BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF034G18

Length=785
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009791518.1|  PREDICTED: endoplasmin homolog                     289   9e-88   Nicotiana sylvestris
dbj|BAL42332.1|  Heat shock protein 90                                  289   9e-88   Nicotiana tabacum [American tobacco]
gb|KJB63505.1|  hypothetical protein B456_010G0030001                   281   1e-87   Gossypium raimondii
ref|XP_007017830.1|  Chaperone protein htpG family protein isoform 3    286   2e-87   
gb|KHG15193.1|  Endoplasmin                                             285   3e-87   Gossypium arboreum [tree cotton]
gb|AAB63606.1|  HSP90 isolog                                            274   4e-87   Arabidopsis thaliana [mouse-ear cress]
gb|AAF64453.1|AF239931_1  putative heat-shock protein 90                273   5e-87   Euphorbia esula [wolf's milk]
gb|KJB63503.1|  hypothetical protein B456_010G0030001                   280   8e-87   Gossypium raimondii
ref|XP_009606988.1|  PREDICTED: endoplasmin homolog                     285   2e-86   Nicotiana tomentosiformis
dbj|BAL42333.1|  Heat shock protein 90                                  285   2e-86   Nicotiana tabacum [American tobacco]
ref|XP_007017829.1|  Chaperone protein htpG family protein isoform 2    284   6e-86   
ref|XP_007017828.1|  Chaperone protein htpG family protein isoform 1    285   6e-86   
ref|XP_007225662.1|  hypothetical protein PRUPE_ppa001487mg             284   6e-86   Prunus persica
ref|XP_008221245.1|  PREDICTED: endoplasmin homolog                     284   7e-86   Prunus mume [ume]
ref|XP_009791520.1|  PREDICTED: endoplasmin homolog                     284   7e-86   Nicotiana sylvestris
ref|XP_004291352.1|  PREDICTED: endoplasmin homolog                     283   2e-85   Fragaria vesca subsp. vesca
ref|XP_010109992.1|  Endoplasmin-like protein                           285   3e-85   
gb|ABK92622.1|  unknown                                                 265   4e-85   Populus trichocarpa [western balsam poplar]
ref|XP_009334927.1|  PREDICTED: endoplasmin homolog                     282   5e-85   Pyrus x bretschneideri [bai li]
gb|KJB63502.1|  hypothetical protein B456_010G0030001                   281   5e-85   Gossypium raimondii
ref|XP_008387928.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin ...    281   6e-85   
ref|XP_002510550.1|  endoplasmin, putative                              281   6e-85   Ricinus communis
gb|KDO84885.1|  hypothetical protein CISIN_1g003458mg                   277   2e-84   Citrus sinensis [apfelsine]
gb|KJB63501.1|  hypothetical protein B456_010G0030001                   280   2e-84   Gossypium raimondii
ref|XP_008377135.1|  PREDICTED: endoplasmin homolog                     280   2e-84   
emb|CDP07384.1|  unnamed protein product                                279   4e-84   Coffea canephora [robusta coffee]
gb|KDO84884.1|  hypothetical protein CISIN_1g003458mg                   278   2e-83   Citrus sinensis [apfelsine]
ref|XP_006435195.1|  hypothetical protein CICLE_v10000296mg             278   2e-83   Citrus clementina [clementine]
ref|XP_006473673.1|  PREDICTED: endoplasmin homolog                     278   2e-83   Citrus sinensis [apfelsine]
gb|KDP36908.1|  hypothetical protein JCGZ_08199                         277   3e-83   Jatropha curcas
ref|XP_010433803.1|  PREDICTED: endoplasmin homolog                     276   4e-83   Camelina sativa [gold-of-pleasure]
ref|XP_010439073.1|  PREDICTED: endoplasmin homolog                     276   1e-82   Camelina sativa [gold-of-pleasure]
ref|XP_010448597.1|  PREDICTED: endoplasmin homolog                     275   1e-82   Camelina sativa [gold-of-pleasure]
gb|EYU38796.1|  hypothetical protein MIMGU_mgv1a001101mg                276   2e-82   Erythranthe guttata [common monkey flower]
ref|NP_974606.1|  HSP90-like protein GRP94                              275   2e-82   Arabidopsis thaliana [mouse-ear cress]
gb|EYU36792.1|  hypothetical protein MIMGU_mgv1a001447mg                274   3e-82   Erythranthe guttata [common monkey flower]
ref|NP_194150.1|  HSP90-like protein GRP94                              275   3e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010246858.1|  PREDICTED: endoplasmin homolog                     274   3e-82   Nelumbo nucifera [Indian lotus]
dbj|BAB86368.1|  SHEPHERD                                               274   4e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283118.1|  hypothetical protein CARUB_v10004140mg             274   6e-82   Capsella rubella
ref|XP_006342064.1|  PREDICTED: endoplasmin homolog                     273   6e-82   Solanum tuberosum [potatoes]
sp|P35016.1|ENPL_CATRO  RecName: Full=Endoplasmin homolog; AltNam...    273   1e-81   Catharanthus roseus [chatas]
ref|XP_002273785.1|  PREDICTED: endoplasmin homolog                     273   1e-81   Vitis vinifera
emb|CDX92620.1|  BnaC07g38780D                                          271   2e-81   
emb|CDY03477.1|  BnaC01g16050D                                          272   2e-81   
ref|XP_010539097.1|  PREDICTED: endoplasmin homolog                     272   2e-81   Tarenaya hassleriana [spider flower]
emb|CDY34264.1|  BnaA01g13670D                                          272   2e-81   Brassica napus [oilseed rape]
ref|XP_004238368.1|  PREDICTED: endoplasmin homolog                     271   3e-81   Solanum lycopersicum
ref|XP_010069812.1|  PREDICTED: endoplasmin homolog                     271   3e-81   Eucalyptus grandis [rose gum]
ref|XP_003589505.1|  Endoplasmin-like protein                           271   5e-81   Medicago truncatula
gb|KJB14397.1|  hypothetical protein B456_002G122800                    271   6e-81   Gossypium raimondii
ref|XP_009137776.1|  PREDICTED: endoplasmin homolog                     271   8e-81   Brassica rapa
ref|XP_006596543.1|  PREDICTED: endoplasmin homolog isoform X2          270   1e-80   Glycine max [soybeans]
ref|XP_003545030.1|  PREDICTED: endoplasmin homolog isoform X1          270   1e-80   Glycine max [soybeans]
gb|KHG17445.1|  Endoplasmin                                             270   1e-80   Gossypium arboreum [tree cotton]
emb|CAN79404.1|  hypothetical protein VITISV_028074                     273   2e-80   Vitis vinifera
ref|XP_006601356.1|  PREDICTED: endoplasmin homolog isoform X2          270   2e-80   Glycine max [soybeans]
ref|XP_003550428.1|  PREDICTED: endoplasmin homolog isoform X1          270   2e-80   
emb|CDY10992.1|  BnaA03g46510D                                          270   2e-80   Brassica napus [oilseed rape]
ref|XP_002867677.1|  hypothetical protein ARALYDRAFT_492441             269   2e-80   Arabidopsis lyrata subsp. lyrata
ref|XP_007160650.1|  hypothetical protein PHAVU_001G005200g             268   5e-80   Phaseolus vulgaris [French bean]
ref|XP_010266798.1|  PREDICTED: endoplasmin homolog                     268   8e-80   Nelumbo nucifera [Indian lotus]
ref|XP_011074690.1|  PREDICTED: endoplasmin homolog                     266   2e-79   Sesamum indicum [beniseed]
ref|XP_004152644.1|  PREDICTED: endoplasmin homolog                     267   2e-79   Cucumis sativus [cucumbers]
ref|XP_008444821.1|  PREDICTED: endoplasmin homolog                     266   2e-79   Cucumis melo [Oriental melon]
ref|XP_004499281.1|  PREDICTED: endoplasmin homolog isoform X1          265   6e-79   Cicer arietinum [garbanzo]
ref|XP_004499283.1|  PREDICTED: endoplasmin homolog isoform X3          265   6e-79   Cicer arietinum [garbanzo]
ref|XP_011045067.1|  PREDICTED: endoplasmin homolog                     265   7e-79   Populus euphratica
ref|XP_006413464.1|  hypothetical protein EUTSA_v10024414mg             265   9e-79   Eutrema salsugineum [saltwater cress]
ref|XP_010691883.1|  PREDICTED: endoplasmin homolog                     265   9e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002307732.1|  hypothetical protein POPTR_0005s26260g             265   1e-78   Populus trichocarpa [western balsam poplar]
gb|KFK29085.1|  hypothetical protein AALP_AA7G086900                    265   1e-78   Arabis alpina [alpine rockcress]
ref|XP_008808636.1|  PREDICTED: endoplasmin homolog                     264   3e-78   Phoenix dactylifera
emb|CDY24830.1|  BnaA08g14800D                                          263   3e-78   Brassica napus [oilseed rape]
gb|AFW75769.1|  hypothetical protein ZEAMMB73_790349                    252   2e-77   
ref|XP_010935079.1|  PREDICTED: endoplasmin homolog                     261   4e-77   Elaeis guineensis
gb|AIZ68158.1|  heat shock protein 90                                   261   4e-77   Ornithogalum longebracteatum [sea-onion]
emb|CDY08910.1|  BnaC08g11400D                                          260   5e-77   Brassica napus [oilseed rape]
gb|EPS69355.1|  hypothetical protein M569_05408                         260   6e-77   Genlisea aurea
ref|XP_006851911.1|  hypothetical protein AMTR_s00041p00161550          258   3e-76   Amborella trichopoda
gb|AAN34791.1|  Grp94                                                   258   4e-76   Xerophyta viscosa
ref|XP_010941296.1|  PREDICTED: endoplasmin homolog                     258   4e-76   Elaeis guineensis
ref|XP_008788614.1|  PREDICTED: endoplasmin homolog                     258   6e-76   Phoenix dactylifera
ref|XP_006657350.1|  PREDICTED: endoplasmin homolog                     257   6e-76   Oryza brachyantha
ref|NP_001058590.1|  Os06g0716700                                       256   2e-75   
gb|AAL79732.1|AC091774_23  heat shock protein 90                        256   2e-75   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ02369.1|  hypothetical protein OsI_24473                          256   4e-75   Oryza sativa Indica Group [Indian rice]
gb|EAZ38293.1|  hypothetical protein OsJ_22671                          256   4e-75   Oryza sativa Japonica Group [Japonica rice]
gb|AFW75768.1|  hypothetical protein ZEAMMB73_790349                    251   1e-74   
dbj|BAA90487.1|  heat shock protein 90                                  253   2e-74   Oryza sativa [red rice]
dbj|BAJ89816.1|  predicted protein                                      247   3e-74   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004966467.1|  PREDICTED: endoplasmin homolog                     253   3e-74   Setaria italica
gb|ABK24228.1|  unknown                                                 244   5e-74   Picea sitchensis
gb|AFW75767.1|  endoplasmin                                             252   6e-74   
ref|XP_009409971.1|  PREDICTED: endoplasmin homolog                     251   1e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001151475.1|  endoplasmin precursor                              250   3e-73   
ref|XP_009393849.1|  PREDICTED: endoplasmin homolog                     249   6e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002439030.1|  hypothetical protein SORBIDRAFT_10g030240          249   6e-73   
ref|XP_003563275.1|  PREDICTED: endoplasmin homolog                     249   9e-73   Brachypodium distachyon [annual false brome]
gb|ABV82432.1|  Hsp90-like protein                                      248   1e-72   Dactylis glomerata [cocksfoot]
ref|XP_011083591.1|  PREDICTED: endoplasmin homolog                     248   2e-72   
sp|P36183.1|ENPL_HORVU  RecName: Full=Endoplasmin homolog; AltNam...    248   2e-72   Hordeum vulgare [barley]
ref|NP_001146348.1|  shepherd-like1                                     246   3e-72   
gb|EMS56078.1|  Endoplasmin-like protein                                248   4e-72   Triticum urartu
ref|XP_008643502.1|  PREDICTED: shepherd-like1 isoform X1               246   9e-72   
gb|AFW69515.1|  hypothetical protein ZEAMMB73_665489                    246   2e-71   
gb|EMT19498.1|  Endoplasmin-like protein                                247   5e-71   
gb|ABV21762.1|  GRP94                                                   244   9e-71   Pinus taeda
ref|XP_001770511.1|  predicted protein                                  220   4e-62   
ref|XP_002969701.1|  hypothetical protein SELMODRAFT_451343             219   1e-61   Selaginella moellendorffii
ref|XP_002981308.1|  hypothetical protein SELMODRAFT_444847             218   1e-61   Selaginella moellendorffii
gb|KDO84886.1|  hypothetical protein CISIN_1g003458mg                   207   9e-58   Citrus sinensis [apfelsine]
gb|KJB14398.1|  hypothetical protein B456_002G122800                    196   7e-54   Gossypium raimondii
ref|XP_003063917.1|  predicted protein                                  195   2e-53   Micromonas pusilla CCMP1545
ref|XP_002508627.1|  predicted protein                                  186   3e-50   Micromonas commoda
ref|XP_001421809.1|  Heat Shock Protein 90, endoplasmic reticulum       178   2e-47   Ostreococcus lucimarinus CCE9901
ref|XP_005842771.1|  hypothetical protein CHLNCDRAFT_59468              167   9e-46   Chlorella variabilis
emb|CEG00480.1|  Histidine kinase-like ATPase, ATP-binding domain       171   5e-45   Ostreococcus tauri
ref|XP_003083767.1|  heat shock protein 90 (ISS)                        171   7e-45   
ref|XP_007512535.1|  predicted protein                                  169   1e-43   Bathycoccus prasinos
gb|AFK40768.1|  unknown                                                 149   7e-42   Lotus japonicus
gb|ACN26939.1|  unknown                                                 148   6e-41   Zea mays [maize]
ref|XP_001753222.1|  predicted protein                                  154   4e-39   
ref|NP_999808.1|  heat shock protein gp96 precursor                     152   4e-38   Strongylocentrotus purpuratus [purple urchin]
ref|XP_001701885.1|  heat shock protein 90B                             151   6e-38   Chlamydomonas reinhardtii
ref|XP_005651682.1|  heat shock protein Hsp90                           151   7e-38   Coccomyxa subellipsoidea C-169
ref|XP_006220022.1|  PREDICTED: heat shock protein 90-like              141   2e-37   
gb|KHJ75602.1|  Hsp90 protein                                           142   3e-37   Oesophagostomum dentatum [nodule worm]
ref|XP_006678605.1|  hypothetical protein BATDEDRAFT_36900              147   4e-37   Batrachochytrium dendrobatidis JAM81
gb|AEG19531.1|  heat shock protein 90                                   147   8e-37   Glaciozyma antarctica
gb|KDE07091.1|  heat shock protein 90-1                                 147   9e-37   Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_007515443.1|  predicted protein                                  147   2e-36   Bathycoccus prasinos
ref|XP_308799.3|  AGAP006959-PA                                         144   2e-36   Anopheles gambiae str. PEST
ref|XP_009065664.1|  hypothetical protein LOTGIDRAFT_197084             147   2e-36   Lottia gigantea
ref|XP_005843734.1|  hypothetical protein CHLNCDRAFT_140066             145   3e-36   Chlorella variabilis
gb|ACU45247.1|  HSP90                                                   143   3e-36   Karlodinium veneficum
gb|EWM29604.1|  heat shock protein 90                                   145   5e-36   Nannochloropsis gaditana
ref|XP_005855339.1|  molecular chaperone HtpG                           145   5e-36   Nannochloropsis gaditana CCMP526
emb|CAG01829.1|  unnamed protein product                                138   7e-36   Tetraodon nigroviridis
ref|XP_308800.3|  AGAP006958-PA                                         145   1e-35   Anopheles gambiae str. PEST
ref|XP_001740319.1|  heat shock protein                                 137   1e-35   Entamoeba dispar SAW760
ref|XP_005538149.1|  heat shock protein of Hsp90 family                 144   1e-35   Cyanidioschyzon merolae strain 10D
gb|EJT49886.1|  chaperone                                               144   1e-35   Trichosporon asahii var. asahii CBS 2479
gb|AGW82181.1|  heat shcok protein 90                                   136   1e-35   Corbicula fluminea [asian clam]
ref|XP_010902983.1|  PREDICTED: heat shock protein HSP 90-alpha 1       144   1e-35   
gb|AAB05638.1|  heat shock protein 82                                   144   2e-35   Anopheles albimanus
gb|KFB48797.1|  hypothetical protein ZHAS_00016808                      143   2e-35   Anopheles sinensis
gb|ETN67039.1|  heat shock protein                                      144   2e-35   Anopheles darlingi [American malaria mosquito]
ref|XP_002968038.1|  hypothetical protein SELMODRAFT_88538              144   3e-35   
ref|XP_002021279.1|  GL24896                                            140   3e-35   
gb|ACF95812.1|  heat shock protein 90                                   143   3e-35   Amphidinium carterae
ref|XP_002992602.1|  hypothetical protein SELMODRAFT_448838             144   3e-35   
gb|ADV03069.1|  heat shock protein 90                                   143   3e-35   Amphidinium carterae
gb|KHJ75025.1|  Hsp90 protein                                           137   3e-35   Oesophagostomum dentatum [nodule worm]
gb|ABF61871.1|  chaperone                                               135   4e-35   Agave tequilana
gb|KIO34802.1|  hypothetical protein M407DRAFT_90187                    143   4e-35   Tulasnella calospora MUT 4182
gb|EMS22510.1|  molecular chaperone HtpG                                143   4e-35   Rhodotorula toruloides NP11
gb|ADO30471.1|  heat shock protein 90                                   141   5e-35   Bactrocera dorsalis [papaya fruit fly]
ref|XP_007764667.1|  heat-shock protein 90                              143   5e-35   Coniophora puteana RWD-64-598 SS2
gb|KDO70244.1|  hypothetical protein CISIN_1g0038272mg                  139   6e-35   Citrus sinensis [apfelsine]
emb|CAY56585.1|  putative heat shock protein 83                         142   6e-35   Bactrocera oleae [olive fly]
gb|ACO58580.1|  heat shock protein 90                                   139   6e-35   Apis mellifera [bee]
ref|XP_007385736.1|  HSP90-domain-containing protein                    142   7e-35   Punctularia strigosozonata HHB-11173 SS5
gb|KFB48798.1|  heat shock protein 82                                   142   7e-35   Anopheles sinensis
ref|XP_005100278.1|  PREDICTED: mesocentin-like                         145   7e-35   
gb|ABI14419.1|  heat shock protein 90                                   142   7e-35   Karlodinium veneficum
ref|XP_010943343.1|  PREDICTED: heat shock protein 83-like              143   7e-35   Elaeis guineensis
ref|XP_008551765.1|  PREDICTED: heat shock protein 83                   142   7e-35   Microplitis demolitor
ref|XP_003074078.1|  heat shock protein 90C (ISS)                       142   7e-35   
gb|ABA28987.1|  heat shock protein 90 3                                 140   9e-35   Symbiodinium sp. C3
ref|XP_009627181.1|  PREDICTED: heat shock protein 90-1-like            142   9e-35   Nicotiana tomentosiformis
gb|AAW49252.2|  heat shock protein 90                                   142   1e-34   Liriomyza huidobrensis
ref|XP_009776793.1|  PREDICTED: heat shock protein 90-1-like            142   1e-34   Nicotiana sylvestris
gb|EPT06188.1|  hypothetical protein FOMPIDRAFT_1109676                 142   1e-34   Fomitopsis pinicola FP-58527 SS1
ref|XP_006844092.1|  hypothetical protein AMTR_s00006p00252810          142   1e-34   Amborella trichopoda
gb|KDQ60746.1|  hypothetical protein JAAARDRAFT_172907                  142   1e-34   Jaapia argillacea MUCL 33604
ref|XP_010736427.1|  PREDICTED: heat shock protein HSP 90-alpha i...    142   1e-34   Larimichthys crocea [croceine croaker]
ref|XP_011182023.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    142   1e-34   Zeugodacus cucurbitae [melon fruit fly]
emb|CEF96474.1|  Histidine kinase-like ATPase, ATP-binding domain       142   1e-34   Ostreococcus tauri
ref|XP_011203601.1|  PREDICTED: heat shock protein 83                   142   1e-34   Bactrocera dorsalis [papaya fruit fly]
dbj|BAF92789.1|  cytosolic heat shock protein 90 alpha                  142   1e-34   Solea senegalensis
gb|AAQ63041.1|  heat shock protein HSP 90 alpha                         134   1e-34   Platichthys flesus
gb|AGU42458.1|  heat shock protein 90                                   142   1e-34   Bactrocera correcta
ref|XP_006793113.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    141   2e-34   Neolamprologus brichardi [lyretail cichlid]
ref|XP_011398501.1|  Heat shock protein 90-2                            139   2e-34   Auxenochlorella protothecoides
ref|XP_002949693.1|  hypothetical protein VOLCADRAFT_80696              142   2e-34   Volvox carteri f. nagariensis
ref|NP_001274755.1|  heat shock protein 83-like                         141   2e-34   Ceratitis capitata [medfly]
emb|CAE02770.2|  OSJNBb0085F13.17                                       141   2e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008297037.1|  PREDICTED: heat shock protein HSP 90-alpha 1       141   2e-34   Stegastes partitus
dbj|BAF01597.1|  heat shock like protein                                138   2e-34   Arabidopsis thaliana [mouse-ear cress]
gb|EAY92778.1|  hypothetical protein OsI_14582                          141   2e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_005805663.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    141   2e-34   
gb|AGT57167.1|  heat shock protein 90-alpha 3                           141   2e-34   Salmo salar
gb|AER28025.1|  heat shock protein 83S2                                 141   2e-34   Stratiomys singularior
ref|XP_010788727.1|  PREDICTED: heat shock protein HSP 90-alpha 1       141   2e-34   Notothenia coriiceps [yellowbelly rockcod]
gb|ABV55506.1|  heat shock protein 90                                   141   2e-34   Microplitis mediator
gb|KIL68560.1|  hypothetical protein M378DRAFT_184990                   141   2e-34   Amanita muscaria Koide BX008
gb|KHN71590.1|  Endoplasmin                                             142   2e-34   Toxocara canis
emb|CDQ81678.1|  unnamed protein product                                141   2e-34   Oncorhynchus mykiss
ref|XP_005805662.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    141   2e-34   Xiphophorus maculatus
gb|AEH27540.1|  cytosolic heat shock protein 90-alpha                   141   2e-34   Lates calcarifer [Asian seabass]
emb|CDO69548.1|  hypothetical protein BN946_scf184785.g53               141   2e-34   Trametes cinnabarina
ref|XP_007577310.1|  PREDICTED: heat shock protein HSP 90-alpha 1       141   2e-34   Poecilia formosa
gb|AIA62362.1|  hsp90                                                   139   2e-34   Bactrocera minax
ref|XP_002447413.1|  hypothetical protein SORBIDRAFT_06g000660          141   2e-34   Sorghum bicolor [broomcorn]
gb|ABK34943.1|  heat shock protein 83                                   141   2e-34   Drosophila buzzatii
gb|EJU00792.1|  heat shock protein 90                                   140   2e-34   Dacryopinax primogenitus
gb|AIU38244.1|  heat shock protein 90                                   141   2e-34   Anisakis paggiae
gb|AIU38242.1|  heat shock protein 90                                   141   2e-34   Anisakis pegreffii
ref|XP_002998541.1|  heat shock protein 90                              140   3e-34   Phytophthora infestans T30-4
gb|AIU38246.1|  heat shock protein 90                                   141   3e-34   Anisakis brevispiculata
emb|CAK22426.1|  heat shock protein 83                                  137   3e-34   Beta vulgaris [beet]
gb|AIU38243.1|  heat shock protein 90                                   141   3e-34   Anisakis typica
gb|ETK95017.1|  heat shock protein 90-2                                 140   3e-34   Phytophthora parasitica
ref|XP_008915791.1|  heat shock protein 90-2                            140   3e-34   Phytophthora parasitica INRA-310
gb|AIU38245.1|  heat shock protein 90                                   141   3e-34   Anisakis physeteris
ref|XP_007863437.1|  HSP90-domain-containing protein                    140   3e-34   Gloeophyllum trabeum ATCC 11539
ref|XP_009534751.1|  hypothetical protein PHYSODRAFT_355817             140   3e-34   Phytophthora sojae
ref|XP_001649751.1|  AAEL014845-PA                                      139   3e-34   
gb|ETN83529.1|  putative heat shock protein 90                          140   3e-34   Necator americanus
ref|XP_009542788.1|  hypothetical protein HETIRDRAFT_311260             140   3e-34   Heterobasidion irregulare TC 32-1
gb|EXX78198.1|  Hsp90 family chaperone HSC82                            137   3e-34   Rhizophagus irregularis DAOM 197198w
ref|XP_007361188.1|  HSP90-domain-containing protein                    140   3e-34   Dichomitus squalens LYAD-421 SS1
gb|KIH68348.1|  Hsp90 protein                                           140   3e-34   Ancylostoma duodenale
gb|ACU00668.1|  heat shock protein 90                                   140   3e-34   Haemonchus contortus [red stomach worm]
ref|XP_011345590.1|  PREDICTED: heat shock protein 83                   140   3e-34   Ooceraea biroi
gb|AAM02974.1|AF421541_1  Hsp90                                         140   3e-34   Crypthecodinium cohnii
emb|CDP96098.1|  Protein BM-DAF-21, isoform a                           140   3e-34   
tpg|DAA61910.1|  TPA: hypothetical protein ZEAMMB73_416250              140   3e-34   
gb|KIP08934.1|  hypothetical protein PHLGIDRAFT_103566                  140   3e-34   Phlebiopsis gigantea 11061_1 CR5-6
gb|EYC13285.1|  hypothetical protein Y032_0044g1081                     140   4e-34   Ancylostoma ceylanicum
ref|XP_006849050.1|  hypothetical protein AMTR_s00028p00187760          141   4e-34   Amborella trichopoda
emb|CAA06694.1|  heat shock protein 90                                  140   4e-34   Brugia pahangi
sp|O61998.2|HSP90_BRUPA  RecName: Full=Heat shock protein 90            140   4e-34   Brugia pahangi
gb|EJW88125.1|  heat shock protein 90                                   140   4e-34   Wuchereria bancrofti [agent of lymphatic filariasis]
gb|KIP09595.1|  hypothetical protein PHLGIDRAFT_126182                  140   4e-34   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_001901767.1|  heat shock protein 90                              140   4e-34   Brugia malayi [agent of lymphatic filariasis]
gb|EYD92886.1|  hsp90 family protein                                    135   4e-34   Escherichia coli 1-176-05_S1_C1
ref|XP_008045254.1|  heat shock protein 90                              140   4e-34   Trametes versicolor FP-101664 SS1
ref|NP_001278186.1|  heat shock protein HSP 90-alpha 1-like             140   4e-34   Astyanax mexicanus [blind cave fish]
ref|XP_008651357.1|  PREDICTED: hypothetical protein isoform X1         140   5e-34   
gb|AAG22091.1|AF306643_1  90 kDa heat-shock protein                     131   5e-34   Scyliorhinus torazame
gb|ACO55133.1|  heat shock protein 90                                   140   5e-34   Litomosoides sigmodontis
gb|AGI19327.1|  heat shock protein 90                                   140   5e-34   Liriomyza trifolii [American serpentine leafminer]
gb|ACO57617.1|  heat shock protein 90                                   140   5e-34   Pteromalus puparum
gb|AAW49253.2|  heat shock protein 90                                   140   5e-34   Liriomyza sativae
ref|XP_004974995.1|  PREDICTED: heat shock protein 82-like              140   5e-34   Setaria italica
ref|XP_008311364.1|  PREDICTED: heat shock protein HSP 90-alpha 1       140   5e-34   Cynoglossus semilaevis [half-smooth tongue sole]
gb|AFD34191.2|  HSP90                                                   140   6e-34   Prorocentrum minimum
gb|EMD38391.1|  hypothetical protein CERSUDRAFT_153213                  140   6e-34   Gelatoporia subvermispora B
emb|CAU15484.1|  heat shock protein 90                                  140   6e-34   Meloidogyne artiellia
emb|CDQ59969.1|  unnamed protein product                                140   6e-34   Oncorhynchus mykiss
ref|XP_003424204.1|  PREDICTED: heat shock protein 83                   140   6e-34   Nasonia vitripennis
gb|ADM83426.1|  heat shock protein 90                                   140   7e-34   Panonychus citri [citrus fruit mite]
ref|XP_002008178.1|  GI13350                                            139   7e-34   Drosophila mojavensis
ref|XP_011310275.1|  PREDICTED: heat shock protein 83                   139   7e-34   Fopius arisanus
gb|EPS64640.1|  hypothetical protein M569_10141                         135   7e-34   Genlisea aurea
gb|AGT57168.1|  heat shock protein 90-alpha 4                           140   7e-34   Salmo salar
gb|AAB49983.1|  heat shock protein hsp90                                140   7e-34   Oncorhynchus tshawytscha [king salmon]
ref|XP_001984000.1|  GH16203                                            139   7e-34   Drosophila grimshawi
gb|AER28024.1|  heat shock protein 83S1                                 139   8e-34   Stratiomys singularior
emb|CBK22622.2|  unnamed protein product                                140   8e-34   Blastocystis hominis
gb|ACO55134.1|  heat shock protein 90                                   139   8e-34   Ascaris suum
ref|XP_002165028.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    139   8e-34   Hydra vulgaris
gb|AAN39696.1|  heat shock protein                                      131   8e-34   Choristoneura parallela
emb|CBK24402.2|  unnamed protein product                                140   8e-34   Blastocystis hominis
ref|XP_010681165.1|  PREDICTED: heat shock protein 90-1 isoform X2      140   9e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004514756.1|  PREDICTED: endoplasmin homolog                     140   9e-34   Cicer arietinum [garbanzo]
emb|CBK20696.2|  unnamed protein product                                140   9e-34   Blastocystis hominis
gb|EEE69897.1|  hypothetical protein OsJ_29732                          140   9e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001353471.1|  Hsp83                                              139   9e-34   Drosophila pseudoobscura pseudoobscura
gb|KIJ44391.1|  hypothetical protein M422DRAFT_228502                   139   9e-34   Sphaerobolus stellatus SS14
ref|XP_010681164.1|  PREDICTED: heat shock protein 90-1 isoform X1      140   9e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_005911315.1|  PREDICTED: heat shock protein HSP 90-alpha-like    131   1e-33   
ref|XP_007300418.1|  HSP90-domain-containing protein                    139   1e-33   Stereum hirsutum FP-91666 SS1
sp|Q90474.3|H90A1_DANRE  RecName: Full=Heat shock protein HSP 90-...    139   1e-33   Danio rerio [leopard danio]
ref|XP_009394558.1|  PREDICTED: heat shock protein 83-like              140   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010552350.1|  PREDICTED: heat shock protein 90-2                 139   1e-33   Tarenaya hassleriana [spider flower]
ref|XP_011171324.1|  PREDICTED: heat shock protein 83                   139   1e-33   Solenopsis invicta [imported red fire ant]
ref|XP_011154034.1|  PREDICTED: heat shock protein 83                   139   1e-33   
gb|ACM50884.1|  heat shock protein 90A                                  139   1e-33   
gb|EPY32689.1|  heat shock protein 83-1                                 134   1e-33   
emb|CCO26395.1|  Heat shock protein 81-2 Short=HSP81-2                  133   1e-33   
gb|KFD54842.1|  hypothetical protein M513_04276                         139   1e-33   
gb|ACF06184.1|  heat shock protein 90                                   137   1e-33   
gb|KJB30529.1|  hypothetical protein B456_005G148100                    139   1e-33   
gb|KJB30530.1|  hypothetical protein B456_005G148100                    139   1e-33   
gb|AAH75757.1|  Hsp90a.1 protein                                        139   1e-33   
ref|XP_001649752.1|  AAEL014843-PA                                      139   1e-33   
emb|CCM02389.1|  predicted protein                                      139   1e-33   
ref|XP_001415715.1|  Heat Shock Protein 90                              139   1e-33   
ref|XP_001655641.1|  AAEL011708-PA                                      139   1e-33   
gb|AGU42456.1|  heat shock protein 90                                   137   1e-33   
emb|CCA68353.1|  related to HSP80 heat shock protein 80                 139   1e-33   
ref|XP_004297188.1|  PREDICTED: heat shock protein 83                   139   1e-33   
gb|ADD10372.1|  heat shock protein 90                                   139   1e-33   
ref|XP_008811147.1|  PREDICTED: heat shock protein 81-1-like            139   1e-33   
ref|XP_002062325.1|  Hsp83                                              139   1e-33   
gb|KJB30528.1|  hypothetical protein B456_005G148100                    139   1e-33   
dbj|BAH71458.1|  ACYPI002010                                            133   1e-33   
gb|EKF32566.1|  heat shock protein 85, putative                         134   1e-33   
gb|AEF33377.1|  heat shock protein 90                                   130   1e-33   
gb|KHG10495.1|  Heat shock cognate 90 kDa                               139   1e-33   
ref|XP_002046978.1|  heat shock protein 83                              139   2e-33   
ref|XP_011060405.1|  PREDICTED: heat shock protein 83                   139   2e-33   
ref|XP_006484274.1|  PREDICTED: heat shock protein 83-like              139   2e-33   
ref|XP_006437833.1|  hypothetical protein CICLE_v10030743mg             139   2e-33   
gb|ACU00686.1|  heat shock protein 90                                   135   2e-33   
gb|KIY65668.1|  HSP90-domain-containing protein                         138   2e-33   
ref|XP_008807013.1|  PREDICTED: heat shock protein 83-like              139   2e-33   
ref|XP_005176932.1|  PREDICTED: heat shock protein 83                   138   2e-33   
gb|EKG06682.1|  heat shock protein 85, putative                         134   2e-33   
ref|NP_001153536.1|  heat shock protein 90                              138   2e-33   
gb|AFM73650.1|  heat shock protein 90                                   133   2e-33   
ref|XP_006619000.1|  PREDICTED: heat shock protein HSP 90-alpha-like    138   2e-33   
gb|KHN76289.1|  Heat shock protein HSP 90-alpha                         137   2e-33   
ref|XP_003396897.1|  PREDICTED: heat shock protein 83-like              138   2e-33   
emb|CAC29071.1|  heat shock protein 90                                  132   2e-33   
gb|AAB23704.1|  HSP90                                                   130   3e-33   
emb|CDY33122.1|  BnaC09g22180D                                          138   3e-33   
ref|XP_006363008.1|  PREDICTED: endoplasmin homolog                     139   3e-33   
ref|XP_009605137.1|  PREDICTED: heat shock protein 83                   138   3e-33   
ref|XP_008216018.1|  PREDICTED: heat shock protein 83-like              137   3e-33   
ref|XP_010257890.1|  PREDICTED: heat shock protein 81-1-like            138   3e-33   
ref|XP_010927989.1|  PREDICTED: heat shock protein 83-like isofor...    138   3e-33   
gb|ACE77780.1|  HSP90                                                   138   3e-33   
emb|CAI64494.1|  Hsp90 protein                                          138   3e-33   
ref|XP_006395659.1|  hypothetical protein EUTSA_v10003676mg             138   3e-33   
ref|XP_009114127.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    138   3e-33   
ref|XP_007399693.1|  hypothetical protein PHACADRAFT_127903             138   3e-33   
gb|ACD63052.1|  heat shock protein 90                                   138   3e-33   
gb|KDQ33187.1|  hypothetical protein PLEOSDRAFT_1052040                 137   3e-33   
ref|XP_008788962.1|  PREDICTED: heat shock protein 83-like              138   3e-33   
ref|XP_002117847.1|  hypothetical protein TRIADDRAFT_64388              137   3e-33   
gb|ESA08764.1|  hypothetical protein GLOINDRAFT_348967                  137   3e-33   
gb|EPQ17302.1|  Heat shock protein HSP 90-beta                          130   3e-33   
gb|AAN76524.1|AF384807_1  heat-shock protein 90                         137   3e-33   
gb|KIJ16896.1|  hypothetical protein PAXINDRAFT_162512                  137   3e-33   
gb|KJE05047.1|  hsp90-like protein                                      137   3e-33   
ref|XP_003197339.1|  cytoplasmic chaperone (Hsp90 family); Hsp82p       137   3e-33   
ref|XP_003578283.1|  PREDICTED: heat shock cognate 90 kDa protein...    138   3e-33   
ref|XP_010934628.1|  PREDICTED: heat shock protein 83-like              137   3e-33   
gb|KIK49294.1|  hypothetical protein CY34DRAFT_70017                    137   4e-33   
gb|KIR84754.1|  hsp90-like protein                                      137   4e-33   
ref|XP_001956817.1|  GF20110                                            137   4e-33   
gb|KIR45891.1|  hsp90-like protein                                      137   4e-33   
gb|KGB79019.1|  hsp90-like protein                                      137   4e-33   
dbj|BAD83620.1|  cytosolic-type hsp90                                   137   4e-33   
gb|AAY67995.1|  HSP 90                                                  135   4e-33   
ref|XP_002093517.1|  GE21339                                            137   4e-33   
ref|NP_523899.1|  heat shock protein 83, isoform A                      137   4e-33   
ref|XP_002035159.1|  Hsp83                                              137   4e-33   
ref|XP_001971711.1|  GG15112                                            137   4e-33   
ref|XP_008855466.1|  heat shock protein 90, putative                    137   4e-33   
gb|AAN76525.1|AF384808_1  heat-shock protein 90                         137   4e-33   
gb|ACO55135.1|  heat shock protein 90                                   137   4e-33   
ref|XP_653132.1|  heat shock protein 90                                 137   4e-33   
ref|XP_653162.1|  heat shock protein 90                                 137   4e-33   
gb|AER28022.1|  heat shock protein 83P1                                 137   4e-33   
gb|EMS50921.1|  Endoplasmin                                             137   4e-33   
gb|AFR98377.1|  hsp90-like protein                                      137   4e-33   
ref|XP_011389839.1|  putative heat shock protein 80                     134   5e-33   
ref|XP_010044352.1|  PREDICTED: heat shock protein 90-1                 138   5e-33   
ref|NP_571403.1|  heat shock protein HSP 90-alpha 1                     137   5e-33   
ref|NP_849932.1|  chloroplast heat shock protein 90                     137   5e-33   
gb|EEC84746.1|  hypothetical protein OsI_31743                          138   5e-33   
sp|O02192.1|HSP83_DROAV  RecName: Full=Heat shock protein 83; Alt...    137   5e-33   
ref|NP_178487.1|  chloroplast heat shock protein 90                     137   5e-33   
gb|AAM19795.1|  At2g04030/F3C11.14                                      137   5e-33   
dbj|BAK00031.1|  predicted protein                                      137   5e-33   
ref|XP_001735351.1|  heat shock protein 81-1                            137   5e-33   
gb|KDP25390.1|  hypothetical protein JCGZ_20546                         137   6e-33   
gb|AAD52684.1|AF179480_1  90kDa heat-shock protein                      128   6e-33   
ref|XP_004149483.1|  PREDICTED: heat shock protein 83-like              137   6e-33   
ref|XP_002531697.1|  heat shock protein, putative                       137   6e-33   
gb|KGN49798.1|  hypothetical protein Csa_5G135340                       137   6e-33   
gb|EPY40503.1|  heat shock protein 83-1                                 132   6e-33   
gb|ABH04243.1|  heat shock protein 90 kDa                               137   6e-33   
ref|XP_011495774.1|  PREDICTED: heat shock protein 83                   137   6e-33   
gb|AAH49951.1|  Hsp90ab1 protein                                        134   6e-33   
gb|AFK31312.1|  heat shock protein 90                                   137   7e-33   
ref|XP_011396896.1|  Heat shock protein 83-1                            137   7e-33   
dbj|BAE87688.1|  unnamed protein product                                134   7e-33   
gb|EGT39214.1|  CBN-DAF-21 protein                                      137   7e-33   
gb|KIK94310.1|  hypothetical protein PAXRUDRAFT_143168                  137   7e-33   
emb|CDP00492.1|  unnamed protein product                                137   7e-33   
gb|AAO14563.2|AF461150_1  Hsp90                                         137   7e-33   
dbj|BAB15121.1|  unnamed protein product                                134   7e-33   
gb|EEE68898.1|  hypothetical protein OsJ_27736                          137   7e-33   
dbj|BAF83423.1|  unnamed protein product                                134   7e-33   
ref|XP_001713499.1|  heat shock protein 82                              136   7e-33   
ref|XP_003102316.1|  CRE-DAF-21 protein                                 137   7e-33   
ref|XP_002637777.1|  C. briggsae CBR-DAF-21 protein                     137   7e-33   
emb|CBJ23502.1|  heat shock protein 90                                  131   8e-33   
ref|NP_001062103.1|  Os08g0487800                                       137   8e-33   
gb|KIM49477.1|  hypothetical protein M413DRAFT_109153                   136   8e-33   
gb|ERG82208.1|  heat shock protein hsp 90-alpha                         137   8e-33   
ref|XP_010091648.1|  Endoplasmin-like protein                           137   8e-33   
ref|XP_003704636.1|  PREDICTED: heat shock protein 83-like              137   9e-33   
gb|AAH44888.1|  Hsp90ab1 protein                                        134   9e-33   
gb|KIH66348.1|  Hsp90 protein                                           137   9e-33   
ref|XP_009861771.1|  PREDICTED: endoplasmin-like                        137   9e-33   
ref|XP_007071733.1|  PREDICTED: heat shock protein HSP 90-beta is...    136   9e-33   
ref|XP_011250812.1|  PREDICTED: heat shock protein 83                   136   9e-33   
gb|ADZ13510.1|  HSP90-1                                                 136   1e-32   
dbj|BAE48212.1|  heat shock protein 90 beta                             132   1e-32   
dbj|BAE87589.1|  unnamed protein product                                136   1e-32   
ref|XP_006664928.1|  PREDICTED: heat shock protein 82-like              136   1e-32   
ref|XP_568451.1|  chaperone                                             136   1e-32   
ref|XP_010671625.1|  PREDICTED: heat shock protein 83                   136   1e-32   
gb|KFG42944.1|  heat shock protein HSP90                                131   1e-32   
ref|XP_008310403.1|  PREDICTED: endoplasmin                             137   1e-32   
ref|XP_005296381.1|  PREDICTED: heat shock protein HSP 90-beta          136   1e-32   
ref|XP_007071731.1|  PREDICTED: heat shock protein HSP 90-beta is...    136   1e-32   
gb|AFA25805.1|  heat shock protein 90 alpha                             134   1e-32   
ref|XP_007071732.1|  PREDICTED: heat shock protein HSP 90-beta is...    136   1e-32   
ref|XP_003971591.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    136   1e-32   
gb|KIM62086.1|  hypothetical protein SCLCIDRAFT_120509                  136   1e-32   
ref|XP_003135662.1|  heat shock protein 90                              136   1e-32   
gb|AAM93928.1|  heat-shock protein 90                                   129   1e-32   
ref|XP_006126585.1|  PREDICTED: heat shock protein HSP 90-beta          135   1e-32   
gb|AEB61093.1|  endoplasmin-like protein                                131   1e-32   
ref|XP_008549803.1|  PREDICTED: heat shock protein 83-like              136   1e-32   
gb|EMS66149.1|  Heat shock protein 83                                   135   1e-32   
ref|XP_007002143.1|  heat-shock protein 90                              136   1e-32   
gb|ETN77129.1|  Hsp90 protein                                           136   1e-32   
gb|KIM27867.1|  hypothetical protein M408DRAFT_70506                    136   1e-32   
ref|XP_002514573.1|  heat shock protein, putative                       135   1e-32   
ref|XP_004542148.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    136   1e-32   
emb|CBI27411.3|  unnamed protein product                                136   1e-32   
ref|XP_002267463.2|  PREDICTED: heat shock protein 90-1                 136   1e-32   
gb|EMT27103.1|  Heat shock protein 83                                   135   1e-32   
ref|XP_002947115.1|  hypothetical protein VOLCADRAFT_73112              136   1e-32   
ref|XP_006632301.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    136   2e-32   
ref|XP_008797179.1|  PREDICTED: heat shock protein 83-like              135   2e-32   
gb|AEJ88466.1|  heat shock protein 90                                   135   2e-32   
gb|ADF31778.1|  heat shock protein 90                                   135   2e-32   
gb|AIC33004.1|  heat-shock protein 90                                   135   2e-32   
ref|XP_006632299.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    136   2e-32   
emb|CBY17856.1|  unnamed protein product                                129   2e-32   
ref|XP_006458532.1|  hypothetical protein AGABI2DRAFT_190809            135   2e-32   
ref|XP_006632300.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    135   2e-32   
ref|XP_001861928.1|  heat shock protein 83                              135   2e-32   
gb|ABO93609.1|  heat shock protein 90                                   132   2e-32   
gb|ADF31772.1|  heat shock protein 90                                   135   2e-32   
gb|AIU47031.1|  heat shock protein                                      135   2e-32   
ref|XP_001865484.1|  heat shock protein 83                              135   2e-32   
gb|ADF31756.1|  heat shock protein 90                                   135   2e-32   
gb|ADF31775.1|  heat shock protein 90                                   135   2e-32   
ref|XP_001702984.1|  heat shock protein 90C                             136   2e-32   
ref|XP_001861926.1|  heat shock protein 83                              135   2e-32   
gb|ADF31754.1|  heat shock protein 90                                   135   2e-32   
gb|ESL09761.1|  heat shock protein 85                                   132   2e-32   
gb|EGW01344.1|  Heat shock protein HSP 90-beta                          133   2e-32   
gb|EYC44140.1|  hypothetical protein Y032_0471g2056                     136   2e-32   
gb|AAD30456.1|AF123259_1  heat shock protein 90                         133   2e-32   
gb|EYC44141.1|  hypothetical protein Y032_0471g2056                     135   2e-32   
ref|XP_003881046.1|  hsp90, related                                     135   2e-32   
gb|ACZ13352.1|  HSP90 protein                                           133   2e-32   
gb|ADF31779.1|  heat shock protein 90                                   135   3e-32   
gb|ADF31755.1|  heat shock protein 90                                   135   3e-32   
ref|XP_006149126.1|  PREDICTED: heat shock protein HSP 90-beta          135   3e-32   
ref|XP_002063871.1|  GK15907                                            135   3e-32   
gb|EKG00457.1|  heat shock protein 85, putative                         133   3e-32   
emb|CAA34748.1|  heat shock-like protein                                130   3e-32   
ref|NP_506626.1|  Protein DAF-21                                        135   3e-32   
ref|XP_004516872.1|  PREDICTED: heat shock protein 83-like              135   3e-32   
ref|XP_007338676.1|  heat shock protein 90                              135   3e-32   
gb|KJA27509.1|  hypothetical protein HYPSUDRAFT_157797                  135   3e-32   
ref|XP_001445076.1|  hypothetical protein                               131   3e-32   
ref|XP_005643869.1|  heat shock protein Hsp90                           135   3e-32   
gb|ACR57215.1|  Hsp90                                                   135   3e-32   
ref|XP_007263998.1|  HSP90-domain-containing protein                    135   4e-32   
ref|XP_002613491.1|  hypothetical protein BRAFLDRAFT_119839             135   4e-32   
dbj|BAJ85535.1|  predicted protein                                      135   4e-32   
gb|AAO46141.1|  heat shock protein 90                                   128   4e-32   
ref|XP_814893.1|  heat shock protein 85                                 133   4e-32   
ref|NP_001126444.1|  heat shock protein HSP 90-beta                     135   4e-32   
gb|AGY56110.1|  heat shock protein 90                                   134   4e-32   
ref|XP_007321864.1|  hypothetical protein SERLADRAFT_397816             134   5e-32   
gb|AFZ62631.1|  HSP90-1                                                 134   5e-32   
emb|CDS03201.1|  Putative Heat shock protein 90-1                       134   5e-32   
ref|XP_008439282.1|  PREDICTED: heat shock protein 83                   134   5e-32   
gb|AHE77376.1|  heat shock protein 90                                   134   5e-32   
gb|ACR57216.1|  Hsp90                                                   134   5e-32   
ref|XP_004083818.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    134   5e-32   
ref|XP_007843733.1|  heat shock protein 90                              134   5e-32   
dbj|BAK08743.1|  heat shock protein 90                                  134   5e-32   
gb|AEF38377.1|  HSP83                                                   134   5e-32   
ref|XP_003533977.1|  PREDICTED: heat shock protein 83-like              134   6e-32   
ref|XP_005900148.1|  PREDICTED: heat shock protein HSP 90-beta is...    134   6e-32   
ref|XP_001878264.1|  predicted protein                                  134   6e-32   
gb|EMD43140.1|  Heat shock family 85 kDa protein                        133   6e-32   
gb|ADJ00017.1|  heat shock protein 90                                   132   6e-32   
gb|AHW57925.1|  heat shock protein 90                                   134   6e-32   
ref|XP_009381110.1|  PREDICTED: heat shock protein 83                   134   6e-32   
emb|CAR63686.1|  putative abnormal DAuer Formation family member        132   6e-32   
gb|KHN09298.1|  Heat shock protein 83                                   134   7e-32   
gb|AEY83982.1|  heat shock protein 80 KDa                               127   7e-32   
gb|ERE80665.1|  heat shock protein HSP 90-alpha                         128   7e-32   



