BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF034F10

Length=747
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006338348.1|  PREDICTED: receptor-like protein kinase FERO...    221   1e-62   Solanum tuberosum [potatoes]
emb|CDP05402.1|  unnamed protein product                                218   1e-61   Coffea canephora [robusta coffee]
ref|XP_004232151.1|  PREDICTED: receptor-like protein kinase FERONIA    218   2e-61   Solanum lycopersicum
emb|CDP05401.1|  unnamed protein product                                215   1e-60   Coffea canephora [robusta coffee]
emb|CDP19885.1|  unnamed protein product                                215   2e-60   Coffea canephora [robusta coffee]
ref|XP_009588433.1|  PREDICTED: receptor-like protein kinase FERONIA    209   1e-58   Nicotiana tomentosiformis
ref|XP_009790513.1|  PREDICTED: receptor-like protein kinase FERONIA    205   3e-57   Nicotiana sylvestris
ref|XP_009790514.1|  PREDICTED: receptor-like protein kinase FERONIA    205   6e-57   Nicotiana sylvestris
gb|EYU44220.1|  hypothetical protein MIMGU_mgv1a003782mg                201   7e-57   Erythranthe guttata [common monkey flower]
emb|CDP19887.1|  unnamed protein product                                197   2e-54   Coffea canephora [robusta coffee]
ref|XP_006373376.1|  hypothetical protein POPTR_0017s13200g             187   1e-53   
ref|NP_001141864.1|  uncharacterized protein LOC100274007               184   1e-53   
emb|CDY48659.1|  BnaC07g27500D                                          182   3e-53   Brassica napus [oilseed rape]
ref|XP_007217058.1|  hypothetical protein PRUPE_ppa001157mg             194   5e-53   
emb|CDP06209.1|  unnamed protein product                                190   9e-53   Coffea canephora [robusta coffee]
ref|XP_008230913.1|  PREDICTED: receptor-like protein kinase FERONIA    192   1e-52   Prunus mume [ume]
ref|XP_011099030.1|  PREDICTED: receptor-like protein kinase FERONIA    192   2e-52   Sesamum indicum [beniseed]
ref|XP_006373380.1|  hypothetical protein POPTR_0017s13240g             192   3e-52   
ref|XP_009373799.1|  PREDICTED: receptor-like protein kinase FERONIA    191   4e-52   
ref|XP_011018979.1|  PREDICTED: receptor-like protein kinase FERONIA    182   7e-52   Populus euphratica
emb|CAN65310.1|  hypothetical protein VITISV_043086                     181   8e-52   Vitis vinifera
emb|CAN68061.1|  hypothetical protein VITISV_037438                     181   9e-52   Vitis vinifera
emb|CAN77538.1|  hypothetical protein VITISV_025026                     189   1e-51   Vitis vinifera
ref|XP_002277584.3|  PREDICTED: receptor-like protein kinase FERONIA    190   2e-51   Vitis vinifera
gb|ABY40731.1|  FERONIA receptor-like kinase                            184   2e-51   Citrus trifoliata [hardy orange]
emb|CBI21192.3|  unnamed protein product                                190   2e-51   Vitis vinifera
ref|XP_010694018.1|  PREDICTED: putative receptor-like protein ki...    189   2e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010660576.1|  PREDICTED: receptor-like protein kinase FERONIA    189   3e-51   
emb|CDP20271.1|  unnamed protein product                                189   4e-51   Coffea canephora [robusta coffee]
gb|EPS73118.1|  hypothetical protein M569_01631                         187   7e-51   Genlisea aurea
ref|XP_010244547.1|  PREDICTED: receptor-like protein kinase FERONIA    188   7e-51   Nelumbo nucifera [Indian lotus]
ref|XP_008463270.1|  PREDICTED: receptor-like protein kinase FERONIA    188   7e-51   Cucumis melo [Oriental melon]
ref|XP_010693989.1|  PREDICTED: receptor-like protein kinase FERO...    188   8e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004142677.1|  PREDICTED: receptor-like protein kinase FERO...    187   9e-51   Cucumis sativus [cucumbers]
ref|XP_006373370.1|  hypothetical protein POPTR_0017s13150g             187   1e-50   
ref|XP_010034429.1|  PREDICTED: receptor-like protein kinase FERONIA    187   1e-50   Eucalyptus grandis [rose gum]
ref|XP_004306057.1|  PREDICTED: receptor-like protein kinase FERONIA    187   2e-50   Fragaria vesca subsp. vesca
ref|NP_001238686.1|  receptor-like kinase                               186   2e-50   Glycine max [soybeans]
ref|XP_011099029.1|  PREDICTED: receptor-like protein kinase FERONIA    186   3e-50   Sesamum indicum [beniseed]
gb|KHN40613.1|  Receptor-like protein kinase FERONIA                    186   3e-50   Glycine soja [wild soybean]
ref|XP_006373383.1|  hypothetical protein POPTR_0017s13270g             185   4e-50   
ref|XP_010034431.1|  PREDICTED: receptor-like protein kinase FERONIA    186   4e-50   
ref|XP_008368476.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    186   5e-50   
ref|XP_006419383.1|  hypothetical protein CICLE_v10004295mg             185   5e-50   Citrus clementina [clementine]
ref|XP_010694005.1|  PREDICTED: putative receptor-like protein ki...    186   6e-50   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO71938.1|  hypothetical protein CISIN_1g041565mg                   185   6e-50   Citrus sinensis [apfelsine]
ref|XP_006488842.1|  PREDICTED: receptor-like protein kinase ANXU...    185   6e-50   Citrus sinensis [apfelsine]
ref|XP_010694013.1|  PREDICTED: putative receptor-like protein ki...    185   6e-50   
ref|XP_010252026.1|  PREDICTED: receptor-like protein kinase FERONIA    185   6e-50   Nelumbo nucifera [Indian lotus]
ref|XP_002467915.1|  hypothetical protein SORBIDRAFT_01g036260          185   7e-50   Sorghum bicolor [broomcorn]
ref|XP_010485852.1|  PREDICTED: receptor-like protein kinase ANXUR1     185   7e-50   
ref|XP_010098025.1|  Receptor-like protein kinase FERONIA               185   8e-50   Morus notabilis
ref|XP_007033491.1|  Malectin/receptor-like protein kinase family...    185   8e-50   Theobroma cacao [chocolate]
gb|KHN29489.1|  Receptor-like protein kinase FERONIA                    185   9e-50   Glycine soja [wild soybean]
gb|KDO64141.1|  hypothetical protein CISIN_1g036624mg                   185   1e-49   Citrus sinensis [apfelsine]
ref|XP_006429617.1|  hypothetical protein CICLE_v10011034mg             185   1e-49   Citrus clementina [clementine]
ref|NP_001237656.1|  FERONIA receptor-like kinase precursor             184   1e-49   Glycine max [soybeans]
gb|KJB29840.1|  hypothetical protein B456_005G120700                    184   1e-49   Gossypium raimondii
ref|XP_006373375.1|  hypothetical protein POPTR_0017s13190g             184   1e-49   
tpg|DAA45217.1|  TPA: putative receptor-like protein kinase famil...    184   1e-49   
ref|XP_006408164.1|  hypothetical protein EUTSA_v10020050mg             184   2e-49   Eutrema salsugineum [saltwater cress]
ref|XP_010684237.1|  PREDICTED: receptor-like protein kinase ANXUR1     184   2e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009388382.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    178   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010417830.1|  PREDICTED: receptor-like protein kinase ANXUR1     184   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_009151260.1|  PREDICTED: receptor-like protein kinase ANXUR2     184   2e-49   Brassica rapa
emb|CDX86206.1|  BnaA06g29230D                                          184   2e-49   
ref|XP_009791682.1|  PREDICTED: receptor-like protein kinase FERONIA    184   2e-49   Nicotiana sylvestris
ref|XP_007208402.1|  hypothetical protein PRUPE_ppa001164mg             184   2e-49   Prunus persica
ref|XP_008244701.1|  PREDICTED: receptor-like protein kinase FERONIA    184   2e-49   Prunus mume [ume]
ref|XP_009617447.1|  PREDICTED: receptor-like protein kinase FERONIA    184   2e-49   Nicotiana tomentosiformis
ref|XP_010683454.1|  PREDICTED: receptor-like protein kinase FERONIA    184   2e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002884459.1|  kinase family protein                              183   2e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_002279218.3|  PREDICTED: receptor-like protein kinase FERONIA    184   2e-49   
ref|XP_008341797.1|  PREDICTED: receptor-like protein kinase FERONIA    184   3e-49   
ref|XP_009337788.1|  PREDICTED: receptor-like protein kinase FERONIA    184   3e-49   Pyrus x bretschneideri [bai li]
ref|XP_008341792.1|  PREDICTED: receptor-like protein kinase FERONIA    183   3e-49   
ref|XP_010043538.1|  PREDICTED: receptor-like protein kinase FERONIA    183   3e-49   Eucalyptus grandis [rose gum]
ref|XP_002528705.1|  kinase, putative                                   183   3e-49   
ref|XP_010921463.1|  PREDICTED: receptor-like protein kinase ANXUR2     183   3e-49   Elaeis guineensis
ref|XP_008660180.1|  PREDICTED: receptor-like protein kinase FERONIA    183   4e-49   Zea mays [maize]
ref|XP_006842554.1|  hypothetical protein AMTR_s00077p00138840          183   4e-49   
gb|KJB38065.1|  hypothetical protein B456_006G235700                    183   4e-49   Gossypium raimondii
ref|XP_004246282.1|  PREDICTED: receptor-like protein kinase FERONIA    183   4e-49   Solanum lycopersicum
gb|KDP21852.1|  hypothetical protein JCGZ_00639                         181   4e-49   Jatropha curcas
ref|XP_006341293.1|  PREDICTED: receptor-like protein kinase FERO...    183   4e-49   Solanum tuberosum [potatoes]
ref|XP_010553161.1|  PREDICTED: receptor-like protein kinase FERONIA    182   4e-49   Tarenaya hassleriana [spider flower]
ref|XP_010463957.1|  PREDICTED: receptor-like protein kinase ANXUR1     182   4e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010494105.1|  PREDICTED: receptor-like protein kinase ANXUR2     182   5e-49   Camelina sativa [gold-of-pleasure]
ref|XP_009365902.1|  PREDICTED: receptor-like protein kinase FERO...    182   6e-49   
gb|KCW52050.1|  hypothetical protein EUGRSUZ_J01490                     181   6e-49   Eucalyptus grandis [rose gum]
ref|XP_009365903.1|  PREDICTED: receptor-like protein kinase FERO...    182   6e-49   
ref|XP_009365907.1|  PREDICTED: receptor-like protein kinase FERONIA    182   6e-49   Pyrus x bretschneideri [bai li]
ref|XP_002271113.1|  PREDICTED: receptor-like protein kinase ANXUR1     182   6e-49   Vitis vinifera
ref|XP_009365906.1|  PREDICTED: receptor-like protein kinase FERO...    182   6e-49   
ref|XP_010455191.1|  PREDICTED: receptor-like protein kinase ANXUR2     182   6e-49   Camelina sativa [gold-of-pleasure]
ref|XP_011079535.1|  PREDICTED: receptor-like protein kinase ANXUR1     182   7e-49   Sesamum indicum [beniseed]
dbj|BAJ91215.1|  predicted protein                                      177   7e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010242732.1|  PREDICTED: receptor-like protein kinase ANXUR1     182   9e-49   Nelumbo nucifera [Indian lotus]
ref|XP_010252025.1|  PREDICTED: receptor-like protein kinase FERONIA    182   9e-49   Nelumbo nucifera [Indian lotus]
ref|XP_006646366.1|  PREDICTED: receptor-like protein kinase FERO...    181   9e-49   Oryza brachyantha
ref|XP_010529939.1|  PREDICTED: receptor-like protein kinase FERONIA    182   9e-49   Tarenaya hassleriana [spider flower]
ref|XP_003609098.1|  FERONIA receptor-like kinase                       182   9e-49   
ref|XP_008364006.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    181   9e-49   
ref|XP_004984479.1|  PREDICTED: receptor-like protein kinase FERO...    182   1e-48   Setaria italica
gb|KEH23293.1|  feronia receptor-like kinase                            182   1e-48   Medicago truncatula
gb|KJB42941.1|  hypothetical protein B456_007G175600                    181   1e-48   Gossypium raimondii
ref|XP_009397265.1|  PREDICTED: probable receptor-like protein ki...    182   1e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010099327.1|  Receptor-like protein kinase FERONIA               182   1e-48   
ref|XP_011095158.1|  PREDICTED: receptor-like protein kinase FERONIA    182   1e-48   Sesamum indicum [beniseed]
ref|XP_010678455.1|  PREDICTED: probable receptor-like protein ki...    182   1e-48   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB42940.1|  hypothetical protein B456_007G175600                    181   2e-48   Gossypium raimondii
ref|XP_011016728.1|  PREDICTED: receptor-like protein kinase FERONIA    181   2e-48   Populus euphratica
ref|XP_004302537.1|  PREDICTED: receptor-like protein kinase FERONIA    181   2e-48   Fragaria vesca subsp. vesca
ref|XP_008370279.1|  PREDICTED: receptor-like protein kinase FERONIA    181   2e-48   
ref|XP_007032831.1|  Malectin/receptor-like protein kinase family...    181   2e-48   
gb|KCW52041.1|  hypothetical protein EUGRSUZ_J01482                     181   2e-48   Eucalyptus grandis [rose gum]
ref|XP_006338349.1|  PREDICTED: receptor-like protein kinase FERO...    181   2e-48   
ref|XP_010034437.1|  PREDICTED: receptor-like protein kinase FERONIA    181   2e-48   Eucalyptus grandis [rose gum]
ref|XP_007140079.1|  hypothetical protein PHAVU_008G082400g             181   2e-48   Phaseolus vulgaris [French bean]
gb|EEC76216.1|  hypothetical protein OsI_13615                          181   2e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_009370899.1|  PREDICTED: receptor-like protein kinase FERONIA    181   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_010034435.1|  PREDICTED: receptor-like protein kinase FERONIA    181   2e-48   
ref|XP_002323088.2|  kinase family protein                              181   2e-48   Populus trichocarpa [western balsam poplar]
ref|XP_006395027.1|  hypothetical protein EUTSA_v10003639mg             181   2e-48   Eutrema salsugineum [saltwater cress]
gb|KJB71481.1|  hypothetical protein B456_011G124900                    180   2e-48   Gossypium raimondii
ref|XP_010938035.1|  PREDICTED: receptor-like protein kinase FERONIA    181   2e-48   Elaeis guineensis
ref|XP_008230912.1|  PREDICTED: receptor-like protein kinase FERONIA    181   2e-48   Prunus mume [ume]
gb|KHN07117.1|  Receptor-like protein kinase FERONIA                    181   2e-48   Glycine soja [wild soybean]
ref|NP_001050022.1|  Os03g0333200                                       181   3e-48   
ref|XP_002463853.1|  hypothetical protein SORBIDRAFT_01g007450          180   3e-48   
ref|XP_003633771.1|  PREDICTED: receptor-like protein kinase FERONIA    181   3e-48   
ref|NP_001159308.1|  uncharacterized protein LOC100304400               174   3e-48   
ref|NP_187120.1|  receptor-like protein kinase ANXUR1                   180   3e-48   Arabidopsis thaliana [mouse-ear cress]
emb|CDX78012.1|  BnaA09g32070D                                          180   3e-48   
ref|XP_009385224.1|  PREDICTED: receptor-like protein kinase ANXUR1     180   3e-48   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY05602.1|  BnaC02g39350D                                          180   3e-48   
ref|XP_010660596.1|  PREDICTED: receptor-like protein kinase FERONIA    181   3e-48   
emb|CDP06378.1|  unnamed protein product                                180   4e-48   Coffea canephora [robusta coffee]
gb|AAK63934.1|AC084282_15  putative protein kinase                      180   4e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009129817.1|  PREDICTED: receptor-like protein kinase ANXUR2     180   4e-48   Brassica rapa
gb|KHN07112.1|  Receptor-like protein kinase FERONIA                    179   4e-48   Glycine soja [wild soybean]
emb|CDY33885.1|  BnaA02g31020D                                          180   4e-48   Brassica napus [oilseed rape]
ref|XP_007140062.1|  hypothetical protein PHAVU_008G081000g             180   4e-48   Phaseolus vulgaris [French bean]
gb|ABF98993.1|  protein kinase family protein, putative, expressed      180   4e-48   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044372.1|  Os01g0769700                                       180   4e-48   
ref|XP_011001679.1|  PREDICTED: receptor-like protein kinase FERONIA    180   4e-48   Populus euphratica
ref|XP_010099328.1|  Receptor-like protein kinase FERONIA               180   5e-48   Morus notabilis
ref|XP_011021061.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    179   5e-48   Populus euphratica
ref|XP_010421701.1|  PREDICTED: receptor-like protein kinase ANXUR2     180   5e-48   Camelina sativa [gold-of-pleasure]
ref|XP_009416326.1|  PREDICTED: receptor-like protein kinase FERONIA    180   5e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009115840.1|  PREDICTED: receptor-like protein kinase FERONIA    180   5e-48   Brassica rapa
ref|XP_002308259.1|  kinase family protein                              180   5e-48   
ref|XP_007032827.1|  Malectin/receptor-like protein kinase family...    180   5e-48   
gb|ABT18100.1|  FERONIA receptor-like kinase                            180   5e-48   Arabidopsis thaliana [mouse-ear cress]
gb|KJB71482.1|  hypothetical protein B456_011G124900                    180   5e-48   Gossypium raimondii
ref|XP_009412649.1|  PREDICTED: receptor-like protein kinase FERONIA    180   5e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_190723.1|  receptor-like protein kinase FERONIA                  180   5e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010503851.1|  PREDICTED: receptor-like protein kinase FERONIA    180   6e-48   
gb|AAK59558.1|  putative receptor-protein kinase                        180   6e-48   Arabidopsis thaliana [mouse-ear cress]
emb|CDO98765.1|  unnamed protein product                                179   6e-48   Coffea canephora [robusta coffee]
ref|XP_010032549.1|  PREDICTED: receptor-like protein kinase FERONIA    180   6e-48   Eucalyptus grandis [rose gum]
gb|EAY97521.1|  hypothetical protein OsI_19449                          179   6e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_008810848.1|  PREDICTED: receptor-like protein kinase FERONIA    180   6e-48   Phoenix dactylifera
gb|EEE63237.1|  hypothetical protein OsJ_18047                          179   6e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010426729.1|  PREDICTED: receptor-like protein kinase FERONIA    180   6e-48   Camelina sativa [gold-of-pleasure]
ref|XP_009385155.1|  PREDICTED: receptor-like protein kinase ANXUR2     179   6e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU42039.1|  hypothetical protein MIMGU_mgv1a001343mg                179   7e-48   Erythranthe guttata [common monkey flower]
ref|XP_010515573.1|  PREDICTED: receptor-like protein kinase FERONIA    180   7e-48   Camelina sativa [gold-of-pleasure]
ref|XP_006403905.1|  hypothetical protein EUTSA_v10010114mg             179   7e-48   Eutrema salsugineum [saltwater cress]
ref|XP_002877809.1|  hypothetical protein ARALYDRAFT_485507             179   7e-48   Arabidopsis lyrata subsp. lyrata
gb|ABT18099.1|  FERONIA receptor-like kinase                            180   7e-48   Cardamine flexuosa
ref|XP_004981691.1|  PREDICTED: probable receptor-like protein ki...    179   7e-48   
emb|CBI21198.3|  unnamed protein product                                180   7e-48   Vitis vinifera
ref|XP_010229562.1|  PREDICTED: probable receptor-like protein ki...    179   7e-48   Brachypodium distachyon [annual false brome]
emb|CDY33271.1|  BnaA01g19380D                                          179   7e-48   Brassica napus [oilseed rape]
ref|XP_009383157.1|  PREDICTED: probable receptor-like protein ki...    179   8e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009136619.1|  PREDICTED: receptor-like protein kinase FERONIA    179   8e-48   Brassica rapa
ref|XP_010032628.1|  PREDICTED: receptor-like protein kinase FERONIA    179   8e-48   Eucalyptus grandis [rose gum]
ref|XP_007151348.1|  hypothetical protein PHAVU_004G038800g             179   9e-48   Phaseolus vulgaris [French bean]
emb|CDY16299.1|  BnaC01g23340D                                          179   9e-48   Brassica napus [oilseed rape]
gb|ABT18098.1|  FERONIA receptor-like kinase                            179   9e-48   Cardamine flexuosa
gb|ABT18094.1|  FERONIA receptor-like kinase                            179   1e-47   Brassica oleracea
ref|XP_010230703.1|  PREDICTED: receptor-like protein kinase ANXUR1     181   1e-47   Brachypodium distachyon [annual false brome]
gb|EEC75192.1|  hypothetical protein OsI_11431                          179   1e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_010519979.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    179   1e-47   
ref|XP_002272797.2|  PREDICTED: receptor-like protein kinase ANXUR1     179   1e-47   Vitis vinifera
ref|XP_011071382.1|  PREDICTED: receptor-like protein kinase ANXUR1     179   1e-47   Sesamum indicum [beniseed]
ref|XP_006290584.1|  hypothetical protein CARUB_v10016673mg             179   1e-47   Capsella rubella
emb|CDY29022.1|  BnaC07g32280D                                          178   1e-47   Brassica napus [oilseed rape]
ref|XP_002990231.1|  hypothetical protein SELMODRAFT_40963              178   1e-47   
ref|XP_002530995.1|  kinase, putative                                   179   1e-47   Ricinus communis
emb|CDP17056.1|  unnamed protein product                                179   1e-47   Coffea canephora [robusta coffee]
gb|KCW45810.1|  hypothetical protein EUGRSUZ_L00361                     170   1e-47   Eucalyptus grandis [rose gum]
emb|CDX90645.1|  BnaA03g41360D                                          178   1e-47   
ref|XP_008344811.1|  PREDICTED: receptor-like protein kinase FERONIA    172   1e-47   
gb|ABT18097.1|  FERONIA receptor-like kinase                            179   1e-47   Cardamine flexuosa
gb|ABT18095.1|  FERONIA receptor-like kinase                            179   1e-47   Cardamine flexuosa
emb|CDX73714.1|  BnaC08g22890D                                          180   1e-47   
ref|XP_006650625.1|  PREDICTED: probable receptor-like protein ki...    178   2e-47   Oryza brachyantha
ref|XP_010032550.1|  PREDICTED: receptor-like protein kinase FERONIA    179   2e-47   
ref|XP_010247768.1|  PREDICTED: receptor-like protein kinase FERONIA    178   2e-47   Nelumbo nucifera [Indian lotus]
ref|XP_006844774.1|  hypothetical protein AMTR_s00016p00259140          178   2e-47   
gb|AAL40864.1|  receptor protein kinase-like protein                    177   2e-47   Capsicum annuum
ref|XP_006289663.1|  hypothetical protein CARUB_v10003221mg             178   2e-47   Capsella rubella
ref|XP_004492579.1|  PREDICTED: receptor-like protein kinase FERO...    178   2e-47   Cicer arietinum [garbanzo]
ref|XP_006654257.1|  PREDICTED: receptor-like protein kinase FERO...    178   2e-47   Oryza brachyantha
ref|XP_010034433.1|  PREDICTED: receptor-like protein kinase FERONIA    178   2e-47   Eucalyptus grandis [rose gum]
gb|KEH25126.1|  feronia receptor-like kinase                            178   2e-47   Medicago truncatula
ref|XP_002992454.1|  hypothetical protein SELMODRAFT_135346             178   2e-47   
ref|XP_010039671.1|  PREDICTED: receptor-like protein kinase HERK 1     169   2e-47   
gb|EYU23499.1|  hypothetical protein MIMGU_mgv1a023218mg                178   2e-47   Erythranthe guttata [common monkey flower]
gb|EMT15162.1|  Putative receptor-like protein kinase                   177   3e-47   
gb|KCW87969.1|  hypothetical protein EUGRSUZ_A00377                     177   3e-47   Eucalyptus grandis [rose gum]
ref|XP_008379440.1|  PREDICTED: receptor-like protein kinase FERONIA    178   3e-47   
ref|XP_010318820.1|  PREDICTED: probable receptor-like protein ki...    177   3e-47   
ref|XP_004304217.1|  PREDICTED: receptor-like protein kinase FERONIA    177   4e-47   Fragaria vesca subsp. vesca
ref|XP_010034426.1|  PREDICTED: receptor-like protein kinase FERONIA    177   4e-47   Eucalyptus grandis [rose gum]
ref|XP_004137258.1|  PREDICTED: receptor-like protein kinase FERO...    177   4e-47   Cucumis sativus [cucumbers]
ref|XP_010065050.1|  PREDICTED: receptor-like protein kinase ANXUR2     177   4e-47   Eucalyptus grandis [rose gum]
ref|XP_002447169.1|  hypothetical protein SORBIDRAFT_06g029710          177   4e-47   Sorghum bicolor [broomcorn]
ref|XP_006593700.1|  PREDICTED: receptor-like protein kinase FERO...    177   4e-47   
gb|KCW52051.1|  hypothetical protein EUGRSUZ_J01491                     177   5e-47   Eucalyptus grandis [rose gum]
ref|XP_010921184.1|  PREDICTED: receptor-like protein kinase FERONIA    177   6e-47   Elaeis guineensis
ref|XP_008813242.1|  PREDICTED: receptor-like protein kinase FERONIA    177   6e-47   Phoenix dactylifera
ref|XP_002874434.1|  kinase family protein                              177   6e-47   Arabidopsis lyrata subsp. lyrata
ref|XP_010914574.1|  PREDICTED: receptor-like protein kinase ANXUR2     177   6e-47   Elaeis guineensis
ref|XP_007217052.1|  hypothetical protein PRUPE_ppa001190mg             177   6e-47   
