PLCFK GEDA++LGL GHERY+IDLP+ ++E++P QDV
Sbjct  799  QAVIAKSFEQIHRSNLVGMGIIPLCFKPGEDAETLGLNGHERYTIDLPNKVSELKPRQDV  858

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
             V TDNGK+F CT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  859  KVVTDNGKSFACTLRFDTEVELAYFDHGGILQYVIRTL  896



>gb|KCW53221.1| hypothetical protein EUGRSUZ_J02488 [Eucalyptus grandis]
Length=930

 Score =   268 bits (684),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L GEVGP+T+HIP+GEK++VFDAAMRYK+EG+DTI+LAG+EYG GSSRD AAKGPML+GV
Sbjct  766  LEGEVGPRTIHIPSGEKMHVFDAAMRYKNEGQDTIVLAGSEYGVGSSRDGAAKGPMLVGV  825

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            +AVIAKSFE+IHRSNLVGMGI+PLCFK GEDA++LGL GHERY+IDLP+ ++E++P QDV
Sbjct  826  QAVIAKSFEQIHRSNLVGMGIIPLCFKPGEDAETLGLNGHERYTIDLPNKVSELKPRQDV  885

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  260
             V TDNGK+F CT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  886  KVVTDNGKSFACTLRFDTEVELAYFDHGGILQYVIRTL  923



>ref|XP_008669747.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X2 [Zea mays]
 tpg|DAA38798.1| TPA: hypothetical protein ZEAMMB73_641300 [Zea mays]
Length=905

 Score =   267 bits (683),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -1

Query  733  LSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGV  554
            L+GE GP T+H+PTGEKLYV+DAAM+YKSEG D +I+AG+EYGSGSSRD AAKGPMLLGV
Sbjct  743  LNGEAGPWTIHVPTGEKLYVYDAAMKYKSEGHDMVIIAGSEYGSGSSRDSAAKGPMLLGV  802

Query  553  KAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDV  374
            K+VIAKSFERIHRSNLVGMGI+PLCF+AGEDADSLGLTG ERY+I LP++  EI PGQDV
Sbjct  803  KSVIAKSFERIHRSNLVGMGIIPLCFQAGEDADSLGLTGRERYTIHLPTSTAEISPGQDV  862

Query  373  TVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  251
            TV T +G++FTCT+R DT++E+ YFNHGGILPY++R L+ Q
Sbjct  863  TVTTHDGRSFTCTLRLDTQLEVTYFNHGGILPYMVRNLAAQ  903



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1327220236485