>ref|XP_009791518.1| PREDICTED: endoplasmin homolog [Nicotiana sylvestris]
Length=811

 Score =   289 bits (739),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 152/157 (97%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSKAKELKESFK+LTKWWKGALASDNVD+VKISNRLADTPCVVVTSK
Sbjct  621  FQNVSKEGLKLGKDSKAKELKESFKELTKWWKGALASDNVDDVKISNRLADTPCVVVTSK  680

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDES K+TA
Sbjct  681  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESVKQTA  740

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL+ESGF + DPKDFASRIY+SVKSSLN+SP
Sbjct  741  QLMYQTALLESGFLLNDPKDFASRIYSSVKSSLNVSP  777



>dbj|BAL42332.1| Heat shock protein 90 [Nicotiana tabacum]
Length=811

 Score =   289 bits (739),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 152/157 (97%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSKAKELKESFK+LTKWWKGALASDNVD+VKISNRLADTPCVVVTSK
Sbjct  621  FQNVSKEGLKLGKDSKAKELKESFKELTKWWKGALASDNVDDVKISNRLADTPCVVVTSK  680

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDES K+TA
Sbjct  681  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESVKQTA  740

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL+ESGF + DPKDFASRIY+SVKSSLN+SP
Sbjct  741  QLMYQTALLESGFLLNDPKDFASRIYSSVKSSLNVSP  777



>gb|KJB63505.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=500

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = -2

Query  784  FQDVSKEXLKIKDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKY  605
            FQ+VSKE LKI   K KELKESFK+LTKWWK ALASDNVDEVKISNRL +TPCVVVTSKY
Sbjct  317  FQNVSKEGLKIGKEKNKELKESFKELTKWWKNALASDNVDEVKISNRLDNTPCVVVTSKY  376

Query  604  GWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQ  425
            GWSANMERIMQSQTLSD+SKQAYMRGKR+LEINPRHPIIKELRERV KD EDE  K+TAQ
Sbjct  377  GWSANMERIMQSQTLSDSSKQAYMRGKRILEINPRHPIIKELRERVAKDSEDEGVKQTAQ  436

Query  424  LIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            LIY+TALMESGFN+P+PKDFASRIY+SVKSSLNISP
Sbjct  437  LIYQTALMESGFNLPEPKDFASRIYSSVKSSLNISP  472



>ref|XP_007017830.1| Chaperone protein htpG family protein isoform 3, partial [Theobroma 
cacao]
 gb|EOY15055.1| Chaperone protein htpG family protein isoform 3, partial [Theobroma 
cacao]
Length=712

 Score =   286 bits (731),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LKI KDSK KELKESFK+LTKWWKGAL S+NVD+VKI+NRL +TPCVVVTSK
Sbjct  542  FQNVSKEGLKIGKDSKNKELKESFKELTKWWKGALTSENVDDVKITNRLDNTPCVVVTSK  601

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDE  K+TA
Sbjct  602  FGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDEGVKQTA  661

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QLIY+TALMESGF++PDPKDFASRIY+SVKSSLNISP
Sbjct  662  QLIYQTALMESGFSLPDPKDFASRIYSSVKSSLNISP  698



>gb|KHG15193.1| Endoplasmin [Gossypium arboreum]
Length=718

 Score =   285 bits (730),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = -2

Query  784  FQDVSKEXLKIKDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKY  605
            FQ+VSKE LKI + K KELKESFK+LTKWWK ALASDNVDEVKISNRL +TPCVVVTSKY
Sbjct  535  FQNVSKEGLKIGNEKNKELKESFKELTKWWKNALASDNVDEVKISNRLDNTPCVVVTSKY  594

Query  604  GWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQ  425
            GWSANMERIMQSQTLSD+SKQAYMRGKR+LEINPRHPIIKELRERVVKD EDE  K+TAQ
Sbjct  595  GWSANMERIMQSQTLSDSSKQAYMRGKRILEINPRHPIIKELRERVVKDSEDEGVKQTAQ  654

Query  424  LIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            LIY+TALMESGFN+PDPKDFASRIY+SVKSSLNISP
Sbjct  655  LIYQTALMESGFNLPDPKDFASRIYSSVKSSLNISP  690



>gb|AAB63606.1| HSP90 isolog [Arabidopsis thaliana]
Length=335

 Score =   274 bits (701),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 147/157 (94%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKE+FK+LTKWWKG LAS+NVD+VKISNRLADTPCVVVTSK
Sbjct  130  FQNVSKEGLKVGKDSKDKELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSK  189

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++R+  DPEDES KETA
Sbjct  190  FGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKETA  249

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL+ESGF + DPKDFA+RIYNSVKS LNISP
Sbjct  250  QLMYQTALIESGFILTDPKDFAARIYNSVKSGLNISP  286



>gb|AAF64453.1|AF239931_1 putative heat-shock protein 90 [Euphorbia esula]
Length=317

 Score =   273 bits (699),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 147/157 (94%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ K SK KELKESFK+LTKWWKG+LAS+NVD+VKISNRL +TPCVVVTSK
Sbjct  121  FQNVSKEGLKLGKGSKDKELKESFKELTKWWKGSLASENVDDVKISNRLDNTPCVVVTSK  180

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWS+NMERIMQ+QTLSDA KQAYM+GKRVLEINPRHPIIKELRERVVKDPEDE+ K+TA
Sbjct  181  YGWSSNMERIMQAQTLSDAKKQAYMKGKRVLEINPRHPIIKELRERVVKDPEDENVKQTA  240

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
             LIY+TALMESGF + DPKDFASRIY+SVKSSLNISP
Sbjct  241  HLIYQTALMESGFMLSDPKDFASRIYSSVKSSLNISP  277



>gb|KJB63503.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
 gb|KJB63504.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=540

 Score =   280 bits (716),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = -2

Query  784  FQDVSKEXLKIKDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKY  605
            FQ+VSKE LKI   K KELKESFK+LTKWWK ALASDNVDEVKISNRL +TPCVVVTSKY
Sbjct  357  FQNVSKEGLKIGKEKNKELKESFKELTKWWKNALASDNVDEVKISNRLDNTPCVVVTSKY  416

Query  604  GWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQ  425
            GWSANMERIMQSQTLSD+SKQAYMRGKR+LEINPRHPIIKELRERV KD EDE  K+TAQ
Sbjct  417  GWSANMERIMQSQTLSDSSKQAYMRGKRILEINPRHPIIKELRERVAKDSEDEGVKQTAQ  476

Query  424  LIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            LIY+TALMESGFN+P+PKDFASRIY+SVKSSLNISP
Sbjct  477  LIYQTALMESGFNLPEPKDFASRIYSSVKSSLNISP  512



>ref|XP_009606988.1| PREDICTED: endoplasmin homolog [Nicotiana tomentosiformis]
Length=812

 Score =   285 bits (730),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 152/157 (97%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSKAKELKESFK+LTKWWKGALASDNVD+VKISNRLADTPCVVVTSK
Sbjct  622  FQNVSKEGLKLGKDSKAKELKESFKELTKWWKGALASDNVDDVKISNRLADTPCVVVTSK  681

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKELR+RV+KDPEDES K+TA
Sbjct  682  YGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELRDRVIKDPEDESVKQTA  741

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL+ESGF + DPKDFASRIY+SVKSSLN+SP
Sbjct  742  QLMYQTALLESGFLLNDPKDFASRIYSSVKSSLNVSP  778



>dbj|BAL42333.1| Heat shock protein 90 [Nicotiana tabacum]
Length=812

 Score =   285 bits (730),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 152/157 (97%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSKAKELKESFK+LTKWWKGALASDNVD+VKISNRLADTPCVVVTSK
Sbjct  622  FQNVSKEGLKLGKDSKAKELKESFKELTKWWKGALASDNVDDVKISNRLADTPCVVVTSK  681

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKELR+RV+KDPEDES K+TA
Sbjct  682  YGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELRDRVIKDPEDESVKQTA  741

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL+ESGF + DPKDFASRIY+SVKSSLN+SP
Sbjct  742  QLMYQTALLESGFLLNDPKDFASRIYSSVKSSLNVSP  778



>ref|XP_007017829.1| Chaperone protein htpG family protein isoform 2 [Theobroma cacao]
 gb|EOY15054.1| Chaperone protein htpG family protein isoform 2 [Theobroma cacao]
Length=824

 Score =   284 bits (727),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LKI KDSK KELKESFK+LTKWWKGAL S+NVD+VKI+NRL +TPCVVVTSK
Sbjct  621  FQNVSKEGLKIGKDSKNKELKESFKELTKWWKGALTSENVDDVKITNRLDNTPCVVVTSK  680

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDE  K+TA
Sbjct  681  FGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDEGVKQTA  740

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QLIY+TALMESGF++PDPKDFASRIY+SVKSSLNISP
Sbjct  741  QLIYQTALMESGFSLPDPKDFASRIYSSVKSSLNISP  777



>ref|XP_007017828.1| Chaperone protein htpG family protein isoform 1 [Theobroma cacao]
 gb|EOY15053.1| Chaperone protein htpG family protein isoform 1 [Theobroma cacao]
Length=840

 Score =   285 bits (728),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LKI KDSK KELKESFK+LTKWWKGAL S+NVD+VKI+NRL +TPCVVVTSK
Sbjct  637  FQNVSKEGLKIGKDSKNKELKESFKELTKWWKGALTSENVDDVKITNRLDNTPCVVVTSK  696

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDE  K+TA
Sbjct  697  FGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDEGVKQTA  756

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QLIY+TALMESGF++PDPKDFASRIY+SVKSSLNISP
Sbjct  757  QLIYQTALMESGFSLPDPKDFASRIYSSVKSSLNISP  793



>ref|XP_007225662.1| hypothetical protein PRUPE_ppa001487mg [Prunus persica]
 gb|EMJ26861.1| hypothetical protein PRUPE_ppa001487mg [Prunus persica]
Length=815

 Score =   284 bits (727),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 151/157 (96%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KE+KES+K+LTKWWK ALASDNVD+VK+SNRLADTPCVVVTSK
Sbjct  622  FQNVSKEGLKLGKDSKDKEVKESYKELTKWWKSALASDNVDDVKLSNRLADTPCVVVTSK  681

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDASKQAYMRGKR+LEINPRHPIIKELRERVVK+ EDES K+TA
Sbjct  682  YGWSANMERIMQSQTLSDASKQAYMRGKRILEINPRHPIIKELRERVVKNAEDESVKQTA  741

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QLIY+TALMESGFN+PDPKDFASRIY+SVKSSLNI+P
Sbjct  742  QLIYQTALMESGFNLPDPKDFASRIYSSVKSSLNINP  778



>ref|XP_008221245.1| PREDICTED: endoplasmin homolog [Prunus mume]
Length=815

 Score =   284 bits (726),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 151/157 (96%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KE+KES+K+LTKWWK ALASDNVD+VK+SNRLADTPCVVVTSK
Sbjct  622  FQNVSKEGLKLGKDSKDKEVKESYKELTKWWKSALASDNVDDVKLSNRLADTPCVVVTSK  681

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDASKQAYMRGKR+LEINPRHPIIKELRERVVK+ EDES K+TA
Sbjct  682  YGWSANMERIMQSQTLSDASKQAYMRGKRILEINPRHPIIKELRERVVKNAEDESVKQTA  741

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QLIY+TALMESGFN+PDPKDFASRIY+SVKSSLNI+P
Sbjct  742  QLIYQTALMESGFNLPDPKDFASRIYSSVKSSLNINP  778



>ref|XP_009791520.1| PREDICTED: endoplasmin homolog [Nicotiana sylvestris]
Length=811

 Score =   284 bits (726),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 151/157 (96%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSKAKELKESFK+LTKWWKGALASDN+D+VKISNRLADTPCVVVTSK
Sbjct  621  FQNVSKEGLKLGKDSKAKELKESFKELTKWWKGALASDNIDDVKISNRLADTPCVVVTSK  680

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR+RV KDPEDES ++TA
Sbjct  681  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRDRVAKDPEDESVEQTA  740

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL+ESGF + DPKDFASRIY+SVKSSLN+SP
Sbjct  741  QLMYQTALLESGFLLNDPKDFASRIYSSVKSSLNVSP  777



>ref|XP_004291352.1| PREDICTED: endoplasmin homolog [Fragaria vesca subsp. vesca]
Length=815

 Score =   283 bits (723),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 175/198 (88%), Gaps = 3/198 (2%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKES+K+LTKWWKGALASDNVD+VK+SNRLADTPCVVVTSK
Sbjct  618  FQNVSKEGLKLGKDSKDKELKESYKELTKWWKGALASDNVDDVKLSNRLADTPCVVVTSK  677

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANME+IMQSQTLSD++KQAYMRGKRVLEINPRHPIIKELRERVVK+PEDES K TA
Sbjct  678  FGWSANMEKIMQSQTLSDSAKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDESVKHTA  737

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISPdavveeddeve--eeaetsskea  254
            QLIY+TALMESGF +PDPKDFASRIY+SVKSSLNI+PDA VEE+D+ E   EAE  +   
Sbjct  738  QLIYQTALMESGFVLPDPKDFASRIYSSVKSSLNINPDATVEEEDDTEDPAEAEAETPAN  797

Query  253  eSNPENAEDGADGIKDEL  200
            E+ PE     AD +KDEL
Sbjct  798  EATPEAEAANADSLKDEL  815



>ref|XP_010109992.1| Endoplasmin-like protein [Morus notabilis]
 gb|EXC25010.1| Endoplasmin-like protein [Morus notabilis]
Length=1004

 Score =   285 bits (730),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 150/157 (96%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSKAKELKESFKDLTKWWK ALASDNVD+VK+SNRL DTPCVVVTSK
Sbjct  617  FQNVSKEGLKLGKDSKAKELKESFKDLTKWWKSALASDNVDDVKVSNRLDDTPCVVVTSK  676

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDES K+T+
Sbjct  677  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESVKQTS  736

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QLIY+TALMESGF + DPKDFA+RIY+SVKSSLNI+P
Sbjct  737  QLIYQTALMESGFMLTDPKDFANRIYSSVKSSLNINP  773



>gb|ABK92622.1| unknown [Populus trichocarpa]
Length=214

 Score =   265 bits (677),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 140/146 (96%), Gaps = 1/146 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSKAKELKESFK+LTKWWKGALAS+NVD+VKISNRLADTPC+VVTSK
Sbjct  12   FQNVSKEGLKLGKDSKAKELKESFKELTKWWKGALASENVDDVKISNRLADTPCIVVTSK  71

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQ+QTLSDA+KQAYMRGKRVLEINPRHPIIKELRERVVKDPED+S K+TA
Sbjct  72   YGWSANMERIMQAQTLSDANKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDDSVKQTA  131

Query  427  QLIYKTALMESGFNVPDPKDFASRIY  350
             L+Y+TALMESGF + DPKDFASRIY
Sbjct  132  HLMYQTALMESGFILNDPKDFASRIY  157



>ref|XP_009334927.1| PREDICTED: endoplasmin homolog [Pyrus x bretschneideri]
Length=818

 Score =   282 bits (721),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 136/157 (87%), Positives = 150/157 (96%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKES+K+LTKWWK ALASDNVD+VK+SNRLADTPCVVVTSK
Sbjct  621  FQNVSKEGLKLGKDSKDKELKESYKELTKWWKSALASDNVDDVKLSNRLADTPCVVVTSK  680

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDA+KQ YMRGKR+LEINPRHPIIKELRERVVK+ EDES K+TA
Sbjct  681  YGWSANMERIMQSQTLSDANKQGYMRGKRILEINPRHPIIKELRERVVKNAEDESVKKTA  740

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QLIY+TALMESGFN+PDPKDFASRIY+SVKSSLNI+P
Sbjct  741  QLIYQTALMESGFNLPDPKDFASRIYSSVKSSLNINP  777



>gb|KJB63502.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=781

 Score =   281 bits (718),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = -2

Query  784  FQDVSKEXLKIKDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKY  605
            FQ+VSKE LKI   K KELKESFK+LTKWWK ALASDNVDEVKISNRL +TPCVVVTSKY
Sbjct  598  FQNVSKEGLKIGKEKNKELKESFKELTKWWKNALASDNVDEVKISNRLDNTPCVVVTSKY  657

Query  604  GWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQ  425
            GWSANMERIMQSQTLSD+SKQAYMRGKR+LEINPRHPIIKELRERV KD EDE  K+TAQ
Sbjct  658  GWSANMERIMQSQTLSDSSKQAYMRGKRILEINPRHPIIKELRERVAKDSEDEGVKQTAQ  717

Query  424  LIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            LIY+TALMESGFN+P+PKDFASRIY+SVKSSLNISP
Sbjct  718  LIYQTALMESGFNLPEPKDFASRIYSSVKSSLNISP  753



>ref|XP_008387928.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmin homolog [Malus domestica]
Length=818

 Score =   281 bits (720),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 150/157 (96%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKES+K+LTKWWK ALASDNVD+VK+SNRLADTPCVVVTSK
Sbjct  621  FQNVSKEGLKLGKDSKDKELKESYKELTKWWKSALASDNVDDVKLSNRLADTPCVVVTSK  680

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDA+KQ YMRGKR+LEINPRHPI+KELRERVVK+ EDES K+TA
Sbjct  681  YGWSANMERIMQSQTLSDANKQGYMRGKRILEINPRHPIVKELRERVVKNAEDESVKKTA  740

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QLIY+TALMESGFN+PDPKDFASRIY+SVKSSLNI+P
Sbjct  741  QLIYQTALMESGFNLPDPKDFASRIYSSVKSSLNINP  777