ref|XP_004962463.1|  PREDICTED: receptor-like protein kinase FERO...    177   6e-47   Setaria italica
gb|EMS48200.1|  Receptor-like protein kinase HERK 1                     176   7e-47   Triticum urartu
gb|KJB80895.1|  hypothetical protein B456_013G120400                    176   7e-47   Gossypium raimondii
ref|XP_004962493.1|  PREDICTED: receptor-like protein kinase ANXU...    176   8e-47   Setaria italica
ref|XP_009414253.1|  PREDICTED: receptor-like protein kinase FERONIA    177   8e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008344357.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    173   9e-47   
ref|XP_009391670.1|  PREDICTED: receptor-like protein kinase FERONIA    176   9e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_198220.1|  receptor-like protein kinase ANXUR2                   176   1e-46   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK06468.1|  predicted protein                                      176   1e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008464585.1|  PREDICTED: receptor-like protein kinase FERONIA    176   1e-46   Cucumis melo [Oriental melon]
ref|XP_011009253.1|  PREDICTED: receptor-like protein kinase FERONIA    176   1e-46   Populus euphratica
ref|NP_001237588.1|  FERONIA receptor-like kinase                       175   1e-46   Glycine max [soybeans]
tpg|DAA51500.1|  TPA: putative receptor-like protein kinase famil...    176   1e-46   
ref|XP_008665441.1|  PREDICTED: probable receptor-like protein ki...    176   1e-46   
ref|XP_008464586.1|  PREDICTED: receptor-like protein kinase FERONIA    176   1e-46   Cucumis melo [Oriental melon]
ref|XP_007030540.1|  Malectin/receptor-like protein kinase family...    176   1e-46   
ref|XP_004154760.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    176   1e-46   
ref|XP_008355123.1|  PREDICTED: receptor-like protein kinase FERONIA    171   2e-46   
ref|XP_010258502.1|  PREDICTED: receptor-like protein kinase ANXUR1     176   2e-46   Nelumbo nucifera [Indian lotus]
gb|EMS63765.1|  Receptor-like protein kinase FERONIA                    175   2e-46   Triticum urartu
ref|XP_006840306.1|  hypothetical protein AMTR_s00045p00071050          176   2e-46   
dbj|BAJ93584.1|  predicted protein                                      176   2e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006493304.1|  PREDICTED: receptor-like protein kinase FERO...    176   2e-46   Citrus sinensis [apfelsine]
gb|KEH24563.1|  malectin/receptor-like kinase family protein            176   2e-46   Medicago truncatula
ref|XP_002439522.1|  hypothetical protein SORBIDRAFT_09g009320          175   2e-46   Sorghum bicolor [broomcorn]
gb|KJB08837.1|  hypothetical protein B456_001G107000                    174   2e-46   Gossypium raimondii
gb|EMT27556.1|  Receptor-like protein kinase ANXUR1                     177   2e-46   
gb|EMT16871.1|  Receptor-like protein kinase FERONIA                    176   2e-46   
gb|EYU46822.1|  hypothetical protein MIMGU_mgv1a022107mg                175   2e-46   Erythranthe guttata [common monkey flower]
gb|EMS54122.1|  Receptor-like protein kinase FERONIA                    175   3e-46   Triticum urartu
ref|XP_009148931.1|  PREDICTED: receptor-like protein kinase FERONIA    175   3e-46   Brassica rapa
gb|EMT27425.1|  Receptor-like protein kinase FERONIA                    175   3e-46   
ref|XP_009781981.1|  PREDICTED: receptor-like protein kinase HERK 1     174   3e-46   Nicotiana sylvestris
ref|XP_009586639.1|  PREDICTED: receptor-like protein kinase HERK 1     174   3e-46   Nicotiana tomentosiformis
ref|XP_002530992.1|  kinase, putative                                   175   3e-46   
ref|XP_008464587.1|  PREDICTED: receptor-like protein kinase FERONIA    175   3e-46   Cucumis melo [Oriental melon]
ref|XP_008668826.1|  PREDICTED: receptor-like protein kinase FERONIA    175   3e-46   
ref|XP_009759079.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    176   3e-46   Nicotiana sylvestris
ref|XP_003557976.1|  PREDICTED: receptor-like protein kinase FERONIA    175   3e-46   Brachypodium distachyon [annual false brome]
gb|EMT17007.1|  Receptor-like protein kinase FERONIA                    175   4e-46   
ref|XP_004495609.1|  PREDICTED: receptor-like protein kinase ANXU...    174   4e-46   Cicer arietinum [garbanzo]
ref|XP_003543886.1|  PREDICTED: receptor-like protein kinase FERO...    175   4e-46   
gb|KHN07118.1|  Receptor-like protein kinase FERONIA                    175   4e-46   Glycine soja [wild soybean]
ref|XP_008809255.1|  PREDICTED: receptor-like protein kinase ANXUR1     174   4e-46   Phoenix dactylifera
gb|KJB21613.1|  hypothetical protein B456_004G003200                    174   4e-46   Gossypium raimondii
gb|AFW77551.1|  putative receptor-like protein kinase family protein    174   5e-46   
ref|XP_006441077.1|  hypothetical protein CICLE_v10024057mg             174   5e-46   
gb|EYU38427.1|  hypothetical protein MIMGU_mgv1a001092mg                174   5e-46   Erythranthe guttata [common monkey flower]
ref|XP_008379872.1|  PREDICTED: receptor-like protein kinase FERONIA    170   5e-46   
ref|XP_006355833.1|  PREDICTED: receptor-like protein kinase ANXU...    174   6e-46   Solanum tuberosum [potatoes]
ref|XP_010260899.1|  PREDICTED: probable receptor-like protein ki...    174   6e-46   Nelumbo nucifera [Indian lotus]
ref|XP_004240568.1|  PREDICTED: receptor-like protein kinase ANXUR1     174   6e-46   Solanum lycopersicum
ref|XP_004507304.1|  PREDICTED: receptor-like protein kinase FERO...    174   6e-46   
ref|XP_011089398.1|  PREDICTED: receptor-like protein kinase HERK 1     174   6e-46   
emb|CDP18314.1|  unnamed protein product                                172   7e-46   
ref|XP_009617176.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    176   8e-46   
ref|XP_003568703.1|  PREDICTED: receptor-like protein kinase ANXUR1     174   8e-46   
ref|XP_009354064.1|  PREDICTED: receptor-like protein kinase FERONIA    171   9e-46   
gb|AAQ82660.1|  Pto-like serine/threonine kinase                        167   9e-46   
ref|XP_009354054.1|  PREDICTED: receptor-like protein kinase FERONIA    171   1e-45   
ref|XP_010550913.1|  PREDICTED: receptor-like protein kinase ANXUR2     173   1e-45   
ref|XP_002519226.1|  ATP binding protein, putative                      173   1e-45   
ref|XP_009799586.1|  PREDICTED: receptor-like protein kinase ANXUR1     173   1e-45   
ref|XP_007037435.1|  Kinase superfamily protein                         173   1e-45   
ref|XP_008456162.1|  PREDICTED: receptor-like protein kinase ANXU...    172   1e-45   
ref|XP_007032823.1|  Malectin/receptor-like protein kinase family...    173   1e-45   
gb|KJB50961.1|  hypothetical protein B456_008G195200                    173   1e-45   
ref|XP_006366328.1|  PREDICTED: receptor-like protein kinase HERK...    172   2e-45   
ref|XP_004240344.1|  PREDICTED: receptor-like protein kinase HERK 1     172   2e-45   
ref|XP_008341790.1|  PREDICTED: receptor-like protein kinase FERONIA    172   2e-45   
gb|KEH30081.1|  receptor-like kinase theseus protein                    171   2e-45   
ref|XP_003568697.1|  PREDICTED: receptor-like protein kinase FERONIA    173   2e-45   
ref|XP_006441078.1|  hypothetical protein CICLE_v10018785mg             173   2e-45   
ref|XP_008356283.1|  PREDICTED: receptor-like protein kinase FERONIA    170   2e-45   
ref|XP_004137257.1|  PREDICTED: receptor-like protein kinase FERO...    173   2e-45   
gb|KDP35955.1|  hypothetical protein JCGZ_09927                         162   2e-45   
ref|XP_008456155.1|  PREDICTED: receptor-like protein kinase ANXU...    172   2e-45   
emb|CDY49572.1|  BnaA10g12680D                                          165   2e-45   
ref|XP_009785956.1|  PREDICTED: receptor-like protein kinase ANXUR1     172   2e-45   
ref|XP_009602553.1|  PREDICTED: receptor-like protein kinase ANXUR1     172   2e-45   
ref|XP_003535601.1|  PREDICTED: probable receptor-like protein ki...    172   2e-45   
gb|KHN21779.1|  Putative receptor-like protein kinase                   172   2e-45   
ref|XP_004154759.1|  PREDICTED: receptor-like protein kinase FERO...    173   2e-45   
emb|CBI16212.3|  unnamed protein product                                172   2e-45   
gb|EYU36239.1|  hypothetical protein MIMGU_mgv1a001323mg                172   2e-45   
emb|CAN77769.1|  hypothetical protein VITISV_009237                     172   2e-45   
ref|XP_002446044.1|  hypothetical protein SORBIDRAFT_06g000910          165   2e-45   
ref|NP_001055089.1|  Os05g0280700                                       172   3e-45   
ref|XP_006654205.1|  PREDICTED: receptor-like protein kinase FERO...    172   3e-45   
ref|XP_010102280.1|  Receptor-like protein kinase                       172   3e-45   
ref|XP_002972798.1|  hypothetical protein SELMODRAFT_15419              164   3e-45   
gb|EPS72234.1|  hypothetical protein M569_02521                         172   3e-45   
gb|EMT04378.1|  Receptor-like protein kinase FERONIA                    172   3e-45   
ref|XP_010535512.1|  PREDICTED: receptor-like protein kinase HERK 1     172   3e-45   
ref|XP_004294627.1|  PREDICTED: receptor-like protein kinase HERK 1     172   3e-45   
ref|XP_010660577.1|  PREDICTED: receptor-like protein kinase FERONIA    172   3e-45   
ref|XP_008353542.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    171   3e-45   
gb|KCW61585.1|  hypothetical protein EUGRSUZ_H04319                     171   4e-45   
ref|XP_007035799.1|  Malectin/receptor-like protein kinase family...    172   4e-45   
gb|KJB20195.1|  hypothetical protein B456_003G137700                    171   4e-45   
ref|XP_006363345.1|  PREDICTED: receptor-like protein kinase HERK...    171   4e-45   
ref|XP_010034409.1|  PREDICTED: receptor-like protein kinase FERONIA    172   4e-45   
ref|XP_007208221.1|  hypothetical protein PRUPE_ppa018611mg             172   4e-45   
ref|XP_010651080.1|  PREDICTED: receptor-like protein kinase HERK 1     171   4e-45   
ref|XP_003606567.1|  Kinase-like protein                                171   5e-45   
ref|XP_006487358.1|  PREDICTED: probable receptor-like protein ki...    171   5e-45   
gb|KDP27273.1|  hypothetical protein JCGZ_19972                         172   5e-45   
ref|XP_006374449.1|  hypothetical protein POPTR_0015s07280g             170   5e-45   
ref|XP_008364675.1|  PREDICTED: receptor-like protein kinase FERONIA    171   5e-45   
ref|XP_007016572.1|  Kinase                                             171   6e-45   
gb|KDO67824.1|  hypothetical protein CISIN_1g003436mg                   171   6e-45   
ref|XP_010025009.1|  PREDICTED: receptor-like protein kinase ANXUR1     171   6e-45   
ref|XP_010932179.1|  PREDICTED: probable receptor-like protein ki...    171   6e-45   
ref|XP_010663864.1|  PREDICTED: probable receptor-like protein ki...    173   6e-45   
ref|XP_007216888.1|  hypothetical protein PRUPE_ppa020589mg             171   6e-45   
ref|XP_006436142.1|  hypothetical protein CICLE_v10030714mg             171   6e-45   
gb|AFK35668.1|  unknown                                                 164   7e-45   
ref|XP_010093014.1|  Receptor-like protein kinase HERK 1                171   8e-45   
ref|XP_009793250.1|  PREDICTED: receptor-like protein kinase THES...    171   8e-45   
ref|XP_010259987.1|  PREDICTED: receptor-like protein kinase HERK 1     171   8e-45   
emb|CDP08976.1|  unnamed protein product                                171   8e-45   
ref|XP_004154761.1|  PREDICTED: receptor-like protein kinase FERO...    171   8e-45   
ref|XP_002534744.1|  kinase, putative                                   167   9e-45   
ref|XP_008341791.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    171   9e-45   
gb|KDO49453.1|  hypothetical protein CISIN_1g047569mg                   171   9e-45   
ref|XP_004304753.1|  PREDICTED: receptor-like protein kinase ANXUR1     171   9e-45   
ref|XP_010089888.1|  putative receptor-like protein kinase              171   9e-45   
ref|XP_004156494.1|  PREDICTED: receptor-like protein kinase ANXU...    171   1e-44   
gb|KDP27915.1|  hypothetical protein JCGZ_18995                         171   1e-44   
ref|XP_006493305.1|  PREDICTED: receptor-like protein kinase FERO...    171   1e-44   
ref|XP_004139382.1|  PREDICTED: receptor-like protein kinase ANXU...    171   1e-44   
ref|XP_002514719.1|  kinase, putative                                   172   1e-44   
ref|XP_009601576.1|  PREDICTED: receptor-like protein kinase ANXUR1     171   1e-44   
ref|XP_009613068.1|  PREDICTED: receptor-like protein kinase THES...    170   1e-44   
ref|XP_009596877.1|  PREDICTED: receptor-like protein kinase HERK 1     170   1e-44   
ref|XP_008453681.1|  PREDICTED: probable receptor-like protein ki...    172   1e-44   
ref|XP_008796451.1|  PREDICTED: probable receptor-like protein ki...    170   1e-44   
ref|XP_006482015.1|  PREDICTED: receptor-like protein kinase FERO...    170   1e-44   
ref|XP_003597308.1|  Kinase-like protein                                170   1e-44   
gb|KEH43006.1|  malectin/receptor-like kinase family protein            170   1e-44   
gb|KDO73009.1|  hypothetical protein CISIN_1g003341mg                   169   1e-44   
ref|XP_007147183.1|  hypothetical protein PHAVU_006G102700g             170   2e-44   
ref|XP_004251295.1|  PREDICTED: receptor-like protein kinase HERK 1     170   2e-44   
gb|EPS64671.1|  hypothetical protein M569_10103                         170   2e-44   
ref|XP_002313457.1|  kinase family protein                              169   2e-44   
ref|XP_004138305.1|  PREDICTED: probable receptor-like protein ki...    170   2e-44   
ref|XP_004240569.1|  PREDICTED: receptor-like protein kinase ANXUR1     170   2e-44   
ref|XP_007032808.1|  Malectin/receptor-like protein kinase family...    170   2e-44   
ref|XP_006592253.1|  PREDICTED: receptor-like protein kinase HERK...    169   2e-44   
ref|XP_010426068.1|  PREDICTED: receptor-like protein kinase HERK 1     168   2e-44   
ref|XP_008230910.1|  PREDICTED: receptor-like protein kinase FERONIA    170   2e-44   
ref|XP_006843268.1|  hypothetical protein AMTR_s00080p00131040          169   2e-44   
emb|CAB62020.1|  receptor-like protein kinase homolog                   167   2e-44   
ref|XP_008796520.1|  PREDICTED: probable receptor-like protein ki...    169   2e-44   
ref|XP_009339695.1|  PREDICTED: probable receptor-like protein ki...    169   2e-44   
ref|XP_007132136.1|  hypothetical protein PHAVU_011G069600g             169   2e-44   
ref|XP_010327142.1|  PREDICTED: receptor-like protein kinase THES...    169   2e-44   
gb|KJB42937.1|  hypothetical protein B456_007G175500                    170   2e-44   
ref|XP_010520290.1|  PREDICTED: receptor-like protein kinase HERK...    169   2e-44   
ref|XP_008218280.1|  PREDICTED: receptor-like protein kinase ANXUR1     170   2e-44   
ref|XP_010520289.1|  PREDICTED: receptor-like protein kinase HERK...    169   2e-44   
ref|NP_001132279.1|  uncharacterized protein LOC100193715               163   2e-44   
ref|NP_001241448.1|  receptor-like protein kinase FERONIA-like pr...    171   2e-44   
gb|KJB11637.1|  hypothetical protein B456_001G269100                    170   3e-44   
dbj|BAF79940.1|  receptor-like kinase                                   170   3e-44   
ref|XP_010270692.1|  PREDICTED: probable receptor-like protein ki...    169   3e-44   
ref|XP_008348094.1|  PREDICTED: receptor-like protein kinase FERONIA    169   3e-44   
ref|XP_001760779.1|  predicted protein                                  163   3e-44   
ref|XP_006424719.1|  hypothetical protein CICLE_v10027823mg             169   3e-44   
gb|KDO73010.1|  hypothetical protein CISIN_1g003341mg                   169   3e-44   
ref|XP_002311383.2|  hypothetical protein POPTR_0008s10500g             169   3e-44   
ref|XP_011041960.1|  PREDICTED: receptor-like protein kinase HERK 1     169   3e-44   
ref|XP_011019995.1|  PREDICTED: receptor-like protein kinase ANXUR1     169   3e-44   
ref|XP_009150283.1|  PREDICTED: receptor-like protein kinase HERK 1     169   3e-44   
ref|XP_011047185.1|  PREDICTED: probable receptor-like protein ki...    169   4e-44   
gb|KJB10590.1|  hypothetical protein B456_001G209200                    169   4e-44   
ref|XP_009354540.1|  PREDICTED: receptor-like protein kinase HERK 1     169   4e-44   
emb|CAB38831.1|  putative receptor-like protein kinase (fragment)       167   4e-44   
ref|XP_004137259.1|  PREDICTED: probable receptor-like protein ki...    171   4e-44   
ref|XP_006382811.1|  serine-threonine kinase family protein             169   4e-44   
ref|XP_010672753.1|  PREDICTED: receptor-like protein kinase HERK 1     169   4e-44   
ref|XP_006427852.1|  hypothetical protein CICLE_v10024830mg             169   4e-44   
gb|KDP31288.1|  hypothetical protein JCGZ_11664                         169   4e-44   
ref|XP_009766353.1|  PREDICTED: receptor-like protein kinase HERK 1     169   4e-44   
ref|XP_009350739.1|  PREDICTED: receptor-like protein kinase HERK 1     168   5e-44   
gb|EEE63235.1|  hypothetical protein OsJ_18045                          158   5e-44   
ref|XP_010045589.1|  PREDICTED: probable receptor-like protein ki...    170   5e-44   
ref|XP_011006280.1|  PREDICTED: probable receptor-like protein ki...    169   5e-44   
gb|KDP44164.1|  hypothetical protein JCGZ_05631                         168   5e-44   
ref|XP_007143463.1|  hypothetical protein PHAVU_007G074000g             168   5e-44   
ref|XP_004977713.1|  PREDICTED: probable receptor-like protein ki...    167   5e-44   
gb|KDP27679.1|  hypothetical protein JCGZ_20099                         161   6e-44   
gb|KJB28740.1|  hypothetical protein B456_005G067100                    168   6e-44   
ref|XP_009360627.1|  PREDICTED: receptor-like protein kinase FERONIA    168   6e-44   
gb|KDP46096.1|  hypothetical protein JCGZ_06607                         168   6e-44   
ref|XP_009615839.1|  PREDICTED: probable receptor-like protein ki...    168   6e-44   
ref|NP_001238536.1|  receptor-like kinase                               169   6e-44   
ref|XP_010514958.1|  PREDICTED: receptor-like protein kinase HERK...    168   7e-44   
ref|XP_010503244.1|  PREDICTED: receptor-like protein kinase HERK 1     168   7e-44   
ref|XP_004244196.1|  PREDICTED: receptor-like protein kinase THES...    168   7e-44   
ref|XP_010685859.1|  PREDICTED: receptor-like protein kinase HERK 1     168   7e-44   
ref|XP_004148239.1|  PREDICTED: receptor-like protein kinase HERK...    168   7e-44   
emb|CDX99115.1|  BnaA06g18060D                                          168   7e-44   
emb|CDX86076.1|  BnaC03g55910D                                          168   8e-44   
emb|CDX82981.1|  BnaA01g19810D                                          168   8e-44   
ref|XP_004301135.1|  PREDICTED: probable receptor-like protein ki...    170   8e-44   
ref|XP_006418923.1|  hypothetical protein EUTSA_v10002401mg             168   8e-44   
gb|KHN43182.1|  Receptor-like protein kinase ANXUR2                     167   8e-44   
ref|XP_009149977.1|  PREDICTED: receptor-like protein kinase HERK 1     168   8e-44   
ref|XP_009365901.1|  PREDICTED: receptor-like protein kinase FERONIA    166   8e-44   
gb|KDP41754.1|  hypothetical protein JCGZ_26772                         168   9e-44   
ref|XP_010431866.1|  PREDICTED: probable receptor-like protein ki...    168   9e-44   
ref|XP_002319081.1|  kinase family protein                              168   9e-44   
ref|XP_009766613.1|  PREDICTED: probable receptor-like protein ki...    167   9e-44   
ref|XP_011032387.1|  PREDICTED: receptor-like protein kinase ANXUR1     168   9e-44   
ref|XP_004494710.1|  PREDICTED: receptor-like protein kinase ANXU...    168   1e-43   
ref|XP_010243447.1|  PREDICTED: receptor-like protein kinase FERONIA    167   1e-43   
ref|XP_008385197.1|  PREDICTED: receptor-like protein kinase HERK 1     167   1e-43   
ref|XP_007227151.1|  hypothetical protein PRUPE_ppa026453mg             168   1e-43   
ref|XP_010455405.1|  PREDICTED: probable receptor-like protein ki...    167   1e-43   
emb|CDX78036.1|  BnaA09g32310D                                          168   1e-43   
ref|XP_010437013.1|  PREDICTED: probable receptor-like protein ki...    168   1e-43   
gb|KHN22011.1|  Receptor-like protein kinase HERK 1                     167   1e-43   
ref|XP_009593506.1|  PREDICTED: receptor-like protein kinase THES...    167   1e-43   
ref|XP_010416895.1|  PREDICTED: probable receptor-like protein ki...    166   1e-43   
ref|NP_001235040.1|  protein kinase precursor                           167   1e-43   
gb|KDP27274.1|  hypothetical protein JCGZ_19973                         166   1e-43   
gb|KCW54833.1|  hypothetical protein EUGRSUZ_I007772                    161   1e-43   
ref|XP_007009484.1|  Receptor-like protein kinase THESEUS 1             168   1e-43   
ref|XP_006342301.1|  PREDICTED: probable receptor-like protein ki...    167   1e-43   
ref|XP_009115877.1|  PREDICTED: putative receptor-like protein ki...    168   1e-43   
emb|CDY41962.1|  BnaA01g05340D                                          167   1e-43   
ref|XP_004234787.1|  PREDICTED: probable receptor-like protein ki...    167   1e-43   
gb|KHN04378.1|  Receptor-like protein kinase FERONIA                    167   1e-43   
ref|XP_002313029.1|  Pto-like kinase OGw family protein                 167   1e-43   
ref|XP_009358295.1|  PREDICTED: receptor-like protein kinase HERK 1     167   1e-43   
ref|XP_009139817.1|  PREDICTED: putative receptor-like protein ki...    167   1e-43   
ref|XP_007208086.1|  hypothetical protein PRUPE_ppa001409mg             167   1e-43   
ref|XP_009150927.1|  PREDICTED: probable receptor-like protein ki...    167   1e-43   
ref|XP_008222676.1|  PREDICTED: receptor-like protein kinase HERK 1     167   1e-43   
ref|XP_011096691.1|  PREDICTED: probable receptor-like protein ki...    167   1e-43   
ref|XP_010526599.1|  PREDICTED: probable receptor-like protein ki...    167   1e-43   
gb|KHN37919.1|  Receptor-like protein kinase FERONIA                    158   1e-43   
gb|KDO54400.1|  hypothetical protein CISIN_1g039107mg                   167   1e-43   
ref|XP_006360136.1|  PREDICTED: receptor-like protein kinase THES...    167   1e-43   
ref|XP_008379865.1|  PREDICTED: receptor-like protein kinase FERONIA    167   1e-43   
ref|XP_007150266.1|  hypothetical protein PHAVU_005G139800g             167   1e-43   
ref|XP_010253388.1|  PREDICTED: receptor-like protein kinase HERK 1     167   2e-43   
ref|XP_011087289.1|  PREDICTED: probable receptor-like protein ki...    167   2e-43   
ref|XP_009410356.1|  PREDICTED: probable receptor-like protein ki...    167   2e-43   
gb|KCW54816.1|  hypothetical protein EUGRSUZ_I00757                     166   2e-43   
gb|KCW51315.1|  hypothetical protein EUGRSUZ_J00871                     166   2e-43   
ref|XP_008342048.1|  PREDICTED: receptor-like protein kinase FERONIA    165   2e-43   
emb|CDX72717.1|  BnaC07g47390D                                          167   2e-43   
emb|CDY12121.1|  BnaC03g60370D                                          167   2e-43   
gb|KDO55483.1|  hypothetical protein CISIN_1g037607mg                   167   2e-43   
ref|XP_002868886.1|  kinase family protein                              167   2e-43   
ref|XP_009139815.1|  PREDICTED: putative receptor-like protein ki...    167   2e-43   
gb|KHN12941.1|  Putative receptor-like protein kinase                   166   2e-43   
ref|NP_195622.1|  putative receptor-like protein kinase                 167   2e-43   
ref|XP_010096654.1|  Receptor-like protein kinase THESEUS 1             167   2e-43   
emb|CDX90312.1|  BnaA08g16720D                                          167   2e-43   
ref|XP_009139816.1|  PREDICTED: putative receptor-like protein ki...    167   2e-43   
tpg|DAA53962.1|  TPA: putative receptor-like protein kinase famil...    167   2e-43   
gb|KFK32894.1|  hypothetical protein AALP_AA6G301900                    167   2e-43   
ref|XP_006285865.1|  hypothetical protein CARUB_v10007359mg             167   2e-43   
emb|CDY56768.1|  BnaA06g40790D                                          167   2e-43   
ref|XP_006604845.1|  PREDICTED: receptor-like protein kinase ANXU...    167   2e-43   
emb|CDX74492.1|  BnaA04g08970D                                          167   2e-43   
gb|KDP27267.1|  hypothetical protein JCGZ_19966                         167   2e-43   
ref|XP_008223394.1|  PREDICTED: receptor-like protein kinase ANXUR1     167   2e-43   
ref|XP_006487877.1|  PREDICTED: receptor-like protein kinase ANXU...    167   2e-43   
ref|XP_006290599.1|  hypothetical protein CARUB_v10016688mg             167   2e-43   



>ref|XP_006338348.1| PREDICTED: receptor-like protein kinase FERONIA-like [Solanum 
tuberosum]
Length=873

 Score =   221 bits (563),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 151/210 (72%), Gaps = 6/210 (3%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEYY+R+Q+TEKSDVYSFGVVLFEVLCAR A+IPN+P+ +V+LA+
Sbjct  669  THVSTVVKGSFGYLDPEYYKRQQLTEKSDVYSFGVVLFEVLCARPALIPNMPKGQVNLAD  728

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W  RS + G++ +I+DPNL+GQIA ECL ++ E A NCLKDQG+ RP+MNDVVW LEF L
Sbjct  729  WACRSCKKGNLQQIIDPNLEGQIAPECLNKFAEAAYNCLKDQGVQRPSMNDVVWNLEFIL  788

Query  380  QLQDAADKRGG-LSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRTK  204
            +LQDAAD RG  +     P  P FPL+   G G     +DE +  AF+ S      + + 
Sbjct  789  KLQDAADNRGHKMELNSYPTSPSFPLIMN-GHGHTNISTDEGF-EAFSGSHEVGGKYTSS  846

Query  203  ssatatstsddSLRGQSHTIFSELSNQLGR  114
            +++  +++ D   + +S TIFSE+ N  GR
Sbjct  847  ATSMTSNSDD---KLKSDTIFSEILNPSGR  873



>emb|CDP05402.1| unnamed protein product [Coffea canephora]
Length=892

 Score =   218 bits (555),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 144/210 (69%), Gaps = 9/210 (4%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            SHVST VKGSFGYVDPEYY+R+Q+TEKSDVYSFGVVL EVLC R A+IPNLP+ +V+LAE
Sbjct  691  SHVSTQVKGSFGYVDPEYYKRQQLTEKSDVYSFGVVLLEVLCGRGAIIPNLPKEQVNLAE  750

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            WG+R Y  G + + VDP++KG+IA ECL  + E A NCLKDQGI+RP MNDVVW LEFAL
Sbjct  751  WGKRYYAKGIIHQTVDPHMKGEIAPECLRSFAETAINCLKDQGIERPGMNDVVWSLEFAL  810

Query  380  QLQDAADKRGGLSPPRTPERP-GFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRTK  204
            QLQ+AA+   G        RP  F +   G D +A  + DED        +++  L +++
Sbjct  811  QLQEAAENESG-------RRPFAFRMHGLGRDEQATTEDDEDVFSDSGVEKDSAALMKSR  863

Query  203  ssatatstsddSLRGQSHTIFSELSNQLGR  114
            S  T T T+   +  +S  +FSE+ N  GR
Sbjct  864  SITTGTFTASSDML-KSDNVFSEIMNPTGR  892



>ref|XP_004232151.1| PREDICTED: receptor-like protein kinase FERONIA [Solanum lycopersicum]
Length=869

 Score =   218 bits (554),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 150/210 (71%), Gaps = 8/210 (4%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEYY+R+Q+TEKSDVYSFGVVLFEVLCAR A+IPN+P+ +V+LA+
Sbjct  667  THVSTVVKGSFGYLDPEYYKRQQLTEKSDVYSFGVVLFEVLCARPALIPNMPKGQVNLAD  726

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W  RS + G++ +I+DPNL+GQIA ECL ++ E A NCLKDQG+ RP+MNDVVW LEF L
Sbjct  727  WACRSCKKGNLQQIIDPNLEGQIAPECLNKFAEAAYNCLKDQGVQRPSMNDVVWNLEFIL  786

Query  380  QLQDAADKRGG-LSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRTK  204
            +LQ+AAD RG  +     P  P FPL+       + ++  E++ G+   +E  EK   + 
Sbjct  787  KLQEAADNRGHKMELNSYPTSPSFPLIMNDHTNISTDEGFEEFSGS---NEVGEKYTSSA  843

Query  203  ssatatstsddSLRGQSHTIFSELSNQLGR  114
            SS T TS      + +S TIFSE+ N  GR
Sbjct  844  SSMTTTSDD----KLKSETIFSEILNPSGR  869



>emb|CDP05401.1| unnamed protein product [Coffea canephora]
Length=888

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 144/210 (69%), Gaps = 9/210 (4%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            SHVST VKGSFGYVDPEYY+R+Q+T+KSDVYSFGVVL EVLC R A+IPNLP+ +V+LAE
Sbjct  687  SHVSTQVKGSFGYVDPEYYKRQQLTDKSDVYSFGVVLLEVLCGRGAIIPNLPKEQVNLAE  746

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            WG+R Y  G + + VDP++KG+IA ECL  + E A NCLKDQGI+RP MNDVVW LEFAL
Sbjct  747  WGKRYYAKGIIHQTVDPHMKGEIAPECLRNFAETAINCLKDQGIERPGMNDVVWSLEFAL  806

Query  380  QLQDAADKRGGLSPPRTPERP-GFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRTK  204
            QLQ+AA+   G        RP  F +   G D +A  + DED        +++  + +++
Sbjct  807  QLQEAAENESG-------RRPFAFRMHGLGRDEQATTEDDEDVFSDSGIEKDSAAMMKSR  859

Query  203  ssatatstsddSLRGQSHTIFSELSNQLGR  114
            S  T T T+   +  +S  +FSE+ N  GR
Sbjct  860  SITTGTFTASSDML-KSDNVFSEIMNPTGR  888



>emb|CDP19885.1| unnamed protein product [Coffea canephora]
Length=895

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 143/210 (68%), Gaps = 9/210 (4%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            SHVST VKGSFGYVDPEYY+R+Q+TEKSDVYSFGVVL EVLC R A+IPNLP+ +V+LAE
Sbjct  694  SHVSTQVKGSFGYVDPEYYKRQQLTEKSDVYSFGVVLLEVLCGRGAIIPNLPKEQVNLAE  753