>ref|XP_002510550.1| endoplasmin, putative [Ricinus communis]
 gb|EEF52737.1| endoplasmin, putative [Ricinus communis]
Length=816

 Score =   281 bits (720),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 149/157 (95%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKESFK+LTKWWKGALAS+NVD+VKISNRL +TPCVVVTSK
Sbjct  620  FQNVSKEGLKLGKDSKDKELKESFKELTKWWKGALASENVDDVKISNRLDNTPCVVVTSK  679

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIM SQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPED+S KETA
Sbjct  680  YGWSANMERIMSSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDDSVKETA  739

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QLIY+TALMESGF + DPKDFASRIYNSVKSSL+ISP
Sbjct  740  QLIYQTALMESGFMLNDPKDFASRIYNSVKSSLDISP  776



>gb|KDO84885.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=679

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 149/157 (95%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KD+K KELKESFK+LTKWWKGALAS+NVD+VK+SNRL +TPCVVVTSK
Sbjct  484  FQNVSKEGLKLGKDTKDKELKESFKELTKWWKGALASENVDDVKVSNRLDNTPCVVVTSK  543

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPED   ++TA
Sbjct  544  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDAGVQQTA  603

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QLIY+TALMESGF++ DPKDFASRIY++VKSSLNISP
Sbjct  604  QLIYQTALMESGFSLNDPKDFASRIYSTVKSSLNISP  640



>gb|KJB63501.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=823

 Score =   280 bits (717),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = -2

Query  784  FQDVSKEXLKIKDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKY  605
            FQ+VSKE LKI   K KELKESFK+LTKWWK ALASDNVDEVKISNRL +TPCVVVTSKY
Sbjct  640  FQNVSKEGLKIGKEKNKELKESFKELTKWWKNALASDNVDEVKISNRLDNTPCVVVTSKY  699

Query  604  GWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQ  425
            GWSANMERIMQSQTLSD+SKQAYMRGKR+LEINPRHPIIKELRERV KD EDE  K+TAQ
Sbjct  700  GWSANMERIMQSQTLSDSSKQAYMRGKRILEINPRHPIIKELRERVAKDSEDEGVKQTAQ  759

Query  424  LIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            LIY+TALMESGFN+P+PKDFASRIY+SVKSSLNISP
Sbjct  760  LIYQTALMESGFNLPEPKDFASRIYSSVKSSLNISP  795



>ref|XP_008377135.1| PREDICTED: endoplasmin homolog [Malus domestica]
Length=818

 Score =   280 bits (717),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/157 (87%), Positives = 149/157 (95%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKES+K+LTKWWK ALASDNVD+VK+SNRLADTPCVVVTSK
Sbjct  621  FQNVSKEGLKLGKDSKDKELKESYKELTKWWKSALASDNVDDVKLSNRLADTPCVVVTSK  680

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDA+KQ YMRGKR+LEINPRHPIIKELRERVVK+ EDES K TA
Sbjct  681  YGWSANMERIMQSQTLSDANKQGYMRGKRILEINPRHPIIKELRERVVKNAEDESVKLTA  740

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QLIY+TALMESGFN+PDPKDFASRIY+SVKSSLNI+P
Sbjct  741  QLIYQTALMESGFNLPDPKDFASRIYSSVKSSLNINP  777



>emb|CDP07384.1| unnamed protein product [Coffea canephora]
Length=815

 Score =   279 bits (714),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 148/157 (94%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LKI KDSK KELKESFKDLTKWWKG LAS+NVD+VKISNRLA+TPCVVVTSK
Sbjct  620  FQNVSKEGLKIGKDSKDKELKESFKDLTKWWKGTLASENVDDVKISNRLANTPCVVVTSK  679

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSD+SKQAYMRGKRVLEINPRHPIIKELRERVVKDPE ES K+TA
Sbjct  680  YGWSANMERIMQSQTLSDSSKQAYMRGKRVLEINPRHPIIKELRERVVKDPEGESVKQTA  739

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
             L+Y+TALMESGF + DPKDFASRIY+SVKSSL+ISP
Sbjct  740  HLMYQTALMESGFMLNDPKDFASRIYDSVKSSLHISP  776



>gb|KDO84884.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=818

 Score =   278 bits (710),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 149/157 (95%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KD+K KELKESFK+LTKWWKGALAS+NVD+VK+SNRL +TPCVVVTSK
Sbjct  623  FQNVSKEGLKLGKDTKDKELKESFKELTKWWKGALASENVDDVKVSNRLDNTPCVVVTSK  682

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPED   ++TA
Sbjct  683  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDAGVQQTA  742

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QLIY+TALMESGF++ DPKDFASRIY++VKSSLNISP
Sbjct  743  QLIYQTALMESGFSLNDPKDFASRIYSTVKSSLNISP  779



>ref|XP_006435195.1| hypothetical protein CICLE_v10000296mg [Citrus clementina]
 gb|ESR48435.1| hypothetical protein CICLE_v10000296mg [Citrus clementina]
Length=820

 Score =   278 bits (710),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 149/157 (95%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KD+K KELKESFK+LTKWWKGALAS+NVD+VK+SNRL +TPCVVVTSK
Sbjct  625  FQNVSKEGLKLGKDTKDKELKESFKELTKWWKGALASENVDDVKVSNRLDNTPCVVVTSK  684

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPED   ++TA
Sbjct  685  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDAGVQQTA  744

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QLIY+TALMESGF++ DPKDFASRIY++VKSSLNISP
Sbjct  745  QLIYQTALMESGFSLNDPKDFASRIYSTVKSSLNISP  781



>ref|XP_006473673.1| PREDICTED: endoplasmin homolog [Citrus sinensis]
Length=822

 Score =   278 bits (710),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 149/157 (95%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KD+K KELKESFK+LTKWWKGALAS+NVD+VK+SNRL +TPCVVVTSK
Sbjct  627  FQNVSKEGLKLGKDTKDKELKESFKELTKWWKGALASENVDDVKVSNRLDNTPCVVVTSK  686

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPED   ++TA
Sbjct  687  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDAGVQQTA  746

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QLIY+TALMESGF++ DPKDFASRIY++VKSSLNISP
Sbjct  747  QLIYQTALMESGFSLNDPKDFASRIYSTVKSSLNISP  783



>gb|KDP36908.1| hypothetical protein JCGZ_08199 [Jatropha curcas]
Length=821

 Score =   277 bits (708),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 148/157 (94%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKESFK+LTKWWKGALAS+NVD+VK+SNRL +TPCVVVTSK
Sbjct  621  FQNVSKEGLKLGKDSKDKELKESFKELTKWWKGALASENVDDVKVSNRLDNTPCVVVTSK  680

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTL+DA+KQAYMRGKRVLEINPRHPIIKELRERVVKDPED S K+TA
Sbjct  681  YGWSANMERIMQSQTLTDANKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDASVKQTA  740

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
             LIY+TALMESGF + DPKDFASRIY+SVKSSLNISP
Sbjct  741  HLIYQTALMESGFMLSDPKDFASRIYSSVKSSLNISP  777



>ref|XP_010433803.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   276 bits (707),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 148/157 (94%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSKAKELKE+FK+LTKWWKG LAS+NVD+VKISNRLADTPCVVVTSK
Sbjct  618  FQNVSKEGLKVGKDSKAKELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSK  677

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++RV  DPEDES KETA
Sbjct  678  FGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRVASDPEDESVKETA  737

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL+ESGF + DPKDFA+RIYNSVKS LNISP
Sbjct  738  QLMYQTALIESGFILNDPKDFAARIYNSVKSGLNISP  774



>ref|XP_010439073.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   276 bits (705),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 149/157 (95%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSKAKELKE+FK+LTKWWKG LAS+NVD+VKISNRLADTPCVVVTSK
Sbjct  618  FQNVSKEGLKVGKDSKAKELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSK  677

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++RV  DPEDES KETA
Sbjct  678  FGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRVASDPEDESVKETA  737

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL+ESGF + DPKDFA+RIYNSVKSSL+ISP
Sbjct  738  QLMYQTALIESGFILNDPKDFAARIYNSVKSSLSISP  774



>ref|XP_010448597.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   275 bits (704),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 149/157 (95%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSKAKELKE+FK+LTKWWKG LAS+NVD+VKISNRLADTPCVVVTSK
Sbjct  618  FQNVSKEGLKVGKDSKAKELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSK  677

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++RV  DPEDES KETA
Sbjct  678  FGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRVASDPEDESVKETA  737

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL+ESGF + DPKDFA+RIYNSVKSSL+ISP
Sbjct  738  QLMYQTALIESGFILNDPKDFAARIYNSVKSSLSISP  774



>gb|EYU38796.1| hypothetical protein MIMGU_mgv1a001101mg [Erythranthe guttata]
Length=889

 Score =   276 bits (706),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 148/157 (94%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LKI KDSK KELKESFK LTKWWKGALASDNVD+VKISNRLADTPCVVVTSK
Sbjct  691  FQNVSKEGLKIGKDSKDKELKESFKGLTKWWKGALASDNVDDVKISNRLADTPCVVVTSK  750

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDA+KQAYM+GKRVLEINPRHPIIKELRERV+KDPEDES K+TA
Sbjct  751  FGWSANMERIMQSQTLSDANKQAYMKGKRVLEINPRHPIIKELRERVLKDPEDESIKQTA  810

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TALMESGF + DPK FAS+IY+SVK+SL ISP
Sbjct  811  QLVYQTALMESGFVLTDPKSFASQIYSSVKNSLEISP  847



>ref|NP_974606.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
 gb|AEE84862.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
Length=823

 Score =   275 bits (702),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 147/157 (94%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKE+FK+LTKWWKG LAS+NVD+VKISNRLADTPCVVVTSK
Sbjct  618  FQNVSKEGLKVGKDSKDKELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSK  677

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++R+  DPEDES KETA
Sbjct  678  FGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKETA  737

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL+ESGF + DPKDFA+RIYNSVKS LNISP
Sbjct  738  QLMYQTALIESGFILTDPKDFAARIYNSVKSGLNISP  774



>gb|EYU36792.1| hypothetical protein MIMGU_mgv1a001447mg [Erythranthe guttata]
Length=818

 Score =   274 bits (701),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 148/157 (94%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LKI KDSK KELKESFK+LTKWWKGALAS NVD+VKISNRLAD+PCVVVTSK
Sbjct  621  FQNVSKEGLKIEKDSKDKELKESFKELTKWWKGALASHNVDDVKISNRLADSPCVVVTSK  680

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGW++NMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKELR+RVVKD EDES K+TA
Sbjct  681  YGWTSNMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELRDRVVKDSEDESVKQTA  740

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QLIY+TALMESGF + DP+DFASRIY+SVK+SL ISP
Sbjct  741  QLIYQTALMESGFMLSDPQDFASRIYSSVKNSLKISP  777



>ref|NP_194150.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
 sp|Q9STX5.1|ENPL_ARATH RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; AltName: Full=HSP90-like 
protein 7; AltName: Full=Protein SHEPHERD; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB45054.1| HSP90-like protein [Arabidopsis thaliana]
 emb|CAB79329.1| HSP90-like protein [Arabidopsis thaliana]
 gb|AAK63999.1| AT4g24190/T22A6_20 [Arabidopsis thaliana]
 dbj|BAB86369.1| SHEPHERD [Arabidopsis thaliana]
 gb|AAO42773.1| At4g24190/T22A6_20 [Arabidopsis thaliana]
 gb|AEE84861.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
Length=823

 Score =   275 bits (702),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 147/157 (94%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKE+FK+LTKWWKG LAS+NVD+VKISNRLADTPCVVVTSK
Sbjct  618  FQNVSKEGLKVGKDSKDKELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSK  677

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++R+  DPEDES KETA
Sbjct  678  FGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKETA  737

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL+ESGF + DPKDFA+RIYNSVKS LNISP
Sbjct  738  QLMYQTALIESGFILTDPKDFAARIYNSVKSGLNISP  774



>ref|XP_010246858.1| PREDICTED: endoplasmin homolog [Nelumbo nucifera]
Length=821

 Score =   274 bits (701),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 147/157 (94%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK K+LKESFK+LTKWWKG+L S+NVD+VKISNRLADTPCVVVTSK
Sbjct  616  FQNVSKEGLKLGKDSKDKDLKESFKELTKWWKGSLTSENVDDVKISNRLADTPCVVVTSK  675

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDASKQ YMRGKRVLEINPRHPIIKELRERVV DPEDES K+TA
Sbjct  676  YGWSANMERIMQSQTLSDASKQGYMRGKRVLEINPRHPIIKELRERVVNDPEDESVKQTA  735

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TALMESGF + DPKDFASRIY+SVK+SL ISP
Sbjct  736  RLMYQTALMESGFMLNDPKDFASRIYDSVKASLKISP  772



>dbj|BAB86368.1| SHEPHERD [Arabidopsis thaliana]
Length=823

 Score =   274 bits (701),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 147/157 (94%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKE+FK+LTKWWKG LAS+NVD+VKISNRLADTPCVVVTSK
Sbjct  618  FQNVSKEGLKVGKDSKDKELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSK  677

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++R+  DPEDES KETA
Sbjct  678  FGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKETA  737

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL+ESGF + DPKDFA+RIYNSVKS LNISP
Sbjct  738  QLMYQTALIESGFLLTDPKDFAARIYNSVKSGLNISP  774



>ref|XP_006283118.1| hypothetical protein CARUB_v10004140mg [Capsella rubella]
 gb|EOA16016.1| hypothetical protein CARUB_v10004140mg [Capsella rubella]
Length=823

 Score =   274 bits (700),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 147/157 (94%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKE+FK+LTKWWKG LAS+NVD+VKISNRLADTPCVVVTSK
Sbjct  618  FQNVSKEGLKVGKDSKDKELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSK  677

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++R+  DPEDES KETA
Sbjct  678  FGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKETA  737

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL+ESGF + DPKDFA+RIYNSVKS LNISP
Sbjct  738  QLMYQTALIESGFLLNDPKDFAARIYNSVKSGLNISP  774



>ref|XP_006342064.1| PREDICTED: endoplasmin homolog [Solanum tuberosum]
Length=806

 Score =   273 bits (699),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = -2

Query  784  FQDVSKEXLKIKDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKY  605
            FQ+VSKE LK+KDSK KELKESFK LTKWWK  LASDNV++VKISNRLADTPCVVVTSKY
Sbjct  616  FQNVSKEGLKLKDSKTKELKESFKGLTKWWKTTLASDNVEDVKISNRLADTPCVVVTSKY  675

Query  604  GWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQ  425
            GWSA ME+IM SQTLSDASKQAYMRGKRVLEINPRHPIIK LRERVV DPEDES K TA+
Sbjct  676  GWSAYMEKIMHSQTLSDASKQAYMRGKRVLEINPRHPIIKALRERVVTDPEDESVKLTAK  735

Query  424  LIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            LIY+TALMESGF++ DPKDFAS IY+SVKSSLNISP
Sbjct  736  LIYQTALMESGFDLSDPKDFASHIYSSVKSSLNISP  771



>sp|P35016.1|ENPL_CATRO RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; Flags: Precursor 
[Catharanthus roseus]
 gb|AAA16785.1| heat shock protein 90 [Catharanthus roseus]
Length=817

 Score =   273 bits (698),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 148/157 (94%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LKI KDSK KELKESFK+LTKWWKGALAS+NVD+VKISNRLA+TPCVVVTSK
Sbjct  622  FQNVSKEGLKIGKDSKDKELKESFKELTKWWKGALASENVDDVKISNRLANTPCVVVTSK  681

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWS+NMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKD EDES K+TA
Sbjct  682  YGWSSNMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDAEDESVKQTA  741

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TALMESGF + DPK+FAS IY+SVKSSL ISP
Sbjct  742  RLMYQTALMESGFMLNDPKEFASSIYDSVKSSLKISP  778



>ref|XP_002273785.1| PREDICTED: endoplasmin homolog [Vitis vinifera]
 emb|CBI19885.3| unnamed protein product [Vitis vinifera]
Length=818

 Score =   273 bits (697),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 146/157 (93%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK K+LKESFKDLTKWWK ALAS+NVD+VKISNRLADTPCVVVTSK
Sbjct  617  FQNVSKEGLKLGKDSKDKDLKESFKDLTKWWKSALASENVDDVKISNRLADTPCVVVTSK  676

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKEL+ERVVKD EDE  K+TA
Sbjct  677  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELQERVVKDSEDEGVKKTA  736

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TALMESGF + DPK FAS IY+SVKSSLNISP
Sbjct  737  QLMYQTALMESGFLLSDPKHFASNIYDSVKSSLNISP  773



>emb|CDX92620.1| BnaC07g38780D [Brassica napus]
Length=792

 Score =   271 bits (694),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 146/157 (93%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKE+FK+LTKWWK +LAS+NVD+VKISNRLADTPCVVVTSK
Sbjct  587  FQNVSKEGLKVGKDSKVKELKEAFKELTKWWKESLASENVDDVKISNRLADTPCVVVTSK  646

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL+ERV  DPEDES KETA
Sbjct  647  FGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKERVASDPEDESVKETA  706

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL+ESGF + DPKDFA RIYNSVKSSL ISP
Sbjct  707  QLMYQTALIESGFVLNDPKDFAGRIYNSVKSSLKISP  743



>emb|CDY03477.1| BnaC01g16050D [Brassica napus]
Length=822

 Score =   272 bits (696),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 146/157 (93%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKE+FK+LTKWWK +LAS+NVD+VKISNRLADTPCVVVTSK
Sbjct  618  FQNVSKEGLKVGKDSKVKELKEAFKELTKWWKESLASENVDDVKISNRLADTPCVVVTSK  677

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL+ERV  DPEDES KETA
Sbjct  678  FGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKERVASDPEDESVKETA  737

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL+ESGF + DPKDFA RIYNSVKSSL ISP
Sbjct  738  QLMYQTALIESGFILNDPKDFAGRIYNSVKSSLKISP  774



>ref|XP_010539097.1| PREDICTED: endoplasmin homolog [Tarenaya hassleriana]
Length=830

 Score =   272 bits (696),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 147/157 (94%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KD K KELKESFK+LTKWWK +LA++NVD+VKISNRLADTPCVVVTSK
Sbjct  623  FQNVSKEGLKLGKDGKDKELKESFKELTKWWKESLATENVDDVKISNRLADTPCVVVTSK  682

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKEL+ERV  DPE+ES KETA
Sbjct  683  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELKERVASDPEEESAKETA  742

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TAL+ESGF + DPKDFASRIYNSVK+SLNISP
Sbjct  743  KLMYQTALLESGFILQDPKDFASRIYNSVKTSLNISP  779



>emb|CDY34264.1| BnaA01g13670D [Brassica napus]
Length=822

 Score =   272 bits (695),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 146/157 (93%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKE+FK+LTKWWK +LAS+NVD+VKISNRLADTPCVVVTSK
Sbjct  618  FQNVSKEGLKVGKDSKVKELKEAFKELTKWWKESLASENVDDVKISNRLADTPCVVVTSK  677

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL+ERV  DPEDES KETA
Sbjct  678  FGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKERVASDPEDESVKETA  737

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL+ESGF + DPKDFA RIYNSVKSSL ISP
Sbjct  738  QLMYQTALIESGFILNDPKDFAGRIYNSVKSSLKISP  774



>ref|XP_004238368.1| PREDICTED: endoplasmin homolog [Solanum lycopersicum]
Length=812

 Score =   271 bits (694),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = -2

Query  784  FQDVSKEXLKIKDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKY  605
            FQ+VSKE LK+KDSK KELKESFK LTKWWK  LASDNV++VKIS+RLADTPCVVVTSKY
Sbjct  622  FQNVSKEGLKLKDSKTKELKESFKGLTKWWKNTLASDNVEDVKISSRLADTPCVVVTSKY  681

Query  604  GWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQ  425
            GWSA ME+IM SQTLSDASKQAYMRGKRVLEINPRHPIIK LRERVV DPEDES K TA+
Sbjct  682  GWSAYMEKIMHSQTLSDASKQAYMRGKRVLEINPRHPIIKALRERVVTDPEDESVKLTAK  741

Query  424  LIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            LIY+TALMESGF++ DPKDFAS IY+SVKSSLNISP
Sbjct  742  LIYQTALMESGFDLSDPKDFASHIYSSVKSSLNISP  777



>ref|XP_010069812.1| PREDICTED: endoplasmin homolog [Eucalyptus grandis]
 gb|KCW58281.1| hypothetical protein EUGRSUZ_H00972 [Eucalyptus grandis]
Length=822

 Score =   271 bits (694),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 146/157 (93%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK K+LKES+K+LTKWWK ALASDNVD+VKISNRL +TPCVVVTSK
Sbjct  625  FQNVSKEGLKLGKDSKDKDLKESYKELTKWWKSALASDNVDDVKISNRLDNTPCVVVTSK  684

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDA+KQ YMRGKRVLEINPRHPIIKELRERVVK+PEDES K TA
Sbjct  685  YGWSANMERIMQSQTLSDANKQGYMRGKRVLEINPRHPIIKELRERVVKNPEDESVKNTA  744

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TALMESGF + DPKDFASRI++SVKS LNISP
Sbjct  745  QLMYQTALMESGFTLSDPKDFASRIHDSVKSGLNISP  781



>ref|XP_003589505.1| Endoplasmin-like protein [Medicago truncatula]
 gb|AES59756.1| heat shock protein 81-2 [Medicago truncatula]
Length=818

 Score =   271 bits (693),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 147/157 (94%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKESFKDLTKWWK +LA+DNVD+VKISNRL +TPCVVVTSK
Sbjct  621  FQNVSKEGLKLGKDSKDKELKESFKDLTKWWKNSLANDNVDDVKISNRLDNTPCVVVTSK  680

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDA KQAYMRGKRVLEINPRHPIIKELRERVVK+PEDES K+TA
Sbjct  681  FGWSANMERIMQSQTLSDAKKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDESVKQTA  740

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL ESGF + DPKDFASRIY+SVK+SL+ISP
Sbjct  741  QLMYQTALFESGFLLNDPKDFASRIYDSVKTSLDISP  777



>gb|KJB14397.1| hypothetical protein B456_002G122800 [Gossypium raimondii]
Length=809

 Score =   271 bits (692),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 148/157 (94%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSK+ LKI KDSK++ELK+SFK+LTKWWKG L +++VDEVKISNRL +TPCVVVTSK
Sbjct  616  FQNVSKDGLKIGKDSKSRELKDSFKELTKWWKGTLKTEDVDEVKISNRLDNTPCVVVTSK  675

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMER+MQ+QTL+DASKQAYMRGKR+LEINPRHPI+KELRERVVKDPEDE  K+TA
Sbjct  676  FGWSANMERLMQAQTLTDASKQAYMRGKRILEINPRHPIVKELRERVVKDPEDEGVKQTA  735

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QLIY+TALMESGF + DPKDFASRIY+SVKSSLNISP
Sbjct  736  QLIYQTALMESGFILSDPKDFASRIYSSVKSSLNISP  772



>ref|XP_009137776.1| PREDICTED: endoplasmin homolog [Brassica rapa]
Length=822

 Score =   271 bits (692),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 146/157 (93%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE L++ KDSK KELKE+FK+LTKWWK +LAS+NVD+VKISNRLADTPCVVVTSK
Sbjct  618  FQNVSKEGLQVGKDSKVKELKEAFKELTKWWKESLASENVDDVKISNRLADTPCVVVTSK  677

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL+ERV  DPEDES KETA
Sbjct  678  FGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKERVASDPEDESVKETA  737

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL+ESGF + DPKDFA RIYNSVKSSL ISP
Sbjct  738  QLMYQTALIESGFILNDPKDFAGRIYNSVKSSLKISP  774



>ref|XP_006596543.1| PREDICTED: endoplasmin homolog isoform X2 [Glycine max]
Length=815

 Score =   270 bits (691),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 145/157 (92%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKESFKDLTKWWK AL+ DNVD+VKISNRL +TPCVVVTSK
Sbjct  620  FQNVSKEGLKLGKDSKDKELKESFKDLTKWWKTALSKDNVDDVKISNRLDNTPCVVVTSK  679

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK+PEDE  K TA
Sbjct  680  FGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDEGVKHTA  739

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL ESGF + DPKDFASRIY+SVK+SL+ISP
Sbjct  740  QLMYQTALFESGFLLDDPKDFASRIYDSVKTSLDISP  776



>ref|XP_003545030.1| PREDICTED: endoplasmin homolog isoform X1 [Glycine max]
 gb|KHN39421.1| Endoplasmin like [Glycine soja]
Length=816

 Score =   270 bits (691),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 145/157 (92%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKESFKDLTKWWK AL+ DNVD+VKISNRL +TPCVVVTSK
Sbjct  621  FQNVSKEGLKLGKDSKDKELKESFKDLTKWWKTALSKDNVDDVKISNRLDNTPCVVVTSK  680

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK+PEDE  K TA
Sbjct  681  FGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDEGVKHTA  740

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL ESGF + DPKDFASRIY+SVK+SL+ISP
Sbjct  741  QLMYQTALFESGFLLDDPKDFASRIYDSVKTSLDISP  777



>gb|KHG17445.1| Endoplasmin [Gossypium arboreum]
Length=812

 Score =   270 bits (690),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 147/157 (94%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSK+ LKI KDSK+KELK+SFK+LTKWWKG L +++VDEVKISNRL +TPCVVVTSK
Sbjct  619  FQNVSKDGLKIGKDSKSKELKDSFKELTKWWKGTLKTEDVDEVKISNRLDNTPCVVVTSK  678

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMER+MQ+QTL+DASKQAYMRG+R+LEINPRHPIIKELRERVVKDPEDE  K+TA
Sbjct  679  FGWSANMERLMQAQTLTDASKQAYMRGRRILEINPRHPIIKELRERVVKDPEDEGVKQTA  738

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QLIY+TALMESGF + DPKDFASRIY+SVKSSLNI P
Sbjct  739  QLIYQTALMESGFILTDPKDFASRIYSSVKSSLNIGP  775



>emb|CAN79404.1| hypothetical protein VITISV_028074 [Vitis vinifera]
Length=1084

 Score =   273 bits (697),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 146/157 (93%), Gaps = 1/157 (1%)
 Frame = -2

Query  784   FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
             FQ+VSKE LK+ KDSK K+LKESFKDLTKWWK ALAS+NVD+VKISNRLADTPCVVVTSK
Sbjct  883   FQNVSKEGLKLGKDSKDKDLKESFKDLTKWWKSALASENVDDVKISNRLADTPCVVVTSK  942

Query  607   YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
             YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKEL+ERVVKD EDE  K+TA
Sbjct  943   YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELQERVVKDSEDEGVKKTA  1002

Query  427   QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
             QL+Y+TALMESGF + DPK FAS IY+SVKSSLNISP
Sbjct  1003  QLMYQTALMESGFLLSDPKHFASNIYDSVKSSLNISP  1039



>ref|XP_006601356.1| PREDICTED: endoplasmin homolog isoform X2 [Glycine max]
Length=813

 Score =   270 bits (689),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 145/157 (92%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKESFKDLTKWWK AL+ DNVD+VKISNRL +TPCVVVTSK
Sbjct  620  FQNVSKEGLKLGKDSKDKELKESFKDLTKWWKTALSKDNVDDVKISNRLDNTPCVVVTSK  679

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDASKQAYMRGKRVLE+NPRHPIIKELRERVVK+PEDE  K TA
Sbjct  680  FGWSANMERIMQSQTLSDASKQAYMRGKRVLEVNPRHPIIKELRERVVKNPEDEGVKHTA  739

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL ESGF + DPKDFASRIY+SVK+SL+ISP
Sbjct  740  QLMYQTALFESGFLLDDPKDFASRIYDSVKTSLDISP  776



>ref|XP_003550428.1| PREDICTED: endoplasmin homolog isoform X1 [Glycine max]
 gb|KHN12637.1| Endoplasmin like [Glycine soja]
Length=814

 Score =   270 bits (689),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 145/157 (92%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKESFKDLTKWWK AL+ DNVD+VKISNRL +TPCVVVTSK
Sbjct  621  FQNVSKEGLKLGKDSKDKELKESFKDLTKWWKTALSKDNVDDVKISNRLDNTPCVVVTSK  680

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDASKQAYMRGKRVLE+NPRHPIIKELRERVVK+PEDE  K TA
Sbjct  681  FGWSANMERIMQSQTLSDASKQAYMRGKRVLEVNPRHPIIKELRERVVKNPEDEGVKHTA  740

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL ESGF + DPKDFASRIY+SVK+SL+ISP
Sbjct  741  QLMYQTALFESGFLLDDPKDFASRIYDSVKTSLDISP  777



>emb|CDY10992.1| BnaA03g46510D [Brassica napus]
Length=871

 Score =   270 bits (691),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 145/157 (92%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKE+FK+LTKWWK +LAS+NVD+VKISNRLADTPCVVV SK
Sbjct  614  FQNVSKEGLKVGKDSKVKELKEAFKELTKWWKESLASENVDDVKISNRLADTPCVVVASK  673

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL+ERV  DPEDES KETA
Sbjct  674  FGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKERVASDPEDESVKETA  733

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL+ESGF + DPKDFA RIYNSVKSSL ISP
Sbjct  734  QLMYQTALIESGFVLNDPKDFAGRIYNSVKSSLKISP  770



>ref|XP_002867677.1| hypothetical protein ARALYDRAFT_492441 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43936.1| hypothetical protein ARALYDRAFT_492441 [Arabidopsis lyrata subsp. 
lyrata]
Length=823

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 146/156 (94%), Gaps = 1/156 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKE+FK+LTKWWKG LAS+NVD+VKISNRLADTPCVVVTSK
Sbjct  618  FQNVSKEGLKVGKDSKDKELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSK  677

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++R+  DPEDES KETA
Sbjct  678  FGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKETA  737

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  320
            QL+Y+TAL+ESGF + DPKDFA+RIYNSVKSSL IS
Sbjct  738  QLMYQTALIESGFLLNDPKDFAARIYNSVKSSLKIS  773



>ref|XP_007160650.1| hypothetical protein PHAVU_001G005200g [Phaseolus vulgaris]
 gb|ESW32644.1| hypothetical protein PHAVU_001G005200g [Phaseolus vulgaris]
Length=817

 Score =   268 bits (686),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 145/157 (92%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KD+K KELKESFKDLTKWWK +L+ DNVD+VKISNRL +TPCVVVTSK
Sbjct  622  FQNVSKEGLKLGKDTKNKELKESFKDLTKWWKSSLSKDNVDDVKISNRLDNTPCVVVTSK  681

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK+PEDE  K+TA
Sbjct  682  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDEGVKQTA  741

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL ESGF + DPKDF SRIY+SVK+SL+ISP
Sbjct  742  QLMYQTALFESGFLLDDPKDFTSRIYDSVKTSLDISP  778



>ref|XP_010266798.1| PREDICTED: endoplasmin homolog [Nelumbo nucifera]
Length=822

 Score =   268 bits (685),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 146/157 (93%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ K+SK KELKESFK+LTKWWKGAL S+NVD+VKISNRL ++PCVVVTSK
Sbjct  617  FQNVSKEGLKLGKESKDKELKESFKELTKWWKGALTSENVDDVKISNRLDNSPCVVVTSK  676

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQ+LSD  KQAYMRGKRVLEINPRHPIIKELRERVVKDPED S K+TA
Sbjct  677  YGWSANMERIMQSQSLSDHRKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDNSVKQTA  736

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +LIY+T+LMESGF + DPKDFASRIY+SVK+SLNISP
Sbjct  737  RLIYQTSLMESGFMLDDPKDFASRIYDSVKTSLNISP  773



>ref|XP_011074690.1| PREDICTED: endoplasmin homolog [Sesamum indicum]
Length=811

 Score =   266 bits (681),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 145/157 (92%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LKI KDSK K LKESFK+LTKWWKGAL S+NVD+VKISNRL+ +PCVVVTSK
Sbjct  618  FQNVSKEGLKIGKDSKDKALKESFKELTKWWKGALVSENVDDVKISNRLSGSPCVVVTSK  677

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDA KQ+YMRGKRVLEIN RHPIIKELRERVVKDPEDES K+TA
Sbjct  678  YGWSANMERIMQSQTLSDARKQSYMRGKRVLEINARHPIIKELRERVVKDPEDESVKQTA  737

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL+ESGF + DPKDFASRIY+SVK+SL ISP
Sbjct  738  QLMYQTALLESGFILNDPKDFASRIYSSVKNSLRISP  774



>ref|XP_004152644.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 ref|XP_004162237.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 gb|KGN62687.1| hypothetical protein Csa_2G368880 [Cucumis sativus]
Length=817

 Score =   267 bits (682),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 146/157 (93%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKESFKDLTKWWK AL+ DNVD+VK+SNRL +TPCVVVTSK
Sbjct  621  FQNVSKEGLKLGKDSKDKELKESFKDLTKWWKTALSFDNVDDVKVSNRLDNTPCVVVTSK  680

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIK+LRER+VKDPEDE  K+ A
Sbjct  681  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKDLRERIVKDPEDEGAKQAA  740

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TAL+ESGF + DPKDFAS+IY++VK+SLNISP
Sbjct  741  KLMYQTALLESGFILSDPKDFASQIYDTVKTSLNISP  777