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            WG+R Y  G + + VDP++KG+IA ECL  + E A NCLKDQGI+RP MNDVVW LEFAL
Sbjct  754  WGKRYYAKGIIHQTVDPHMKGEIAPECLRSFAETAINCLKDQGIERPGMNDVVWSLEFAL  813

Query  380  QLQDAADKRGGLSPPRTPERP-GFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRTK  204
            QLQ+AA+   G        RP  F +   G D +A  + DED        +++    +++
Sbjct  814  QLQEAAENESG-------RRPFAFRMHGLGRDEQATTEDDEDVFSDSGVEKDSAARMKSR  866

Query  203  ssatatstsddSLRGQSHTIFSELSNQLGR  114
            S  T T T+   +  +S  +FSE+ N  GR
Sbjct  867  SITTGTFTASSDML-KSDNVFSEIMNPTGR  895



>ref|XP_009588433.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana tomentosiformis]
Length=882

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 149/212 (70%), Gaps = 12/212 (6%)
 Frame = -2

Query  743  VSHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLA  564
            ++HVSTAVKGSFGY+DPEYY+R+Q+TEKSDVYSFGVVLFEVLCAR A+I NLP+ +V+LA
Sbjct  681  ITHVSTAVKGSFGYLDPEYYKRQQLTEKSDVYSFGVVLFEVLCARPAIIQNLPKGQVNLA  740

Query  563  EWGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFA  384
            +W  R  + G + +I+DPNL+GQIA ECL ++ E+A +CL DQG+DRPAM DVVW LEFA
Sbjct  741  DWACRCCKKGKLDQIIDPNLEGQIAPECLNKFAEVAYSCLSDQGVDRPAMGDVVWTLEFA  800

Query  383  LQLQDAADKRG-GLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTS-ENAEKLFR  210
            LQLQ+AAD RG  +     P  P  PL+         ++S+     AF+ S E   KL  
Sbjct  801  LQLQEAADNRGHAVEGYSYPTSPSLPLILNDQTNILTDESE-----AFSGSGEVGGKLTN  855

Query  209  TKssatatstsddSLRGQSHTIFSELSNQLGR  114
            + +S T++S      + +S TIFSE+ N  GR
Sbjct  856  STNSMTSSSD-----KLKSDTIFSEIQNPSGR  882



>ref|XP_009790513.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana sylvestris]
Length=874

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 145/211 (69%), Gaps = 13/211 (6%)
 Frame = -2

Query  743  VSHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLA  564
            ++H+STAVKGSFGYVDPEYY+R+Q+TEKSDVYSFGVVLFEVLCAR A+IPNLP+ +V+LA
Sbjct  676  ITHISTAVKGSFGYVDPEYYKRQQLTEKSDVYSFGVVLFEVLCARPAIIPNLPKGQVNLA  735

Query  563  EWGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFA  384
            EW  R     ++ +I+DPNL+GQIA ECL ++ E+A  CL+DQG+ RP+M+DVV  LEFA
Sbjct  736  EWACRGCRKRNLEQIIDPNLQGQIAPECLSKFAELAYRCLRDQGVQRPSMDDVVRTLEFA  795

Query  383  LQLQDAADKRGG-LSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRT  207
            LQLQ+AAD RG  L          F L+    +G+A   SDED    F+ S   E+   +
Sbjct  796  LQLQEAADNRGHELEGYIYAPSSSFCLIT---NGDANMSSDED--EVFSGSGEVERKLAS  850

Query  206  KssatatstsddSLRGQSHTIFSELSNQLGR  114
              ++ +        R ++  IFSE+ N LGR
Sbjct  851  SGTSVSK-------RMKNVAIFSEIVNPLGR  874



>ref|XP_009790514.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana sylvestris]
Length=879

 Score =   205 bits (521),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 146/211 (69%), Gaps = 11/211 (5%)
 Frame = -2

Query  743  VSHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLA  564
            ++HVSTAVKGSFGY+DPEYY+R+Q+TEKSDVYSFGVVLFEVLCAR A+I NLP+ +V+LA
Sbjct  679  ITHVSTAVKGSFGYLDPEYYKRQQLTEKSDVYSFGVVLFEVLCARPAIIQNLPKGQVNLA  738

Query  563  EWGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFA  384
            +W  R    G++ +I+DP L+GQIA ECL ++ E+A +CLKDQG+ RP M+DVVW LEFA
Sbjct  739  DWACRCCRKGNLDQIIDPCLEGQIAPECLSKFAEVASSCLKDQGVQRPPMSDVVWTLEFA  798

Query  383  LQLQDAADKRGGLSPPRT-PERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRT  207
            LQLQ+AAD RG      + P  P  P++       + ++S+     AF+ S      + +
Sbjct  799  LQLQEAADNRGHTVEGYSYPASPSLPMILNDQTNISTDESE-----AFSGSGEVGGKWTS  853

Query  206  KssatatstsddSLRGQSHTIFSELSNQLGR  114
              S+  +S      + +S TIFSE+ N LGR
Sbjct  854  SGSSMTSSD-----KLKSGTIFSEIRNPLGR  879



>gb|EYU44220.1| hypothetical protein MIMGU_mgv1a003782mg [Erythranthe guttata]
Length=564

 Score =   201 bits (512),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 120/159 (75%), Gaps = 7/159 (4%)
 Frame = -2

Query  746  AVSHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSL  567
            A +HVST VKGSFGYVDPEYYRR+Q+T+KSDVYSFGVVLFEVLCAR A+IP+LPR +V+L
Sbjct  359  AHTHVSTVVKGSFGYVDPEYYRRQQLTDKSDVYSFGVVLFEVLCARPAIIPSLPREQVNL  418

Query  566  AEWGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEF  387
             EW +  Y+ G + +IVD NL GQIA ECL ++VE A  CLK++GIDRPAM DVVW LEF
Sbjct  419  GEWAKFCYKKGTLEQIVDSNLDGQIAPECLGKFVETAITCLKEKGIDRPAMGDVVWSLEF  478

Query  386  ALQLQDAADKRGGLSPPRTPE-------RPGFPLLAKGG  291
            A+QLQ+AA++RGG  P             P FPLL   G
Sbjct  479  AMQLQEAAERRGGDGPAADGGDGDIFSINPSFPLLVGAG  517



>emb|CDP19887.1| unnamed protein product [Coffea canephora]
Length=825

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            SHVST V+GSFGYVDPEYY+R+Q+TEKSDVYSFGVVL EVLC R A+I NLP+ +V+LA 
Sbjct  693  SHVSTQVRGSFGYVDPEYYKRQQLTEKSDVYSFGVVLLEVLCGRGAIIRNLPKEQVNLAG  752

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            WG+R+Y  G + + VDP++KG+IA ECL  + E A NCLKDQGI+RP MNDVVW LEFAL
Sbjct  753  WGKRNYAKGIIHQTVDPHMKGEIAPECLRSFAETAINCLKDQGIERPGMNDVVWSLEFAL  812

Query  380  QLQDAADK  357
            QLQ+AA+ 
Sbjct  813  QLQEAAEN  820



>ref|XP_006373376.1| hypothetical protein POPTR_0017s13200g [Populus trichocarpa]
 gb|ERP51173.1| hypothetical protein POPTR_0017s13200g [Populus trichocarpa]
Length=307

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST V+GS GYVDPEYYRR+ +TEKSDVYSFGVVLFEVLCAR  VIP+ P+++ SLAE
Sbjct  110  THVSTVVRGSIGYVDPEYYRRQHLTEKSDVYSFGVVLFEVLCARPPVIPSSPKDQASLAE  169

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W R+ Y+ G + EIVDP+LKG++A   L ++ EIA +CL  QGI+RP M DVVWGLEFAL
Sbjct  170  WARKCYQRGTLDEIVDPHLKGEVAPVSLNKFAEIANSCLHGQGIERPKMGDVVWGLEFAL  229

Query  380  QLQDAADK  357
            QLQ +A+K
Sbjct  230  QLQQSAEK  237



>ref|NP_001141864.1| uncharacterized protein LOC100274007 [Zea mays]
 gb|ACF87195.1| unknown [Zea mays]
Length=216

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 111/146 (76%), Gaps = 2/146 (1%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LP+ +VSLAE
Sbjct  20   THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLPKEEVSLAE  79

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +IVDP LKG+IA +C  ++ E A  C+ DQGIDRP+M DV+W LEFAL
Sbjct  80   WALHCQKKGILDQIVDPYLKGKIAPQCFKKFAETAEKCVSDQGIDRPSMGDVLWNLEFAL  139

Query  380  QLQDAADKRGGLSPPRTPERPGFPLL  303
            Q+Q+ A++ G L    + E  G PL+
Sbjct  140  QMQEGAEESGSLGCGMSDE--GAPLM  163



>emb|CDY48659.1| BnaC07g27500D [Brassica napus]
Length=186

 Score =   182 bits (461),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 119/174 (68%), Gaps = 8/174 (5%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSL +W
Sbjct  5    HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLGDW  64

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
                 + G + +IVDPNLKG+I  ECL ++ + A  CL D G+DRP M DV+W LEFALQ
Sbjct  65   AMNCKKKGTLEDIVDPNLKGKINPECLKKFADTAEKCLSDSGLDRPTMGDVLWNLEFALQ  124

Query  377  LQDAAD-------KRGGLSPPRTPERPGFPLLAKG-GDGEAANKSDEDYGGAFT  240
            LQ+ A+        RGG S     E  G  +   G G+ + ++ S E+  G F+
Sbjct  125  LQETAEGSRQTTPSRGGESEDLAGEGGGMAVNVGGAGEHDVSDLSSEESSGIFS  178



>ref|XP_007217058.1| hypothetical protein PRUPE_ppa001157mg [Prunus persica]
 gb|EMJ18257.1| hypothetical protein PRUPE_ppa001157mg [Prunus persica]
Length=893

 Score =   194 bits (492),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 147/212 (69%), Gaps = 14/212 (7%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVL EVLCAR A+I  + + ++SLAE
Sbjct  693  THISTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLCEVLCARPALIRTVEKKQMSLAE  752

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +  +  G + +I+DP+L+G+I + CL +YVEIA +C++D GI+RP+MNDVVWGLEFAL
Sbjct  753  WTKVCHRNGKIDQIIDPSLRGKIGNACLNKYVEIAVSCIQDNGIERPSMNDVVWGLEFAL  812

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANK--SDEDYGGAFTTSENAEKLFR-  210
            QLQ +      LS  +           KG D E+     SD  +  ++  S +  K+ R 
Sbjct  813  QLQQSGGGVLNLSEEK-----------KGEDEESLMNAASDAGFSCSWEDSSSESKVSRV  861

Query  209  TKssatatstsddSLRGQSHTIFSELSNQLGR  114
            TKSS+   S+++ S++G S T+FSE+++  GR
Sbjct  862  TKSSSDHNSSTNKSMKGMSGTVFSEINDPNGR  893



>emb|CDP06209.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   190 bits (483),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 116/161 (72%), Gaps = 7/161 (4%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            SH+ST VKGSFGY+DPEYY R+Q+T+KSDVYSFGVVL EVLC RA +I +LP+ +V+LAE
Sbjct  403  SHISTQVKGSFGYIDPEYYTRQQLTDKSDVYSFGVVLLEVLCGRAPIILDLPQEQVNLAE  462

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W ++ Y+ G +  +VDP++KG+IA +CL  + E A NCLKDQGI RP M+DVV  LEFAL
Sbjct  463  WAKKCYKKGIIHRVVDPDVKGEIAPQCLRIFAETAINCLKDQGIQRPGMDDVVGRLEFAL  522

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDED  258
            Q+Q+AA+  GG   P       FPL   GGD +     D D
Sbjct  523  QVQEAAENEGGRPDP-------FPLHMHGGDVQNMTDDDTD  556



>ref|XP_008230913.1| PREDICTED: receptor-like protein kinase FERONIA [Prunus mume]
Length=721

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 148/212 (70%), Gaps = 14/212 (7%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVL EVLCAR A+I  + + ++SLAE
Sbjct  521  THISTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLCEVLCARPALIRTVEKKQMSLAE  580

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +  +  G + +I+DP+L+G+I + CL +YVEIA +CL+D GI+RP+MNDVVWGLEFAL
Sbjct  581  WTKVCHRNGKIDQIIDPSLRGKIGNACLNKYVEIAVSCLQDNGIERPSMNDVVWGLEFAL  640

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEA--ANKSDEDYGGAFTTSENAEKLFR-  210
            QLQ +      LS  +           KG D E+  +  SD  +  ++  S +  K+ R 
Sbjct  641  QLQQSGGGVLNLSEEK-----------KGEDEESLMSAASDAGFSCSWEDSSSELKVSRV  689

Query  209  TKssatatstsddSLRGQSHTIFSELSNQLGR  114
            TKSS+   S++++S++G S  +FSE+++  GR
Sbjct  690  TKSSSDHNSSTNESMKGMSGAVFSEINDPNGR  721



>ref|XP_011099030.1| PREDICTED: receptor-like protein kinase FERONIA [Sesamum indicum]
Length=886

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 141/215 (66%), Gaps = 15/215 (7%)
 Frame = -2

Query  746  AVSHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSL  567
            A +HVST VKGSFGY+DPEYYRR+Q+T+KSDVYSF +VL EVLCAR A+IP+LP+ +V+L
Sbjct  683  AQTHVSTVVKGSFGYMDPEYYRRQQLTDKSDVYSFAIVLLEVLCARPAIIPSLPKEQVNL  742

Query  566  AEWGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEF  387
            AEW +  Y  G   +I+D NLK QIA ECL ++VE A +C+ D+GIDRPAM+DV+W LEF
Sbjct  743  AEWAKFCYRKGTFEQIIDSNLKDQIAPECLKKFVETAIHCISDKGIDRPAMSDVLWMLEF  802

Query  386  ALQLQDAADKRGGLS----PPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEK  219
            A+Q Q+  D RG              P  PLLA G      +K+DE+    + +SE A  
Sbjct  803  AMQQQEGTDCRGSNKVEGGDSFFAASPSLPLLAVG----EPDKTDEEM--LWGSSEAALS  856

Query  218  LFRTKssatatstsddSLRGQSHTIFSELSNQLGR  114
              ++   +T +S      + +S  IFSE+ N LGR
Sbjct  857  GSKSSGLSTPSSE-----KLKSGDIFSEIMNPLGR  886



>ref|XP_006373380.1| hypothetical protein POPTR_0017s13240g [Populus trichocarpa]
 gb|ERP51177.1| hypothetical protein POPTR_0017s13240g [Populus trichocarpa]
Length=879

 Score =   192 bits (487),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST V+GS GYVDPEYYRR+ VTEKSDVYSFGVVLFEVLCAR  VIP+ P+++ SLAE
Sbjct  682  THVSTVVRGSIGYVDPEYYRRQHVTEKSDVYSFGVVLFEVLCARPPVIPSSPKDQASLAE  741

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W RR Y+ G + +IVDP+LKG++AS  L ++ EIA +CL  QGI+RP M DVVWGLEFAL
Sbjct  742  WARRCYQRGTLDQIVDPHLKGEVASVSLNKFAEIANSCLHVQGIERPKMGDVVWGLEFAL  801

Query  380  QLQDAADKRG  351
            QLQ  A+K G
Sbjct  802  QLQQTAEKNG  811



>ref|XP_009373799.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
Length=890

 Score =   191 bits (486),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 146/209 (70%), Gaps = 11/209 (5%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVL EVLCAR A+I    + ++SLAE
Sbjct  693  THISTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLCEVLCARPALIRTAEKKQMSLAE  752

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +  +  G + +I+DP+L+G+I + CL +YVEIA +C+ D GI+RP+MNDVVWGLEFAL
Sbjct  753  WTKICHRNGKLDQIIDPSLRGKIGNACLKKYVEIAVSCMHDSGIERPSMNDVVWGLEFAL  812

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRTKs  201
            QLQ +    GG S            +  G D E+  +SD  +  ++  S + EK   +K+
Sbjct  813  QLQQSV---GGDSNSNDE-------MGSGDDVESVTRSDVGF-ISWEESSDLEKSRVSKT  861

Query  200  satatstsddSLRGQSHTIFSELSNQLGR  114
            S+   ST++DS++G S T+FSE+++  GR
Sbjct  862  SSDHNSTTNDSIKGMSGTVFSEINDPNGR  890



>ref|XP_011018979.1| PREDICTED: receptor-like protein kinase FERONIA, partial [Populus 
euphratica]
Length=297

 Score =   182 bits (461),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  96   THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  155

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    ++ G + +I+DP LKG+IA EC  ++ E A  C+ DQ IDRP+M DV+W LEFAL
Sbjct  156  WAAHCHKKGILDQILDPYLKGKIAPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFAL  215

Query  380  QLQDAAD  360
            QLQ++A+
Sbjct  216  QLQESAE  222



>emb|CAN65310.1| hypothetical protein VITISV_043086 [Vitis vinifera]
Length=289

 Score =   181 bits (460),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 138/213 (65%), Gaps = 8/213 (4%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVLFEVLCAR  +   + + +VSLA+
Sbjct  81   AHVSTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLFEVLCARPPLNQTVEKERVSLAQ  140

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y  G + +IVDP LKG+IA +CL ++ EIA +CL+DQGI+RP+M+DVVWGL+FA+
Sbjct  141  WAPACYRDGKLEQIVDPFLKGKIAPDCLQKFGEIAVSCLQDQGIERPSMSDVVWGLQFAM  200

Query  380  QLQDAA----DKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLF  213
            QLQ++A    +K G     +  E P    +    D      SD   GG + +  +   + 
Sbjct  201  QLQESAEQEMEKSGSWRKVKDEEAPLKXSITDDSDDAYVLTSDS--GGTWDSKSSGVMIQ  258

Query  212  RTKssatatstsddSLRGQSHTIFSELSNQLGR  114
             +    ++TS   D+L   S  +FSE+ N  GR
Sbjct  259  SSGEEKSSTSCESDAL--MSGAVFSEILNPKGR  289



>emb|CAN68061.1| hypothetical protein VITISV_037438 [Vitis vinifera]
Length=289

 Score =   181 bits (460),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 137/213 (64%), Gaps = 8/213 (4%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVLFEVLCAR  +   + + +VSLA+
Sbjct  81   AHVSTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLFEVLCARPPLNQTVEKERVSLAQ  140

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y  G + +IVDP LKG+IA +CL ++ EIA +CL+DQGI+RP+M DVVWGL+FA+
Sbjct  141  WAPSCYRDGKLEQIVDPFLKGKIAPDCLQKFGEIAVSCLQDQGIERPSMTDVVWGLQFAM  200

Query  380  QLQDAA----DKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLF  213
            QLQ++A    +K G     +  E P    +    D      SD   GG + +  +   + 
Sbjct  201  QLQESAEQETEKSGSWRKVKDEEAPLKTSITDDSDDAYVLTSDS--GGTWDSQSSGIMIP  258

Query  212  RTKssatatstsddSLRGQSHTIFSELSNQLGR  114
             +    ++TS   D+L   S  +FSE+ N  GR
Sbjct  259  SSGEEKSSTSRESDAL--MSGAVFSEILNPKGR  289



>emb|CAN77538.1| hypothetical protein VITISV_025026 [Vitis vinifera]
Length=853

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKGSFGYVDPEY+R RQ+TEKSDVYSFGVVLFEVLCAR AVIP+ P  +V LAE
Sbjct  644  THVSTAVKGSFGYVDPEYFRLRQLTEKSDVYSFGVVLFEVLCARPAVIPDAPEKQVCLAE  703

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            WGRRSY  G +  I+D NL+ ++A ECL ++ EIA +C++D+GI+RP M+DVVW LEFAL
Sbjct  704  WGRRSYRKGALVRIMDQNLRDEVAPECLKKFGEIADSCVRDKGIERPPMSDVVWALEFAL  763

Query  380  QLQDAADKRGGLS  342
            QLQ+ A++   ++
Sbjct  764  QLQETAERNSQIN  776



>ref|XP_002277584.3| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=895

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKGSFGYVDPEY+R RQ+TEKSDVYSFGVVLFEVLCAR AVIP+ P  +V LAE
Sbjct  686  THVSTAVKGSFGYVDPEYFRLRQLTEKSDVYSFGVVLFEVLCARPAVIPDAPEKQVCLAE  745

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            WGRRSY  G +  I+D NL+ ++A ECL ++ EIA +C++D+GI+RP M+DVVW LEFAL
Sbjct  746  WGRRSYRKGALVRIMDQNLRDEVAPECLKKFGEIADSCVRDKGIERPPMSDVVWALEFAL  805

Query  380  QLQDAADKRGGLS  342
            QLQ+ A++   ++
Sbjct  806  QLQETAERNSQIN  818



>gb|ABY40731.1| FERONIA receptor-like kinase [Citrus trifoliata]
Length=447

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  244  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  303

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    ++ G + +I+DP LKG+IA EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  304  WAAHCHKKGILEQIMDPYLKGKIAPECFKKFAETAMKCVSDQGIERPSMGDVLWNLEFAL  363

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  364  QLQESAEESG  373



>emb|CBI21192.3| unnamed protein product [Vitis vinifera]
Length=974

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKGSFGYVDPEY+R RQ+TEKSDVYSFGVVLFEVLCAR AVIP+ P  +V LAE
Sbjct  768  THVSTAVKGSFGYVDPEYFRLRQLTEKSDVYSFGVVLFEVLCARPAVIPDAPEKQVCLAE  827

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            WGRRSY  G +  I+D NL+ ++A ECL ++ EIA +C++D+GI+RP M+DVVW LEFAL
Sbjct  828  WGRRSYRKGALVRIMDQNLRDEVAPECLKKFGEIADSCVRDKGIERPPMSDVVWALEFAL  887

Query  380  QLQDAADKRGGLS  342
            QLQ+ A++   ++
Sbjct  888  QLQETAERNSQIN  900



>ref|XP_010694018.1| PREDICTED: putative receptor-like protein kinase At5g39000 isoform 
X3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010694023.1| PREDICTED: putative receptor-like protein kinase At5g39000 isoform 
X4 [Beta vulgaris subsp. vulgaris]
Length=899

 Score =   189 bits (481),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -2

Query  743  VSHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLA  564
            ++H+STAVKGS GY+DPEYY+RRQ+TEKSDVYSFGVVLFEVLCARA V PNLPR + +LA
Sbjct  692  ITHISTAVKGSVGYLDPEYYQRRQLTEKSDVYSFGVVLFEVLCARAVVKPNLPREQANLA  751

Query  563  EWGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFA  384
             W    Y++G ++ IVDP+L GQI+ ECL ++ EIA  C++D+G +RP M D+VWGLEFA
Sbjct  752  RWATTRYKSGTLNTIVDPDLTGQISPECLRKFGEIASMCVRDRGSERPPMGDIVWGLEFA  811

Query  383  LQLQDAADK  357
            LQLQ+AA+K
Sbjct  812  LQLQEAAEK  820



>ref|XP_010660576.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=875

 Score =   189 bits (479),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKGSFGYVDPEY+R RQ+TEKSDVYSFGVVLFEVLC R AVIP  P+ +VS+AE
Sbjct  666  THVSTAVKGSFGYVDPEYFRLRQLTEKSDVYSFGVVLFEVLCGRPAVIPGAPKEQVSVAE  725

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            WGRRSY  G +  I+D NL+ ++A ECL ++ EIA +C++++GI+RP M+DVVW LEFAL
Sbjct  726  WGRRSYRNGALDRIMDQNLRDEVAPECLKKFGEIADSCVRNEGIERPPMSDVVWALEFAL  785

Query  380  QLQDAADKRGGLS  342
            QLQ+ A++   ++
Sbjct  786  QLQETAERNAQIN  798



>emb|CDP20271.1| unnamed protein product [Coffea canephora]
Length=886

 Score =   189 bits (479),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 116/161 (72%), Gaps = 7/161 (4%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            SH+ST VKGSFGY+DPEYY R+Q+T+KSDVYSFGVVLFEVLC RA +I +LP+ +V+LAE
Sbjct  684  SHISTQVKGSFGYIDPEYYTRQQLTDKSDVYSFGVVLFEVLCGRAPIILDLPQEQVNLAE  743

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W ++ Y+ G +  +VDP++ G+IA +CL  + E A NCLKDQGI RP M+DVV  LE AL
Sbjct  744  WAKKCYKKGIIHRVVDPDVNGEIAPQCLRIFAETAINCLKDQGIQRPGMDDVVGDLELAL  803

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDED  258
            Q+Q+AA+  GG   P       FPL      G+  N +D+D
Sbjct  804  QVQEAAENEGGRPDP-------FPLHLHMHGGDVQNMTDDD  837



>gb|EPS73118.1| hypothetical protein M569_01631 [Genlisea aurea]
Length=873

 Score =   187 bits (476),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 117/173 (68%), Gaps = 0/173 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVL EVLCAR A+ P+LP+ +VSLAE
Sbjct  681  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEVLCARPALNPSLPKEQVSLAE  740

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            WG   ++ G + +I+DP L G+IASEC  +Y E A  CL D G+DRPAM DV+W LEFAL
Sbjct  741  WGVHCHKKGTLDQIIDPYLYGKIASECFKKYTETAVKCLSDVGMDRPAMGDVLWNLEFAL  800

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAE  222
             LQ++A++ G +      +        KG DG A +      G   +    +E
Sbjct  801  NLQESAEESGMVPKGGGGDMESSSFKGKGFDGTATDSKSSSSGMTMSIGGRSE  853



>ref|XP_010244547.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=890

 Score =   188 bits (477),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P L + +VSLAE
Sbjct  687  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLAKEQVSLAE  746

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +I+DP LKG+IA EC  ++ EIA  C+ DQGIDRPAM DV+W LEFAL
Sbjct  747  WALHCQKKGILDQIIDPYLKGKIAPECFKKFAEIAEKCVADQGIDRPAMGDVLWHLEFAL  806

Query  380  QLQDAADKRGGLS  342
            QLQ++A++ GGL+
Sbjct  807  QLQESAEENGGLA  819



>ref|XP_008463270.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
 ref|XP_008463271.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
 ref|XP_008463272.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
Length=897

 Score =   188 bits (477),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P LP+ +VSLAE
Sbjct  695  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPTLPKEQVSLAE  754

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y  G + +I+D  LKG+IASECL ++ E A  C+ DQGIDRP+M DV+W LEFAL
Sbjct  755  WAAHCYNKGILDQIIDTFLKGKIASECLKKFAETAMKCVSDQGIDRPSMGDVLWNLEFAL  814

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  815  QLQESAEESG  824



>ref|XP_010693989.1| PREDICTED: receptor-like protein kinase FERONIA isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010693992.1| PREDICTED: receptor-like protein kinase FERONIA isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=934

 Score =   188 bits (477),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -2

Query  743  VSHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLA  564
            ++H+STAVKGS GY+DPEYY+RRQ+TEKSDVYSFGVVLFEVLCARA V PNLPR + +LA
Sbjct  727  ITHISTAVKGSVGYLDPEYYQRRQLTEKSDVYSFGVVLFEVLCARAVVKPNLPREQANLA  786

Query  563  EWGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFA  384
            +W    Y++G ++ IVDP+L GQI+ ECL ++ EIA  C++D+G +RP M D+VWGLEFA
Sbjct  787  KWATTRYKSGTLNTIVDPDLTGQISPECLRKFGEIASMCVRDRGSERPPMGDIVWGLEFA  846

Query  383  LQLQDAADK  357
            LQLQ+ A+K
Sbjct  847  LQLQEDAEK  855



>ref|XP_004142677.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cucumis 
sativus]
 ref|XP_004161706.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cucumis 
sativus]
 gb|KGN54458.1| hypothetical protein Csa_4G334690 [Cucumis sativus]
Length=897

 Score =   187 bits (476),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P LP+ +VSLAE
Sbjct  695  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPTLPKEQVSLAE  754

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y  G + +I+D  LKG+IASECL ++ E A  C+ DQGIDRP+M DV+W LEFAL
Sbjct  755  WAAHCYNKGILDQIIDTFLKGKIASECLKKFAETAMKCVSDQGIDRPSMGDVLWNLEFAL  814

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  815  QLQESAEESG  824



>ref|XP_006373370.1| hypothetical protein POPTR_0017s13150g [Populus trichocarpa]
 gb|ERP51167.1| hypothetical protein POPTR_0017s13150g [Populus trichocarpa]
Length=855

 Score =   187 bits (475),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST V+GSFGYVDPEYYRR+ +TEKSDVYSFGVVLFEVLCAR  VIP+ P+ + SLAE
Sbjct  658  THVSTVVRGSFGYVDPEYYRRQHLTEKSDVYSFGVVLFEVLCARPPVIPSSPKEQASLAE  717

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W R+ Y  G + EIVDP+LKG++A   L ++ EIA +CL  QGI+RP M DVVWGLEFAL
Sbjct  718  WARKCYLRGTLDEIVDPHLKGEVAPVSLNKFAEIANSCLHGQGIERPKMGDVVWGLEFAL  777

Query  380  QLQDAADKRG  351
            QLQ  A+K  
Sbjct  778  QLQQTAEKNA  787



>ref|XP_010034429.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
Length=888

 Score =   187 bits (475),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 119/177 (67%), Gaps = 5/177 (3%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKG+FGY+DPEYYRR+++T+KSDVYSFGVVLFEVLCAR AV    P  ++SLAE
Sbjct  693  THVSTAVKGTFGYLDPEYYRRQRLTDKSDVYSFGVVLFEVLCARPAVSRMAPMEQISLAE  752

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +   ++G V E+VDP+LKG IA ECL ++ EIA +CL+D+G  RP+MNDVVWGL FAL
Sbjct  753  WAQSCCKSGSVEEMVDPHLKGAIALECLNKFCEIAMSCLQDEGAKRPSMNDVVWGLNFAL  812

Query  380  QLQ-----DAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENA  225
            QLQ     +  D  G               +   G  EA N SD D GG  ++ E A
Sbjct  813  QLQVSTELEVKDHAGVSVHDSDDSDHDAASIRGSGSDEAINTSDSDSGGWKSSRETA  869



>ref|XP_004306057.1| PREDICTED: receptor-like protein kinase FERONIA [Fragaria vesca 
subsp. vesca]
Length=885

 Score =   187 bits (474),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 144/211 (68%), Gaps = 16/211 (8%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVL EVLCAR A+I  + + ++SLAE
Sbjct  689  THISTMVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLCEVLCARPALIRTVEKKQMSLAE  748

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +  +  G + +I+DPNL+G+IA+ CL ++VE+A +C+ D G +RP+MNDVVWGLEFAL
Sbjct  749  WTKSCHRNGSIYQIIDPNLRGKIAATCLNKFVELAVSCMNDNGNERPSMNDVVWGLEFAL  808

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAA--NKSDEDYGGAFTTSENAEKLFRT  207
            QLQ +A+               F  +   G+ E A    +D+    ++  S +++    T
Sbjct  809  QLQQSAEV--------------FLDVDMEGEDEVAFIKGNDDGTSCSWEYSSDSKNSRTT  854

Query  206  KssatatstsddSLRGQSHTIFSELSNQLGR  114
            K+S+   ST+++S+RG S TIFSE+ +   R
Sbjct  855  KTSSGKMSTTNESIRGMSGTIFSEIKDPTVR  885



>ref|NP_001238686.1| receptor-like kinase [Glycine max]
 gb|ACM89482.1| receptor-like kinase [Glycine max]
Length=883

 Score =   186 bits (473),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P L + +VSLAE
Sbjct  684  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPTLAKEQVSLAE  743

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G +  I+DP LKG+IASEC  ++ E A  C+ DQGIDRP+M DV+W LEFAL
Sbjct  744  WAAHCYKKGILDSIIDPYLKGKIASECFKKFAETAMKCVADQGIDRPSMGDVLWNLEFAL  803

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  804  QLQESAEESG  813



>ref|XP_011099029.1| PREDICTED: receptor-like protein kinase FERONIA [Sesamum indicum]
Length=885

 Score =   186 bits (473),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 111/155 (72%), Gaps = 4/155 (3%)
 Frame = -2

Query  746  AVSHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSL  567
            A +HVST VKGS GYVDPEYYRR+Q+T+KSDVYSF +VL EVLCAR A+IP+LPR +V+L
Sbjct  682  AQTHVSTVVKGSLGYVDPEYYRRQQLTDKSDVYSFAIVLLEVLCARPAIIPSLPREQVNL  741

Query  566  AEWGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEF  387
            AEW +  Y  G   +I+D NLK QIA ECL ++VE A +C+ D+GIDR AM+DV+W LEF
Sbjct  742  AEWAKFCYRKGTFEQIIDSNLKDQIAPECLKKFVETAIHCISDKGIDRLAMSDVLWMLEF  801

Query  386  ALQLQDAADKRGGLSP----PRTPERPGFPLLAKG  294
            A+Q Q+ AD RG              P  PLLA G
Sbjct  802  AMQQQEGADCRGSNKAEGGDSFFAASPSLPLLAVG  836



>gb|KHN40613.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=894

 Score =   186 bits (472),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P L + +VSLAE
Sbjct  695  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPTLAKEQVSLAE  754

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G +  I+DP LKG+IASEC  ++ E A  C+ DQGIDRP+M DV+W LEFAL
Sbjct  755  WAAHCYKKGILDSIIDPYLKGKIASECFKKFAETAMKCVADQGIDRPSMGDVLWNLEFAL  814

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  815  QLQESAEESG  824



>ref|XP_006373383.1| hypothetical protein POPTR_0017s13270g [Populus trichocarpa]
 gb|ERP51180.1| hypothetical protein POPTR_0017s13270g [Populus trichocarpa]
Length=829

 Score =   185 bits (470),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST V+GS GYVDPEYYRR+ +TEKSDVYSFGVVLFEVLCAR  VIP+ P+++ SLAE
Sbjct  689  THVSTVVRGSIGYVDPEYYRRQHLTEKSDVYSFGVVLFEVLCARPPVIPSSPKDQASLAE  748

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W R+ Y+ G + +IVDP+LKG++A   L ++ EIA +CL  QGI+RP M DVVWGLEFAL
Sbjct  749  WARKCYQRGTLDQIVDPHLKGEVAPVSLNKFAEIANSCLHGQGIERPKMGDVVWGLEFAL  808

Query  380  QLQDAADK  357
            QLQ  A+K
Sbjct  809  QLQQTAEK  816



>ref|XP_010034431.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 gb|KCW52043.1| hypothetical protein EUGRSUZ_J01484 [Eucalyptus grandis]
Length=883

 Score =   186 bits (471),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 115/169 (68%), Gaps = 5/169 (3%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKG+FGY+DPEYYRR+++T+KSDVYSFGVVLFEVLCAR AV    P  ++SLAE
Sbjct  683  THVSTAVKGTFGYLDPEYYRRQRLTDKSDVYSFGVVLFEVLCARPAVSRMAPMEQISLAE  742

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +   ++G V E+VDP+LKG IA ECL ++ EIA +CL+D+G  RP+MNDVVWGL FAL
Sbjct  743  WAQSCCKSGSVEEMVDPHLKGAIALECLNKFCEIAMSCLQDEGAKRPSMNDVVWGLNFAL  802

Query  380  QLQ-----DAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGG  249
            QLQ     +  D  G               +   G  EA N SD D GG
Sbjct  803  QLQVSTELEVKDHAGVSVHDSDDSDHDAASIRGSGSDEAINTSDSDSGG  851



>ref|XP_008368476.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA [Malus domestica]
Length=892

 Score =   186 bits (471),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 145/212 (68%), Gaps = 17/212 (8%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVL EVLCAR A+I    + ++SLAE
Sbjct  695  THISTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLCEVLCARPALIRTAEKKQMSLAE  754

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +  +  G + +I+DP+L+G+I + CL +YVEIA +C+ D GI+RP+MNDVVWGLEFAL
Sbjct  755  WTKICHRNGKLDQIIDPSLRGKIGNACLKKYVEIAVSCMHDSGIERPSMNDVVWGLEFAL  814

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFR---  210
            QLQ +    GG S               GG  +  + +  D G  F + E + +L +   
Sbjct  815  QLQQSV---GGDSNSND---------EMGGGDDIGSVTGSDVG--FISWEESSELKKSRV  860

Query  209  TKssatatstsddSLRGQSHTIFSELSNQLGR  114
            +K+S+   ST+++S++G S T+FSE+++  GR
Sbjct  861  SKTSSDHNSTTNESIKGMSGTVFSEINDPNGR  892



>ref|XP_006419383.1| hypothetical protein CICLE_v10004295mg [Citrus clementina]
 gb|ESR32623.1| hypothetical protein CICLE_v10004295mg [Citrus clementina]
Length=862

 Score =   185 bits (470),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+  NLP+ +VSLA+
Sbjct  683  THVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNVNLPKEQVSLAD  742

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W       G + +I+DPNLKG I  +CL ++ E A  CL DQGIDRP+M DV+W LEFAL
Sbjct  743  WALHCQRMGTIEDIIDPNLKGNITDQCLRKFTETAEKCLSDQGIDRPSMGDVLWNLEFAL  802

Query  380  QLQDAAD  360
            QLQD  D
Sbjct  803  QLQDNPD  809



>ref|XP_010694005.1| PREDICTED: putative receptor-like protein kinase At5g39000 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=910

 Score =   186 bits (471),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -2

Query  743  VSHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLA  564
            ++H+STAVKGS GY+DPEYY+RRQ+TEKSDVYSFGVVLFEVLCARAAV PNLP+ + +LA
Sbjct  702  ITHISTAVKGSVGYLDPEYYQRRQLTEKSDVYSFGVVLFEVLCARAAVKPNLPKEQANLA  761

Query  563  EWGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFA  384
            +W     ++G +  IVDPNL GQI+ ECL ++ E+A  C++D+G +RP M D+VWGLEF+
Sbjct  762  KWATARCKSGTLYTIVDPNLTGQISPECLRKFGEVASMCVRDRGSERPPMGDIVWGLEFS  821

Query  383  LQLQDAADK  357
            LQLQ+AA+K
Sbjct  822  LQLQEAAEK  830



>gb|KDO71938.1| hypothetical protein CISIN_1g041565mg [Citrus sinensis]
Length=862

 Score =   185 bits (470),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+  NLP+ +VSLA+
Sbjct  683  THVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNVNLPKEQVSLAD  742

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W       G + +I+DPNLKG I  +CL ++ E A  CL DQGIDRP+M DV+W LEFAL
Sbjct  743  WALHCQRMGTIEDIIDPNLKGNITDQCLRKFTETAEKCLSDQGIDRPSMGDVLWNLEFAL  802