>ref|XP_008444821.1| PREDICTED: endoplasmin homolog [Cucumis melo]
Length=817

 Score =   266 bits (681),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 146/157 (93%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKESFKDLTKWWK AL+ DNVD+VK+SNRL +TPCVVVTSK
Sbjct  621  FQNVSKEGLKLGKDSKDKELKESFKDLTKWWKTALSFDNVDDVKVSNRLDNTPCVVVTSK  680

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPI+K+LRER+VKDPEDE  K+ A
Sbjct  681  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIVKDLRERIVKDPEDEGAKQAA  740

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TAL+ESGF + DPKDFAS+IY++VK+SLNISP
Sbjct  741  KLMYQTALLESGFILSDPKDFASQIYDTVKTSLNISP  777



>ref|XP_004499281.1| PREDICTED: endoplasmin homolog isoform X1 [Cicer arietinum]
 ref|XP_004499282.1| PREDICTED: endoplasmin homolog isoform X2 [Cicer arietinum]
Length=817

 Score =   265 bits (678),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 145/157 (92%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KD+K KELKESFKDLTKWWK +L+ DNVD+VKIS+RL +TPCVVVTSK
Sbjct  621  FQNVSKEGLKLGKDTKDKELKESFKDLTKWWKNSLSKDNVDDVKISDRLDNTPCVVVTSK  680

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK+PEDE  K TA
Sbjct  681  FGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDEGVKNTA  740

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL ESGF + DPKDFASRIY+SVK+SL+ISP
Sbjct  741  QLMYQTALFESGFLLNDPKDFASRIYDSVKTSLDISP  777



>ref|XP_004499283.1| PREDICTED: endoplasmin homolog isoform X3 [Cicer arietinum]
Length=816

 Score =   265 bits (678),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 145/157 (92%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KD+K KELKESFKDLTKWWK +L+ DNVD+VKIS+RL +TPCVVVTSK
Sbjct  620  FQNVSKEGLKLGKDTKDKELKESFKDLTKWWKNSLSKDNVDDVKISDRLDNTPCVVVTSK  679

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK+PEDE  K TA
Sbjct  680  FGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDEGVKNTA  739

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL ESGF + DPKDFASRIY+SVK+SL+ISP
Sbjct  740  QLMYQTALFESGFLLNDPKDFASRIYDSVKTSLDISP  776



>ref|XP_011045067.1| PREDICTED: endoplasmin homolog [Populus euphratica]
Length=823

 Score =   265 bits (678),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 140/146 (96%), Gaps = 1/146 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSKAKELKESFK+LTKWWKGALAS+NVD+VKISNRLADTPCVVVTSK
Sbjct  621  FQNVSKEGLKLGKDSKAKELKESFKELTKWWKGALASENVDDVKISNRLADTPCVVVTSK  680

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQ+QTLSDA+KQAYMRGKRVLEINPRHPIIKELRERVVKDPED+S K+TA
Sbjct  681  YGWSANMERIMQAQTLSDANKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDDSVKQTA  740

Query  427  QLIYKTALMESGFNVPDPKDFASRIY  350
             L+Y+TALMESGF + DPKDFASRIY
Sbjct  741  HLMYQTALMESGFILNDPKDFASRIY  766



>ref|XP_006413464.1| hypothetical protein EUTSA_v10024414mg [Eutrema salsugineum]
 gb|ESQ54917.1| hypothetical protein EUTSA_v10024414mg [Eutrema salsugineum]
Length=822

 Score =   265 bits (677),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 145/157 (92%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KD+  KELKE+FK+LTKWWK +LAS+NVD+VKISNRLADTPCVVVTSK
Sbjct  618  FQNVSKEGLKVGKDANVKELKEAFKELTKWWKESLASENVDDVKISNRLADTPCVVVTSK  677

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++RV  D EDES KETA
Sbjct  678  FGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRVASDAEDESVKETA  737

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL+ESGF + DPKDFA+RIYNSVKSSL ISP
Sbjct  738  QLMYQTALIESGFILNDPKDFAARIYNSVKSSLKISP  774



>ref|XP_010691883.1| PREDICTED: endoplasmin homolog [Beta vulgaris subsp. vulgaris]
Length=810

 Score =   265 bits (677),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 168/196 (86%), Gaps = 6/196 (3%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KE+KES+K+LTKWWKGALA+D VD+VKISNRLADTPCVVVTSK
Sbjct  620  FQNVSKEGLKLGKDSKDKEIKESYKELTKWWKGALATDKVDDVKISNRLADTPCVVVTSK  679

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKELRERV  DPED+  K+TA
Sbjct  680  FGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELRERVATDPEDDGVKQTA  739

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISPdavveeddeveeeaetsskeaeS  248
            +L+Y+TAL ESGF + DPKDFASR+Y+SVK+SL+I+PDA VEE+D+ EE       ++ S
Sbjct  740  RLMYQTALFESGFLLDDPKDFASRVYDSVKTSLSINPDAAVEEEDDTEEPEIEMKGDSSS  799

Query  247  NPENAEDGADGIKDEL  200
            N E     AD +KDEL
Sbjct  800  NAE-----ADDVKDEL  810



>ref|XP_002307732.1| hypothetical protein POPTR_0005s26260g [Populus trichocarpa]
 gb|EEE94728.1| hypothetical protein POPTR_0005s26260g [Populus trichocarpa]
Length=823

 Score =   265 bits (677),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 140/146 (96%), Gaps = 1/146 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSKAKELKESFK+LTKWWKGALAS+NVD+VKISNRLADTPC+VVTSK
Sbjct  621  FQNVSKEGLKLGKDSKAKELKESFKELTKWWKGALASENVDDVKISNRLADTPCIVVTSK  680

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQ+QTLSDA+KQAYMRGKRVLEINPRHPIIKELRERVVKDPED+S K+TA
Sbjct  681  YGWSANMERIMQAQTLSDANKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDDSVKQTA  740

Query  427  QLIYKTALMESGFNVPDPKDFASRIY  350
             L+Y+TALMESGF + DPKDFASRIY
Sbjct  741  HLMYQTALMESGFILNDPKDFASRIY  766



>gb|KFK29085.1| hypothetical protein AALP_AA7G086900 [Arabis alpina]
Length=823

 Score =   265 bits (676),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKE+FK+LT WWKG LASDNVD VKISNRLADTPCVVVTSK
Sbjct  618  FQNVSKEGLKVGKDSKDKELKEAFKELTTWWKGILASDNVDSVKISNRLADTPCVVVTSK  677

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++R+  D EDES KETA
Sbjct  678  FGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDSEDESVKETA  737

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  320
            QL+Y+TAL+ESGF + DPKDFA+RIYNSVKS L IS
Sbjct  738  QLMYQTALIESGFVLNDPKDFAARIYNSVKSGLKIS  773



>ref|XP_008808636.1| PREDICTED: endoplasmin homolog [Phoenix dactylifera]
Length=817

 Score =   264 bits (674),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 143/157 (91%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKESFK+LT WWK AL+S+NVD VKISNRL +TPCVVVTSK
Sbjct  618  FQNVSKEGLKLGKDSKLKELKESFKELTDWWKNALSSENVDSVKISNRLDNTPCVVVTSK  677

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANME+IMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERV +DPEDES K+TA
Sbjct  678  YGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVAQDPEDESMKQTA  737

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +LIY+TALMESGFN+ DPK+FAS IY SV  SL+ISP
Sbjct  738  RLIYQTALMESGFNLNDPKEFASSIYKSVHKSLDISP  774



>emb|CDY24830.1| BnaA08g14800D [Brassica napus]
Length=819

 Score =   263 bits (673),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 143/157 (91%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKE+FK+LTKWWK +LA +NVD+VKISNRLADTPC+VVTSK
Sbjct  618  FQNVSKEGLKVGKDSKVKELKEAFKELTKWWKESLAGENVDDVKISNRLADTPCIVVTSK  677

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDA KQAYMRGKRVLEINPRHPIIKEL++RV  D ED+S KETA
Sbjct  678  FGWSANMERIMQSQTLSDAKKQAYMRGKRVLEINPRHPIIKELKDRVASDQEDKSVKETA  737

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL+ESGF + DPKDFA RIYNSVKSSL ISP
Sbjct  738  QLMYQTALIESGFILNDPKDFAGRIYNSVKSSLKISP  774



>gb|AFW75769.1| hypothetical protein ZEAMMB73_790349 [Zea mays]
Length=429

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 139/157 (89%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKESFK+LT WWK AL S+NVD VKISNRL DTPCVVVTSK
Sbjct  241  FQNVSKEGLKLGKDSKLKELKESFKELTDWWKKALESENVDSVKISNRLHDTPCVVVTSK  300

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANME+IMQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K TA
Sbjct  301  YGWSANMEKIMQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTA  360

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TALMESGFN+PDPK+FAS IY SV+  L++SP
Sbjct  361  RLVYQTALMESGFNLPDPKEFASSIYKSVQKGLDLSP  397



>ref|XP_010935079.1| PREDICTED: endoplasmin homolog [Elaeis guineensis]
Length=822

 Score =   261 bits (666),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 143/157 (91%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKESFK+LT WWK AL+S+NVD VKISNRL +TPCVVVTSK
Sbjct  623  FQNVSKEGLKLGKDSKLKELKESFKELTDWWKNALSSENVDSVKISNRLDNTPCVVVTSK  682

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANME+IMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERV +DP+DES K+TA
Sbjct  683  YGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVAQDPKDESVKQTA  742

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QLIY+TALMESGF + DPK+FAS IY SV+ SL+ISP
Sbjct  743  QLIYQTALMESGFILNDPKEFASSIYKSVQKSLDISP  779



>gb|AIZ68158.1| heat shock protein 90 [Ornithogalum saundersiae]
Length=814

 Score =   261 bits (666),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 167/196 (85%), Gaps = 1/196 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE L I KDSK KELKE+FK+LTKWWK AL+++NVD VKISNRL +TPCVVVTSK
Sbjct  619  FQNVSKEGLNIGKDSKGKELKETFKELTKWWKDALSAENVDSVKISNRLDNTPCVVVTSK  678

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANME+IMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRER+  +P+DES K+TA
Sbjct  679  YGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERIAANPQDESIKQTA  738

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISPdavveeddeveeeaetsskeaeS  248
            +L+Y+TALMESGF + DPKDFA RIY+SVK+SL+ISPDA  EE+D++EE      + A +
Sbjct  739  RLMYQTALMESGFLLNDPKDFAERIYSSVKASLDISPDATAEEEDDIEETEAEEKESASA  798

Query  247  NPENAEDGADGIKDEL  200
            + E  E+ +  +KDEL
Sbjct  799  DKEADEEDSSSLKDEL  814



>emb|CDY08910.1| BnaC08g11400D [Brassica napus]
Length=783

 Score =   260 bits (664),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 141/157 (90%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKE+FKDLTKWWK +LA +NVD+VKISNRLADT CVVVTSK
Sbjct  600  FQNVSKEGLKVGKDSKVKELKEAFKDLTKWWKESLAGENVDDVKISNRLADTLCVVVTSK  659

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            +GWSANMERIMQSQTLSDA KQAYMRGKRVLEIN RHPIIKEL++RV  DPED S KETA
Sbjct  660  FGWSANMERIMQSQTLSDAKKQAYMRGKRVLEINLRHPIIKELKDRVASDPEDGSVKETA  719

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TAL+ESGF + DPKDFA RIYNSVKSSL ISP
Sbjct  720  QLMYQTALIESGFILNDPKDFAGRIYNSVKSSLKISP  756



>gb|EPS69355.1| hypothetical protein M569_05408 [Genlisea aurea]
Length=815

 Score =   260 bits (664),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 148/159 (93%), Gaps = 3/159 (2%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSK-AKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            FQ+VSKE LK+ KDSK +KE+KESFK+LTKWWKGALASDNVD+VKIS+RL+D+PCVVVTS
Sbjct  620  FQNVSKEGLKLGKDSKDSKEVKESFKELTKWWKGALASDNVDDVKISSRLSDSPCVVVTS  679

Query  610  KYGWSANMERIMQSQTLSDASKQ-AYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKE  434
            KYGWSANMERIMQSQTLSD++KQ +YMRGKRVLEINPRHPIIKELR+RV  +PEDE  K+
Sbjct  680  KYGWSANMERIMQSQTLSDSNKQSSYMRGKRVLEINPRHPIIKELRDRVALNPEDEGVKQ  739

Query  433  TAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            TAQL+Y+TALMESGF + DPKDFASRIY SVK+SLNISP
Sbjct  740  TAQLMYQTALMESGFVLNDPKDFASRIYGSVKNSLNISP  778



>ref|XP_006851911.1| hypothetical protein AMTR_s00041p00161550 [Amborella trichopoda]
 gb|ERN13378.1| hypothetical protein AMTR_s00041p00161550 [Amborella trichopoda]
Length=818

 Score =   258 bits (660),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 141/157 (90%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ++SKE LK+ KDSK KE KESFK+LT WWK  L+SDNVD VKISNRL +TPCVVVTSK
Sbjct  621  FQNISKEGLKMGKDSKIKETKESFKELTNWWKDVLSSDNVDSVKISNRLDNTPCVVVTSK  680

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKELRERV  DP+DE+ KETA
Sbjct  681  YGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELRERVAVDPQDENVKETA  740

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TALMESGF + +PK+FAS IYNSVKSSL ISP
Sbjct  741  KLMYQTALMESGFMLSEPKEFASSIYNSVKSSLKISP  777



>gb|AAN34791.1| Grp94 [Xerophyta viscosa]
Length=812

 Score =   258 bits (659),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 144/157 (92%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LKI K+SK K+LKESFK+LT WWK AL+S+NVD VKISNRL +TPCVVVTSK
Sbjct  618  FQNVSKEGLKIGKESKIKDLKESFKELTSWWKEALSSENVDSVKISNRLDNTPCVVVTSK  677

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANME+IMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERV  DP+DE+ K+TA
Sbjct  678  YGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVAVDPQDENIKQTA  737

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +LIY+TALMESGF + DPK+FA+ IY+SVKSSLNISP
Sbjct  738  KLIYQTALMESGFLMNDPKEFATSIYSSVKSSLNISP  774



>ref|XP_010941296.1| PREDICTED: endoplasmin homolog [Elaeis guineensis]
Length=838

 Score =   258 bits (659),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 143/157 (91%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKESFK+LT WWK AL+S+NVD VKISNRL +TPCVVVTSK
Sbjct  639  FQNVSKEGLKLGKDSKLKELKESFKELTDWWKNALSSENVDSVKISNRLDNTPCVVVTSK  698

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANME+IMQSQTLSDASKQAYMRGKRVLEINPRHPI+KELRERV +DP+DES K+TA
Sbjct  699  YGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPIVKELRERVAQDPKDESVKQTA  758

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +LIY+TALMESGF + DPK+FAS IY SV+ SL+ISP
Sbjct  759  RLIYQTALMESGFILNDPKEFASSIYKSVQKSLDISP  795



>ref|XP_008788614.1| PREDICTED: endoplasmin homolog [Phoenix dactylifera]
Length=822

 Score =   258 bits (658),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 142/157 (90%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK  KDSK KELKESFK+LT WWK +L+S+NVD VKISNRL +TPCVVVTSK
Sbjct  623  FQNVSKEGLKFGKDSKLKELKESFKELTDWWKNSLSSENVDSVKISNRLDNTPCVVVTSK  682

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANME+IMQSQTLSDASKQAYM GKRVLEINPRHPIIKELRERV +DP+DES K+TA
Sbjct  683  YGWSANMEKIMQSQTLSDASKQAYMHGKRVLEINPRHPIIKELRERVAQDPKDESVKQTA  742

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +LIY+TALMESGF + DPK+FAS IYNSV+ SL+ISP
Sbjct  743  RLIYQTALMESGFILNDPKEFASSIYNSVQKSLDISP  779



>ref|XP_006657350.1| PREDICTED: endoplasmin homolog [Oryza brachyantha]
Length=810

 Score =   257 bits (657),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 142/157 (90%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK K+LKESFK+LT WWK AL S+NVD VKISNRL DTPCVVVTSK
Sbjct  618  FQNVSKEGLKLGKDSKLKDLKESFKELTDWWKKALDSENVDSVKISNRLHDTPCVVVTSK  677

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANME+IMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +D E ES K+TA
Sbjct  678  YGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAEDNESESLKQTA  737

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TALMESGFN+PDPKDFAS IY SV+ SL++SP
Sbjct  738  KLVYQTALMESGFNLPDPKDFASSIYKSVQKSLDLSP  774



>ref|NP_001058590.1| Os06g0716700 [Oryza sativa Japonica Group]
 dbj|BAF20504.1| Os06g0716700 [Oryza sativa Japonica Group]
Length=810

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 143/157 (91%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK K+LKESFK+LT WWK AL +++VD VKISNRL+DTPCVVVTSK
Sbjct  617  FQNVSKEGLKLGKDSKLKDLKESFKELTDWWKKALDTESVDSVKISNRLSDTPCVVVTSK  676

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANME+IMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +D E ES K+TA
Sbjct  677  YGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTA  736

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TALMESGFN+PDPKDFAS IY SV+ SL++SP
Sbjct  737  KLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLSP  773



>gb|AAL79732.1|AC091774_23 heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD53585.1| heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD61715.1| heat shock protein 90 [Oryza sativa Japonica Group]
 gb|ADR66979.1| 90 kDa heat shock protein [Oryza sativa Japonica Group]
Length=812

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 143/157 (91%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK K+LKESFK+LT WWK AL +++VD VKISNRL+DTPCVVVTSK
Sbjct  619  FQNVSKEGLKLGKDSKLKDLKESFKELTDWWKKALDTESVDSVKISNRLSDTPCVVVTSK  678

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANME+IMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +D E ES K+TA
Sbjct  679  YGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTA  738

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TALMESGFN+PDPKDFAS IY SV+ SL++SP
Sbjct  739  KLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLSP  775



>gb|EAZ02369.1| hypothetical protein OsI_24473 [Oryza sativa Indica Group]
Length=837

 Score =   256 bits (653),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 143/157 (91%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK K+LKESFK+LT WWK AL +++VD VKISNRL+DTPCVVVTSK
Sbjct  644  FQNVSKEGLKLGKDSKLKDLKESFKELTDWWKKALDTESVDSVKISNRLSDTPCVVVTSK  703

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANME+IMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +D E ES K+TA
Sbjct  704  YGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTA  763

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TALMESGFN+PDPKDFAS IY SV+ SL++SP
Sbjct  764  KLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLSP  800



>gb|EAZ38293.1| hypothetical protein OsJ_22671 [Oryza sativa Japonica Group]
Length=838

 Score =   256 bits (653),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 143/157 (91%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK K+LKESFK+LT WWK AL +++VD VKISNRL+DTPCVVVTSK
Sbjct  645  FQNVSKEGLKLGKDSKLKDLKESFKELTDWWKKALDTESVDSVKISNRLSDTPCVVVTSK  704

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANME+IMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +D E ES K+TA
Sbjct  705  YGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTA  764

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TALMESGFN+PDPKDFAS IY SV+ SL++SP
Sbjct  765  KLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLSP  801



>gb|AFW75768.1| hypothetical protein ZEAMMB73_790349 [Zea mays]
Length=667

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 139/157 (89%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKESFK+LT WWK AL S+NVD VKISNRL DTPCVVVTSK
Sbjct  479  FQNVSKEGLKLGKDSKLKELKESFKELTDWWKKALESENVDSVKISNRLHDTPCVVVTSK  538

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANME+IMQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K TA
Sbjct  539  YGWSANMEKIMQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTA  598

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TALMESGFN+PDPK+FAS IY SV+  L++SP
Sbjct  599  RLVYQTALMESGFNLPDPKEFASSIYKSVQKGLDLSP  635



>dbj|BAA90487.1| heat shock protein 90 [Oryza sativa]
Length=810

 Score =   253 bits (647),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 142/157 (90%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK K+LKESFK+LT WWK AL +++VD VKISNRL+DTPCVVVTSK
Sbjct  617  FQNVSKEGLKLGKDSKLKDLKESFKELTDWWKKALDTESVDSVKISNRLSDTPCVVVTSK  676

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANME+IMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +D E ES K+TA
Sbjct  677  YGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTA  736

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TALMESGFN+PDPKDFA  IY SV+ SL++SP
Sbjct  737  KLVYQTALMESGFNLPDPKDFAFSIYRSVQKSLDLSP  773



>dbj|BAJ89816.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=542

 Score =   247 bits (631),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 140/157 (89%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK K+LKESFK+LT WWK AL ++ +D VKISNRL +TPCVVVTSK
Sbjct  348  FQNVSKEGLKLGKDSKLKDLKESFKELTDWWKKALDTEGIDSVKISNRLHNTPCVVVTSK  407

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWS+NME+IMQ+QTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +D + E  K+TA
Sbjct  408  YGWSSNMEKIMQAQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSDSEGLKQTA  467

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TALMESGFN+PDPKDFAS IY SV+ SL++SP
Sbjct  468  RLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLSP  504



>ref|XP_004966467.1| PREDICTED: endoplasmin homolog [Setaria italica]
Length=807

 Score =   253 bits (645),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 141/157 (90%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK K+LKESFK+LT WWK AL S+NVD VKISNRL DTPCVVVTSK
Sbjct  615  FQNVSKEGLKLGKDSKLKDLKESFKELTDWWKKALESENVDSVKISNRLHDTPCVVVTSK  674

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANME+IMQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K+TA
Sbjct  675  YGWSANMEKIMQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDTESEGLKQTA  734

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TALMESGFN+PDPK+FAS IY SV+ SL++SP
Sbjct  735  RLVYQTALMESGFNLPDPKEFASSIYKSVQKSLDLSP  771



>gb|ABK24228.1| unknown [Picea sitchensis]
Length=466

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 142/157 (90%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KD+K KE+K+SFK+LT WWK  L+S+NVD VKISNRL +TP VVVTSK
Sbjct  252  FQNVSKEGLKLGKDTKDKEIKDSFKELTNWWKDILSSENVDSVKISNRLDNTPGVVVTSK  311

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDA++Q+YMRGKRVLEINPRHPIIKELRERV + PEDE+ K+TA
Sbjct  312  YGWSANMERIMQSQTLSDANRQSYMRGKRVLEINPRHPIIKELRERVTQSPEDENIKQTA  371

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +LIY+TALMESGF + DPK+FAS IY+++K++LN++P
Sbjct  372  RLIYQTALMESGFILNDPKEFASSIYSTIKTTLNVNP  408



>gb|AFW75767.1| endoplasmin [Zea mays]
Length=804

 Score =   252 bits (643),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 139/157 (89%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKESFK+LT WWK AL S+NVD VKISNRL DTPCVVVTSK
Sbjct  616  FQNVSKEGLKLGKDSKLKELKESFKELTDWWKKALESENVDSVKISNRLHDTPCVVVTSK  675

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANME+IMQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K TA
Sbjct  676  YGWSANMEKIMQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTA  735

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TALMESGFN+PDPK+FAS IY SV+  L++SP
Sbjct  736  RLVYQTALMESGFNLPDPKEFASSIYKSVQKGLDLSP  772



>ref|XP_009409971.1| PREDICTED: endoplasmin homolog [Musa acuminata subsp. malaccensis]
Length=814

 Score =   251 bits (642),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 140/157 (89%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK K+LKESFK+LT WWK AL+S+NVD VKISNRL +TPCVVVTSK
Sbjct  620  FQNVSKEGLKLGKDSKLKDLKESFKELTNWWKDALSSENVDSVKISNRLDNTPCVVVTSK  679

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANME+IMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKELR+RV +D +DE  K TA
Sbjct  680  YGWSANMEKIMQSQTLSDATKQAYMRGKRVLEINPRHPIIKELRDRVAQDSKDEGLKHTA  739

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +LIY+TALMESGF + DPKDFAS IY SV+ SL+ISP
Sbjct  740  RLIYQTALMESGFILNDPKDFASSIYKSVQKSLDISP  776



>ref|NP_001151475.1| endoplasmin precursor [Zea mays]
 gb|ACG42989.1| endoplasmin precursor [Zea mays]
Length=807

 Score =   250 bits (639),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 139/157 (89%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK K+LKESFK+LT WWK AL S+NVD VKISNRL DTPCVVVTSK
Sbjct  618  FQNVSKEGLKLGKDSKLKDLKESFKELTDWWKKALESENVDSVKISNRLHDTPCVVVTSK  677

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANME+IMQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K TA
Sbjct  678  YGWSANMEKIMQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTA  737

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TALMESGFN+PDPK+FAS IY SV+  L++SP
Sbjct  738  RLVYQTALMESGFNLPDPKEFASSIYKSVQKGLDLSP  774



>ref|XP_009393849.1| PREDICTED: endoplasmin homolog [Musa acuminata subsp. malaccensis]
Length=815

 Score =   249 bits (636),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 140/157 (89%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK K+LKESFK+LT WW  AL+S+NVD VKISNRL +TPCVVVTSK
Sbjct  617  FQNVSKEGLKLGKDSKLKDLKESFKELTNWWNDALSSENVDSVKISNRLDNTPCVVVTSK  676

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANME+IMQSQTLSDASKQAYMRGKRVLEINPRHP+IKELR+RV +D +DES K TA
Sbjct  677  YGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPVIKELRDRVAQDSKDESLKHTA  736

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +LIY+TALMESGF + DPK+FAS IY SV+ SL+ISP
Sbjct  737  RLIYQTALMESGFILNDPKEFASSIYKSVQKSLDISP  773



>ref|XP_002439030.1| hypothetical protein SORBIDRAFT_10g030240 [Sorghum bicolor]
 gb|EER90397.1| hypothetical protein SORBIDRAFT_10g030240 [Sorghum bicolor]
Length=807

 Score =   249 bits (636),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 140/157 (89%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK KELKESFK+L+ WWK AL S+NVD VKISNRL +TPCVVVTSK
Sbjct  616  FQNVSKEGLKLGKDSKLKELKESFKELSDWWKKALESENVDSVKISNRLHNTPCVVVTSK  675

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANME+IMQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K TA
Sbjct  676  YGWSANMEKIMQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTA  735

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TALMESGFN+PDPK+FAS IY SV+ SL++SP
Sbjct  736  RLVYQTALMESGFNLPDPKEFASSIYKSVQKSLDLSP  772



>ref|XP_003563275.1| PREDICTED: endoplasmin homolog [Brachypodium distachyon]
Length=807

 Score =   249 bits (635),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK K+LKESFK+LT WWK AL S+++D VKISNRL +TPCVVVTSK
Sbjct  615  FQNVSKEGLKLGKDSKLKDLKESFKELTDWWKKALESESIDSVKISNRLHNTPCVVVTSK  674

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWS+NME+IMQ+QTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +D E ES K+TA
Sbjct  675  YGWSSNMEKIMQAQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTA  734

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  320
            +L+Y+TALMESGFN+PDPKDFAS IY SV+ SL++S
Sbjct  735  RLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLS  770



>gb|ABV82432.1| Hsp90-like protein [Dactylis glomerata]
Length=808

 Score =   248 bits (634),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 140/157 (89%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK K+LKESFK+LT WWK AL ++ +D VKISNRL +TPCVVVTSK
Sbjct  614  FQNVSKEGLKLGKDSKLKDLKESFKELTDWWKKALDTEGIDSVKISNRLHNTPCVVVTSK  673

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWS+NME+IMQ+QTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +D ED   K+TA
Sbjct  674  YGWSSNMEKIMQAQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDNEDVGLKQTA  733

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TALMESGFN+PDPKDFAS IY SV+ SL++SP
Sbjct  734  RLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLSP  770



>ref|XP_011083591.1| PREDICTED: endoplasmin homolog [Sesamum indicum]
Length=808

 Score =   248 bits (633),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 140/157 (89%), Gaps = 9/157 (6%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KD K KELKESFK+LTKWWKGALAS+NVD+VKISNRL+D+PCVVVTSK
Sbjct  620  FQNVSKEGLKLGKDPKDKELKESFKELTKWWKGALASENVDDVKISNRLSDSPCVVVTSK  679

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWS+NMERIMQSQTLSDASKQAYMRGKRVLEINPRHPII  +        +DES K+TA
Sbjct  680  YGWSSNMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIFLV--------QDESVKQTA  731

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            QL+Y+TALMESGF + DPKDFASRIY+SVKSSLNISP
Sbjct  732  QLMYQTALMESGFLLNDPKDFASRIYSSVKSSLNISP  768



>sp|P36183.1|ENPL_HORVU RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; Flags: Precursor 
[Hordeum vulgare]
 emb|CAA48143.1| GRP94 homologue [Hordeum vulgare]
 dbj|BAJ91793.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=809

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 140/157 (89%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK K+LKESFK+LT WWK AL ++ +D VKISNRL +TPCVVVTSK
Sbjct  615  FQNVSKEGLKLGKDSKLKDLKESFKELTDWWKKALDTEGIDSVKISNRLHNTPCVVVTSK  674

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWS+NME+IMQ+QTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +D + E  K+TA
Sbjct  675  YGWSSNMEKIMQAQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSDSEGLKQTA  734

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TALMESGFN+PDPKDFAS IY SV+ SL++SP
Sbjct  735  RLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLSP  771



>ref|NP_001146348.1| shepherd-like1 [Zea mays]
 gb|ACL53742.1| unknown [Zea mays]
Length=719

 Score =   246 bits (627),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 141/157 (90%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDS+ K+LKESFK+LT+WWK AL S++VD VK+S+RL DTPCVVVTSK
Sbjct  527  FQNVSKEGLKLGKDSRLKDLKESFKELTEWWKKALESESVDSVKVSSRLHDTPCVVVTSK  586

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANME+IMQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K+TA
Sbjct  587  YGWSANMEKIMQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKQTA  646

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TALMESGFN+PDPK+FAS IY SV  SL++SP
Sbjct  647  RLVYQTALMESGFNLPDPKEFASSIYKSVHKSLDLSP  683



>gb|EMS56078.1| Endoplasmin-like protein [Triticum urartu]
Length=875

 Score =   248 bits (632),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 140/157 (89%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK K+LKESFK+LT WWK AL ++ +D VKISNRL +TPCVVVTSK
Sbjct  683  FQNVSKEGLKLGKDSKLKDLKESFKELTDWWKKALDTEGIDSVKISNRLHNTPCVVVTSK  742

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWS+NME+IMQ+QTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +D + E  K+TA
Sbjct  743  YGWSSNMEKIMQAQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSDSEGLKQTA  802

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TALMESGFN+PDPKDFAS IY SV+ SL++SP
Sbjct  803  RLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLSP  839



>ref|XP_008643502.1| PREDICTED: shepherd-like1 isoform X1 [Zea mays]
 gb|AFW69514.1| hypothetical protein ZEAMMB73_665489 [Zea mays]
Length=808

 Score =   246 bits (628),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 141/157 (90%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDS+ K+LKESFK+LT+WWK AL S++VD VK+S+RL DTPCVVVTSK
Sbjct  616  FQNVSKEGLKLGKDSRLKDLKESFKELTEWWKKALESESVDSVKVSSRLHDTPCVVVTSK  675

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANME+IMQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K+TA
Sbjct  676  YGWSANMEKIMQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKQTA  735

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TALMESGFN+PDPK+FAS IY SV  SL++SP
Sbjct  736  RLVYQTALMESGFNLPDPKEFASSIYKSVHKSLDLSP  772



>gb|AFW69515.1| hypothetical protein ZEAMMB73_665489 [Zea mays]
Length=1001

 Score =   246 bits (629),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 141/157 (90%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDS+ K+LKESFK+LT+WWK AL S++VD VK+S+RL DTPCVVVTSK
Sbjct  809  FQNVSKEGLKLGKDSRLKDLKESFKELTEWWKKALESESVDSVKVSSRLHDTPCVVVTSK  868

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANME+IMQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K+TA
Sbjct  869  YGWSANMEKIMQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKQTA  928

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TALMESGFN+PDPK+FAS IY SV  SL++SP
Sbjct  929  RLVYQTALMESGFNLPDPKEFASSIYKSVHKSLDLSP  965



>gb|EMT19498.1| Endoplasmin-like protein [Aegilops tauschii]
Length=1222

 Score =   247 bits (630),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 140/157 (89%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KDSK K+LKESFK+LT WWK AL ++ +D VKISNRL +TPCVVVTSK
Sbjct  624  FQNVSKEGLKLGKDSKLKDLKESFKELTDWWKKALDTEGIDSVKISNRLHNTPCVVVTSK  683

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWS+NME+IMQ+QTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +D + E  K+TA
Sbjct  684  YGWSSNMEKIMQAQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSDSEGLKQTA  743

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +L+Y+TALMESGFN+PDPKDFAS IY SV+ SL++SP
Sbjct  744  RLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLSP  780



>gb|ABV21762.1| GRP94 [Pinus taeda]
Length=834

 Score =   244 bits (622),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 143/157 (91%), Gaps = 1/157 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LKI KDSK KE+K+SFK+LT WWK  L+S+NVD VKISNRL +TP VVVTSK
Sbjct  620  FQNVSKEGLKIGKDSKDKEIKDSFKELTNWWKDVLSSENVDSVKISNRLDNTPGVVVTSK  679

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIMQSQTLSDA++Q+YMRGKRVLEINP+HPIIKELRERV ++PE+E+ K+TA
Sbjct  680  YGWSANMERIMQSQTLSDANRQSYMRGKRVLEINPKHPIIKELRERVTQNPEEENIKQTA  739