Query  380  QLQDAAD  360
            QLQD  D
Sbjct  803  QLQDNPD  809



>ref|XP_006488842.1| PREDICTED: receptor-like protein kinase ANXUR1-like [Citrus sinensis]
Length=862

 Score =   185 bits (470),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+  NLP+ +VSLA+
Sbjct  683  THVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNVNLPKEQVSLAD  742

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W       G + +I+DPNLKG I  +CL ++ E A  CL DQGIDRP+M DV+W LEFAL
Sbjct  743  WALHCQRMGTIEDIIDPNLKGNITDQCLRKFTETAEKCLSDQGIDRPSMGDVLWNLEFAL  802

Query  380  QLQDAAD  360
            QLQD  D
Sbjct  803  QLQDNPD  809



>ref|XP_010694013.1| PREDICTED: putative receptor-like protein kinase At5g39000 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=908

 Score =   185 bits (470),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -2

Query  743  VSHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLA  564
            ++H+STAVKGS GY+DPEYY+RRQ+TEKSDVYSFGVVLFEVLCARAAV PNLP+ + +LA
Sbjct  700  ITHISTAVKGSVGYLDPEYYQRRQLTEKSDVYSFGVVLFEVLCARAAVKPNLPKEQANLA  759

Query  563  EWGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFA  384
            +W     ++G +  IVDPNL GQI+ ECL ++ E+A  C++D+G +RP M D+VWGLEF+
Sbjct  760  KWATARCKSGTLYTIVDPNLTGQISPECLRKFGEVASMCVRDRGSERPPMGDIVWGLEFS  819

Query  383  LQLQDAADK  357
            LQLQ+AA+K
Sbjct  820  LQLQEAAEK  828



>ref|XP_010252026.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=886

 Score =   185 bits (470),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  687  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  746

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +I+DP LKG+IA EC  ++ E A  C+ DQGIDRPAM DV+W LEFAL
Sbjct  747  WALHCQKKGILDQIIDPYLKGKIAPECFKKFAETAEKCVSDQGIDRPAMGDVLWNLEFAL  806

Query  380  QLQDAADKRG  351
            QLQ++A+  G
Sbjct  807  QLQESAESSG  816



>ref|XP_002467915.1| hypothetical protein SORBIDRAFT_01g036260 [Sorghum bicolor]
 gb|EER94913.1| hypothetical protein SORBIDRAFT_01g036260 [Sorghum bicolor]
Length=895

 Score =   185 bits (470),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 113/149 (76%), Gaps = 2/149 (1%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LP+ +VSLAE
Sbjct  698  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLPKEEVSLAE  757

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +IVDP LKG+IA +C  ++ E A  C+ DQGIDRP+M DV+W LEFAL
Sbjct  758  WALHCQKKGILDQIVDPYLKGKIAPQCFKKFAETAEKCVSDQGIDRPSMGDVLWNLEFAL  817

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKG  294
            Q+Q++A++ G L    + E  G PL+  G
Sbjct  818  QMQESAEESGSLGCGMSDE--GTPLVMVG  844



>ref|XP_010485852.1| PREDICTED: receptor-like protein kinase ANXUR1 [Camelina sativa]
Length=851

 Score =   185 bits (469),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 116/176 (66%), Gaps = 15/176 (9%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ PNLP+ +VSL +W
Sbjct  673  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPNLPKEQVSLGDW  732

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
                   G + +I+DPNLKG+I SECL ++ + A  CL D G++RP M DV+W LEFALQ
Sbjct  733  AMNCKRRGTLDDIIDPNLKGKINSECLKKFADTAEKCLSDSGLERPTMGDVLWNLEFALQ  792

Query  377  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAA----------NKSDEDYGGAFT  240
            LQ+ AD        RTP R G       G G AA          + S ED  G F+
Sbjct  793  LQETAD-----GTRRTPNRGGSSEDVGDGGGMAAVNVAGRDDVSDLSSEDSSGIFS  843



>ref|XP_010098025.1| Receptor-like protein kinase FERONIA [Morus notabilis]
 gb|EXB74408.1| Receptor-like protein kinase FERONIA [Morus notabilis]
Length=888

 Score =   185 bits (469),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  690  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  749

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    ++ G + +I+DP LKG+IA EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  750  WAAHCHKKGILDQILDPYLKGKIAPECFKKFAETAMKCVSDQGIERPSMGDVLWNLEFAL  809

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  810  QLQESAEESG  819



>ref|XP_007033491.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY04417.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
Length=892

 Score =   185 bits (469),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  690  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  749

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    ++ G + +I+DP LKG+IA EC  ++ E A  C+ DQGIDRP+M DV+W LEFAL
Sbjct  750  WAAHCHKKGILDQIMDPYLKGKIAPECFKKFAETAMKCVADQGIDRPSMGDVLWNLEFAL  809

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  810  QLQESAEESG  819



>gb|KHN29489.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=896

 Score =   185 bits (469),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 117/172 (68%), Gaps = 6/172 (3%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P L + +VSLAE
Sbjct  697  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPTLAKEQVSLAE  756

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G +  I+DP LKG+IA EC  ++ E A  C+ DQGIDRP+M DV+W LEFAL
Sbjct  757  WAAHCYQKGILDSIIDPYLKGKIAPECFKKFAETAMKCVADQGIDRPSMGDVLWNLEFAL  816

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENA  225
            QLQ++A++ G        E P +       D +    SD  Y G  T S ++
Sbjct  817  QLQESAEESGNGFGDIHCEEPLY------TDSKGKKDSDPGYDGNVTDSRSS  862



>gb|KDO64141.1| hypothetical protein CISIN_1g036624mg [Citrus sinensis]
Length=893

 Score =   185 bits (469),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  690  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  749

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    ++ G + +I+DP LKG+IA EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  750  WAAHCHKKGILEQIMDPYLKGKIAPECFKKFAETAMKCVSDQGIERPSMGDVLWNLEFAL  809

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  810  QLQESAEESG  819



>ref|XP_006429617.1| hypothetical protein CICLE_v10011034mg [Citrus clementina]
 ref|XP_006481221.1| PREDICTED: receptor-like protein kinase FERONIA-like [Citrus 
sinensis]
 gb|ESR42857.1| hypothetical protein CICLE_v10011034mg [Citrus clementina]
Length=895

 Score =   185 bits (469),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  692  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  751

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    ++ G + +I+DP LKG+IA EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  752  WAAHCHKKGILEQIMDPYLKGKIAPECFKKFAETAMKCVSDQGIERPSMGDVLWNLEFAL  811

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  812  QLQESAEESG  821



>ref|NP_001237656.1| FERONIA receptor-like kinase precursor [Glycine max]
 gb|ACM89524.1| FERONIA receptor-like kinase [Glycine max]
Length=892

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 117/172 (68%), Gaps = 6/172 (3%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P L + +VSLAE
Sbjct  693  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPTLAKEQVSLAE  752

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G +  I+DP LKG+IA EC  ++ E A  C+ DQGIDRP+M DV+W LEFAL
Sbjct  753  WAAHCYQKGILDSIIDPYLKGKIAPECFKKFAETAMKCVADQGIDRPSMGDVLWNLEFAL  812

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENA  225
            QLQ++A++ G        E P +       D +    SD  Y G  T S ++
Sbjct  813  QLQESAEESGNGFGDIHCEEPLY------TDSKGKKDSDPGYDGNVTDSRSS  858



>gb|KJB29840.1| hypothetical protein B456_005G120700 [Gossypium raimondii]
Length=889

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  687  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  746

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    ++ G + +I+DP LKG+IA EC  ++ E A  C+ DQGIDRP+M DV+W LEFAL
Sbjct  747  WAAHCHKKGILDQIMDPYLKGKIAPECFKKFAETAMKCVADQGIDRPSMGDVLWNLEFAL  806

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  807  QLQESAEESG  816



>ref|XP_006373375.1| hypothetical protein POPTR_0017s13190g, partial [Populus trichocarpa]
 gb|ERP51172.1| hypothetical protein POPTR_0017s13190g, partial [Populus trichocarpa]
Length=855

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST V+GS GYVDP+YYRR+ +TEKSDVYSFGVVLFEVLCAR  VIP+ P+++ SLA+
Sbjct  687  THVSTVVRGSIGYVDPQYYRRQHLTEKSDVYSFGVVLFEVLCARPPVIPSSPKDQASLAD  746

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W R+ Y  G + +IVDP+LKG++A   L ++ EIA +CL  QGI+RP M DVVWGLEFAL
Sbjct  747  WARKCYHRGTLDQIVDPHLKGEVAPVSLNKFAEIANSCLHVQGIERPKMGDVVWGLEFAL  806

Query  380  QLQDAADKRG  351
            QLQ +A+K G
Sbjct  807  QLQQSAEKNG  816



>tpg|DAA45217.1| TPA: putative receptor-like protein kinase family protein [Zea 
mays]
Length=886

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 112/151 (74%), Gaps = 2/151 (1%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LP+ +VSLAE
Sbjct  690  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLPKEEVSLAE  749

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +IVDP LKG+IA +C  ++ E A  C+ DQGIDRP+M DV+W LEFAL
Sbjct  750  WALHCQKKGILDQIVDPYLKGKIAPQCFKKFAETAEKCVSDQGIDRPSMGDVLWNLEFAL  809

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGD  288
            Q+Q+ A++ G L    + E  G PL+    D
Sbjct  810  QMQEGAEESGSLGCGMSDE--GAPLMVGKKD  838



>ref|XP_006408164.1| hypothetical protein EUTSA_v10020050mg [Eutrema salsugineum]
 gb|ESQ49617.1| hypothetical protein EUTSA_v10020050mg [Eutrema salsugineum]
Length=854

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 118/178 (66%), Gaps = 16/178 (9%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSL +W
Sbjct  673  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLGDW  732

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
                   G + +I+DPNLKG+I SECL ++ + A  CL D G+DRP M DV+W LEFALQ
Sbjct  733  AMNCKRKGTLEDIIDPNLKGKINSECLKKFADTAEKCLSDSGLDRPTMGDVLWNLEFALQ  792

Query  377  LQDAADKRGGLSPPRTPERPG------------FPLLAKGGDGEAANKSDEDYGGAFT  240
            LQ+ AD     +  RTP   G              L  +G D + ++ S ED  G F+
Sbjct  793  LQETADG----TRHRTPINGGSSEDIGGGGMVAVNLGGRGEDHDVSDLSSEDNSGIFS  846



>ref|XP_010684237.1| PREDICTED: receptor-like protein kinase ANXUR1 [Beta vulgaris 
subsp. vulgaris]
Length=865

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSLA+W
Sbjct  683  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLADW  742

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
             R S   G++ EI+D ++KG I  ECL ++V+ A  CL D GIDRP+M+D++W LEF+LQ
Sbjct  743  ARSSVRKGNIDEIIDTHIKGTIKPECLKKFVDTAFKCLSDHGIDRPSMSDLLWNLEFSLQ  802

Query  377  LQDAAD  360
            LQ+  D
Sbjct  803  LQETED  808



>ref|XP_009388382.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
ANXUR2 [Musa acuminata subsp. malaccensis]
Length=402

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCARAA+ PNLP+ +VSLA+
Sbjct  223  THVSTMVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARAALSPNLPKEQVSLAD  282

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G +++I+DP+L+G+ + ECL +  E A  CL D G+DRP+M DV+W LEFAL
Sbjct  283  WALHCXKKGVLADIIDPHLEGKSSPECLKKSAETAEKCLLDHGVDRPSMGDVLWNLEFAL  342

Query  380  QLQD  369
            QLQD
Sbjct  343  QLQD  346



>ref|XP_010417830.1| PREDICTED: receptor-like protein kinase ANXUR1 [Camelina sativa]
Length=852

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 105/141 (74%), Gaps = 5/141 (4%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ PNLP+ +VSL +W
Sbjct  673  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPNLPKEQVSLGDW  732

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
                   G + +I+DPNLKG+I SECL ++ + A  CL D G++RP M DV+W LEFALQ
Sbjct  733  AMNCKRRGTLDDIIDPNLKGKINSECLKKFADTAEKCLSDSGLERPTMGDVLWNLEFALQ  792

Query  377  LQDAADKRGGLSPPRTPERPG  315
            LQ+ AD        RTP R G
Sbjct  793  LQETAD-----GTRRTPNRGG  808



>ref|XP_009151260.1| PREDICTED: receptor-like protein kinase ANXUR2 [Brassica rapa]
 ref|XP_009151261.1| PREDICTED: receptor-like protein kinase ANXUR2 [Brassica rapa]
Length=859

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 119/174 (68%), Gaps = 8/174 (5%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSL +W
Sbjct  678  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLGDW  737

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
                 + G + +I+DPNLKG+I  ECL ++ + A  CL D G+DRP M DV+W LEFALQ
Sbjct  738  ATNCKKKGTLEDIIDPNLKGKINPECLKKFADTAEKCLSDSGLDRPTMGDVLWNLEFALQ  797

Query  377  LQDAAD-------KRGGLSPPRTPERPGFPLLAKG-GDGEAANKSDEDYGGAFT  240
            LQ+ AD        RGG S     E  G  +   G G+ + ++ S E+  G F+
Sbjct  798  LQETADGSRQPTPSRGGESEDLAGEGGGMAVNVGGAGEHDVSDLSSEESSGIFS  851



>emb|CDX86206.1| BnaA06g29230D [Brassica napus]
Length=859

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 119/174 (68%), Gaps = 8/174 (5%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSL +W
Sbjct  678  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLGDW  737

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
                 + G + +I+DPNLKG+I  ECL ++ + A  CL D G+DRP M DV+W LEFALQ
Sbjct  738  ATNCKKKGTLEDIIDPNLKGKINPECLKKFADTAEKCLSDSGLDRPTMGDVLWNLEFALQ  797

Query  377  LQDAAD-------KRGGLSPPRTPERPGFPLLAKG-GDGEAANKSDEDYGGAFT  240
            LQ+ AD        RGG S     E  G  +   G G+ + ++ S E+  G F+
Sbjct  798  LQETADGSRQPTPSRGGESEDLAGEGGGMAVNVGGAGEHDVSDLSSEESSGIFS  851



>ref|XP_009791682.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana sylvestris]
Length=888

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  687  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFELLCARPALNPTLPKEQVSLAE  746

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G   +I+DP LKG+IA ECL ++ E A  C+ D G+DRP+M DV+W LEFAL
Sbjct  747  WAFHCYKKGTFDQIIDPYLKGKIAPECLKKFTETAVKCVSDVGVDRPSMGDVLWNLEFAL  806

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  807  QLQESAEECG  816



>ref|XP_007208402.1| hypothetical protein PRUPE_ppa001164mg [Prunus persica]
 gb|EMJ09601.1| hypothetical protein PRUPE_ppa001164mg [Prunus persica]
Length=891

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 108/142 (76%), Gaps = 1/142 (1%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSLAE
Sbjct  690  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLAE  749

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    ++ G +  I+DP LKG+I  EC  ++ E A  C+ DQ IDRP+M DV+W LEFAL
Sbjct  750  WAAHCHKKGSLDHILDPYLKGKITPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFAL  809

Query  380  QLQDAADKRG-GLSPPRTPERP  318
            QLQ++A++ G G+      E P
Sbjct  810  QLQESAEESGKGIGAMELEEEP  831



>ref|XP_008244701.1| PREDICTED: receptor-like protein kinase FERONIA [Prunus mume]
Length=891

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 108/142 (76%), Gaps = 1/142 (1%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSLAE
Sbjct  690  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLAE  749

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    ++ G +  I+DP LKG+I  EC  ++ E A  C+ DQ IDRP+M DV+W LEFAL
Sbjct  750  WAAHCHKKGSLDHILDPYLKGKITPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFAL  809

Query  380  QLQDAADKRG-GLSPPRTPERP  318
            QLQ++A++ G G+      E P
Sbjct  810  QLQESAEESGKGIGAMELEEEP  831



>ref|XP_009617447.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana tomentosiformis]
Length=888

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  687  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFELLCARPALNPTLPKEQVSLAE  746

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G   +I+DP LKG+IA ECL ++ E A  C+ D G+DRP+M DV+W LEFAL
Sbjct  747  WAFHCYKKGTFDQIIDPYLKGKIAPECLKKFTETAVKCVSDVGVDRPSMGDVLWNLEFAL  806

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  807  QLQESAEECG  816



>ref|XP_010683454.1| PREDICTED: receptor-like protein kinase FERONIA [Beta vulgaris 
subsp. vulgaris]
Length=881

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P+LP+ +VSLAE
Sbjct  683  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPSLPKEQVSLAE  742

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +I+DP LKG+IA EC  ++ E A  C+ DQ IDRP+M DV+W LEFAL
Sbjct  743  WAVYCYKKGILEQIMDPYLKGKIAPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFAL  802

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  803  QLQESAEESG  812



>ref|XP_002884459.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60718.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=850

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 118/172 (69%), Gaps = 5/172 (3%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSL +W
Sbjct  673  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLGDW  732

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
                   G++ +I+DPNLKG+I SECL ++ + A  CL D G++RP M DV+W LEFALQ
Sbjct  733  AMNCKRKGNLEDIIDPNLKGKINSECLKKFADTAEKCLNDSGLERPTMGDVLWNLEFALQ  792

Query  377  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAE  222
            LQ+ AD     +  RTP   G      GG G A N +  D     ++ +N E
Sbjct  793  LQETADG----TRHRTPNSGG-SSEDLGGGGMAVNVAGRDDVSDLSSEDNTE  839



>ref|XP_002279218.3| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=893

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  691  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  750

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +I+DP LKG+IA EC  +  E A  C+ DQGIDRP+M DV+W LEFAL
Sbjct  751  WALHCQKKGILDQIIDPYLKGKIAPECFKKIAETAVKCVSDQGIDRPSMGDVLWNLEFAL  810

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  811  QLQESAEEAG  820



>ref|XP_008341797.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=892

 Score =   184 bits (466),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/212 (48%), Positives = 144/212 (68%), Gaps = 17/212 (8%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFG VL EVLCAR A+I    + ++SLAE
Sbjct  695  THISTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGXVLCEVLCARPALIRTAEKKQMSLAE  754

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +  +  G + +I+DP+L+G+I + CL +YVEIA +C+ D GI+RP+MNDVVWGLEFAL
Sbjct  755  WTKICHRNGKLDQIIDPSLRGKIGNACLKKYVEIAVSCMHDSGIERPSMNDVVWGLEFAL  814

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFR---  210
            QLQ +    GG S               GG  +  + +  D G  F + E + +L +   
Sbjct  815  QLQQSV---GGDSNSND---------EMGGGDDIGSVTGSDVG--FISWEESSELKKSRV  860

Query  209  TKssatatstsddSLRGQSHTIFSELSNQLGR  114
            +K+S+   ST+++S++G S T+FSE+++  GR
Sbjct  861  SKTSSDHNSTTNESIKGMSGTVFSEINDPNGR  892



>ref|XP_009337788.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
Length=893

 Score =   184 bits (466),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  690  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  749

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    ++ G +  I+DP+LKG+I  EC  ++ E A  C+ DQ IDRP+M DV+W LEFAL
Sbjct  750  WAAHCHKKGILEHILDPHLKGKITPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFAL  809

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  810  QLQESAEESG  819



>ref|XP_008341792.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=892

 Score =   183 bits (465),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/212 (48%), Positives = 144/212 (68%), Gaps = 17/212 (8%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFG VL EVLCAR A+I    + ++SLAE
Sbjct  695  THISTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGXVLCEVLCARPALIRTAEKKQMSLAE  754

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +  +  G + +I+DP+L+G+I + CL +YVEIA +C+ D GI+RP+MNDVVWGLEFAL
Sbjct  755  WTKICHRNGKLDQIIDPSLRGKIGNACLKKYVEIAVSCMHDSGIERPSMNDVVWGLEFAL  814

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFR---  210
            QLQ +    GG S               GG  +  + +  D G  F + E + +L +   
Sbjct  815  QLQQSV---GGDSNSND---------EMGGGDDIXSVTGSDVG--FISWEESSELKKSRV  860

Query  209  TKssatatstsddSLRGQSHTIFSELSNQLGR  114
            +K+S+   ST+++S++G S T+FSE+++  GR
Sbjct  861  SKTSSDHNSTTNESIKGMSGTVFSEINDPNGR  892



>ref|XP_010043538.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 ref|XP_010043545.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 gb|KCW88392.1| hypothetical protein EUGRSUZ_A00782 [Eucalyptus grandis]
Length=897

 Score =   183 bits (465),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  694  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  753

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    ++ G +  I+DP+LKG+I+ EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  754  WAAHCHKKGILEHIMDPHLKGKISPECFKKFAETAMKCVNDQGIERPSMGDVLWNLEFAL  813

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  814  QLQESAEESG  823



>ref|XP_002528705.1| kinase, putative [Ricinus communis]
 gb|EEF33694.1| kinase, putative [Ricinus communis]
Length=891

 Score =   183 bits (465),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE++CAR A+ P LP+ +VSLAE
Sbjct  689  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEIICARPALNPALPKEQVSLAE  748

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    ++ G + +IVDP LKG+IA EC  ++ E A  C+ D GIDRP+M DV+W LEFAL
Sbjct  749  WAAHCHKKGILDQIVDPYLKGKIAPECFKKFAETAMKCVSDVGIDRPSMGDVLWNLEFAL  808

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  809  QLQESAEESG  818



>ref|XP_010921463.1| PREDICTED: receptor-like protein kinase ANXUR2 [Elaeis guineensis]
Length=870

 Score =   183 bits (464),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 117/173 (68%), Gaps = 5/173 (3%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LPR +VSLA+
Sbjct  686  THVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLPREQVSLAD  745

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W       G + +I+DPN+KG+I  ECL ++ E A  CL DQG+DRP M DV+W LEFAL
Sbjct  746  WALNCQRRGALGDIIDPNVKGKIGPECLKKFAETAEKCLSDQGVDRPYMGDVLWNLEFAL  805

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAE  222
            QLQ+  +       P T E P   L +   DG + + S    GG    S +++
Sbjct  806  QLQENFET----GKPVTAEAPS-SLESATSDGNSGSHSPMVIGGGSEVSVDSD  853



>ref|XP_008660180.1| PREDICTED: receptor-like protein kinase FERONIA [Zea mays]
 gb|AFW88468.1| putative receptor-like protein kinase family protein [Zea mays]
Length=888

 Score =   183 bits (465),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 112/149 (75%), Gaps = 2/149 (1%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LP+ +VSLAE
Sbjct  691  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLPKEEVSLAE  750

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +IVDP LKG+IA +C  ++ E A  C+ DQ IDRP+M DV+W LEFAL
Sbjct  751  WALHCQKKGVLDQIVDPYLKGKIAPQCFKKFAETAEKCVSDQSIDRPSMGDVLWNLEFAL  810

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKG  294
            Q+Q++A++ G L    + E  G PL+  G
Sbjct  811  QMQESAEESGSLGCGMSDE--GTPLVMVG  837



>ref|XP_006842554.1| hypothetical protein AMTR_s00077p00138840 [Amborella trichopoda]
 gb|ERN04229.1| hypothetical protein AMTR_s00077p00138840 [Amborella trichopoda]
Length=899

 Score =   183 bits (465),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 112/153 (73%), Gaps = 0/153 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LP+ +VSLAE
Sbjct  703  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLPKEQVSLAE  762

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +I+DP L+G+IA EC  ++ E A  C+ DQGIDRPAM DV+W LEFAL
Sbjct  763  WALHCQKKGVLEQIMDPYLRGKIAPECFKKFAETAEKCVGDQGIDRPAMGDVLWNLEFAL  822

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGE  282
            QLQ+++++       +       PL  KG DG+
Sbjct  823  QLQESSEEDIVADTTQIENDEEAPLTMKGKDGQ  855



>gb|KJB38065.1| hypothetical protein B456_006G235700 [Gossypium raimondii]
Length=895

 Score =   183 bits (465),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  691  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  750

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    ++ G + +I+DP LKG+IA EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  751  WAAHCHKKGILDQIMDPYLKGKIAPECFKKFAETAMKCVADQGIERPSMGDVLWNLEFAL  810

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  811  QLQESAEESG  820



>ref|XP_004246282.1| PREDICTED: receptor-like protein kinase FERONIA [Solanum lycopersicum]
Length=889

 Score =   183 bits (464),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  687  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  746

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G   +I+DP LKG++A ECL ++ E A  C+ D G+DRP+M DV+W LEFAL
Sbjct  747  WAFHCYKKGTFDQIIDPYLKGKLAPECLKKFTETAVKCVSDVGVDRPSMGDVLWNLEFAL  806

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  807  QLQESAEECG  816



>gb|KDP21852.1| hypothetical protein JCGZ_00639 [Jatropha curcas]
Length=652

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P L + +VSLAE
Sbjct  450  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLAKEQVSLAE  509

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    ++ G + +I+DP LKG+IA EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  510  WAAHCHKKGILDQILDPYLKGKIAPECFKKFAETAMKCVSDQGIERPSMGDVLWNLEFAL  569

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  570  QLQESAEESG  579



>ref|XP_006341293.1| PREDICTED: receptor-like protein kinase FERONIA-like [Solanum 
tuberosum]
Length=889

 Score =   183 bits (464),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  687  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  746

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G   +I+DP LKG++A ECL ++ E A  C+ D G+DRP+M DV+W LEFAL
Sbjct  747  WAFHCYKKGTFDQIIDPYLKGKLAPECLKKFTETAVKCVSDVGVDRPSMGDVLWNLEFAL  806

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  807  QLQESAEECG  816



>ref|XP_010553161.1| PREDICTED: receptor-like protein kinase FERONIA [Tarenaya hassleriana]
Length=852

 Score =   182 bits (463),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYS+GVVLFEVLCAR  + P LP+ +VSLAE
Sbjct  690  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSYGVVLFEVLCARPPLNPTLPKEQVSLAE  749

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W  R ++ G++ EI+DP LKG+IA EC  +Y E A  C+ DQGI+RP M DV+W LEFAL
Sbjct  750  WAARCFKKGELEEIIDPYLKGKIAPECFNKYAETAIKCVADQGIERPPMGDVLWNLEFAL  809

Query  380  QLQD  369
            QLQ+
Sbjct  810  QLQE  813



>ref|XP_010463957.1| PREDICTED: receptor-like protein kinase ANXUR1 [Camelina sativa]
Length=853

 Score =   182 bits (463),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 104/139 (75%), Gaps = 5/139 (4%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ PNLP+ +VSL +W
Sbjct  673  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPNLPKEQVSLGDW  732

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
                   G + +I+DPNLKG+I SECL ++ + A  CL D G++RP M DV+W LEFALQ
Sbjct  733  AMNCKRKGTLDDIIDPNLKGKINSECLKKFADTAEKCLSDSGLERPTMGDVLWNLEFALQ  792

Query  377  LQDAADKRGGLSPPRTPER  321
            LQ+ AD        RTP R
Sbjct  793  LQETAD-----GTRRTPNR  806



>ref|XP_010494105.1| PREDICTED: receptor-like protein kinase ANXUR2 [Camelina sativa]
 ref|XP_010494106.1| PREDICTED: receptor-like protein kinase ANXUR2 [Camelina sativa]
Length=859

 Score =   182 bits (463),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 117/174 (67%), Gaps = 7/174 (4%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSL +W
Sbjct  678  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLPKEQVSLGDW  737

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
                   G + +I+DPNLKG+I  ECL ++ + A  CL D G+DRP M DV+W LEFALQ
Sbjct  738  AMNCKRKGTLEDIIDPNLKGKINPECLKKFADTAEKCLSDSGLDRPTMGDVLWNLEFALQ  797

Query  377  LQDAADKRGGLSPPRTPERPGFPL-LAKGGDGEAANKSDE--DYGGAFTTSENA  225
            LQ+ AD        RTP   G    L +GG G A N   E  D     ++ EN+
Sbjct  798  LQETADG----PRHRTPSHGGGSEDLGRGGGGVAVNIDIEENDVADDLSSEENS  847



>ref|XP_009365902.1| PREDICTED: receptor-like protein kinase FERONIA isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009365905.1| PREDICTED: receptor-like protein kinase FERONIA isoform X3 [Pyrus 
x bretschneideri]
Length=902

 Score =   182 bits (463),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 140/209 (67%), Gaps = 11/209 (5%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +H++T  KGSFGY+DPEYYR  Q+TEKSDVYSFGVVL EVLCAR A++    + ++SLA 
Sbjct  705  THITTVAKGSFGYLDPEYYRLNQLTEKSDVYSFGVVLCEVLCARPALVRGPDKKQMSLAH  764

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +  Y  G++ +I+DPNL+G+I + C+ ++ +IA +C+ D GIDRP+MNDVVWGLEFAL
Sbjct  765  WAKSCYLKGELDQIMDPNLQGKIGTACMNKFADIAMSCMHDNGIDRPSMNDVVWGLEFAL  824

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRTKs  201
            QL    +++G L         GF +  KG D  A     +  G + +  E+++ + +T  
Sbjct  825  QLHQ-KEEQGDL---------GFDIEKKGEDEVAVMNDIDALGFSSSLGESSDWMTKTH-  873

Query  200  satatstsddSLRGQSHTIFSELSNQLGR  114
            S+   ST++D ++G S TIFS + NQ GR
Sbjct  874  SSEQNSTTNDPIKGMSRTIFSGIDNQDGR  902



>gb|KCW52050.1| hypothetical protein EUGRSUZ_J01490 [Eucalyptus grandis]
Length=682

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 122/177 (69%), Gaps = 5/177 (3%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKG+FGY+DPEYYRR+++T+KSDVYSFGVVLFEVLCAR AV    P  ++SLAE
Sbjct  487  THVSTAVKGTFGYLDPEYYRRQRLTDKSDVYSFGVVLFEVLCARPAVSRMAPVEQISLAE  546

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +   ++G V E+VDP+LKG IA ECL ++ EIA +CL+D+G  RP+MNDVVWGL FAL
Sbjct  547  WAQSCCKSGSVEEMVDPHLKGAIALECLNRFCEIAMSCLQDEGAKRPSMNDVVWGLNFAL  606

Query  380  QLQDAAD----KRGGLSPPRTPERPGFPLLAKG-GDGEAANKSDEDYGGAFTTSENA  225
            QLQ + +       G+S   +          +G G  EA N SD D G   ++ E A
Sbjct  607  QLQVSTELEVKDHAGVSVHDSDGSDHDAASIRGSGSNEAINTSDSDSGRWKSSRETA  663



>ref|XP_009365903.1| PREDICTED: receptor-like protein kinase FERONIA isoform X2 [Pyrus 
x bretschneideri]
Length=902

 Score =   182 bits (463),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 140/209 (67%), Gaps = 11/209 (5%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +H++T  KGSFGY+DPEYYR  Q+TEKSDVYSFGVVL EVLCAR A++    + ++SLA 
Sbjct  705  THITTVAKGSFGYLDPEYYRLNQLTEKSDVYSFGVVLCEVLCARPALVRGPDKKQMSLAH  764

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +  Y  G++ +I+DPNL+G+I + C+ ++ +IA +C+ D GIDRP+MNDVVWGLEFAL
Sbjct  765  WAKSCYLKGELDQIMDPNLQGKIGTACMNKFADIAMSCMHDNGIDRPSMNDVVWGLEFAL  824

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRTKs  201
            QL    +++G L         GF +  KG D  A     +  G + +  E+++ + +T  
Sbjct  825  QLHQ-KEEQGDL---------GFDIEKKGEDEVAVMNDIDALGFSSSLGESSDWMTKTH-  873

Query  200  satatstsddSLRGQSHTIFSELSNQLGR  114
            S+   ST++D ++G S TIFS + NQ GR
Sbjct  874  SSEQNSTTNDPIKGMSRTIFSGIDNQDGR  902



>ref|XP_009365907.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
Length=899

 Score =   182 bits (463),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 140/209 (67%), Gaps = 11/209 (5%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +H++T  KGSFGY+DPEYYR  Q+TEKSDVYSFGVVL EVLCAR A++    + ++SLA 
Sbjct  702  THITTVAKGSFGYLDPEYYRLNQLTEKSDVYSFGVVLCEVLCARPALVRGPDKKQMSLAH  761

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +  Y  G++ +I+DPNL+G+I + C+ ++ +IA +C+ D GIDRP+MNDVVWGLEFAL
Sbjct  762  WAKSCYLKGELDQIMDPNLQGKIGTACMNKFADIAMSCMHDNGIDRPSMNDVVWGLEFAL  821

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRTKs  201
            QL    +++G L         GF +  KG D  A     +  G + +  E+++ + +T  
Sbjct  822  QLHQ-KEEQGDL---------GFDIEKKGEDEVAVMNDIDALGFSSSLGESSDWMTKTN-  870

Query  200  satatstsddSLRGQSHTIFSELSNQLGR  114
            S+   ST++D ++G S TIFS + NQ GR
Sbjct  871  SSEQNSTTNDPIKGMSRTIFSGIDNQDGR  899



>ref|XP_002271113.1| PREDICTED: receptor-like protein kinase ANXUR1 [Vitis vinifera]
Length=857

 Score =   182 bits (462),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 116/173 (67%), Gaps = 8/173 (5%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLA+
Sbjct  673  NHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLPKEQVSLAD  732

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +I+DP+LKG I  ECL ++ + A  CL D G+DRP+M D++W LEFAL
Sbjct  733  WALHCQKKGILEDIIDPHLKGTINPECLKKFADTAEKCLSDHGLDRPSMGDILWNLEFAL  792

Query  380  QLQDAADKRGGLSPPRTPERPGF--------PLLAKGGDGEAANKSDEDYGGA  246
            QLQ+  D    +S    PE             +L+ G D    N+  +D  G+
Sbjct  793  QLQENPDGAKAVSERENPEEFNHNNIMGMHRNMLSLGSDDSDMNEVSDDLNGS  845



>ref|XP_009365906.1| PREDICTED: receptor-like protein kinase FERONIA isoform X4 [Pyrus 
x bretschneideri]
Length=902

 Score =   182 bits (463),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 140/209 (67%), Gaps = 11/209 (5%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +H++T  KGSFGY+DPEYYR  Q+TEKSDVYSFGVVL EVLCAR A++    + ++SLA 
Sbjct  705  THITTVAKGSFGYLDPEYYRLNQLTEKSDVYSFGVVLCEVLCARPALVRGPDKKQMSLAH  764

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +  Y  G++ +I+DPNL+G+I + C+ ++ +IA +C+ D GIDRP+MNDVVWGLEFAL
Sbjct  765  WAKSCYLKGELDQIMDPNLQGKIGTACMNKFADIAMSCMHDNGIDRPSMNDVVWGLEFAL  824

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRTKs  201
            QL    +++G L         GF +  KG D  A     +  G + +  E+++ + +T  
Sbjct  825  QLHQ-KEEQGDL---------GFDIEKKGEDEVAVMNDIDALGFSSSLGESSDWMTKTH-  873

Query  200  satatstsddSLRGQSHTIFSELSNQLGR  114
            S+   ST++D ++G S TIFS + NQ GR
Sbjct  874  SSEQNSTTNDPIKGMSRTIFSGIDNQDGR  902



>ref|XP_010455191.1| PREDICTED: receptor-like protein kinase ANXUR2 [Camelina sativa]
Length=858

 Score =   182 bits (462),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 118/174 (68%), Gaps = 7/174 (4%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSL +W
Sbjct  677  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLPKEQVSLGDW  736

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
                   G + +I+DPNLKG+I  ECL ++ + A  CL D G+DRP M DV+W LEFALQ
Sbjct  737  AMNCKRKGTLEDIIDPNLKGKINPECLKKFADTAEKCLSDSGLDRPTMGDVLWNLEFALQ  796

Query  377  LQDAADKRGGLSPPRTPERPGFPL-LAKGGDGEAANKSDE--DYGGAFTTSENA  225
            LQ+ AD +      RTP   G    L +GG   A N + E  D     ++ EN+
Sbjct  797  LQETADGQRN----RTPSHGGGSEDLGRGGGAVAVNVAIEENDVADDLSSEENS  846



>ref|XP_011079535.1| PREDICTED: receptor-like protein kinase ANXUR1 [Sesamum indicum]
Length=894

 Score =   182 bits (463),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 104/143 (73%), Gaps = 2/143 (1%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLA+W
Sbjct  704  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLPKEQVSLADW  763

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
              R      + +I+DP LKG+I  ECL ++ E A  CL D G+DRP M DV+W LE ALQ
Sbjct  764  ALRCARNKTLEDIIDPQLKGKINPECLKKFAETAEKCLADHGVDRPTMGDVLWSLELALQ  823

Query  377  LQDAADKRGGLSPPRTPERPGFP  309
            LQD  +  GG +  RT  R   P
Sbjct  824  LQD--NHEGGSTTSRTKNRKNNP  844



>dbj|BAJ91215.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=402

 Score =   177 bits (448),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 110/149 (74%), Gaps = 2/149 (1%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P L + +VSLAE
Sbjct  205  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLAKEEVSLAE  264

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +IVDP LKG+I  +C  ++ E A  C+ D GI+RP+M DV+W LEFAL
Sbjct  265  WALHCQKKGILDQIVDPYLKGKIVPQCFKKFAETAEKCVADNGIERPSMGDVLWNLEFAL  324

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKG  294
            Q+Q++A++ G +    + E  G PL+  G
Sbjct  325  QMQESAEESGSIGCGMSDE--GTPLVMVG  351



>ref|XP_010242732.1| PREDICTED: receptor-like protein kinase ANXUR1 [Nelumbo nucifera]
Length=858

 Score =   182 bits (461),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 106/140 (76%), Gaps = 3/140 (2%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            SHVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLA+
Sbjct  677  SHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLPKEQVSLAD  736

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W       G + +I+DP LKG+I  ECL ++ E A  CL D G+DRP+M DV+W LEFAL
Sbjct  737  WALHCQARGTLEDIIDPELKGKITPECLKKFAETAEKCLSDHGVDRPSMGDVLWNLEFAL  796

Query  380  QLQDAADKRGGLSPPRTPER  321
            QLQ+  D   G+ P +  E+
Sbjct  797  QLQENPD---GVKPEKDEEK  813



>ref|XP_010252025.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=886

 Score =   182 bits (462),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 104/133 (78%), Gaps = 1/133 (1%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  688  THVSTVVKGSFGYLDPEYFRRLQLTEKSDVYSFGVVLFEILCARPALSPTLPKEQVSLAE  747

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + E +DP LKG+IA EC  ++ EIA  C+ DQG DRPAM DV+W LEFAL
Sbjct  748  WAVHCQKKGILEEFIDPYLKGKIAPECFKKFAEIAEKCVSDQGSDRPAMGDVLWNLEFAL  807