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +LIY+TALMESGF + DPK+FA+ IY+++K++LN++P
Sbjct  740  RLIYQTALMESGFILNDPKEFATSIYSTIKTTLNVNP  776



>ref|XP_001770511.1| predicted protein [Physcomitrella patens]
 gb|EDQ64680.1| predicted protein [Physcomitrella patens]
Length=849

 Score =   220 bits (560),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 137/160 (86%), Gaps = 4/160 (3%)
 Frame = -2

Query  784  FQDVSKEXLKI--KDSKAK--ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVV  617
            FQ+ SK+ LK+  KD KAK  E+KES+K+LTKWWK  L+ + V+ VK+SNRLA+TP VVV
Sbjct  622  FQNASKDDLKLGSKDEKAKFKEIKESYKELTKWWKDLLSGEMVEAVKVSNRLANTPAVVV  681

Query  616  TSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTK  437
            TSKYGWSANMERIMQ+QTL+D SKQ+YMRGKR+LEINP+HPIIK+L+E++    ED+S K
Sbjct  682  TSKYGWSANMERIMQAQTLADPSKQSYMRGKRILEINPKHPIIKDLKEKISLSSEDDSAK  741

Query  436  ETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            + A+L+++TAL+ESGF + DPKDFA+RIY+ +KS+LN+SP
Sbjct  742  QAAKLVFETALLESGFVLEDPKDFANRIYSVIKSNLNVSP  781



>ref|XP_002969701.1| hypothetical protein SELMODRAFT_451343 [Selaginella moellendorffii]
 gb|EFJ28825.1| hypothetical protein SELMODRAFT_451343 [Selaginella moellendorffii]
Length=867

 Score =   219 bits (557),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 130/157 (83%), Gaps = 3/157 (2%)
 Frame = -2

Query  778  DVSKEXLKI--KD-SKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            ++SKE LK+  KD  KAKELK+SFK L  WWK  L  + VD VKISNRLADTP VVVTS 
Sbjct  640  NISKEGLKLGQKDKEKAKELKQSFKPLLAWWKDVLKPEGVDSVKISNRLADTPAVVVTST  699

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIM++QTL+D S+Q YMRGKRVLEINPRHPIIKELR +V + PEDESTK T 
Sbjct  700  YGWSANMERIMRAQTLTDNSRQNYMRGKRVLEINPRHPIIKELRGKVDEQPEDESTKATG  759

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +LIYKTAL++SGF V D K+FAS+IY+ +KS+LNISP
Sbjct  760  KLIYKTALIDSGFLVDDSKEFASQIYSIIKSNLNISP  796



>ref|XP_002981308.1| hypothetical protein SELMODRAFT_444847 [Selaginella moellendorffii]
 gb|EFJ17496.1| hypothetical protein SELMODRAFT_444847 [Selaginella moellendorffii]
Length=867

 Score =   218 bits (556),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 130/157 (83%), Gaps = 3/157 (2%)
 Frame = -2

Query  778  DVSKEXLKI--KD-SKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            ++SKE LK+  KD  KAKELK+SFK L  WWK  L  + VD VKISNRLADTP VVVTS 
Sbjct  640  NISKEGLKLGQKDKEKAKELKQSFKPLLAWWKDVLKPEGVDSVKISNRLADTPAVVVTST  699

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIM++QTL+D S+Q YMRGKRVLEINPRHPIIKELR +V + PEDESTK T 
Sbjct  700  YGWSANMERIMRAQTLTDNSRQNYMRGKRVLEINPRHPIIKELRGKVDEQPEDESTKATG  759

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            +LIYKTAL++SGF V D K+FAS+IY+ +KS+LNISP
Sbjct  760  KLIYKTALIDSGFLVDDSKEFASQIYSIIKSNLNISP  796



>gb|KDO84886.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=762

 Score =   207 bits (526),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 109/114 (96%), Gaps = 1/114 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSKE LK+ KD+K KELKESFK+LTKWWKGALAS+NVD+VK+SNRL +TPCVVVTSK
Sbjct  623  FQNVSKEGLKLGKDTKDKELKESFKELTKWWKGALASENVDDVKVSNRLDNTPCVVVTSK  682

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDE  446
            YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE E
Sbjct  683  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEVE  736



>gb|KJB14398.1| hypothetical protein B456_002G122800 [Gossypium raimondii]
Length=739

 Score =   196 bits (497),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 107/112 (96%), Gaps = 1/112 (1%)
 Frame = -2

Query  784  FQDVSKEXLKI-KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            FQ+VSK+ LKI KDSK++ELK+SFK+LTKWWKG L +++VDEVKISNRL +TPCVVVTSK
Sbjct  616  FQNVSKDGLKIGKDSKSRELKDSFKELTKWWKGTLKTEDVDEVKISNRLDNTPCVVVTSK  675

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  452
            +GWSANMER+MQ+QTL+DASKQAYMRGKR+LEINPRHPI+KELRERVVKDPE
Sbjct  676  FGWSANMERLMQAQTLTDASKQAYMRGKRILEINPRHPIVKELRERVVKDPE  727



>ref|XP_003063917.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51539.1| predicted protein [Micromonas pusilla CCMP1545]
Length=820

 Score =   195 bits (496),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 119/161 (74%), Gaps = 6/161 (4%)
 Frame = -2

Query  784  FQDVSKEXLKIKDSKAKE------LKESFKDLTKWWKGALASDNVDEVKISNRLADTPCV  623
            F + SKE LK  D+  KE      LKE FKD T+WWK  L +D V+ VKISNRL  TPC 
Sbjct  615  FSNASKEDLKFGDTDDKEKARNKKLKEQFKDFTRWWKDVLPADEVESVKISNRLVTTPCS  674

Query  622  VVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDES  443
            VVTSKYGWSANMERIM++Q LSD S+ +YM+GK+ LEINPRHPIIK L+ER   D +DE 
Sbjct  675  VVTSKYGWSANMERIMKAQALSDESRLSYMKGKKTLEINPRHPIIKALKERAADDADDEE  734

Query  442  TKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  320
            TK  A+++++TA++ESGF   +P  FASR+++ V+S++ +S
Sbjct  735  TKTLAKVMFETAMLESGFTFEEPAGFASRLFDMVRSNMGVS  775



>ref|XP_002508627.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69885.1| predicted protein [Micromonas sp. RCC299]
Length=777

 Score =   186 bits (471),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 114/160 (71%), Gaps = 6/160 (4%)
 Frame = -2

Query  784  FQDVSKEXLKIKD------SKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCV  623
            F + SK+ LK  D      ++ K++KE FKD TKWWK  L S+ V+ VKISNRL  TPC 
Sbjct  591  FSNASKDDLKFGDDTEAAKARLKKVKEEFKDFTKWWKEILPSEEVEAVKISNRLVTTPCS  650

Query  622  VVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDES  443
            VVTSKYGWSANMERIM++Q LSD  + AYMRG++ LEINP HPIIK L+E+   D  DE 
Sbjct  651  VVTSKYGWSANMERIMKAQALSDDGRMAYMRGRKTLEINPGHPIIKALKEKSEDDAGDED  710

Query  442  TKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
            TK TA ++Y+TAL+ESGF   +PK FA R+++ V+  L +
Sbjct  711  TKRTALIMYETALLESGFMFEEPKGFAGRLFDMVRRDLGV  750



>ref|XP_001421809.1| Heat Shock Protein 90, endoplasmic reticulum [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP00103.1| Heat Shock Protein 90, endoplasmic reticulum [Ostreococcus lucimarinus 
CCE9901]
Length=794

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 115/160 (72%), Gaps = 6/160 (4%)
 Frame = -2

Query  784  FQDVSKEXLKIKDS------KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCV  623
            F + SKE LK  D+      + K+ KE+FK  T WWK  L    ++ VK+SNRL+ TPCV
Sbjct  596  FSNASKEDLKFGDADDDEKARFKKTKEAFKSFTTWWKSKLPDTMIEAVKVSNRLSTTPCV  655

Query  622  VVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDES  443
            VV+SKYGWSANMERIM++Q + D S+  YMRGK+ LE+NPRHP+I  L+ER   DP+ E 
Sbjct  656  VVSSKYGWSANMERIMKAQAMGDESRHEYMRGKKTLEVNPRHPMIAALKERAATDPDSEE  715

Query  442  TKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
            T+  A+L+++TA++ESGF+   P+++ SR+++ +KS++ I
Sbjct  716  TETLAKLMFETAMLESGFSFDKPQEYTSRVFDLLKSNMGI  755



>ref|XP_005842771.1| hypothetical protein CHLNCDRAFT_59468, partial [Chlorella variabilis]
 gb|EFN50654.1| hypothetical protein CHLNCDRAFT_59468 [Chlorella variabilis]
Length=325

 Score =   167 bits (423),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 108/149 (72%), Gaps = 7/149 (5%)
 Frame = -2

Query  784  FQDVSKEXLKIKDSKA------KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCV  623
            F +VSK+ LK+ D  A      K+LKE FKDL KWWK +L    V+ VK+S RLA TPCV
Sbjct  178  FANVSKDDLKLGDKDAGEKKADKKLKEEFKDLAKWWKESLGP-AVESVKVSKRLATTPCV  236

Query  622  VVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDES  443
            VV+SKYGWSA ME+I +SQTL D+ +  +MRG+R LEINPRHP+I+EL+ + + DPE  S
Sbjct  237  VVSSKYGWSATMEKIARSQTLGDSERAKWMRGQRTLEINPRHPLIRELKAQHIADPESAS  296

Query  442  TKETAQLIYKTALMESGFNVPDPKDFASR  356
             K+ AQL+Y+T L+ESG  + D K+F SR
Sbjct  297  VKDNAQLLYQTCLLESGCLLDDMKEFNSR  325



>emb|CEG00480.1| Histidine kinase-like ATPase, ATP-binding domain [Ostreococcus 
tauri]
Length=789

 Score =   171 bits (433),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 113/160 (71%), Gaps = 6/160 (4%)
 Frame = -2

Query  784  FQDVSKEXLKIKDS----KA--KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCV  623
            F + SKE LK  D+    KA  K+ K++FK  T WWK  L  + ++ VK+SNRL+ TPCV
Sbjct  594  FSNASKEDLKFGDADDDEKALFKKTKDAFKTFTTWWKSKLPDNVIEAVKVSNRLSTTPCV  653

Query  622  VVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDES  443
            VV+SKYGWSANMERIM++Q + D S+  YMRGK+ LEINPRHP+I  L+ER   DP+   
Sbjct  654  VVSSKYGWSANMERIMKAQAMGDESRHEYMRGKKTLEINPRHPMIAALKERAASDPDSTE  713

Query  442  TKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
             +  A+L+++TA++ESGF+   P D+A R+++ +K ++ +
Sbjct  714  NEALAKLMFETAMLESGFSFDKPGDYAGRVFDLLKMNMGV  753



>ref|XP_003083767.1| heat shock protein 90 (ISS) [Ostreococcus tauri]
Length=788

 Score =   171 bits (433),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 113/160 (71%), Gaps = 6/160 (4%)
 Frame = -2

Query  784  FQDVSKEXLKIKDS----KA--KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCV  623
            F + SKE LK  D+    KA  K+ K++FK  T WWK  L  + ++ VK+SNRL+ TPCV
Sbjct  593  FSNASKEDLKFGDADDDEKALFKKTKDAFKTFTTWWKSKLPDNVIEAVKVSNRLSTTPCV  652

Query  622  VVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDES  443
            VV+SKYGWSANMERIM++Q + D S+  YMRGK+ LEINPRHP+I  L+ER   DP+   
Sbjct  653  VVSSKYGWSANMERIMKAQAMGDESRHEYMRGKKTLEINPRHPMIAALKERAASDPDSTE  712

Query  442  TKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
             +  A+L+++TA++ESGF+   P D+A R+++ +K ++ +
Sbjct  713  NEALAKLMFETAMLESGFSFDKPGDYAGRVFDLLKMNMGV  752



>ref|XP_007512535.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17135.1| predicted protein [Bathycoccus prasinos]
Length=1223

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 116/163 (71%), Gaps = 9/163 (6%)
 Frame = -2

Query  784   FQDVSKEXLKIKDS------KAKELKESFKDLTKWWKGALAS---DNVDEVKISNRLADT  632
             F + SKE +K  D+      + K+ KE FK  TKWWK AL +   D+++ VKISNRL+ T
Sbjct  1014  FSNASKEDMKFGDADEGEKKQFKKTKEHFKPFTKWWKDALLTSYPDSIENVKISNRLSTT  1073

Query  631   PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  452
             PCVVVTSKYGWSANMERIM++Q LSD S+  YM+GK+ LEIN +HP++  L+E+   D E
Sbjct  1074  PCVVVTSKYGWSANMERIMRAQALSDDSRAQYMKGKKTLEINYKHPLVAALKEKYEADGE  1133

Query  451   DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
             DE++K  A ++++TAL+ESGF + D K  ASR+++ +K  + +
Sbjct  1134  DETSKNLAVVMFETALIESGFVIDDSKSMASRVFDLLKDKMGV  1176



>gb|AFK40768.1| unknown [Lotus japonicus]
Length=82

 Score =   149 bits (377),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = -2

Query  589  MERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKT  410
            MERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDES K+TAQL+Y+T
Sbjct  1    MERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESVKQTAQLMYQT  60

Query  409  ALMESGFNVPDPKDFASRI  353
            AL ESGF + DPKDFASRI
Sbjct  61   ALFESGFLLNDPKDFASRI  79



>gb|ACN26939.1| unknown [Zea mays]
Length=123

 Score =   148 bits (374),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -2

Query  589  MERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKT  410
            ME+IMQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K TA+L+Y+T
Sbjct  1    MEKIMQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTARLVYQT  60

Query  409  ALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            ALMESGFN+PDPK+FAS IY SV+  L++SP
Sbjct  61   ALMESGFNLPDPKEFASSIYKSVQKGLDLSP  91



>ref|XP_001753222.1| predicted protein [Physcomitrella patens]
 gb|EDQ81851.1| predicted protein [Physcomitrella patens]
Length=759

 Score =   154 bits (390),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 109/160 (68%), Gaps = 4/160 (3%)
 Frame = -2

Query  784  FQDVSKEXLKIKDSKAKELKESFKD----LTKWWKGALASDNVDEVKISNRLADTPCVVV  617
            FQD SK+ LKI   + K   +        LT+WWK  LA +++  VK+S RLA+TP VVV
Sbjct  561  FQDASKDSLKILGKEGKVKMKKAAKMYKKLTRWWKDLLAGESIGFVKVSARLANTPAVVV  620

Query  616  TSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTK  437
            TS+ GWS+NMER++ +Q L D SK + M+ KR+LEINPRHPII+ L ++V +DP DE   
Sbjct  621  TSRTGWSSNMERVVLAQALVDPSKVSQMKSKRILEINPRHPIIRMLLQKVTEDPADEVAH  680

Query  436  ETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
              A LIY+TAL+ESGF + + K FA +I++ +K  L++ P
Sbjct  681  RVAVLIYETALLESGFTLNNAKTFAEQIHSLMKLVLDVDP  720



>ref|NP_999808.1| heat shock protein gp96 precursor [Strongylocentrotus purpuratus]
 gb|AAO21341.1| heat shock protein gp96 [Strongylocentrotus purpuratus]
Length=806

 Score =   152 bits (384),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 111/166 (67%), Gaps = 10/166 (6%)
 Frame = -2

Query  784  FQDVSKEXLKI--KDSKA-----KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPC  626
            FQ+V+KE LKI  +DS+A     +EL+  F+ L KW K A   D + + K+SNRL+D+PC
Sbjct  588  FQNVAKEGLKIDGEDSEAAKERKEELEAKFEPLLKWLKDAALGDEIKDAKLSNRLSDSPC  647

Query  625  VVVTSKYGWSANMERIMQSQTLSDASK---QAYMRGKRVLEINPRHPIIKELRERVVKDP  455
             +V S+YGWS NMERIM++Q  + A+    + Y   K+ LE+NPRHP+IK L E+V  D 
Sbjct  648  ALVASQYGWSGNMERIMKAQAYAQANNPNTEYYASQKKTLEVNPRHPLIKTLLEKVEADA  707

Query  454  EDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  317
            EDE+ K+ A ++++TA + SGF +PD   FA RI   +K S+N+ P
Sbjct  708  EDETAKDLAVVMFETATLRSGFALPDSAAFAGRIERMLKISMNLDP  753



>ref|XP_001701885.1| heat shock protein 90B [Chlamydomonas reinhardtii]
 gb|EDP06860.1| heat shock protein 90B, partial [Chlamydomonas reinhardtii]
Length=768

 Score =   151 bits (382),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 106/157 (68%), Gaps = 5/157 (3%)
 Frame = -2

Query  784  FQDVSKEXLKIKDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKY  605
            F + SKE LK+ D K +ELKE FKDLTKWWK  +    +  VK+SNRLA TPC+VVT KY
Sbjct  569  FSNASKEDLKLTD-KDEELKEQFKDLTKWWKKVVDDSKLQGVKVSNRLATTPCIVVTGKY  627

Query  604  GWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE---DESTKE  434
            G SANMERIM++Q  S     ++   +R LEINPRHP+I  L++++    E   +ES   
Sbjct  628  GNSANMERIMRAQAFSRPG-SSFTPTQRTLEINPRHPLIVALKDKLAAATEETVEESAVA  686

Query  433  TAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
            TA+L+Y+TAL+ESGF   D K F+ R+Y  +K +L +
Sbjct  687  TARLLYETALLESGFVPDDAKAFSQRMYGVLKDTLGV  723



>ref|XP_005651682.1| heat shock protein Hsp90 [Coccomyxa subellipsoidea C-169]
 gb|EIE27138.1| heat shock protein Hsp90 [Coccomyxa subellipsoidea C-169]
Length=768

 Score =   151 bits (382),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 107/157 (68%), Gaps = 4/157 (3%)
 Frame = -2

Query  784  FQDVSKEXLKIKDSKAKELK---ESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVT  614
            FQD SK+ +K+     K LK   E FKD+  WWK  L +  V +VK+S RLA +P +V+T
Sbjct  583  FQDASKDDVKLGKDDKKGLKKLKEEFKDVLAWWKELLGA-AVGQVKVSTRLATSPAIVLT  641

Query  613  SKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKE  434
            SKYGWSANMERIM+SQ L D + ++YM+G + LEINPRHP++ EL+ +  +D E +    
Sbjct  642  SKYGWSANMERIMKSQALGDTADRSYMKGMKTLEINPRHPLVLELKRQFEEDKESDKAAA  701

Query  433  TAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
             A+L++ TAL+ESGF +  PK+F SRIY  +  + NI
Sbjct  702  YARLLWDTALLESGFEIEAPKEFNSRIYGLLAQAYNI  738



>ref|XP_006220022.1| PREDICTED: heat shock protein 90-like, partial [Vicugna pacos]
Length=189

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 104/157 (66%), Gaps = 6/157 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +S     K +E K  F++L K  K  L    V++V +SNRL  +PC +VTS
Sbjct  1    VTKEGLELPESEDEKKKFEEDKVKFENLCKVIKDILEK-KVEKVAVSNRLVHSPCCIVTS  59

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGWSANMERIM++Q L D+S   YM  K+ LEINP H I+K LRERV  D  D++ K+ 
Sbjct  60   EYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRERVEVDKNDKTVKDL  119

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  320
              L+++TAL+ SGF + +P+  ASRIY  +K  L+I 
Sbjct  120  VILLFETALLSSGFTLEEPQSHASRIYRMIKLGLDIG  156



>gb|KHJ75602.1| Hsp90 protein [Oesophagostomum dentatum]
Length=212

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 106/157 (68%), Gaps = 6/157 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +S     K +E K  F++L K  K  L    V++V +SNRL ++PC +VTS
Sbjct  24   VTKEGLELPESEDEKKKFEEDKVKFENLCKVIKDILEK-KVEKVVVSNRLVNSPCCIVTS  82

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGWSANMERIM++Q L D+S   YM  K+ LEINP H I+K LRERV  D  D++ K+ 
Sbjct  83   EYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRERVEVDKNDKTVKDL  142

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  320
              L+++TAL+ SGF++ +P+  ASRIY  +K  L+I 
Sbjct  143  VILLFETALLSSGFSLEEPQSHASRIYRMIKLGLDIG  179



>ref|XP_006678605.1| hypothetical protein BATDEDRAFT_36900 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF80649.1| hypothetical protein BATDEDRAFT_36900 [Batrachochytrium dendrobatidis 
JAM81]
Length=586

 Score =   147 bits (372),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 104/140 (74%), Gaps = 1/140 (1%)
 Frame = -2

Query  742  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  563
            K K+ KE+F+ LTK  K  L  D V++V ISNR+ ++PCV+VT++YGWSANMERIM++Q 
Sbjct  419  KLKQQKEAFEPLTKQIKEILG-DKVEKVTISNRIVNSPCVLVTNQYGWSANMERIMKAQA  477

Query  562  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  383
            L DAS Q+YM GK+ LE+NP + I+K L+ +V +D  D++ K+  QL+Y+TAL+ SGF++
Sbjct  478  LRDASMQSYMLGKKTLELNPDNAIVKALKVKVDEDKNDKTVKDLTQLLYETALLSSGFSL  537

Query  382  PDPKDFASRIYNSVKSSLNI  323
             +P  FA RI+  +K  L+I
Sbjct  538  EEPSSFAGRIHRMIKLGLSI  557



>gb|AEG19531.1| heat shock protein 90 [Glaciozyma antarctica]
Length=707

 Score =   147 bits (372),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 110/157 (70%), Gaps = 8/157 (5%)
 Frame = -2

Query  775  VSKEXLKI------KDSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVT  614
            VSK+ L++      K ++  E KE F+DLT+  K  L  D V++V ISNR+AD+PCV+VT
Sbjct  522  VSKDGLELEETDEEKAARETETKE-FEDLTRTMKDILG-DKVEKVSISNRIADSPCVLVT  579

Query  613  SKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKE  434
             ++GWS+NMERIM++Q L D+S  +YM+ K+ LEINP + IIKELR +V +D  D++ K 
Sbjct  580  GQFGWSSNMERIMKAQALRDSSMSSYMQSKKTLEINPHNAIIKELRRKVQEDAADKTVKS  639

Query  433  TAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
               L+Y+TAL+ SGF +  P DFA+RI+N +   L+I
Sbjct  640  LIVLLYETALLTSGFTLDAPVDFANRIHNMISLGLSI  676



>gb|KDE07091.1| heat shock protein 90-1 [Microbotryum violaceum p1A1 Lamole]
Length=707

 Score =   147 bits (372),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 112/156 (72%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS---KAKELKES--FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            VSK+ L+++++   KA+  KE+  F+DLT+  K  L  D V++V ISNR++D+PCV+VT 
Sbjct  518  VSKDGLELEETDEEKAQREKETKEFEDLTRTIKEILG-DKVEKVSISNRISDSPCVLVTG  576

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
             +GWSANMERIM++Q L DAS  +YM+ K+ LEINP + I+KELR +V +D  D++ ++ 
Sbjct  577  AFGWSANMERIMKAQALRDASMSSYMQSKKTLEINPHNAIVKELRSKVQEDAADKTVRDL  636

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+Y+TAL+ SGF +  P DFA+RI+  +   L+I
Sbjct  637  VTLLYETALLTSGFTLDAPTDFAARIHRMISLGLSI  672



>ref|XP_007515443.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14322.1| predicted protein [Bathycoccus prasinos]
Length=802

 Score =   147 bits (372),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 101/140 (72%), Gaps = 1/140 (1%)
 Frame = -2

Query  742  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  563
            K +++ + FK +T+W K  L  + V++V++S+RL +TPC++VTSK+GWSANMERIM++Q 
Sbjct  650  KNEQIADEFKTVTEWLKKELVGE-VEKVEVSSRLTETPCILVTSKFGWSANMERIMKAQA  708

Query  562  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  383
            + DA  Q YM+GK+ LEINP  P+IK+L+ RV   P+ E TKE  +L++ TAL+ SGF++
Sbjct  709  MGDARAQDYMKGKKTLEINPFSPVIKQLKMRVESAPDAEETKEMCKLLFDTALLTSGFSI  768

Query  382  PDPKDFASRIYNSVKSSLNI  323
              P +FA R++  +    N+
Sbjct  769  DQPAEFAERVFKLMTQEANL  788



>ref|XP_308799.3| AGAP006959-PA [Anopheles gambiae str. PEST]
 gb|EAA04769.4| AGAP006959-PA [Anopheles gambiae str. PEST]
Length=393

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = -2

Query  742  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  563
            K +E K  F++L K  K  L S  V++V +SNRL D+PC +VTS+YGWSANMERIM++Q 
Sbjct  213  KREEDKAKFENLCKVMKSVLES-KVEKVMVSNRLVDSPCCIVTSQYGWSANMERIMKAQA  271

Query  562  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  383
            L D+S   YM GK+ LEINP H II+ LR+R   D  D++ K+   L+++TAL+ SGF++
Sbjct  272  LRDSSAMGYMAGKKHLEINPDHAIIETLRQRAEADKNDKAVKDLVILLFETALLSSGFSL  331

Query  382  PDPKDFASRIYNSVKSSLNI  323
             +P   ASRIY  +K  L I
Sbjct  332  DEPGTHASRIYRMIKLGLGI  351



>ref|XP_009065664.1| hypothetical protein LOTGIDRAFT_197084 [Lottia gigantea]
 gb|ESO83635.1| hypothetical protein LOTGIDRAFT_197084 [Lottia gigantea]
Length=792

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 110/162 (68%), Gaps = 8/162 (5%)
 Frame = -2

Query  784  FQDVSKEXLKIKDS-KAKELKES----FKDLTKWWKGALASDNVDEVKISNRLADTPCVV  620
            FQ+V+KE LK+ DS KAKE KE+    F+ L  W K +  +D +++  IS RLA +PC +
Sbjct  588  FQNVAKEGLKLDDSEKAKERKEATEKEFEPLITWLKDSALNDKIEKATISERLASSPCAL  647

Query  619  VTSKYGWSANMERIMQSQTLS---DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPED  449
            V S+YGWS NMERIMQ+Q  +   D S++ Y   K+ LEINPRHP+IKEL++RV  + ED
Sbjct  648  VASQYGWSGNMERIMQAQAYAKAKDPSQEFYATQKKTLEINPRHPLIKELKKRVEANKED  707

Query  448  ESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
            E+ K+ A ++++TA + SG+ + D   FA R+ N ++ SL +
Sbjct  708  ETAKDLAVVMFETATVRSGYRITDTAGFAQRVENMLRLSLEV  749



>ref|XP_005843734.1| hypothetical protein CHLNCDRAFT_140066 [Chlorella variabilis]
 gb|EFN51632.1| hypothetical protein CHLNCDRAFT_140066 [Chlorella variabilis]
Length=574

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 102/151 (68%), Gaps = 8/151 (5%)
 Frame = -2

Query  784  FQDVSKEXLKI----KDSKAKE-LKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVV  620
              DVS+E L++    +D KA E   E  K LT + K  L  D V++V +++RL D+P VV
Sbjct  381  LTDVSREDLQLDESEEDKKALEGASEELKGLTAYMKKVLG-DKVEKVAVTSRLTDSPAVV  439

Query  619  VTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDEST  440
            V SK+GWSANMERIM+SQ + DA    YMRG+R++E+NP+HPII+ L+ +V  + E    
Sbjct  440  VASKFGWSANMERIMRSQAMGDARSAEYMRGRRIMELNPQHPIIRTLKSKV--ELESREA  497

Query  439  KETAQLIYKTALMESGFNVPDPKDFASRIYN  347
            KE  QL+Y+ AL+  GF +  PKDFA+RIY+
Sbjct  498  KEQVQLLYEAALLAGGFMIESPKDFAARIYS  528



>gb|ACU45247.1| HSP90 [Karlodinium veneficum]
Length=373

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 106/158 (67%), Gaps = 5/158 (3%)
 Frame = -2

Query  784  FQDVSKEXLKIKDS----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVV  617
             +  +KE L I+D     K +ELK  F+ LTK  K  L  D V++V IS+R+AD+PCV+ 
Sbjct  184  LKSTTKEGLDIEDEDEKKKIEELKAEFEPLTKLMKEVLG-DKVEKVLISSRMADSPCVLT  242

Query  616  TSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTK  437
            TS+YGWSANMERIM++Q L D S  +YM  K+ +E+NP+H I+ EL+++   D  D++ K
Sbjct  243  TSEYGWSANMERIMKAQALRDNSMTSYMVSKKTMEVNPKHSIMTELKKKAAADKSDKTVK  302

Query  436  ETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
            +   L++ T+L+ SGFN+ +P  FA RI+  +K  L+I
Sbjct  303  DLIWLLFDTSLLTSGFNLDEPTQFAGRIHRMIKLGLSI  340



>gb|EWM29604.1| heat shock protein 90 [Nannochloropsis gaditana]
Length=713

 Score =   145 bits (367),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 109/157 (69%), Gaps = 7/157 (4%)
 Frame = -2

Query  775  VSKEXLKI-----KDSKA-KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVT  614
            V+KE LKI     +++KA +ELK   + L K  K  L  + VD+V +S RLAD+PCV+VT
Sbjct  524  VTKEGLKIDEDDEEEAKAFEELKAKTEGLCKLMKEVL-DEKVDKVVVSPRLADSPCVLVT  582

Query  613  SKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKE  434
             +YGWSANMERIM++Q L D+S  AYM  K+ +EINP+HPI+K LRE+   +  D++ K+
Sbjct  583  GEYGWSANMERIMKAQALRDSSTSAYMTSKKTMEINPKHPIVKALREKAEANQTDKTLKD  642

Query  433  TAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
               L+Y T+L+ SGF++ DP  FASRI+  +K  L+I
Sbjct  643  LTWLLYDTSLLTSGFSLDDPNTFASRIHRLIKLGLSI  679



>ref|XP_005855339.1| molecular chaperone HtpG [Nannochloropsis gaditana CCMP526]
 gb|EKU21014.1| molecular chaperone HtpG [Nannochloropsis gaditana CCMP526]
Length=712

 Score =   145 bits (367),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 109/157 (69%), Gaps = 7/157 (4%)
 Frame = -2

Query  775  VSKEXLKI-----KDSKA-KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVT  614
            V+KE LKI     +++KA +ELK   + L K  K  L  + VD+V +S RLAD+PCV+VT
Sbjct  524  VTKEGLKIDEDDEEEAKAFEELKAKTEGLCKLMKEVL-DEKVDKVVVSPRLADSPCVLVT  582

Query  613  SKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKE  434
             +YGWSANMERIM++Q L D+S  AYM  K+ +EINP+HPI+K LRE+   +  D++ K+
Sbjct  583  GEYGWSANMERIMKAQALRDSSTSAYMTSKKTMEINPKHPIVKALREKAEANQTDKTLKD  642

Query  433  TAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
               L+Y T+L+ SGF++ DP  FASRI+  +K  L+I
Sbjct  643  LTWLLYDTSLLTSGFSLDDPNTFASRIHRLIKLGLSI  679



>emb|CAG01829.1| unnamed protein product [Tetraodon nigroviridis]
Length=212

 Score =   138 bits (347),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 89/132 (67%), Gaps = 1/132 (1%)
 Frame = -2

Query  718  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  539
            F++L K  K  L    +++V +SNRL  +PC +VTS YGW+ANMERIM+SQ L D+S   
Sbjct  48   FENLCKIMKDIL-DKKIEKVTVSNRLVASPCCIVTSTYGWTANMERIMKSQALRDSSTMG  106

Query  538  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  359
            YM  K+ LEINP HPII+ LRE+   D  D++ K+   L+Y+TAL+ SGF + DP+  A+
Sbjct  107  YMTAKKHLEINPLHPIIETLREKAEADKNDKAVKDLVILLYETALLSSGFTLEDPQTHAN  166

Query  358  RIYNSVKSSLNI  323
            RIY  +K  L I
Sbjct  167  RIYRMIKLGLGI  178



>ref|XP_308800.3| AGAP006958-PA [Anopheles gambiae str. PEST]
 sp|Q7PT10.3|HSP83_ANOGA RecName: Full=Heat shock protein 83 [Anopheles gambiae]
 gb|EAA04712.4| AGAP006958-PA [Anopheles gambiae str. PEST]
Length=720

 Score =   145 bits (365),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 105/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDSKAK-----ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ + +A+     E K  F++L K  K  L S  V++V +SNRL D+PC +VTS
Sbjct  524  VTKEGLELPEDEAEKKKREEDKAKFENLCKVMKSVLES-KVEKVMVSNRLVDSPCCIVTS  582

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGWSANMERIM++Q L D+S   YM GK+ LEINP H II+ LR+R   D  D++ K+ 
Sbjct  583  QYGWSANMERIMKAQALRDSSAMGYMAGKKHLEINPDHAIIETLRQRAEADKNDKAVKDL  642

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF++ +P   ASRIY  +K  L I
Sbjct  643  VILLFETALLSSGFSLDEPGTHASRIYRMIKLGLGI  678



>ref|XP_001740319.1| heat shock protein [Entamoeba dispar SAW760]
 gb|EDR23250.1| heat shock protein, putative [Entamoeba dispar SAW760]
Length=207

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 93/131 (71%), Gaps = 1/131 (1%)
 Frame = -2

Query  715  KDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQAY  536
            ++L+K  K  L  D +++V ISNRL ++PC +VT +YGWSANMERIM++Q L D S   Y
Sbjct  49   EELSKVVKEILG-DKIEKVVISNRLVNSPCALVTGEYGWSANMERIMKAQALRDNSMSTY  107

Query  535  MRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASR  356
            M  K+ LEINP HPI++ELR+RV  D  D++ K+   L+++TAL+ SGF++ +P  FA R
Sbjct  108  MVSKKTLEINPDHPIVQELRKRVHTDNSDKTVKDLVVLLFETALLSSGFSLDEPAAFAGR  167

Query  355  IYNSVKSSLNI  323
            IY  VK  L++
Sbjct  168  IYRMVKLGLSL  178



>ref|XP_005538149.1| heat shock protein of Hsp90 family [Cyanidioschyzon merolae strain 
10D]
 dbj|BAC67671.2| heat shock 90kD protein [Cyanidioschyzon merolae strain 10D]
 dbj|BAM82113.1| heat shock protein of Hsp90 family [Cyanidioschyzon merolae strain 
10D]
Length=706

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = -2

Query  718  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  539
            F +L K  K  L  D V++V +S RLAD+PC++VTS++GWSANMERIM++Q L D++   
Sbjct  542  FANLLKVMKDILG-DRVEKVILSERLADSPCILVTSEFGWSANMERIMKAQALRDSTMSM  600

Query  538  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  359
            YM  K+++E+NP +PII+ELR+RV  DP D++ K+   L+Y TAL+ SGF++ +P  F+S
Sbjct  601  YMSAKKIMEVNPSNPIIRELRDRVEADPSDKTVKDLVNLLYDTALLASGFSLDEPNTFSS  660

Query  358  RIYNSVKSSLNI  323
            RI+  +K  L+I
Sbjct  661  RIHRMIKLGLSI  672



>gb|EJT49886.1| chaperone [Trichosporon asahii var. asahii CBS 2479]
 gb|EKC98967.1| chaperone [Trichosporon asahii var. asahii CBS 8904]
Length=691

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 113/157 (72%), Gaps = 8/157 (5%)
 Frame = -2

Query  775  VSKEXLKIKDS---KA---KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVT  614
            VSKE L+++++   KA   KE KE F+DL K  K  L  D V++V +SNR+ D+PCV+VT
Sbjct  508  VSKEGLELEETPEEKAELEKEQKE-FEDLCKNIKETLG-DRVEKVVVSNRITDSPCVLVT  565

Query  613  SKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKE  434
             ++GWS+NMERIM++Q L D+S  +YM  K+ LEINP+HPIIKEL+++  +D  D++ K+
Sbjct  566  GQFGWSSNMERIMKAQALRDSSMSSYMASKKTLEINPQHPIIKELKKKSDEDKGDKTVKD  625

Query  433  TAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
               L+Y+T+L+ SGF + +P+DFASRI   +   L+I
Sbjct  626  LTTLLYETSLLTSGFTLNNPQDFASRINRMISLGLSI  662



>gb|AGW82181.1| heat shcok protein 90, partial [Corbicula fluminea]
Length=190

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 101/156 (65%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDSKAK-----ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ + +A+     E K  F+ L K  K  L    V++V +SNRL ++PC +VTS
Sbjct  34   VTKEGLELPEDEAEKKKREEQKAEFEGLCKVMKEIL-DKKVEKVTVSNRLVNSPCCIVTS  92

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGWSANMERIM++Q L D+S   YM  K+ LEINP H IIK L+E+V  D  D+S K+ 
Sbjct  93   QYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSIIKALKEKVSVDKNDKSVKDL  152

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF + DP   A+RI   +K  L I
Sbjct  153  VLLMFETALLASGFALEDPTTHANRINRMIKLGLGI  188



>ref|XP_010902983.1| PREDICTED: heat shock protein HSP 90-alpha 1 [Esox lucius]
Length=725

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 102/156 (65%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +      K +ELK +F++L K  K  L    +++V +SNRL  +PC +VTS
Sbjct  537  VTKEGLELPEDEDEKKKQEELKTTFENLCKIMKDIL-DKKIEKVTVSNRLVSSPCCIVTS  595

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
             YGW+ANMERIM+SQ L D S   YM  K+ LEINP HPII+ LRE+   D  D++ K+ 
Sbjct  596  TYGWTANMERIMKSQALRDNSTMGYMTAKKHLEINPTHPIIETLREKAEADKNDKAVKDL  655

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TALM SGF + DP+  A+RIY  +K  L I
Sbjct  656  VILLFETALMSSGFTLDDPQTHANRIYRMIKLGLGI  691



>gb|AAB05638.1| heat shock protein 82 [Anopheles albimanus]
 gb|AAB05639.1| heat shock protein 82 [Anopheles albimanus]
Length=721

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 105/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDSKAK-----ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ + +A+     E K  F++L K  K  L S  V++V +SNRL D+PC +VTS
Sbjct  526  VTKEGLELPEDEAEKKKREEDKAKFENLCKVMKSVLES-KVEKVVVSNRLVDSPCCIVTS  584

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGWSANMERIM++Q L D+S   YM GK+ LEINP H II+ LR+R   D  D++ K+ 
Sbjct  585  QYGWSANMERIMKAQALRDSSAMGYMAGKKHLEINPDHAIIETLRQRAEADKNDKAVKDL  644

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF++ +P   A+RIY  VK  L I
Sbjct  645  VILLFETALLSSGFSLDEPGTHAARIYRMVKLGLGI  680



>gb|KFB48797.1| hypothetical protein ZHAS_00016808 [Anopheles sinensis]
Length=573

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 105/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDSKAK-----ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ + +A+     E K  F++L K  K  L  + V++V +SNRL D+PC +VTS
Sbjct  378  VTKEGLELPEDEAEKKKREEDKAKFENLCKVMKSVL-ENKVEKVVVSNRLVDSPCCIVTS  436

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGWSANMERIM++Q L D+S   YM GK+ LEINP H I++ LR+R   D  D++ K+ 
Sbjct  437  QYGWSANMERIMKAQALRDSSAMGYMAGKKHLEINPDHAIVETLRQRADADKNDKAVKDL  496

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF++ +P   ASRIY  +K  L I
Sbjct  497  VILLFETALLSSGFSLDEPGTHASRIYRMIKLGLGI  532



>gb|ETN67039.1| heat shock protein [Anopheles darlingi]
Length=721

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 105/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDSKAK-----ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ + +A+     E K  F++L K  K  L S  V++V +SNRL D+PC +VTS
Sbjct  526  VTKEGLELPEDEAEKKKREEDKAKFENLCKVMKSVLES-KVEKVVVSNRLVDSPCCIVTS  584

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGWSANMERIM++Q L D+S   YM GK+ LEINP H II+ LR+R   D  D++ K+ 
Sbjct  585  QYGWSANMERIMKAQALRDSSAMGYMAGKKHLEINPDHAIIETLRQRADADKNDKAVKDL  644

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF++ +P   A+RIY  VK  L I
Sbjct  645  VILLFETALLSSGFSLDEPGTHAARIYRMVKLGLGI  680



>ref|XP_002968038.1| hypothetical protein SELMODRAFT_88538 [Selaginella moellendorffii]
 gb|EFJ31385.1| hypothetical protein SELMODRAFT_88538 [Selaginella moellendorffii]
Length=751

 Score =   144 bits (363),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 99/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  784  FQDVSKEXLKIK---DSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVT  614
            F D+SKE L +    ++K +E++  F     W K  L  + V  V ISNRL+ +PCV+VT
Sbjct  528  FVDISKEDLDLGAADEAKEQEIEREFTYCCDWIKQILG-EKVASVGISNRLSTSPCVLVT  586

Query  613  SKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKE  434
             K+GWSANMERIM++Q L D S+  YMRGKR+LEINP+HPII  L E     P D   +E
Sbjct  587  GKHGWSANMERIMKAQALGDTSQLDYMRGKRILEINPQHPIIASLNEACKSSPHDTRAQE  646

Query  433  TAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLN  326
              +L+Y+TA + SGF   +  +F +RIY+ +  +L 
Sbjct  647  IVELLYETAHVSSGFTPDNASEFGARIYDMIGVALG  682



>ref|XP_002021279.1| GL24896 [Drosophila persimilis]
 gb|EDW40435.1| GL24896 [Drosophila persimilis]
Length=362

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 104/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDSKAK-----ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ + +A+     E K  F+ L K  K  L S  V++V +SNRL D+PC +VTS
Sbjct  174  VTKEGLELPEDEAEKKKREEDKAKFEGLCKLMKSILDS-KVEKVVVSNRLVDSPCCIVTS  232

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            ++GWSANMERIM++Q L D +   YM GK+ LEINP HPI++ LR++   D  D++ K+ 
Sbjct  233  QFGWSANMERIMKAQALRDTATMGYMAGKKQLEINPDHPIVEALRQKADADKNDKAVKDL  292

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++T+L+ SGF++  P+  ASRIY  +K  L I
Sbjct  293  VILLFETSLLSSGFSLDSPQVHASRIYRMIKLGLGI  328



>gb|ACF95812.1| heat shock protein 90 [Amphidinium carterae]
Length=682

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 107/158 (68%), Gaps = 5/158 (3%)
 Frame = -2

Query  784  FQDVSKEXLKIKDS----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVV  617
             +  +KE L+I D     K +E+K  F+ LTK  K  L  D V++V IS+R+AD+PCV+ 
Sbjct  493  LKSTTKEGLEIDDEDEKKKLEEMKAEFEPLTKLMKEVLG-DKVEKVLISSRMADSPCVLT  551

Query  616  TSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTK  437
            TS+YGWSANMERIM++Q L D+S  +YM  K+ +E+NP+H I+ EL+++   D  D++ K
Sbjct  552  TSEYGWSANMERIMKAQALRDSSMTSYMVSKKTMEVNPKHSIMSELKKKASADKSDKTVK  611

Query  436  ETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
            +   L++ TAL+ SGFN+ +P  FA RI+  +K  L+I
Sbjct  612  DLIWLLFDTALLTSGFNLDEPTQFAGRIHRMIKLGLSI  649



>ref|XP_002992602.1| hypothetical protein SELMODRAFT_448838 [Selaginella moellendorffii]
 gb|EFJ06304.1| hypothetical protein SELMODRAFT_448838 [Selaginella moellendorffii]
Length=836

 Score =   144 bits (363),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 99/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  784  FQDVSKEXLKIK---DSKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVT  614
            F D+SKE L +    ++K +E++  F     W K  L  + V  V ISNRL+ +PCV+VT
Sbjct  613  FVDISKEDLDLGAADEAKEQEIEREFTYCCDWIKQILG-EKVASVGISNRLSTSPCVLVT  671

Query  613  SKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKE  434
             K+GWSANMERIM++Q L D S+  YMRGKR+LEINP+HPII  L E     P D   +E
Sbjct  672  GKHGWSANMERIMKAQALGDTSQLDYMRGKRILEINPQHPIIASLNEACKSSPHDTRAQE  731

Query  433  TAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLN  326
              +L+Y+TA + SGF   +  +F +RIY+ +  +L 
Sbjct  732  IVELLYETAHVSSGFTPDNASEFGARIYDMIGVALG  767



>gb|ADV03069.1| heat shock protein 90 [Amphidinium carterae]
Length=710

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 107/158 (68%), Gaps = 5/158 (3%)
 Frame = -2

Query  784  FQDVSKEXLKIKDS----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVV  617
             +  +KE L+I D     K +E+K  F+ LTK  K  L  D V++V IS+R+AD+PCV+ 
Sbjct  521  LKSTTKEGLEIDDEDEKKKLEEMKAEFEPLTKLMKEVLG-DKVEKVLISSRMADSPCVLT  579

Query  616  TSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTK  437
            TS+YGWSANMERIM++Q L D+S  +YM  K+ +E+NP+H I+ EL+++   D  D++ K
Sbjct  580  TSEYGWSANMERIMKAQALRDSSMTSYMVSKKTMEVNPKHSIMSELKKKASADKSDKTVK  639

Query  436  ETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
            +   L++ TAL+ SGFN+ +P  FA RI+  +K  L+I
Sbjct  640  DLIWLLFDTALLTSGFNLDEPTQFAGRIHRMIKLGLSI  677



>gb|KHJ75025.1| Hsp90 protein [Oesophagostomum dentatum]
Length=257

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 104/163 (64%), Gaps = 8/163 (5%)
 Frame = -2

Query  784  FQDVSKEXLKIKDSKA-----KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVV  620
            FQ+V+KE + I DS+      KEL++ ++ LT+W K     D +++  +S RL  +P  +
Sbjct  58   FQNVAKEGVSIDDSEKAKEAYKELEKEYEPLTQWLKETALKDKIEKAVVSQRLVKSPSAL  117

Query  619  VTSKYGWSANMERIMQSQTLS---DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPED  449
            V S YGWS NMERIM+SQ  +   D +++ Y   K+  EINPRHP++KEL  RVV D  D
Sbjct  118  VASSYGWSGNMERIMKSQAYAKAKDPTQEFYANQKKTFEINPRHPVVKELLRRVVADGSD  177

Query  448  ESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  320
            +   +TA L+++TA + SGF++ D   FA RI + ++ SL++S
Sbjct  178  QRAMDTAMLLFETATLRSGFSLQDQVGFAERIEHVLRQSLDVS  220



>gb|ABF61871.1| chaperone [Agave tequilana]
Length=174

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = -2

Query  721  SFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQ  542
            +F++L K  K  L  D V++V +S+R+ D+PC +VT +YGW+ANMERIM++Q L D +  
Sbjct  15   AFENLCKTMKEILG-DRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDNNMS  73

Query  541  AYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFA  362
            AYM  K+ +EINP + I++ELR+R   D  D+S K+   L+++TAL+ SGF++ DP  FA
Sbjct  74   AYMSSKKTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFA  133

Query  361  SRIYNSVKSSLNI  323
             RI+  +K  LNI
Sbjct  134  GRIHRMLKLGLNI  146



>gb|KIO34802.1| hypothetical protein M407DRAFT_90187 [Tulasnella calospora MUT 
4182]
Length=697

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 113/156 (72%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS----KAKELK-ESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            VSKE L+++++    KA+E + + F+DL K  K AL  D V++V +SNR++D+PCV+VT 
Sbjct  514  VSKEGLELEETEDEKKAREEEAKQFEDLCKTIKDALG-DKVEKVVVSNRISDSPCVLVTG  572

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            ++GWS+NMERIM++Q L D+S  +YM  K+ LE+NP +PI+KEL+++V +D  D+S ++ 
Sbjct  573  QFGWSSNMERIMKAQALRDSSMSSYMASKKTLELNPHNPIVKELKKKVAEDKADKSVRDL  632

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF + DP  FA RI+  +   L++
Sbjct  633  TFLLFETALLTSGFVLDDPTSFAKRIHRMISLGLDV  668



>gb|EMS22510.1| molecular chaperone HtpG [Rhodosporidium toruloides NP11]
 emb|CDR46785.1| RHTO0S13e01772g1_1 [Rhodosporidium toruloides]
Length=697

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 110/156 (71%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS----KAKELK-ESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            +SKE L+++++    KA+E + + F+DLT+  K  L  D V++V ISNR+AD+PC++VT 
Sbjct  511  ISKEGLELEETDEEKKAREDEAKQFEDLTRTMKEVLG-DRVEKVTISNRIADSPCILVTG  569

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            ++GWSANMERIM++Q L DAS  +YM  K+ LEINP + II+EL+ +V  D  D++ ++ 
Sbjct  570  QFGWSANMERIMKAQALRDASMSSYMMSKKTLEINPNNAIIRELKNKVQADSADKAVRDL  629

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+Y+TAL+ SGF + +P  FA RI+  +   L+I
Sbjct  630  VVLLYETALLTSGFTLDEPHHFAERIHAMISLGLSI  665



>gb|ADO30471.1| heat shock protein 90 [Bactrocera dorsalis]
Length=516

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 105/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDSKAK-----ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ + +A+     E K  F++L K  K  L  + V++V +SNRL ++PC +VTS
Sbjct  328  VTKEGLELPEDEAEKKKREEDKAKFENLCKLMKSIL-DNKVEKVVVSNRLVESPCCIVTS  386

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            ++GWSANMERIM++Q L D S   YM GK+ LEINP HPII+ LR++   D  D++ K+ 
Sbjct  387  QFGWSANMERIMKAQALRDTSTMGYMAGKKHLEINPEHPIIETLRQKAEADKNDKAVKDL  446

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF++  P+  ASRIY  +K  L I
Sbjct  447  CILLFETALLSSGFSLDSPQVHASRIYRMIKLGLGI  482



>ref|XP_007764667.1| heat-shock protein 90 [Coniophora puteana RWD-64-598 SS2]
 gb|EIW85058.1| heat-shock protein 90 [Coniophora puteana RWD-64-598 SS2]
Length=714

 Score =   143 bits (360),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 110/156 (71%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS----KAKELKES-FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            VSKE L++++S    KA+E + S F DL    K AL  D V++V +SNR+ D+PCV+VT 
Sbjct  531  VSKEGLELEESEDEKKAREEEASQFNDLCTTIKDALG-DKVEKVVVSNRITDSPCVLVTG  589

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            ++GWS+NMERIM++Q L D+S  +YM  K+ LE+NP++PI+KEL+ +V +D  D+S ++ 
Sbjct  590  QFGWSSNMERIMKAQALRDSSMSSYMASKKTLELNPKNPIVKELKRKVAEDKADKSVRDL  649

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF++ DP  FA RI   +   L++
Sbjct  650  TYLLFETALLTSGFSLEDPTSFAKRINRMISLGLDV  685



>gb|KDO70244.1| hypothetical protein CISIN_1g0038272mg, partial [Citrus sinensis]
 gb|KDO70245.1| hypothetical protein CISIN_1g0038272mg, partial [Citrus sinensis]
Length=368

 Score =   139 bits (351),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 96/156 (62%), Gaps = 4/156 (3%)
 Frame = -2

Query  784  FQDVSKEXLKIKDS---KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVT  614
            F D+SKE L++ D    K +E K+ F  L  W K  L  D V +V++S RL+ +PCV+V+
Sbjct  166  FVDISKEDLELGDEDEVKERETKQEFNLLCDWIKQQLG-DKVAKVQVSKRLSSSPCVLVS  224

Query  613  SKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKE  434
             K+GWSANMER+M++Q L D S   +MRG+R+LEINP HPI+K+L       P+    K 
Sbjct  225  GKFGWSANMERLMKAQALGDTSSLEFMRGRRILEINPDHPIVKDLNAACKNAPDSTDAKR  284

Query  433  TAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLN  326
               L+Y TAL+ SGF    P D  ++IY  +  +L 
Sbjct  285  AVDLLYDTALISSGFTPDSPADLGNKIYEMMAMALG  320



>emb|CAY56585.1| putative heat shock protein 83 [Bactrocera oleae]
Length=666

 Score =   142 bits (358),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 106/156 (68%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDSKAK-----ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ + +A+     E K  F++L K  K  L  + V++V +SNRL ++PC +VTS
Sbjct  486  VTKEGLELPEDEAEKKKREEDKAKFENLCKLMKSIL-DNKVEKVVVSNRLVESPCCIVTS  544

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            ++GWSANMERIM++Q L D S   YM GK+ LEINP HPII+ LR++   D +D++ K+ 
Sbjct  545  QFGWSANMERIMKAQALRDTSTMGYMAGKKHLEINPEHPIIETLRQKAEADKDDKAVKDL  604

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF++  P+  ASRIY  +K  L I
Sbjct  605  CILLFETALLSSGFSLDSPQVHASRIYRMIKLGLGI  640



>gb|ACO58580.1| heat shock protein 90 [Apis mellifera]
Length=362

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = -2

Query  718  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  539
            F++L K  K  L    V++V +SNRL D+PC +VTS+YGW+ANMERIM++Q L DAS   
Sbjct  198  FENLCKVMKDIL-DKKVEKVVVSNRLVDSPCCIVTSQYGWTANMERIMKAQALRDASTMG  256

Query  538  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  359
            YM  K+ LEINP HPI++ LR++   D  D+S K+   L+++TAL+ SGF + DP+  AS
Sbjct  257  YMAAKKHLEINPDHPIMENLRQKAEADKHDKSVKDLVMLLFETALLSSGFALEDPQVHAS  316

Query  358  RIYNSVKSSLNI  323
            RIY  +K  L  
Sbjct  317  RIYRMIKLGLGF  328



>ref|XP_007385736.1| HSP90-domain-containing protein [Punctularia strigosozonata HHB-11173 
SS5]
 gb|EIN07443.1| HSP90-domain-containing protein [Punctularia strigosozonata HHB-11173 
SS5]
Length=697

 Score =   142 bits (358),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 95/133 (71%), Gaps = 1/133 (1%)
 Frame = -2

Query  721  SFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQ  542
            SF DL    K AL  D V++V +SNR+ D+PCV+VT ++GWSANMERIM++Q L D+S  
Sbjct  536  SFADLCTAVKDALG-DKVEKVVVSNRITDSPCVLVTGQFGWSANMERIMKAQALRDSSMS  594

Query  541  AYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFA  362
            +YM  K+ LE+NP +PIIKELR++V +D  D+S ++   L+++TAL+ SGF + DP  FA
Sbjct  595  SYMASKKTLELNPHNPIIKELRKKVSEDKADKSVRDLTYLLFETALLTSGFTLDDPTSFA  654

Query  361  SRIYNSVKSSLNI  323
             RI+  +   L++
Sbjct  655  KRIHRMISLGLDV  667



>gb|KFB48798.1| heat shock protein 82 [Anopheles sinensis]
Length=717

 Score =   142 bits (359),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 105/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDSKAK-----ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ + +A+     E K  F++L K  K  L  + V++V +SNRL D+PC +VTS
Sbjct  522  VTKEGLELPEDEAEKKKREEDKAKFENLCKVIKTVL-ENKVEKVVVSNRLVDSPCCIVTS  580

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGWSANMERIM++Q L D+S   YM GK+ LEINP H II+ LR+R   D  D++ K+ 
Sbjct  581  QYGWSANMERIMKAQALRDSSAMGYMAGKKHLEINPDHAIIETLRQRADADKNDKAVKDL  640

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF++ +P   ASRIY  +K  L I
Sbjct  641  VILLFETALLSSGFSLDEPGTHASRIYRMIKLGLGI  676



>ref|XP_005100278.1| PREDICTED: mesocentin-like [Aplysia californica]
Length=3413

 Score =   145 bits (365),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 106/162 (65%), Gaps = 8/162 (5%)
 Frame = -2

Query  784  FQDVSKEXLKIKDS-KAKELKES----FKDLTKWWKGALASDNVDEVKISNRLADTPCVV  620
            FQ+++KE L +  S KAKE KE+    FK L  W K     D +++  IS RL  +PC +
Sbjct  587  FQNIAKEGLSLDTSEKAKERKEAQEKEFKPLVDWLKENALKDKIEKATISERLTTSPCAL  646

Query  619  VTSKYGWSANMERIMQSQTLS---DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPED  449
            V S+YGWS NMERIM+SQ  +   DAS Q Y   K+ LE+NPRHP+IKEL+ RV  D E+
Sbjct  647  VASQYGWSGNMERIMKSQAYAKQGDASNQFYASQKKTLELNPRHPLIKELKARVEADAEE  706

Query  448  ESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
            ++ K+ AQ++++TA + SG+ VPD   FA R+   ++ SL+I
Sbjct  707  QTAKDLAQVMFETATLRSGYAVPDSAGFAERVERMLRLSLDI  748



>gb|ABI14419.1| heat shock protein 90 [Karlodinium veneficum]
Length=709

 Score =   142 bits (359),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 106/158 (67%), Gaps = 5/158 (3%)
 Frame = -2

Query  784  FQDVSKEXLKIKDS----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVV  617
             +  +KE L I+D     K +ELK  F+ LTK  K  L  D V++V IS+R+AD+PCV+ 
Sbjct  520  LKSTTKEGLDIEDEDEKKKIEELKAEFEPLTKLMKEVLG-DKVEKVLISSRMADSPCVLT  578

Query  616  TSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTK  437
            TS+YGWSANMERIM++Q L D S  +YM  K+ +E+NP+H I+ EL+++   D  D++ K
Sbjct  579  TSEYGWSANMERIMKAQALRDNSMTSYMVSKKTMEVNPKHSIMTELKKKAAADKSDKTVK  638

Query  436  ETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
            +   L++ T+L+ SGFN+ +P  FA RI+  +K  L+I
Sbjct  639  DLIWLLFDTSLLTSGFNLDEPTQFAGRIHRMIKLGLSI  676



>ref|XP_010943343.1| PREDICTED: heat shock protein 83-like [Elaeis guineensis]
Length=797

 Score =   143 bits (360),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 99/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  784  FQDVSKEXLKIKDS---KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVT  614
            F D+SKE L++ D    K +E K+ +  L  W K  L  D V +V++SNRL+ +PCV+V+
Sbjct  595  FVDISKEDLELGDEDEVKERESKQEYNLLCDWIKQQLG-DKVAKVQVSNRLSSSPCVLVS  653

Query  613  SKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKE  434
             K+GWSANMER+M++QTL D S   +MRG+R+LEINP HPIIK+L      DP  +  K 
Sbjct  654  GKFGWSANMERLMKAQTLGDTSSLEFMRGRRILEINPDHPIIKDLNAACKNDPSSDEAKR  713

Query  433  TAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLN  326
               L+Y TAL+ SG+    P +  S+IY  +  +L 
Sbjct  714  AVDLLYDTALISSGYTPDSPAELGSKIYEMMAIALG  749



>ref|XP_008551765.1| PREDICTED: heat shock protein 83 [Microplitis demolitor]
Length=723

 Score =   142 bits (359),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 105/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDSKAK-----ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ + +A+     E K  F++L K  K  L S  V++V +SNRL D+PC +VTS
Sbjct  536  VTKEGLELPEDEAEKKKREEDKAKFEELCKVMKTILDS-KVEKVVVSNRLVDSPCCIVTS  594

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGW+ANMERIM++Q L D S   YM  K+ LEINP HP+I+ LR++   D  D+S K+ 
Sbjct  595  QYGWTANMERIMKAQALRDTSTMGYMAAKKHLEINPDHPVIENLRQKAEADKNDKSVKDL  654

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF++ DP+  A+RIY  +K  L I
Sbjct  655  VVLLFETALLSSGFSLDDPQVHAARIYRMIKLGLGI  690



>ref|XP_003074078.1| heat shock protein 90C (ISS) [Ostreococcus tauri]
Length=679

 Score =   142 bits (358),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 100/149 (67%), Gaps = 9/149 (6%)
 Frame = -2

Query  778  DVSKEXLKIKDSKAK------ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVV  617
            D SKE L + D   K      EL++ FKDLT W K  L +  V++V +SNRL DTPCV+V
Sbjct  510  DASKEALDMGDEDEKDKAALEELEKEFKDLTDWMKETLGT-QVEKVTVSNRLTDTPCVLV  568

Query  616  TSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTK  437
            TSK+GWSANMERIM++Q + D     YM+GK+ +EINP  P+I +LR+  +K+   +   
Sbjct  569  TSKFGWSANMERIMKAQAMGDNRASDYMKGKKTMEINPSSPVIAQLRK--LKEAGSKEAT  626

Query  436  ETAQLIYKTALMESGFNVPDPKDFASRIY  350
            ++ QL++ TAL+ SGF++  P  FASR++
Sbjct  627  DSCQLLFDTALLTSGFSIDKPSVFASRVF  655



>gb|ABA28987.1| heat shock protein 90 3 [Symbiodinium sp. C3]
Length=441

 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 105/158 (66%), Gaps = 5/158 (3%)
 Frame = -2

Query  784  FQDVSKEXLKIKDS----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVV  617
             +  +KE L I D     K +ELK  F+ LTK  K  L  D V++V +S+R+AD+PCV+ 
Sbjct  270  LKSTTKEGLDIDDEDEKKKIEELKAEFEPLTKLMKEVLG-DKVEKVLVSSRMADSPCVLT  328

Query  616  TSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTK  437
            TS+YGWSANMERIM++Q L D S  +YM  K+ +E+NP+H I+ EL+++   D  D++ K
Sbjct  329  TSEYGWSANMERIMKAQALRDNSMTSYMVSKKTMEVNPKHSIMVELKKKAAADKSDKTVK  388

Query  436  ETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
            +   L++ T+L+ SGFN+ +P  FA RI+  +K  L+I
Sbjct  389  DLIWLLFDTSLLTSGFNLDEPTQFAGRIHRMIKLGLSI  426



>ref|XP_009627181.1| PREDICTED: heat shock protein 90-1-like [Nicotiana tomentosiformis]
Length=791

 Score =   142 bits (359),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 100/156 (64%), Gaps = 4/156 (3%)
 Frame = -2

Query  784  FQDVSKEXLKIKDS---KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVT  614
            F D+SKE L++ D    K +E K+ F  L  W K  L  + V +V++SNRL+ +PCV+V+
Sbjct  596  FVDISKEDLELGDEDEVKERETKQEFNLLCDWIKQQLG-EKVAKVQVSNRLSSSPCVLVS  654

Query  613  SKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKE  434
             K+GWSANMER+M++QTL D S   +MRG+R+LE+NP HPIIK+L       P+    K 
Sbjct  655  GKFGWSANMERLMKAQTLGDTSAMEFMRGRRILEVNPDHPIIKDLNAACKNAPDSSDAKR  714

Query  433  TAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLN  326
              +L+Y TAL+ SGF    P +  ++IY+ +  +L 
Sbjct  715  AVELLYDTALISSGFTPDSPAELGNKIYDMMSMALG  750



>gb|AAW49252.2| heat shock protein 90 [Liriomyza huidobrensis]
Length=714

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 106/156 (68%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDSKAK-----ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ + +A+     E K  F++L K  K  L  + V++V +SNRL D+PC +VTS
Sbjct  525  VTKEGLELPEDEAEKKKREEDKAKFENLCKLIKSIL-DNKVEKVVVSNRLVDSPCCIVTS  583

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGWSANMERIM++Q L D++   YM GK+ LEINP HPII+ LRE+   D  D++ K+ 
Sbjct  584  QYGWSANMERIMKTQALRDSNTMGYMSGKKHLEINPDHPIIETLREKSEADKNDKAVKDL  643

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++T+L+ SGF++  P+  ASRIY  +K  L I
Sbjct  644  VILLFETSLLSSGFSLDSPQVHASRIYRMIKLGLGI  679



>ref|XP_009776793.1| PREDICTED: heat shock protein 90-1-like [Nicotiana sylvestris]
Length=786

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 100/156 (64%), Gaps = 4/156 (3%)
 Frame = -2

Query  784  FQDVSKEXLKIKDS---KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVT  614
            F D+SKE L++ D    K +E K+ F  L  W K  L  + V +V++SNRL+ +PCV+V+
Sbjct  592  FVDISKEDLELGDEDEVKERETKQEFNLLCDWIKQQLG-EKVAKVQVSNRLSSSPCVLVS  650

Query  613  SKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKE  434
             K+GWSANMER+M++QTL D S   +MRG+R+LE+NP HPIIK+L       P+    K 
Sbjct  651  GKFGWSANMERLMKAQTLGDTSAMEFMRGRRILEVNPDHPIIKDLNAACKNAPDSSDAKR  710

Query  433  TAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLN  326
              +L+Y TAL+ SGF    P +  ++IY+ +  +L 
Sbjct  711  AVELLYDTALISSGFTPDSPAELGNKIYDMMSMALG  746



>gb|EPT06188.1| hypothetical protein FOMPIDRAFT_1109676 [Fomitopsis pinicola 
FP-58527 SS1]
Length=702

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = -2

Query  718  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  539
            F+DL K  K AL  D V++V +SNR++D+PCV+VT ++GWS+NMERIM++Q L D+S  +
Sbjct  541  FEDLCKAVKDALG-DKVEKVVVSNRISDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  599

Query  538  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  359
            YM  K+ LE+NP +PI+KELR++V +D  D+S ++   L+++TAL+ SGF++ DP  FA 
Sbjct  600  YMASKKTLELNPHNPIVKELRKKVAEDKADKSVRDLTFLLFETALLTSGFSLDDPTSFAK  659

Query  358  RIYNSVKSSLNI  323
            RI+  +   L++
Sbjct  660  RIHRMISLGLDV  671



>ref|XP_006844092.1| hypothetical protein AMTR_s00006p00252810 [Amborella trichopoda]
 gb|ERN05767.1| hypothetical protein AMTR_s00006p00252810 [Amborella trichopoda]
Length=817

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 99/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  784  FQDVSKEXLKIKDS---KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVT  614
            F D+SKE L++ D    K +E K+ F  L  W K  L  D V +V++S RL+ +PCV+V+
Sbjct  614  FVDISKEDLELGDEDEVKERETKQEFNLLCDWIKQQLG-DKVAKVQVSKRLSSSPCVLVS  672

Query  613  SKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKE  434
             K+GWSANMER+M++QTL D +   +MRG+R+LEINP HPIIK+L      DP+D   + 
Sbjct  673  GKFGWSANMERLMKAQTLGDTASLEFMRGRRILEINPDHPIIKDLSAACKYDPDDSEARR  732

Query  433  TAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLN  326
               L+Y TAL+ SGF    P +  ++IY  +  +L 
Sbjct  733  AVDLLYDTALISSGFTPDSPAELGNKIYEMMSIALG  768



>gb|KDQ60746.1| hypothetical protein JAAARDRAFT_172907 [Jaapia argillacea MUCL 
33604]
Length=703

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 109/156 (70%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDSKAKELKE-----SFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            VSKE L++++++ ++         F DL    K AL  D V++V ISNR+AD+PCV+VT 
Sbjct  516  VSKEGLELEETEDEKKSREEEEKQFNDLCSAVKEALG-DKVEKVVISNRIADSPCVLVTG  574

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            ++GWSANMERIM++Q L D+S  +YM  K+ LE+NP++P+IKEL+++V +D  D+S ++ 
Sbjct  575  QFGWSANMERIMKAQALRDSSMSSYMASKKTLELNPKNPVIKELKKKVAEDRADKSVRDL  634

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF + DP  FA RI+  +   L++
Sbjct  635  TFLLFETALLTSGFTLDDPTSFAKRIHRMIALGLDV  670



>ref|XP_010736427.1| PREDICTED: heat shock protein HSP 90-alpha isoform X3 [Larimichthys 
crocea]
 ref|XP_010736428.1| PREDICTED: heat shock protein HSP 90-alpha isoform X4 [Larimichthys 
crocea]
Length=727

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 101/156 (65%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +      K +ELK  F++L K  K  L    +++V +SNRL  +PC +VTS
Sbjct  539  VTKEGLELPEDEDEKKKQEELKNKFENLCKIMKDIL-DKKIEKVTVSNRLVASPCCIVTS  597

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
             YGW+ANMERIM+SQ L D S   YM  K+ LEINP HPII+ LRE+   D  D++ K+ 
Sbjct  598  TYGWTANMERIMKSQALRDNSTMGYMTAKKHLEINPMHPIIETLREKAEADKNDKAVKDL  657

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF + DP+  A+RIY  +K  L I
Sbjct  658  VILLFETALLSSGFTLEDPQTHANRIYRMIKLGLGI  693



>ref|XP_011182023.1| PREDICTED: LOW QUALITY PROTEIN: heat shock protein 83 [Bactrocera 
cucurbitae]
Length=715

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 105/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDSKAK-----ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ + +A+     E K  F++L K  K  L  + V++V +SNRL ++PC +VTS
Sbjct  527  VTKEGLELPEDEAEKKKREEDKAKFENLCKLMKSIL-DNKVEKVVVSNRLVESPCCIVTS  585

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            ++GWSANMERIM++Q L D S   YM GK+ LEINP HPII+ LR++   D  D++ K+ 
Sbjct  586  QFGWSANMERIMKAQALRDTSTMGYMAGKKHLEINPEHPIIETLRQKAEADKNDKAVKDL  645

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF++  P+  ASRIY  +K  L I
Sbjct  646  CILLFETALLSSGFSLDSPQVHASRIYRMIKLGLGI  681



>emb|CEF96474.1| Histidine kinase-like ATPase, ATP-binding domain [Ostreococcus 
tauri]
Length=746

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 100/149 (67%), Gaps = 9/149 (6%)
 Frame = -2

Query  778  DVSKEXLKIKDSKAK------ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVV  617
            D SKE L + D   K      EL++ FKDLT W K  L +  V++V +SNRL DTPCV+V
Sbjct  577  DASKEALDMGDEDEKDKAALEELEKEFKDLTDWMKETLGT-QVEKVTVSNRLTDTPCVLV  635

Query  616  TSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTK  437
            TSK+GWSANMERIM++Q + D     YM+GK+ +EINP  P+I +LR+  +K+   +   
Sbjct  636  TSKFGWSANMERIMKAQAMGDNRASDYMKGKKTMEINPSSPVIAQLRK--LKEAGSKEAT  693

Query  436  ETAQLIYKTALMESGFNVPDPKDFASRIY  350
            ++ QL++ TAL+ SGF++  P  FASR++
Sbjct  694  DSCQLLFDTALLTSGFSIDKPSVFASRVF  722



>ref|XP_011203601.1| PREDICTED: heat shock protein 83 [Bactrocera dorsalis]
Length=715

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 105/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDSKAK-----ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ + +A+     E K  F++L K  K  L  + V++V +SNRL ++PC +VTS
Sbjct  527  VTKEGLELPEDEAEKKKREEDKAKFENLCKLMKSIL-DNKVEKVVVSNRLVESPCCIVTS  585

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            ++GWSANMERIM++Q L D S   YM GK+ LEINP HPII+ LR++   D  D++ K+ 
Sbjct  586  QFGWSANMERIMKAQALRDTSTMGYMAGKKHLEINPEHPIIETLRQKAEADKNDKAVKDL  645

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF++  P+  ASRIY  +K  L I
Sbjct  646  CILLFETALLSSGFSLDSPQVHASRIYRMIKLGLGI  681



>dbj|BAF92789.1| cytosolic heat shock protein 90 alpha [Solea senegalensis]
Length=724

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 101/156 (65%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +      K +ELK  F++L K  K  L    +++V +SNRL  +PC +VTS
Sbjct  536  VTKEGLELPEDEDEKKKQEELKNKFENLCKIMKDIL-DKKIEKVTVSNRLVSSPCCIVTS  594

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
             YGW+ANMERIM+SQ L D S   YM  K+ LEINP HPI++ LRE+   D  D++ K+ 
Sbjct  595  TYGWTANMERIMKSQALRDNSTMGYMTAKKHLEINPMHPIVETLREKAEADKNDKAVKDL  654

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF + DP+  A+RIY  +K  L I
Sbjct  655  VILLFETALLSSGFTLEDPQTHANRIYRMIKLGLGI  690



>gb|AAQ63041.1| heat shock protein HSP 90 alpha, partial [Platichthys flesus]
Length=207

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 99/156 (63%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +        +E K  F++L K  K  L    V++V +SNRL  +PC +VTS
Sbjct  18   VTKEGLELPEDDDEKKNQEEKKSKFENLCKIMKDILEK-KVEKVTVSNRLVSSPCCIVTS  76

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
             YGW+ANMERIM++Q L D S   YM  K+ LEINP HPI++ LR++   D  D+S K+ 
Sbjct  77   TYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHPIVETLRQKAEADKNDKSVKDL  136

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF + DP+  ++RIY  +K  L I
Sbjct  137  VILLFETALLSSGFTLDDPQTHSNRIYRMIKLGLGI  172



>gb|AGU42458.1| heat shock protein 90 [Bactrocera correcta]
Length=715

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 105/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDSKAK-----ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ + +A+     E K  F++L K  K  L  + V++V +SNRL ++PC +VTS
Sbjct  527  VTKEGLELPEDEAEKKKREEDKAKFENLCKLMKSIL-DNKVEKVVVSNRLVESPCCIVTS  585

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            ++GWSANMERIM++Q L D S   YM GK+ LEINP HPII+ LR++   D  D++ K+ 
Sbjct  586  QFGWSANMERIMKAQALRDTSTMGYMAGKKHLEINPEHPIIETLRQKAEADKNDKAVKDL  645

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF++  P+  ASRIY  +K  L I
Sbjct  646  CILLFETALLSSGFSLDSPQVHASRIYRMIKLGLGI  681



>ref|XP_006793113.1| PREDICTED: heat shock protein HSP 90-alpha 1-like isoform X1 
[Neolamprologus brichardi]
 ref|XP_006793114.1| PREDICTED: heat shock protein HSP 90-alpha 1-like isoform X2 
[Neolamprologus brichardi]
Length=724

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 101/156 (65%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +      K +ELK  F+DL K  K  L    +++V +SNRL  +PC +VTS
Sbjct  536  VTKEGLELPEDEDEKKKQEELKTKFEDLCKIMKDIL-DKKIEKVVVSNRLVASPCCIVTS  594

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
             YGW+ANMERIM+SQ L D S   YM  K+ LEINP HPI++ LRE+   D  D++ K+ 
Sbjct  595  TYGWTANMERIMKSQALRDNSTLGYMTAKKHLEINPLHPIVETLREKAEADKNDKAVKDL  654

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF + DP+  A+RIY  +K  L I
Sbjct  655  VILLFETALLSSGFTLEDPQTHANRIYRMIKLGLGI  690



>ref|XP_011398501.1| Heat shock protein 90-2 [Auxenochlorella protothecoides]
 gb|KFM25605.1| Heat shock protein 90-2 [Auxenochlorella protothecoides]
Length=432

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 94/140 (67%), Gaps = 1/140 (1%)
 Frame = -2

Query  742  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  563
            K  E K +F+ L +  K  L  D V++V +  R+ D+PCV+VT +YGWSANMERIM++Q 
Sbjct  263  KDYETKAAFEPLCRLMKDVLG-DRVEKVVVGERIVDSPCVLVTGEYGWSANMERIMKAQA  321

Query  562  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  383
            L D+S   YM  K+ LEIN  +P+I ELR R   D  D++ ++  QL+++TAL+ SGF++
Sbjct  322  LRDSSMAGYMSSKKTLEINAANPVIAELRTRAEADKGDKTVRDLVQLLFETALLASGFSL  381

Query  382  PDPKDFASRIYNSVKSSLNI  323
             DP  FASRI+  VK  L+I
Sbjct  382  DDPNTFASRIHRMVKLGLSI  401



>ref|XP_002949693.1| hypothetical protein VOLCADRAFT_80696 [Volvox carteri f. nagariensis]
 gb|EFJ49245.1| hypothetical protein VOLCADRAFT_80696 [Volvox carteri f. nagariensis]
Length=808

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 95/133 (71%), Gaps = 4/133 (3%)
 Frame = -2

Query  712  DLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQAYM  533
            DLTKWWK  +    +  VK+SNRLA TPCVVV+ KYG SANMERIM++Q  S  S  ++ 
Sbjct  646  DLTKWWKKVIEDSRLQTVKVSNRLATTPCVVVSGKYGQSANMERIMRAQAFS-RSAGSFT  704

Query  532  RGKRVLEINPRHPIIKELRERVV---KDPEDESTKETAQLIYKTALMESGFNVPDPKDFA  362
             G+RVLEINPRHP+I  L++++    +D  DE+T  TA+++Y+TAL+ESGF   D K F+
Sbjct  705  PGQRVLEINPRHPLIVALKDKLAAASEDTVDETTVATARILYETALLESGFIPDDAKSFS  764

Query  361  SRIYNSVKSSLNI  323
             R+Y+ +K +L +
Sbjct  765  QRVYSVLKGNLGV  777



>ref|NP_001274755.1| heat shock protein 83-like [Ceratitis capitata]
 emb|CAJ28987.1| heat shock protein 83 [Ceratitis capitata]
Length=715

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 104/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDSKAK-----ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +  A+     E K  F++L K  K  L  + V++V +SNRL ++PC +VTS
Sbjct  527  VTKEGLELPEDDAEKKKREEDKAKFENLCKLMKSIL-DNKVEKVVVSNRLVESPCCIVTS  585

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            ++GWSANMERIM++Q L D S   YM GK+ LEINP HPII+ LRE+   D  D++ K+ 
Sbjct  586  QFGWSANMERIMKAQALRDTSTMGYMAGKKHLEINPEHPIIETLREKADVDKNDKAVKDL  645

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF++  P+  ASRIY  +K  L I
Sbjct  646  CILLFETALLSSGFSLDSPQVHASRIYRMIKLGLGI  681



>emb|CAE02770.2| OSJNBb0085F13.17 [Oryza sativa Japonica Group]
 emb|CAD39419.2| OSJNBa0027H06.1 [Oryza sativa Japonica Group]
Length=703

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 105/151 (70%), Gaps = 2/151 (1%)
 Frame = -2

Query  772  SKEXLKIKDSK-AKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWS  596
            +KE LK+ D   AKE K SF+ L K  K  L  D V++V +S+R+ D+PC +VT +YGW+
Sbjct  523  TKEGLKLDDDDDAKERKRSFEPLCKVIKDILG-DRVEKVVVSDRIVDSPCCLVTGEYGWT  581

Query  595  ANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIY  416
            ANMERIM++Q L D+S  AYM  K+ +EINP + I++ELR+R   D  D+S ++   L++
Sbjct  582  ANMERIMKAQALRDSSMGAYMSSKKTMEINPENGIMEELRKRADADANDKSVRDLVLLLF  641

Query  415  KTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
            +TAL+ SGF++ DP  FA+RI+  +K  LNI
Sbjct  642  ETALLTSGFSLDDPNTFAARIHRMLKLGLNI  672



>ref|XP_008297037.1| PREDICTED: heat shock protein HSP 90-alpha 1 [Stegastes partitus]
Length=724

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 100/156 (64%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +      K  ELK  F++L K  K  L    +++V +SNRL  +PC +VTS
Sbjct  536  VTKEGLELPEDEEDKKKQDELKNKFENLCKIMKDIL-DKKIEKVTVSNRLVSSPCCIVTS  594

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
             YGW+ANMERIM+SQ L D S   YM  K+ LEINP HPI++ LRE+   D  D++ K+ 
Sbjct  595  TYGWTANMERIMKSQALRDNSTMGYMTAKKHLEINPMHPIVETLREKAEADKNDKAVKDL  654

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF + DP+  A+RIY  +K  L I
Sbjct  655  VILLFETALLSSGFTLEDPQTHANRIYRMIKLGLGI  690



>dbj|BAF01597.1| heat shock like protein [Arabidopsis thaliana]
Length=361

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 93/148 (63%), Gaps = 4/148 (3%)
 Frame = -2

Query  784  FQDVSKEXLKIKDS---KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVT  614
            F D+SKE L++ D    K +E K+ F  L  W K  L  D V +V++SNRL+ +PCV+V+
Sbjct  165  FVDISKEDLELGDEDEVKDREAKQEFNLLCDWIKQQLG-DKVAKVQVSNRLSSSPCVLVS  223

Query  613  SKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKE  434
             K+GWSANMER+M++Q L D S   +MRG+R+LEINP HPIIK+L       PE      
Sbjct  224  GKFGWSANMERLMKAQALGDTSSLEFMRGRRILEINPDHPIIKDLNAACKNAPESTEATR  283

Query  433  TAQLIYKTALMESGFNVPDPKDFASRIY  350
               L+Y TA++ SGF    P +  ++IY
Sbjct  284  VVDLLYDTAIISSGFTPDSPAELGNKIY  311



>gb|EAY92778.1| hypothetical protein OsI_14582 [Oryza sativa Indica Group]
Length=703

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 105/151 (70%), Gaps = 2/151 (1%)
 Frame = -2

Query  772  SKEXLKIKDSK-AKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWS  596
            +KE LK+ D   AKE K SF+ L K  K  L  D V++V +S+R+ D+PC +VT +YGW+
Sbjct  523  TKEGLKLDDDDDAKERKRSFEPLCKVIKDILG-DRVEKVVVSDRIVDSPCCLVTGEYGWT  581

Query  595  ANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIY  416
            ANMERIM++Q L D+S  AYM  K+ +EINP + I++ELR+R   D  D+S ++   L++
Sbjct  582  ANMERIMKAQALRDSSMGAYMSSKKTMEINPENGIMEELRKRADADANDKSVRDLVLLLF  641

Query  415  KTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
            +TAL+ SGF++ DP  FA+RI+  +K  LNI
Sbjct  642  ETALLTSGFSLDDPNTFAARIHRMLKLGLNI  672



>ref|XP_005805663.1| PREDICTED: heat shock protein HSP 90-alpha 1-like isoform X2 
[Xiphophorus maculatus]
Length=676

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 101/156 (65%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +      K +ELK  F++L K  K  L    +++V +SNRL  +PC +VTS
Sbjct  488  VTKEGLELPEDEDEKKKHEELKNKFENLCKIMKDIL-DKKIEKVVVSNRLVASPCCIVTS  546

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
             YGW+ANMERIM+SQ L D S   YM  K+ LEINP HPII+ LRE+   D  D++ K+ 
Sbjct  547  TYGWTANMERIMKSQALRDNSTMGYMTAKKHLEINPLHPIIETLREKAEADKNDKAVKDL  606

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF + DP+  A+RIY  +K  L I
Sbjct  607  VILLFETALLSSGFTLEDPQTHANRIYRMIKLGLGI  642



>gb|AGT57167.1| heat shock protein 90-alpha 3 [Salmo salar]
Length=727

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 100/156 (64%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +      K +EL   F++L K  K  L    +++V +SNRL  +PC +VTS
Sbjct  539  VTKEGLELPEDEDEKKKQEELNSKFENLCKIMKDILDK-KIEKVSVSNRLVSSPCCIVTS  597

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
             YGW+ANMERIM+SQ L D S   YM  K+ LEINP HPI++ LRE+   D  D++ K+ 
Sbjct  598  NYGWTANMERIMKSQALRDNSTMGYMTAKKHLEINPTHPIVETLREKAEADKNDKAVKDL  657

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TALM SGF + DP+  A+RIY  +K  L I
Sbjct  658  VILLFETALMSSGFTLDDPQTHANRIYRMIKLGLGI  693



>gb|AER28025.1| heat shock protein 83S2 [Stratiomys singularior]
Length=719

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 105/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKI---KDSKAK--ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            VSKE L++   +D K K  E K  F+ L K  K  L  + V++V +SNRL D+PC +VTS
Sbjct  530  VSKEGLELPEDEDEKKKREEDKAKFEGLCKVMKSIL-DNKVEKVVVSNRLVDSPCCIVTS  588

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGWSANMERIM++Q L D+S   YM  K+ LEINP HPII+ LR++   D  D+S K+ 
Sbjct  589  QYGWSANMERIMKAQALRDSSTMGYMTSKKHLEINPDHPIIENLRQKTEADKNDKSVKDL  648

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++T+L+ SGF++ DP+  ASRI+  +K  L I
Sbjct  649  VILLFETSLLSSGFSLDDPQVHASRIHRMIKLGLGI  684



>ref|XP_010788727.1| PREDICTED: heat shock protein HSP 90-alpha 1 [Notothenia coriiceps]
Length=721

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 102/156 (65%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDSKA-----KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ + +A     +ELK  F+++ K  K  L    +++V +SNRL  +PC +VTS
Sbjct  533  VTKEGLELPEDEADVKKQEELKNKFENICKIMKDIL-DKKIEKVTVSNRLVSSPCCIVTS  591

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
             YGW+ANMERIM+SQ L D S   YM  K+ LEINP HPI++ LRE+   D  D++ K+ 
Sbjct  592  TYGWTANMERIMKSQALRDNSTMGYMTAKKHLEINPLHPIVETLREKAEADKNDKAVKDL  651

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+Y+T+L+ SGF + DP+  A+RIY  +K  L I
Sbjct  652  VILLYETSLLSSGFTLEDPQTHANRIYRMIKLGLGI  687



>gb|ABV55506.1| heat shock protein 90 [Microplitis mediator]
Length=723

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 105/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDSKAK-----ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ + +A+     E K  F++L K  K  L S  V++V +SNRL D+PC +VTS
Sbjct  536  VTKEGLELPEDEAEKKKREEDKAKFEELCKVMKTILDS-KVEKVVVSNRLVDSPCCIVTS  594

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            ++GW+ANMERIM++Q L D S   YM  K+ LEINP HP+I+ LR++   D  D+S K+ 
Sbjct  595  QFGWTANMERIMKAQALRDTSTMGYMAAKKHLEINPDHPVIENLRQKAEADKNDKSVKDL  654

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF++ DP+  A+RIY  +K  L I
Sbjct  655  VVLLFETALLSSGFSLDDPQVHAARIYRMIKLGLGI  690



>gb|KIL68560.1| hypothetical protein M378DRAFT_184990 [Amanita muscaria Koide 
BX008]
Length=705

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = -2

Query  721  SFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQ  542
            +F DL    K AL  D V++V ISNR+AD+PCV+VT ++GWS+NMERIM++Q L D S  
Sbjct  543  AFNDLCSVVKDALG-DKVEKVVISNRIADSPCVLVTGQFGWSSNMERIMKAQALRDTSMS  601

Query  541  AYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFA  362
            +YM  K+ LE+NP +PI+KEL+++V +D  D+S ++   L+Y TAL+ SGF + +P  FA
Sbjct  602  SYMASKKTLELNPHNPIVKELKKKVAEDKADKSVRDLTYLLYDTALLTSGFALDEPTSFA  661

Query  361  SRIYNSVKSSLNI  323
             RIY  +   L++
Sbjct  662  KRIYRMISLGLDV  674



>gb|KHN71590.1| Endoplasmin [Toxocara canis]
Length=786

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 105/163 (64%), Gaps = 8/163 (5%)
 Frame = -2

Query  784  FQDVSKEXLKIKDS-KAKELKE----SFKDLTKWWKGALASDNVDEVKISNRLADTPCVV  620
            FQ+V+KE LKI DS K+KE++E    S++ LTKW K     D +++  +S RL  +P  +
Sbjct  587  FQNVAKEGLKIDDSEKSKEIQEQLEKSYEPLTKWLKDKALKDEIEKAVVSQRLTKSPSAL  646

Query  619  VTSKYGWSANMERIMQSQTLS---DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPED  449
            V S +GWS NMERIM+SQ  +   D S++ Y   K+  EINPRHP+IKEL  RV  DPED
Sbjct  647  VASSFGWSGNMERIMKSQAYAKSNDPSQEFYASQKKTFEINPRHPVIKELLRRVEGDPED  706

Query  448  ESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  320
                 TA+L+++TA + SGF + D   FA+R+   ++ S+ IS
Sbjct  707  PKALATARLLFETATLRSGFTIKDQVGFATRVEQILRQSMEIS  749



>emb|CDQ81678.1| unnamed protein product [Oncorhynchus mykiss]
Length=725

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 100/156 (64%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +      K +EL   F++L K  K  L    +++V +SNRL  +PC +VTS
Sbjct  537  VTKEGLELPEDEDEKKKQEELNSKFENLCKIMKDIL-DKKIEKVSVSNRLVSSPCCIVTS  595

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
             YGW+ANMERIM+SQ L D S   YM  K+ LEINP HPI++ LRE+   D  D++ K+ 
Sbjct  596  TYGWTANMERIMKSQALRDNSTMGYMTAKKHLEINPTHPIVETLREKAEADKNDKAVKDL  655

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TALM SGF + DP+  A+RIY  +K  L I
Sbjct  656  VILLFETALMSSGFTLDDPQTHANRIYRMIKLGLGI  691



>ref|XP_005805662.1| PREDICTED: heat shock protein HSP 90-alpha 1-like isoform X1 
[Xiphophorus maculatus]
Length=724

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 101/156 (65%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +      K +ELK  F++L K  K  L    +++V +SNRL  +PC +VTS
Sbjct  536  VTKEGLELPEDEDEKKKHEELKNKFENLCKIMKDIL-DKKIEKVVVSNRLVASPCCIVTS  594

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
             YGW+ANMERIM+SQ L D S   YM  K+ LEINP HPII+ LRE+   D  D++ K+ 
Sbjct  595  TYGWTANMERIMKSQALRDNSTMGYMTAKKHLEINPLHPIIETLREKAEADKNDKAVKDL  654

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF + DP+  A+RIY  +K  L I
Sbjct  655  VILLFETALLSSGFTLEDPQTHANRIYRMIKLGLGI  690



>gb|AEH27540.1| cytosolic heat shock protein 90-alpha [Lates calcarifer]
Length=724

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 101/156 (65%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +      K +ELK  F++L K  K  L    +++V +SNRL  +PC +VTS
Sbjct  536  VTKEGLELPEDEDEKKKQEELKNKFENLCKIMKDIL-DKKIEKVVVSNRLVASPCCIVTS  594

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
             YGW+ANMERIM+SQ L D S   YM  K+ LEINP HPII+ LRE+   D  D++ K+ 
Sbjct  595  TYGWTANMERIMKSQALRDNSTMGYMTAKKHLEINPLHPIIETLREKAEADKNDKAVKDL  654

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF + DP+  A+RIY  +K  L I
Sbjct  655  VILLFETALLSSGFTLEDPQTHANRIYRMIKLGLGI  690



>emb|CDO69548.1| hypothetical protein BN946_scf184785.g53 [Trametes cinnabarina]
Length=698

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = -2

Query  718  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  539
            F+DL K  K AL  D V++V +SNR+ D+PCV+VT ++GWS+NMERIM++Q L D+S  +
Sbjct  536  FEDLCKAVKDALG-DKVEKVVVSNRITDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  594

Query  538  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  359
            YM  K+ LE+NP +PIIKEL+ +V +D  D+S ++   L+++TAL+ SGF++ DP  FA 
Sbjct  595  YMASKKTLELNPHNPIIKELKRKVAEDKADKSVRDLTYLLFETALLTSGFSLDDPTSFAK  654

Query  358  RIYNSVKSSLNI  323
            RI+  +   L++
Sbjct  655  RIHRMIALGLDV  666



>ref|XP_007577310.1| PREDICTED: heat shock protein HSP 90-alpha 1 [Poecilia formosa]
Length=724

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 101/156 (65%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +      K +ELK  F++L K  K  L    +++V +SNRL  +PC +VTS
Sbjct  536  VTKEGLELPEDEDEKKKHEELKNKFENLCKIMKDIL-DKKIEKVVVSNRLVASPCCIVTS  594

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
             YGW+ANMERIM+SQ L D S   YM  K+ LEINP HPII+ LRE+   D  D++ K+ 
Sbjct  595  TYGWTANMERIMKSQALRDNSTMGYMTAKKHLEINPLHPIIETLREKAEADKNDKAVKDL  654

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF + DP+  A+RIY  +K  L I
Sbjct  655  VILLFETALLSSGFTLEDPQTHANRIYRMIKLGLGI  690



>gb|AIA62362.1| hsp90, partial [Bactrocera minax]
Length=455

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 105/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDSKAK-----ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ + +A+     E +  F++L +  K  L  + V++V +SNRL ++PC +VTS
Sbjct  267  VTKEGLELPEDEAEKKKREEDRAKFENLCRLMKSIL-DNKVEKVVVSNRLVESPCCIVTS  325

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            ++GWSANMERIM++Q L D S   YM GK+ LEINP HPII+ LR++   D  D++ K+ 
Sbjct  326  QFGWSANMERIMKAQALRDTSTMGYMAGKKHLEINPEHPIIETLRQKADADKNDKAVKDL  385

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF++  P+  ASRIY  +K  L I
Sbjct  386  CILLFETALLSSGFSLDSPQVHASRIYRMIKLGLGI  421



>ref|XP_002447413.1| hypothetical protein SORBIDRAFT_06g000660 [Sorghum bicolor]
 gb|EES11741.1| hypothetical protein SORBIDRAFT_06g000660 [Sorghum bicolor]
Length=716

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 106/156 (68%), Gaps = 7/156 (4%)
 Frame = -2

Query  772  SKEXLKIKDS------KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            +KE LK+ D       + +E K+ F+DL K  K  L  D V++V +S+R+ D+PC +VT 
Sbjct  533  TKEGLKLDDDDEEAKKRREERKKQFEDLCKVIKDILG-DRVEKVVVSDRIVDSPCCLVTG  591

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGW+ANMERIM++Q L D+S  AYM  K+ +EINP + I++ELR+R   D  D+S K+ 
Sbjct  592  EYGWTANMERIMKAQALRDSSMSAYMSSKKTMEINPDNGIMEELRKRAEADRNDKSVKDL  651

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF++ DP  FA+RI+  +K  LNI
Sbjct  652  VLLLFETALLTSGFSLDDPNTFAARIHRMLKLGLNI  687



>gb|ABK34943.1| heat shock protein 83 [Drosophila buzzatii]
Length=716

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 105/159 (66%), Gaps = 6/159 (4%)
 Frame = -2

Query  784  FQDVSKEXLKIKDSKAK-----ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVV  620
            F  V+KE L++ + +A+     E K  F+ L K  K  L  + V++V +SNRL D+PC +
Sbjct  525  FVSVTKEGLELPEDEAEKKKREEDKAKFESLCKLMKSIL-DNKVEKVVVSNRLVDSPCCI  583

Query  619  VTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDEST  440
            VTS++GWSANMERIM++Q L D S   YM GK+ LEINP HPI++ LR++   D  D++ 
Sbjct  584  VTSQFGWSANMERIMKAQALRDTSTMGYMAGKKHLEINPDHPIVETLRQKAEADKNDKAV  643

Query  439  KETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
            K+   L+++T+L+ SGF++  P+  ASRIY  +K  L I
Sbjct  644  KDLVILLFETSLLSSGFSLDSPQVHASRIYRMIKLGLGI  682



>gb|EJU00792.1| heat shock protein 90 [Dacryopinax sp. DJM-731 SS1]
Length=695

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 108/156 (69%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDSKAKELK-----ESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            VSKE L++++++ ++ +     + F DL K  K AL  D V++V +SNR+ D+PCV+VT 
Sbjct  510  VSKEGLELEETEQEKTEREDEAKQFDDLCKSIKEALG-DKVEKVVVSNRIVDSPCVLVTG  568

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            ++GWS+NMERIM++Q L DAS  +YM  K+ LE+NP +PIIKEL+ +V  D  D++ ++ 
Sbjct  569  QFGWSSNMERIMKAQALRDASMSSYMASKKTLELNPHNPIIKELKTKVAADKNDKTVRDL  628

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+Y+TAL+ SGF + +P  FA RI+  +   L++
Sbjct  629  TYLLYETALLTSGFVLDEPSSFAKRIHRMISLGLDV  664



>gb|AIU38244.1| heat shock protein 90 [Anisakis paggiae]
Length=720

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 104/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +S     K +E K  +++L K  K  L    V++V +SNRL  +PC +VTS
Sbjct  529  VTKEGLELPESEDEKKKYEEDKVKYENLCKVIKDILEK-KVEKVAVSNRLVSSPCCIVTS  587

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGWSANMERIM++Q L D+S   YM  K+ LEINP H +IK LRERV  D  D++ K+ 
Sbjct  588  EYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDL  647

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF + DP+  ASRIY  +K  L+I
Sbjct  648  VVLLFETALLSSGFTLDDPQLHASRIYRMIKLGLDI  683



>gb|AIU38242.1| heat shock protein 90 [Anisakis pegreffii]
Length=718

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 104/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +S     K +E K  +++L K  K  L    V++V +SNRL  +PC +VTS
Sbjct  527  VTKEGLELPESEDEKKKYEEDKVKYENLCKVIKDILEK-KVEKVAVSNRLVSSPCCIVTS  585

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGWSANMERIM++Q L D+S   YM  K+ LEINP H +IK LRERV  D  D++ K+ 
Sbjct  586  EYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDL  645

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF + DP+  ASRIY  +K  L+I
Sbjct  646  VVLLFETALLSSGFTLDDPQLHASRIYRMIKLGLDI  681



>ref|XP_002998541.1| heat shock protein 90 [Phytophthora infestans T30-4]
 gb|EEY69894.1| heat shock protein 90 [Phytophthora infestans T30-4]
Length=706

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 107/155 (69%), Gaps = 6/155 (4%)
 Frame = -2

Query  772  SKEXLKIKDSK-----AKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            +KE LK+++++      +E K + + L K  K  L  D V++V+ISNR+ ++PCV+VT +
Sbjct  522  TKEGLKMEETEDEKKSFEEAKAATEGLCKLMKEVL-DDKVEKVEISNRIVESPCVLVTGE  580

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIM++Q L D+S  AYM  K+ +EINP HPIIK LRE+   D  D++ K+  
Sbjct  581  YGWSANMERIMKAQALRDSSTSAYMSSKKTMEINPLHPIIKSLREKAEADKSDKTVKDLI  640

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
             L+Y T+L+ SGF++ +P  FA+RI+  +K  L+I
Sbjct  641  WLLYDTSLLTSGFSLDEPTTFANRIHRLIKLGLSI  675



>gb|AIU38246.1| heat shock protein 90 [Anisakis brevispiculata]
Length=721

 Score =   141 bits (355),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 104/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +S     K +E K  +++L K  K  L    V++V +SNRL  +PC +VTS
Sbjct  530  VTKEGLELPESEDEKKKFEEDKVKYENLCKVIKDILEK-KVEKVAVSNRLVSSPCCIVTS  588

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGWSANMERIM++Q L D+S   YM  K+ LEINP H +IK LRERV  D  D++ K+ 
Sbjct  589  EYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDL  648

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF + DP+  ASRIY  +K  L+I
Sbjct  649  VVLLFETALLSSGFTLDDPQLHASRIYRMIKLGLDI  684



>emb|CAK22426.1| heat shock protein 83 [Beta vulgaris]
Length=350

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 95/133 (71%), Gaps = 1/133 (1%)
 Frame = -2

Query  721  SFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQ  542
            SF++L K  K  L  D V++V +S+R+ D+PC +VT +YGWSANMERIM++Q L D+S  
Sbjct  191  SFENLCKVIKDVLG-DKVEKVVVSDRIVDSPCCLVTGEYGWSANMERIMKAQALRDSSMG  249

Query  541  AYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFA  362
            AYM  K+ +EINP + I++ELR+R   D  D+S K+   L+++TAL+ SGF++ DP  FA
Sbjct  250  AYMSSKKTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFA  309

Query  361  SRIYNSVKSSLNI  323
            +RI+  +K  L+I
Sbjct  310  ARIHRMLKLGLSI  322



>gb|AIU38243.1| heat shock protein 90 [Anisakis typica]
Length=720

 Score =   141 bits (355),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 104/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +S     K +E K  +++L K  K  L    V++V +SNRL  +PC +VTS
Sbjct  529  VTKEGLELPESEDEKKKYEEDKVKYENLCKVIKDILEK-KVEKVAVSNRLVSSPCCIVTS  587

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGWSANMERIM++Q L D+S   YM  K+ LEINP H +IK LRERV  D  D++ K+ 
Sbjct  588  EYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDL  647

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF + DP+  ASRIY  +K  L+I
Sbjct  648  VVLLFETALLSSGFTLDDPQLHASRIYRMIKLGLDI  683



>gb|ETK95017.1| heat shock protein 90-2 [Phytophthora parasitica]
 gb|ETL48421.1| heat shock protein 90-2 [Phytophthora parasitica]
Length=706

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 107/155 (69%), Gaps = 6/155 (4%)
 Frame = -2

Query  772  SKEXLKIKDSK-----AKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            +KE LK+++++      +E K + + L K  K  L  D V++V+ISNR+ ++PCV+VT +
Sbjct  522  TKEGLKMEETEDEKKSFEEAKAATEGLCKLMKEVL-DDKVEKVEISNRIVESPCVLVTGE  580

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIM++Q L D+S  AYM  K+ +EINP HPIIK LRE+   D  D++ K+  
Sbjct  581  YGWSANMERIMKAQALRDSSTSAYMTSKKTMEINPLHPIIKSLREKAEADKSDKTVKDLI  640

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
             L+Y T+L+ SGF++ +P  FA+RI+  +K  L+I
Sbjct  641  WLLYDTSLLTSGFSLDEPTTFANRIHRLIKLGLSI  675



>ref|XP_008915791.1| heat shock protein 90-2 [Phytophthora parasitica INRA-310]
 gb|ETI55191.1| heat shock protein 90-2 [Phytophthora parasitica P1569]
 gb|ETM01491.1| heat shock protein 90-2 [Phytophthora parasitica]
 gb|ETM54696.1| heat shock protein 90-2 [Phytophthora parasitica]
 gb|ETM98910.1| heat shock protein 90-2 [Phytophthora parasitica INRA-310]
 gb|ETO83922.1| heat shock protein 90-2 [Phytophthora parasitica P1976]
 gb|ETP24998.1| heat shock protein 90-2 [Phytophthora parasitica CJ01A1]
 gb|ETP52997.1| heat shock protein 90-2 [Phytophthora parasitica P10297]
Length=706

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 107/155 (69%), Gaps = 6/155 (4%)
 Frame = -2

Query  772  SKEXLKIKDSK-----AKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            +KE LK+++++      +E K + + L K  K  L  D V++V+ISNR+ ++PCV+VT +
Sbjct  522  TKEGLKMEETEDEKKSFEEAKAATEGLCKLMKEVL-DDKVEKVEISNRIVESPCVLVTGE  580

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIM++Q L D+S  AYM  K+ +EINP HPIIK LRE+   D  D++ K+  
Sbjct  581  YGWSANMERIMKAQALRDSSTSAYMTSKKTMEINPLHPIIKSLREKAEADKSDKTVKDLI  640

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
             L+Y T+L+ SGF++ +P  FA+RI+  +K  L+I
Sbjct  641  WLLYDTSLLTSGFSLDEPTTFANRIHRLIKLGLSI  675



>gb|AIU38245.1| heat shock protein 90 [Anisakis physeteris]
Length=720

 Score =   141 bits (355),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 104/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +S     K +E K  +++L K  K  L    V++V +SNRL  +PC +VTS
Sbjct  529  VTKEGLELPESEDEKKKFEEDKVKYENLCKVIKDILEK-KVEKVAVSNRLVSSPCCIVTS  587

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGWSANMERIM++Q L D+S   YM  K+ LEINP H +IK LRERV  D  D++ K+ 
Sbjct  588  EYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDL  647

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF + DP+  ASRIY  +K  L+I
Sbjct  648  VVLLFETALLSSGFTLDDPQLHASRIYRMIKLGLDI  683



>ref|XP_007863437.1| HSP90-domain-containing protein [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ58188.1| HSP90-domain-containing protein [Gloeophyllum trabeum ATCC 11539]
Length=701

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = -2

Query  718  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  539
            F DL    K AL  D V++V +SNR++D+PCV+VT ++GWSANMERIM++Q L D+S  +
Sbjct  539  FNDLCSAVKEALG-DKVEKVVVSNRISDSPCVLVTGQFGWSANMERIMKAQALRDSSMSS  597

Query  538  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  359
            YM  K+ LE+NP++PIIKEL+ +V +D  D+S ++   L+++TAL+ SGF++ DP  FA 
Sbjct  598  YMASKKTLELNPKNPIIKELKNKVAQDKADKSVRDLTYLLFETALLTSGFSLDDPTSFAK  657

Query  358  RIYNSVKSSLNI  323
            RI+  +   L++
Sbjct  658  RIHRMIALGLDV  669



>ref|XP_009534751.1| hypothetical protein PHYSODRAFT_355817 [Phytophthora sojae]
 gb|EGZ09890.1| hypothetical protein PHYSODRAFT_355817 [Phytophthora sojae]
Length=706

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 107/155 (69%), Gaps = 6/155 (4%)
 Frame = -2

Query  772  SKEXLKIKDSK-----AKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSK  608
            +KE LK+++++      +E K + + L K  K  L  D V++V+ISNR+ ++PCV+VT +
Sbjct  522  TKEGLKMEETEDEKKSFEEAKAATEGLCKLMKEVL-DDKVEKVEISNRIVESPCVLVTGE  580

Query  607  YGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETA  428
            YGWSANMERIM++Q L D+S  AYM  K+ +EINP HPIIK LRE+   D  D++ K+  
Sbjct  581  YGWSANMERIMKAQALRDSSTSAYMTSKKTMEINPLHPIIKSLREKAEADKSDKTVKDLI  640

Query  427  QLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
             L+Y T+L+ SGF++ +P  FA+RI+  +K  L+I
Sbjct  641  WLLYDTSLLTSGFSLDEPTTFANRIHRLIKLGLSI  675



>ref|XP_001649751.1| AAEL014845-PA [Aedes aegypti]
 gb|EAT32918.1| AAEL014845-PA [Aedes aegypti]
Length=560

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = -2

Query  718  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  539
            F++L K  K  L  + V++V +SNRL D+PC +VTS+YGWSANMERIM++Q L D+S   
Sbjct  394  FENLCKVMKSVL-DNKVEKVVVSNRLVDSPCCIVTSQYGWSANMERIMKAQALRDSSAMG  452

Query  538  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  359
            YM GK+ +EINP H II+ LR+R   D  D++ K+   L+++TAL+ SGF++ +P   AS
Sbjct  453  YMAGKKHMEINPDHSIIETLRQRAEADKNDKAVKDLVILLFETALLSSGFSLDEPGVHAS  512

Query  358  RIYNSVKSSLNI  323
            RIY  VK  L I
Sbjct  513  RIYRMVKLGLGI  524



>gb|ETN83529.1| putative heat shock protein 90 [Necator americanus]
Length=689

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 105/157 (67%), Gaps = 6/157 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +S     K +E K  F++L K  K  L    V++V +SNRL  +PC +VTS
Sbjct  501  VTKEGLELPESEDEKKKFEEDKVKFENLCKVIKDILEK-KVEKVVVSNRLVHSPCCIVTS  559

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGWSANMERIM++Q L D+S   YM  K+ LEINP H I+K LRERV  D  D++ K+ 
Sbjct  560  EYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRERVEVDKNDKTVKDL  619

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  320
              L+++TAL+ SGF++ +P+  ASRIY  +K  L+I 
Sbjct  620  VILLFETALLSSGFSLEEPQSHASRIYRMIKLGLDIG  656



>ref|XP_009542788.1| hypothetical protein HETIRDRAFT_311260 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW85997.1| hypothetical protein HETIRDRAFT_311260 [Heterobasidion irregulare 
TC 32-1]
Length=701

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 110/156 (71%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            VSKE L+++++       +E  ++F+DL K  K AL  + V++V +SNR+ D+PCV+VT 
Sbjct  516  VSKEGLELEETDEEKKAREEEAKAFEDLCKVIKDALG-EKVEKVVVSNRITDSPCVLVTG  574

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            ++GWS+NMERIM++Q L D+S  +YM  K+ LE+NP HPIIKEL+ +V +D  D+S ++ 
Sbjct  575  QFGWSSNMERIMKAQALRDSSMSSYMASKKTLELNPTHPIIKELKRKVSEDKADKSVRDL  634

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF++ +P  FA RI+  +   L++
Sbjct  635  TYLLFETALLTSGFSLEEPTSFAKRIHRMISLGLDV  670



>gb|EXX78198.1| Hsp90 family chaperone HSC82 [Rhizophagus irregularis DAOM 197198w]
Length=359

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = -2

Query  718  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  539
            F DL K  K  L  D V++V +SNR++++PCV+VT +YGW+AN ERIM++Q L D+S  +
Sbjct  198  FDDLCKQIKEILG-DKVEKVLVSNRISESPCVLVTGQYGWAANFERIMKAQALRDSSMAS  256

Query  538  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  359
            YM  K+++EINP HPI+K L+ +V  D  D++ K+   L+++T+L++SGF + +P  FA 
Sbjct  257  YMASKKIMEINPNHPIVKSLKSKVEADKNDKTVKDLTWLLFETSLLQSGFTLEEPSSFAG  316

Query  358  RIYNSVKSSLNIS  320
            RI+  +K  L+I 
Sbjct  317  RIFKMIKLGLDIG  329



>ref|XP_007361188.1| HSP90-domain-containing protein [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF65926.1| HSP90-domain-containing protein [Dichomitus squalens LYAD-421 
SS1]
Length=703

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = -2

Query  718  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  539
            F+DL K  K AL  D V++V +SNR+ D+PCV+VT ++GWS+NMERIM++Q L D+S  +
Sbjct  542  FEDLCKAVKDALG-DKVEKVVVSNRITDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  600

Query  538  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  359
            YM  K+ LE+NP +PI+KEL+ +V +D  D+S ++   L+++TAL+ SGF++ DP  FA 
Sbjct  601  YMASKKTLELNPHNPIVKELKRKVAEDKADKSVRDLTYLLFETALLTSGFSLDDPTSFAK  660

Query  358  RIYNSVKSSLNI  323
            RI+  +   L++
Sbjct  661  RIHRMIALGLDV  672



>gb|KIH68348.1| Hsp90 protein [Ancylostoma duodenale]
Length=707

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 105/157 (67%), Gaps = 6/157 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +S     K +E K  F++L K  K  L    V++V +SNRL  +PC +VTS
Sbjct  519  VTKEGLELPESEDEKKKFEEDKVKFENLCKVIKDILEK-KVEKVVVSNRLVHSPCCIVTS  577

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGWSANMERIM++Q L D+S   YM  K+ LEINP H I+K LRERV  D  D++ K+ 
Sbjct  578  EYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRERVEVDKNDKTVKDL  637

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  320
              L+++TAL+ SGF++ +P+  ASRIY  +K  L+I 
Sbjct  638  VILLFETALLSSGFSLEEPQSHASRIYRMIKLGLDIG  674



>gb|ACU00668.1| heat shock protein 90 [Haemonchus contortus]
Length=707

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 104/157 (66%), Gaps = 6/157 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +S     K +E K  F++L K  K  L    V++V +SNRL  +PC +VTS
Sbjct  519  VTKEGLELPESEDEKKKFEEDKVKFENLCKVIKDILEK-KVEKVVVSNRLVHSPCCIVTS  577

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGWSANMERIM++Q L D+S   YM  K+ LEINP H I+K LRERV  D  D++ K+ 
Sbjct  578  EYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRERVEVDKNDKTVKDL  637

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  320
              L+++TAL+ SGF + +P+  ASRIY  +K  L+I 
Sbjct  638  VILLFETALLSSGFTLEEPQSHASRIYRMIKLGLDIG  674



>ref|XP_011345590.1| PREDICTED: heat shock protein 83 [Cerapachys biroi]
 gb|EZA50089.1| Heat shock protein HSP 90-alpha [Cerapachys biroi]
Length=722

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 103/156 (66%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKI---KDSKAK--ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++   +D K K  E K  F++L K  K  L    V++V +SNRL D+PC +VTS
Sbjct  534  VTKEGLELPEDEDEKKKREEDKTKFENLCKVMKDIL-DKKVEKVVVSNRLVDSPCCIVTS  592

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGW+ANMERIM++Q L D S   YM  K+ LEINP HPI++ LR++V  D  D+S K+ 
Sbjct  593  QYGWTANMERIMKAQALRDTSTMGYMAAKKHLEINPDHPIMENLRQKVEADKHDKSVKDL  652

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF + DP+  ASRIY  +K  L  
Sbjct  653  VMLLFETALLSSGFVLEDPQVHASRIYRMIKLGLGF  688



>gb|AAM02974.1|AF421541_1 Hsp90 [Crypthecodinium cohnii]
Length=711

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 106/158 (67%), Gaps = 5/158 (3%)
 Frame = -2

Query  784  FQDVSKEXLKIKDS----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVV  617
             +  +KE L ++D     K +ELK  F+ LTK  K  L  D V++V +S+R+AD+PCV+ 
Sbjct  522  LKSTTKEGLDLEDEDEKKKLEELKAEFEPLTKLMKEVLG-DKVEKVLVSSRMADSPCVLT  580

Query  616  TSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTK  437
            TS+YGWSANMERIM++Q + D S  +YM  K+ +EINP+H I+ EL+++   D  D++ K
Sbjct  581  TSEYGWSANMERIMKAQAMRDNSMTSYMVSKKTMEINPKHSIMSELKKKAAADKSDKTVK  640

Query  436  ETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
            +   L++ T+L+ SGFN+ +P  FA RI+  +K  L+I
Sbjct  641  DLIWLLFDTSLLTSGFNLDEPTQFAGRIHRMIKLGLSI  678



>emb|CDP96098.1| Protein BM-DAF-21, isoform a [Brugia malayi]
Length=717

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = -2

Query  718  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  539
            F++L K  K  L    V++V +SNRL  +PC +VTS+YGWSANMERIM++Q L D+S   
Sbjct  550  FENLCKVMKDILEK-KVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMG  608

Query  538  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  359
            YM  K+ LEINP H +IK LRERV  D  D++ K+   L+++TAL+ SGF++ DP+  AS
Sbjct  609  YMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFSLEDPQLHAS  668

Query  358  RIYNSVKSSLNIS  320
            RIY  +K  L+I+
Sbjct  669  RIYRMIKLGLDIT  681



>tpg|DAA61910.1| TPA: hypothetical protein ZEAMMB73_416250 [Zea mays]
Length=708

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 98/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  784  FQDVSKEXLKIKDS---KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVT  614
            F D+SKE L++ D    K KE K+ +  L  W K  L  D V +V+IS RL+ +PCV+V+
Sbjct  507  FVDISKEDLELGDEDEDKEKESKQEYTLLCDWIKQQLG-DKVAKVQISKRLSSSPCVLVS  565

Query  613  SKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKE  434
             K+GWSANMER+M++QTL D S   +MRG+R+ EINP HPIIK+L      +PE    K 
Sbjct  566  GKFGWSANMERLMKAQTLGDTSSLEFMRGRRIFEINPDHPIIKDLNAACKNEPESTEAKR  625

Query  433  TAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLN  326
             A+L+Y+ AL+ SG+    P +   +IY  +  +L 
Sbjct  626  AAELLYEAALISSGYTPDSPAELGGKIYEMMTMALG  661



>gb|KIP08934.1| hypothetical protein PHLGIDRAFT_103566 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=698

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 110/156 (71%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            VSKE L+++++       +E  + F+DL K  K AL  D V++V +SNR++D+PCV+VT 
Sbjct  514  VSKEGLELEETDEEKKAREEEAKQFEDLCKAVKEALG-DKVEKVVVSNRISDSPCVLVTG  572

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            ++GWS+NMERIM++Q L D+S  +YM  K+ LE+NP +PI++EL+ +V +D  D+S ++ 
Sbjct  573  QFGWSSNMERIMKAQALRDSSMSSYMASKKTLELNPHNPIVRELKSKVAEDKADKSVRDL  632

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF++ DP  FA RI+  +   L++
Sbjct  633  TYLLFETALLTSGFSLDDPTSFAKRIHRMIALGLDV  668



>gb|EYC13285.1| hypothetical protein Y032_0044g1081 [Ancylostoma ceylanicum]
Length=707

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 105/157 (67%), Gaps = 6/157 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +S     K +E K  F++L K  K  L    V++V +SNRL  +PC +VTS
Sbjct  519  VTKEGLELPESEDEKKKFEEDKVKFENLCKVIKDILEK-KVEKVVVSNRLVHSPCCIVTS  577

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGWSANMERIM++Q L D+S   YM  K+ LEINP H I+K LRERV  D  D++ K+ 
Sbjct  578  EYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRERVEVDKNDKTVKDL  637

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  320
              L+++TAL+ SGF++ +P+  ASRIY  +K  L+I 
Sbjct  638  VILLFETALLSSGFSLEEPQSHASRIYRMIKLGLDIG  674



>ref|XP_006849050.1| hypothetical protein AMTR_s00028p00187760 [Amborella trichopoda]
 gb|ERN10631.1| hypothetical protein AMTR_s00028p00187760 [Amborella trichopoda]
Length=799

 Score =   141 bits (355),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 93/148 (63%), Gaps = 4/148 (3%)
 Frame = -2

Query  784  FQDVSKEXLKIKD---SKAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVT  614
            F D+SKE L + D    + KE+K+ +     W K  L  D V  V+ISNRL+ +PCV+V+
Sbjct  608  FVDISKEDLDLGDKNEDREKEMKQEYGKTCDWIKKRLG-DKVASVQISNRLSTSPCVLVS  666

Query  613  SKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKE  434
             K+GWSANMER+M++QTL D S   YMRG+RV EINP HPIIK+L      +P+      
Sbjct  667  GKFGWSANMERLMKAQTLGDTSSLEYMRGRRVFEINPEHPIIKDLNAACSSNPDSTDALR  726

Query  433  TAQLIYKTALMESGFNVPDPKDFASRIY  350
               L+Y TAL+ SGF   +P +  S+IY
Sbjct  727  AIDLLYDTALISSGFTPENPSELGSKIY  754



>emb|CAA06694.1| heat shock protein 90 [Brugia pahangi]
Length=717

 Score =   140 bits (354),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = -2

Query  718  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  539
            F++L K  K  L    V++V +SNRL  +PC +VTS+YGWSANMERIM++Q L D+S   
Sbjct  550  FENLCKVMKDILEK-KVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMG  608

Query  538  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  359
            YM  K+ LEINP H +IK LRERV  D  D++ K+   L+++TAL+ SGF++ DP+  AS
Sbjct  609  YMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFSLEDPQLHAS  668

Query  358  RIYNSVKSSLNIS  320
            RIY  +K  L+I+
Sbjct  669  RIYRMIKLGLDIT  681



>sp|O61998.2|HSP90_BRUPA RecName: Full=Heat shock protein 90 [Brugia pahangi]
 emb|CAA06695.1| heat shock protein 90 [Brugia pahangi]
Length=717

 Score =   140 bits (354),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = -2

Query  718  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  539
            F++L K  K  L    V++V +SNRL  +PC +VTS+YGWSANMERIM++Q L D+S   
Sbjct  550  FENLCKVMKDILEK-KVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMG  608

Query  538  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  359
            YM  K+ LEINP H +IK LRERV  D  D++ K+   L+++TAL+ SGF++ DP+  AS
Sbjct  609  YMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFSLEDPQLHAS  668

Query  358  RIYNSVKSSLNIS  320
            RIY  +K  L+I+
Sbjct  669  RIYRMIKLGLDIT  681



>gb|EJW88125.1| heat shock protein 90 [Wuchereria bancrofti]
Length=717

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = -2

Query  718  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  539
            F++L K  K  L    V++V +SNRL  +PC +VTS+YGWSANMERIM++Q L D+S   
Sbjct  550  FENLCKVMKDILEK-KVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMG  608

Query  538  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  359
            YM  K+ LEINP H +IK LRERV  D  D++ K+   L+++TAL+ SGF++ DP+  AS
Sbjct  609  YMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFSLEDPQLHAS  668

Query  358  RIYNSVKSSLNIS  320
            RIY  +K  L+I+
Sbjct  669  RIYRMIKLGLDIT  681



>gb|KIP09595.1| hypothetical protein PHLGIDRAFT_126182 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=697

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = -2

Query  718  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  539
            F+DL K  K AL  D V++V +SNR++D+PCV+VT ++GWS+NMERIM++Q L D+S  +
Sbjct  537  FEDLCKAVKEALG-DKVEKVIVSNRISDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  595

Query  538  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  359
            YM  K+ LE+NP +PI+KEL+ +V +D  D+S ++   L+++TAL+ SGF++ DP  FA 
Sbjct  596  YMASKKTLELNPHNPIVKELKSKVAEDKADKSVRDLTYLLFETALLTSGFSLDDPTSFAK  655

Query  358  RIYNSVKSSLNI  323
            RI+  +   L++
Sbjct  656  RIHRMIALGLDV  667



>ref|XP_001901767.1| heat shock protein 90 [Brugia malayi]
Length=699

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = -2

Query  718  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  539
            F++L K  K  L    V++V +SNRL  +PC +VTS+YGWSANMERIM++Q L D+S   
Sbjct  532  FENLCKVMKDILEK-KVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMG  590

Query  538  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  359
            YM  K+ LEINP H +IK LRERV  D  D++ K+   L+++TAL+ SGF++ DP+  AS
Sbjct  591  YMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFSLEDPQLHAS  650

Query  358  RIYNSVKSSLNIS  320
            RIY  +K  L+I+
Sbjct  651  RIYRMIKLGLDIT  663



>gb|EYD92886.1| hsp90 family protein, partial [Escherichia coli 1-176-05_S1_C1]
Length=294

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 106/157 (68%), Gaps = 8/157 (5%)
 Frame = -2

Query  775  VSKEXLKIKDSKAKELKESFKDLTKWWK------GALASDNVDEVKISNRLADTPCVVVT  614
             +KE L ++++   E KE+F+ L K ++        +  D VD+V  S R++D+PCV+VT
Sbjct  111  CTKEGLTLEETA--EEKEAFEALQKEYEPLCQLIKEVLHDKVDKVITSQRISDSPCVLVT  168

Query  613  SKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKE  434
            S+YGWSANMERIM++Q L D S  +YM  K+ +EINP +PI+ EL+ ++V D  D++ K+
Sbjct  169  SEYGWSANMERIMKAQALRDTSMTSYMMSKKTMEINPYNPIMTELKNKIVNDKSDKTVKD  228

Query  433  TAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
               L+Y+T+L+ SGF++ DP  F+SRI   +K  L+I
Sbjct  229  LIWLLYETSLLTSGFSLEDPTQFSSRINRMIKLGLSI  265



>ref|XP_008045254.1| heat shock protein 90 [Trametes versicolor FP-101664 SS1]
 gb|EIW51690.1| heat shock protein 90 [Trametes versicolor FP-101664 SS1]
Length=700

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 108/156 (69%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            VSKE L+++++       +E    F+DL K  K AL  D V++V +SNR+ D+PCV+VT 
Sbjct  514  VSKEGLELEETDEEKKAREEEATQFEDLCKAVKEALG-DKVEKVVVSNRITDSPCVLVTG  572

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            ++GWS+NMERIM++Q L D+S  +YM  K+ LE+NP +P+IKEL+ +V +D  D+S ++ 
Sbjct  573  QFGWSSNMERIMKAQALRDSSMSSYMASKKTLELNPHNPVIKELKRKVSEDKADKSVRDL  632

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF++ DP  FA RI+  +   L++
Sbjct  633  TYLLFETALLTSGFSLDDPTSFAKRIHRMIALGLDV  668



>ref|NP_001278186.1| heat shock protein HSP 90-alpha 1-like [Astyanax mexicanus]
 gb|AAO52675.1| heat shock protein 90 alpha [Astyanax mexicanus]
Length=723

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 100/156 (64%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +      K  ELK  F++L K  K  L    +++V +SNRL  +PC +VTS
Sbjct  535  VTKEGLELPEDEEEKKKQDELKTKFENLCKIMKDIL-DKKIEKVTVSNRLVASPCCIVTS  593

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
             YGW+ANMERIM+SQ L D S   YM  K+ LEINP HPI++ LRE+   D  D++ K+ 
Sbjct  594  TYGWTANMERIMKSQALRDNSTMGYMTAKKHLEINPLHPIVETLREKAEADKNDKAVKDL  653

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF + DP+  A+RIY  +K  L I
Sbjct  654  VILLFETALLSSGFTLEDPQTHANRIYRMIKLGLGI  689



>ref|XP_008651357.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=797

 Score =   140 bits (354),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 98/156 (63%), Gaps = 4/156 (3%)
 Frame = -2

Query  784  FQDVSKEXLKIKDS---KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVT  614
            F D+SKE L++ D    K KE K+ +  L  W K  L  D V +V+IS RL+ +PCV+V+
Sbjct  596  FVDISKEDLELGDEDEDKEKESKQEYTLLCDWIKQQLG-DKVAKVQISKRLSSSPCVLVS  654

Query  613  SKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKE  434
             K+GWSANMER+M++QTL D S   +MRG+R+ EINP HPIIK+L      +PE    K 
Sbjct  655  GKFGWSANMERLMKAQTLGDTSSLEFMRGRRIFEINPDHPIIKDLNAACKNEPESTEAKR  714

Query  433  TAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLN  326
             A+L+Y+ AL+ SG+    P +   +IY  +  +L 
Sbjct  715  AAELLYEAALISSGYTPDSPAELGGKIYEMMTMALG  750



>gb|AAG22091.1|AF306643_1 90 kDa heat-shock protein [Scyliorhinus torazame]
Length=138

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 87/132 (66%), Gaps = 1/132 (1%)
 Frame = -2

Query  718  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  539
            + DL K  K  L    V++V +SNRL  +PC +VTS YGW+ANMERIM++Q L D S   
Sbjct  5    YDDLCKLMKEIL-DKKVEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMG  63

Query  538  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  359
            YM  K+ LEINP HPI+  LR++   D  D++ K+   L+++TAL+ SGF++ DP+  ++
Sbjct  64   YMMAKKHLEINPDHPIVDTLRQKADVDKNDKAVKDLVILLFETALLSSGFSLDDPQTHSN  123

Query  358  RIYNSVKSSLNI  323
            RIY  +K  L I
Sbjct  124  RIYRMIKLGLGI  135



>gb|ACO55133.1| heat shock protein 90 [Litomosoides sigmodontis]
Length=718

 Score =   140 bits (353),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = -2

Query  718  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  539
            F++L K  K  L    V++V +SNRL  +PC +VTS+YGWSANMERIM++Q L D+S   
Sbjct  551  FENLCKVMKDILEK-KVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMG  609

Query  538  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  359
            YM  K+ LEINP H +IK LRERV  D  D++ K+   L+++TAL+ SGF++ DP+  AS
Sbjct  610  YMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFSLDDPQLHAS  669

Query  358  RIYNSVKSSLNIS  320
            RIY  +K  L+I+
Sbjct  670  RIYRMIKLGLDIT  682



>gb|AGI19327.1| heat shock protein 90 [Liriomyza trifolii]
Length=714

 Score =   140 bits (353),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 105/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDSKAK-----ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ + +A+     E K  F++L K  K  L  + V++V +SNRL D+PC +VTS
Sbjct  525  VTKEGLELPEDEAEKKKREEDKAKFENLCKLIKSIL-DNKVEKVVVSNRLVDSPCCIVTS  583

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGWSANMERIM++Q L D+S   YM GK+ LEINP HPII+ LR +   D  D++ K+ 
Sbjct  584  QYGWSANMERIMKAQALRDSSTMGYMSGKKHLEINPDHPIIETLRVKSEADKNDKAVKDL  643

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++T+L+ SGF++  P+  ASRIY  +K  L I
Sbjct  644  VILLFETSLLSSGFSLDSPQVHASRIYRMIKLGLGI  679



>gb|ACO57617.1| heat shock protein 90 [Pteromalus puparum]
Length=715

 Score =   140 bits (353),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = -2

Query  718  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  539
            F++L K  K  L S  V++V +SNRL D+PC +VTS+YGW+ANMERIM++Q L DAS   
Sbjct  552  FENLCKVMKNILDS-KVEKVLVSNRLVDSPCCIVTSQYGWTANMERIMKAQALRDASTMG  610

Query  538  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  359
            YM  K+ LEINP HP+I  LRE+   D  D+S K+   L+++TAL+ SGF++ +P+  A+
Sbjct  611  YMAAKKHLEINPDHPVINTLREKAEADKNDKSVKDLVVLLFETALLSSGFSLDEPQVHAA  670

Query  358  RIYNSVKSSLNI  323
            RIY  +K  L I
Sbjct  671  RIYRMIKLGLGI  682



>gb|AAW49253.2| heat shock protein 90 [Liriomyza sativae]
Length=714

 Score =   140 bits (353),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 105/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDSKAK-----ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ + +A+     E K  F++L K  K  L  + V++V +SNRL D+PC +VTS
Sbjct  525  VTKEGLELPEDEAEKKKREEDKAKFENLCKLIKSIL-DNKVEKVVVSNRLVDSPCCIVTS  583

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGWSANMERIM++Q L D+S   YM GK+ LEINP HPII+ LR +   D  D++ K+ 
Sbjct  584  QYGWSANMERIMKAQALRDSSTMGYMSGKKHLEINPDHPIIETLRVKSEADKNDKAVKDL  643

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++T+L+ SGF++  P+  ASRIY  +K  L I
Sbjct  644  VILLFETSLLSSGFSLDSPQVHASRIYRMIKLGLGI  679



>ref|XP_004974995.1| PREDICTED: heat shock protein 82-like [Setaria italica]
Length=709

 Score =   140 bits (352),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 107/156 (69%), Gaps = 7/156 (4%)
 Frame = -2

Query  772  SKEXLKIK--DSKAK----ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            +KE LK+   D +AK    E K+ F+DL K  K  L  D V++V +S+R+ D+PC +VT 
Sbjct  526  TKEGLKLDEDDEEAKKRREERKKQFEDLCKVIKEILG-DRVEKVVVSDRIVDSPCCLVTG  584

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
            +YGW+ANMERIM++Q L D+S  AYM  K+ +EINP + I++ELR+R   D  D+S K+ 
Sbjct  585  EYGWTANMERIMKAQALRDSSMSAYMASKKTMEINPDNGIMEELRKRAEADRNDKSVKDL  644

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF++ DP  FA+RI+  +K  LNI
Sbjct  645  VMLLFETALLTSGFSLDDPNTFAARIHRMLKLGLNI  680



>ref|XP_008311364.1| PREDICTED: heat shock protein HSP 90-alpha 1 [Cynoglossus semilaevis]
Length=724

 Score =   140 bits (353),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 100/156 (64%), Gaps = 6/156 (4%)
 Frame = -2

Query  775  VSKEXLKIKDS-----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTS  611
            V+KE L++ +      K +ELK  F+DL K  K  L    +++V +SNRL  +PC +VTS
Sbjct  536  VTKEGLELPEDEDEKKKQEELKNKFEDLCKIMKDIL-DKKIEKVTVSNRLVSSPCCIVTS  594

Query  610  KYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKET  431
             YGW+ANMERIM+SQ L D S   YM  K+ LEINP HPI++ LR +   D  D++ K+ 
Sbjct  595  TYGWTANMERIMKSQALRDNSTMGYMTAKKHLEINPMHPIVETLRVKAEVDKNDKAVKDL  654

Query  430  AQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
              L+++TAL+ SGF + DP+  A+RIY  +K  L I
Sbjct  655  VILLFETALLSSGFTLEDPQTHANRIYRMIKLGLGI  690



>gb|AFD34191.2| HSP90 [Prorocentrum minimum]
Length=709

 Score =   140 bits (352),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 106/158 (67%), Gaps = 5/158 (3%)
 Frame = -2

Query  784  FQDVSKEXLKIKDS----KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVV  617
             +  +KE L ++D     K +E+K  F+ LTK  K  L  D V++V IS+R+AD+PCV+ 
Sbjct  520  LKSTTKEGLDLEDEDEKKKLEEMKAEFEPLTKLMKEVLG-DKVEKVVISSRMADSPCVLT  578

Query  616  TSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTK  437
            TS+YGWSANMERIM++Q L D S  +YM  K+ +E+NP+H I+ EL+++   D  D++ K
Sbjct  579  TSEYGWSANMERIMKAQALRDNSMTSYMVSKKTMEVNPKHSIMSELKKKASADKSDKTVK  638

Query  436  ETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  323
            +   L++ T+L+ SGFN+ +P  FA RI+  +K  L+I
Sbjct  639  DLIWLLFDTSLLTSGFNLDEPTQFAGRIHRMIKLGLSI  676



>gb|EMD38391.1| hypothetical protein CERSUDRAFT_153213 [Ceriporiopsis subvermispora 
B]
Length=698

 Score =   140 bits (352),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = -2

Query  718  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  539
            F+DL K  K AL  D V++V +SNR+ D+PCV+VT ++GWS+NMERIM++Q L D+S  +
Sbjct  538  FEDLCKAVKEALG-DKVEKVVVSNRITDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  596

Query  538  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  359
            YM  K+ LE+NP +P++KEL+++V +D  D+S ++   L+++TAL+ SGF++ DP  FA 
Sbjct  597  YMASKKTLELNPHNPVVKELKKKVAEDSADKSVRDLTYLLFETALLTSGFSLDDPTSFAK  656

Query  358  RIYNSVKSSLNI  323
            RI+  +   L++
Sbjct  657  RIHRMIALGLDV  668



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1534440539150