Query  380  QLQDAADKRGGLS  342
            QLQ++A+  GG S
Sbjct  808  QLQESAES-GGFS  819



>ref|XP_006646366.1| PREDICTED: receptor-like protein kinase FERONIA-like, partial 
[Oryza brachyantha]
Length=824

 Score =   181 bits (460),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 113/149 (76%), Gaps = 2/149 (1%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P L + +VSLAE
Sbjct  627  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLAKEEVSLAE  686

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +IVDP+LKG+IA +C  ++ E A  C+ D+GIDRP+M DV+W LEFAL
Sbjct  687  WALHCQKKGILDQIVDPHLKGKIAPQCFKKFAETAEKCVSDEGIDRPSMGDVLWNLEFAL  746

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKG  294
            Q+Q++A++ G +    + E  G PL+  G
Sbjct  747  QMQESAEESGSIGCGMSDE--GTPLVMTG  773



>ref|XP_010529939.1| PREDICTED: receptor-like protein kinase FERONIA [Tarenaya hassleriana]
Length=892

 Score =   182 bits (462),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  688  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  747

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFA+
Sbjct  748  WAPHCYKKGMLDQIVDPFLKGKITPECFKKFAETAMKCVSDQGIERPSMGDVLWNLEFAM  807

Query  380  QLQDAADKRG  351
            QLQ++ ++ G
Sbjct  808  QLQESVEESG  817



>ref|XP_003609098.1| FERONIA receptor-like kinase [Medicago truncatula]
Length=893

 Score =   182 bits (462),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P L + +VSLAE
Sbjct  691  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPTLAKEQVSLAE  750

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +I DP LKG+IA EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  751  WAAHCYKKGILDQITDPYLKGKIAPECFKKFAETAMKCVNDQGIERPSMGDVLWNLEFAL  810

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  811  QLQESAEESG  820



>ref|XP_008364006.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA [Malus domestica]
Length=747

 Score =   181 bits (459),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  546  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  605

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    ++ G +  I+DP+LKG+I  EC  ++ E A  C+ DQ IDRP+M DV+W LEFAL
Sbjct  606  WAAHCHKKGILEHILDPHLKGKITPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFAL  665

Query  380  QLQDAA  363
            QLQ++A
Sbjct  666  QLQESA  671



>ref|XP_004984479.1| PREDICTED: receptor-like protein kinase FERONIA-like [Setaria 
italica]
Length=884

 Score =   182 bits (461),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 112/149 (75%), Gaps = 2/149 (1%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P L + +VSLAE
Sbjct  687  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLAKEEVSLAE  746

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +IVDP LKG+IA +C  ++ E A  C+ DQGIDRP+M DV+W LEFAL
Sbjct  747  WALHCQKKGILDQIVDPYLKGKIAPQCFKKFAETAEKCVSDQGIDRPSMGDVLWNLEFAL  806

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKG  294
            Q+Q++A++ G L    + E  G PL+  G
Sbjct  807  QMQESAEESGSLGCGMSDE--GTPLVMVG  833



>gb|KEH23293.1| feronia receptor-like kinase [Medicago truncatula]
Length=899

 Score =   182 bits (462),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P L + +VSLAE
Sbjct  697  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPTLAKEQVSLAE  756

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +I DP LKG+IA EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  757  WAAHCYKKGILDQITDPYLKGKIAPECFKKFAETAMKCVNDQGIERPSMGDVLWNLEFAL  816

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  817  QLQESAEESG  826



>gb|KJB42941.1| hypothetical protein B456_007G175600 [Gossypium raimondii]
Length=825

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            SHVST VKGS GYVDPEYYR++Q+TEKSDVYSFGVVLFEVLCAR A+IP LP++++SLA 
Sbjct  612  SHVSTVVKGSVGYVDPEYYRKQQLTEKSDVYSFGVVLFEVLCARPAMIPGLPKDQISLAR  671

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +   + G +  IVDPNL G I+  CL ++ E+A +C+KD+GI+RP MN+VVWGLEFAL
Sbjct  672  WAKICLKRGSLESIVDPNLMGDISPLCLKKFGELAESCIKDEGIERPIMNEVVWGLEFAL  731

Query  380  QLQDAAD  360
            Q+Q++ +
Sbjct  732  QVQESGN  738



>ref|XP_009397265.1| PREDICTED: probable receptor-like protein kinase At5g61350 [Musa 
acuminata subsp. malaccensis]
Length=868

 Score =   182 bits (461),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR+A+ P LPR +V+LAE
Sbjct  696  THVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARSAINPALPREQVNLAE  755

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W  + +  G + +I+DP+L G I+   L +YVE A  CL D G+DRP+M DV+W LE+AL
Sbjct  756  WAMQCHRKGQLEKIIDPHLVGTISPASLKKYVEAAEKCLADHGVDRPSMGDVLWNLEYAL  815

Query  380  QLQDAADKRGG  348
            QLQDA  +  G
Sbjct  816  QLQDAVMEHPG  826



>ref|XP_010099327.1| Receptor-like protein kinase FERONIA [Morus notabilis]
 gb|EXB77673.1| Receptor-like protein kinase FERONIA [Morus notabilis]
Length=950

 Score =   182 bits (462),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 134/214 (63%), Gaps = 14/214 (7%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGS GY+DPEYYRR+Q++EKSDVYSFGVVL EVLC R  ++ N  + +VSLAE
Sbjct  746  AHVSTVVKGSIGYLDPEYYRRQQLSEKSDVYSFGVVLCEVLCGRPPIMRNAEKRQVSLAE  805

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +  Y  G + +I+D NL  +I  ECL +Y EIA NC+ D GI+RP+MNDVVWGLEFA+
Sbjct  806  WAQHCYRNGTLHQIIDRNLTSKIVPECLKKYSEIAVNCMHDNGIERPSMNDVVWGLEFAM  865

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTS-----ENAEKL  216
            QLQ  A+           +R G  ++   G+ E A  ++ +  G FT +     E    +
Sbjct  866  QLQQNAEDN---------DRIGGAIMEAKGEDEVAFMNNNNSDGTFTYTWEESLELKSSV  916

Query  215  FRTKssatatstsddSLRGQSHTIFSELSNQLGR  114
                SS+   S + +S++  S  +FSE+ +  GR
Sbjct  917  MTKISSSEQGSITVESMKEMSGAVFSEIKDPKGR  950



>ref|XP_011095158.1| PREDICTED: receptor-like protein kinase FERONIA [Sesamum indicum]
Length=883

 Score =   182 bits (461),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYS+GVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  683  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSYGVVLFEILCARPALNPTLPKEQVSLAE  742

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +  ++ G + +I+DP LKG+IA EC  ++ E A  C+ D G DRP+M DV+W LEFAL
Sbjct  743  WAQHCHKKGILDQIIDPYLKGKIAPECFKKFAETAVKCVSDVGTDRPSMGDVLWNLEFAL  802

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  803  QLQESAEESG  812



>ref|XP_010678455.1| PREDICTED: probable receptor-like protein kinase At5g61350 [Beta 
vulgaris subsp. vulgaris]
Length=896

 Score =   182 bits (461),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVL EVL AR A+ P LPR++V+LAE
Sbjct  715  THVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEVLTARPAINPALPRDQVNLAE  774

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            WG  +Y  G++ +IVDPNL+G I+S  L +YVE A  CL + G+DRP+M DV+W LE+AL
Sbjct  775  WGMSNYRKGNLEKIVDPNLQGTISSGSLKKYVEAAEKCLAEYGVDRPSMGDVLWNLEYAL  834

Query  380  QLQDAADK  357
            QLQ+A+ K
Sbjct  835  QLQEASSK  842



>gb|KJB42940.1| hypothetical protein B456_007G175600 [Gossypium raimondii]
Length=891

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            SHVST VKGS GYVDPEYYR++Q+TEKSDVYSFGVVLFEVLCAR A+IP LP++++SLA 
Sbjct  678  SHVSTVVKGSVGYVDPEYYRKQQLTEKSDVYSFGVVLFEVLCARPAMIPGLPKDQISLAR  737

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +   + G +  IVDPNL G I+  CL ++ E+A +C+KD+GI+RP MN+VVWGLEFAL
Sbjct  738  WAKICLKRGSLESIVDPNLMGDISPLCLKKFGELAESCIKDEGIERPIMNEVVWGLEFAL  797

Query  380  QLQDAAD  360
            Q+Q++ +
Sbjct  798  QVQESGN  804



>ref|XP_011016728.1| PREDICTED: receptor-like protein kinase FERONIA [Populus euphratica]
Length=893

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  692  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  751

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    ++ G + +I+DP LKG+IA EC  ++ E A  C+ DQ IDRP+M DV+W LEFAL
Sbjct  752  WAAHCHKKGILDQILDPYLKGKIAPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFAL  811

Query  380  QLQDAAD  360
            QLQ++A+
Sbjct  812  QLQESAE  818



>ref|XP_004302537.1| PREDICTED: receptor-like protein kinase FERONIA [Fragaria vesca 
subsp. vesca]
Length=883

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  683  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  742

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    ++ G + +I+DP LKG+I  EC  ++ E A  C+ DQ IDRP+M DV+W LEFAL
Sbjct  743  WAAHCHKKGMLDQILDPYLKGKITPECFRKFAETAMKCVSDQSIDRPSMGDVLWNLEFAL  802

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  803  QLQESAEESG  812



>ref|XP_008370279.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=891

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  690  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  749

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    ++ G +  I+DP+LKG+I  EC  ++ E A  C+ DQ IDRP+M DV+W LEFAL
Sbjct  750  WAAHCHKKGILEHILDPHLKGKITPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFAL  809

Query  380  QLQDAA  363
            QLQ++A
Sbjct  810  QLQESA  815



>ref|XP_007032831.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03757.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=884

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            SHVST VKGS GYVDPEYYRR+Q+T+KSDVYSFGVVLFEVLCAR ++IP LP+++VSLA 
Sbjct  681  SHVSTVVKGSIGYVDPEYYRRQQLTQKSDVYSFGVVLFEVLCARPSMIPGLPKDQVSLAR  740

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W R  +  G + EI+DPNL G I   CL ++ E+A +C++D GI+RP M+DVVWGLEFAL
Sbjct  741  WARICHARGTLEEIMDPNLVGDITPLCLKKFGELAGSCIRDNGIERPMMSDVVWGLEFAL  800

Query  380  QLQDAADK  357
            Q+Q A  +
Sbjct  801  QIQGATGR  808



>gb|KCW52041.1| hypothetical protein EUGRSUZ_J01482 [Eucalyptus grandis]
Length=856

 Score =   181 bits (459),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 116/172 (67%), Gaps = 24/172 (14%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKG+FGY+DPEYYRR+++T+KSDVYSFGVVLFEVLCAR AV    P  ++SLAE
Sbjct  690  THVSTAVKGTFGYLDPEYYRRQRLTDKSDVYSFGVVLFEVLCARPAVSRMAPMEQISLAE  749

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +   ++G V E+VDP+LKG IA ECL ++ EIA +CL+D+G  RP+MNDVVWGL FAL
Sbjct  750  WAQSCCKSGSVEEMVDPHLKGAIALECLNKFCEIAMSCLQDEGAKRPSMNDVVWGLNFAL  809

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENA  225
            QLQ + +                         EA N SD D GG  ++ E A
Sbjct  810  QLQVSTEL------------------------EAINTSDSDSGGWKSSRETA  837



>ref|XP_006338349.1| PREDICTED: receptor-like protein kinase FERONIA-like [Solanum 
tuberosum]
Length=856

 Score =   181 bits (459),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 111/150 (74%), Gaps = 8/150 (5%)
 Frame = -2

Query  743  VSHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLA  564
            ++HVSTAVKGSFGYVDPEYY+R+++T KSDVYSFGVVLFEVLCAR A+ PNLP  +V+LA
Sbjct  666  ITHVSTAVKGSFGYVDPEYYKRQRLTVKSDVYSFGVVLFEVLCARPAINPNLPSGQVNLA  725

Query  563  EWGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFA  384
            EW  RS +  ++ EI+DPNLKGQIA ECL ++ E+A +CL+ +G+ RP+M DVV  LE A
Sbjct  726  EWASRSCKKRELEEIIDPNLKGQIAPECLSKFAELAYHCLRKEGVQRPSMGDVVKTLESA  785

Query  383  LQLQDAADKRGGLSPPRTPERPGFPLLAKG  294
            LQ+Q+  D           E   FPL+  G
Sbjct  786  LQVQEGEDHE--------VEGSSFPLIING  807



>ref|XP_010034437.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
Length=917

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 120/178 (67%), Gaps = 7/178 (4%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKG+FGY+DPEY+R +++T+KSDVYSFGVVLFEVLCAR AV    P  ++SLAE
Sbjct  717  THVSTAVKGTFGYLDPEYFRHQRLTDKSDVYSFGVVLFEVLCARPAVSRMAPMEQISLAE  776

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +   ++G V EIVDP+LKG I  ECL ++ EIA +CL+D+G  RP+MNDVVWGL FAL
Sbjct  777  WAQSCCKSGAVEEIVDPHLKGSITPECLNKFCEIAMSCLQDKGAKRPSMNDVVWGLNFAL  836

Query  380  QLQ-----DAADKRG-GLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENA  225
            QLQ     +  D  G  +      +     +   G D EA N SD D GG  ++ E A
Sbjct  837  QLQVSTELEVTDHVGVSVHDSNDSDHDAASIRGSGSD-EAINTSDSDSGGWKSSRETA  893



>ref|XP_007140079.1| hypothetical protein PHAVU_008G082400g [Phaseolus vulgaris]
 gb|ESW12073.1| hypothetical protein PHAVU_008G082400g [Phaseolus vulgaris]
Length=898

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P L + +VSLAE
Sbjct  696  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPALAKEQVSLAE  755

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y  G + +I+DP LKG+IA EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  756  WAAHCYLKGTLDQIIDPYLKGKIAPECFKKFAETAMKCVADQGIERPSMGDVLWNLEFAL  815

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  816  QLQESAEESG  825



>gb|EEC76216.1| hypothetical protein OsI_13615 [Oryza sativa Indica Group]
Length=809

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LPR++V+LAE
Sbjct  647  THVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPAINPTLPRDQVNLAE  706

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W R  +  G++++I+DP++ GQI  + L  + E A  CL D G+DRP+M DV+W LEFAL
Sbjct  707  WARTWHRKGELNKIIDPHISGQIRPDSLEIFAEAAEKCLADYGVDRPSMGDVLWKLEFAL  766

Query  380  QLQDAADKRGGLS  342
            QLQ+  D   G S
Sbjct  767  QLQEKGDIVDGTS  779



>ref|XP_009370899.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
 ref|XP_009370904.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
Length=892

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  690  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  749

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    ++ G +  I+DP+LKG+I  EC  ++ E A  C+ DQ IDRP+M DV+W LEFAL
Sbjct  750  WAAHCHKKGILEHILDPHLKGKITPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFAL  809

Query  380  QLQDAA  363
            QLQ++A
Sbjct  810  QLQESA  815



>ref|XP_010034435.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
Length=883

 Score =   181 bits (459),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 122/177 (69%), Gaps = 5/177 (3%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKG+FGY+DPEYYRR+++T+KSDVYSFGVVLFEVLCAR AV    P  ++SLAE
Sbjct  688  THVSTAVKGTFGYLDPEYYRRQRLTDKSDVYSFGVVLFEVLCARPAVSRMAPVEQISLAE  747

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +   ++G V E+VDP+LKG IA ECL ++ EIA +CL+D+G  RP+MNDVVWGL FAL
Sbjct  748  WAQSCCKSGSVEEMVDPHLKGAIALECLNRFCEIAMSCLQDEGAKRPSMNDVVWGLNFAL  807

Query  380  QLQDAAD----KRGGLSPPRTPERPGFPLLAKG-GDGEAANKSDEDYGGAFTTSENA  225
            QLQ + +       G+S   +          +G G  EA N SD D G   ++ E A
Sbjct  808  QLQVSTELEVKDHAGVSVHDSDGSDHDAASIRGSGSNEAINTSDSDSGRWKSSRETA  864



>ref|XP_002323088.2| kinase family protein [Populus trichocarpa]
 gb|EEF04849.2| kinase family protein [Populus trichocarpa]
Length=894

 Score =   181 bits (459),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  693  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  752

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    ++ G + +I+DP LKG+I  EC  ++ E A  C+ DQ IDRP+M DV+W LEFAL
Sbjct  753  WAAHCHKKGILDQILDPYLKGKITPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFAL  812

Query  380  QLQDAADKRG  351
            QLQ++A+  G
Sbjct  813  QLQESAEDGG  822



>ref|XP_006395027.1| hypothetical protein EUTSA_v10003639mg [Eutrema salsugineum]
 gb|ESQ32313.1| hypothetical protein EUTSA_v10003639mg [Eutrema salsugineum]
Length=858

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSL +W
Sbjct  678  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLGDW  737

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
                   G + EIVDPNLKG+I  ECL ++ + A  CL D G+DRP M DV+W LEFALQ
Sbjct  738  AMNCKRKGTLEEIVDPNLKGKINPECLKKFADTAEKCLSDSGLDRPTMGDVLWNLEFALQ  797

Query  377  LQDAAD  360
            LQ+ AD
Sbjct  798  LQETAD  803



>gb|KJB71481.1| hypothetical protein B456_011G124900 [Gossypium raimondii]
Length=742

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  540  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  599

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    ++ G + +I+DP LKG+I  EC  ++ E A  C+ D+GI+RP+M DV+W LEFAL
Sbjct  600  WAAHCHKKGILDQIMDPYLKGKITPECFKKFAETAMKCVADEGIERPSMGDVLWNLEFAL  659

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  660  QLQESAEESG  669



>ref|XP_010938035.1| PREDICTED: receptor-like protein kinase FERONIA [Elaeis guineensis]
Length=891

 Score =   181 bits (459),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LP+ +VSLAE
Sbjct  693  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLPKEQVSLAE  752

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +I+DP L+G IA +C  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  753  WALHCQKKGILDQIIDPYLRGNIAPQCFKKFAETAEKCVADQGIERPSMGDVLWNLEFAL  812

Query  380  QLQDAADKRGGL  345
            QLQ+ A++ G L
Sbjct  813  QLQEGAEENGSL  824



>ref|XP_008230912.1| PREDICTED: receptor-like protein kinase FERONIA [Prunus mume]
Length=914

 Score =   181 bits (459),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 141/213 (66%), Gaps = 17/213 (8%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +H+ST VKGSFGY+DPEYYRR Q+TEKSDVYSFGVVL EVLCAR A++  + + ++SLAE
Sbjct  715  THISTMVKGSFGYLDPEYYRRNQLTEKSDVYSFGVVLCEVLCARPALLRTVEKKQMSLAE  774

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +  +  G + +I+DP+LKG+I + CL ++VE+A +C+ D GI+RP+MNDVVWGLE+A+
Sbjct  775  WVKSCHRKGTLDQIIDPSLKGKIGNACLNKFVEMAISCMHDNGIERPSMNDVVWGLEYAM  834

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAE----KLF  213
            QL             R      F L  KG D E A  +D ++   FTTS + E       
Sbjct  835  QLHQ-----------REEREKDFDLENKGED-EVALMND-NHSTGFTTSRSWEGETLNSG  881

Query  212  RTKssatatstsddSLRGQSHTIFSELSNQLGR  114
             TK+S    ST+++S++G S  +FS +++  GR
Sbjct  882  LTKTSGEQNSTTNESIKGMSRIVFSGINDSDGR  914



>gb|KHN07117.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=857

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            SHVST VKGSFGY+DPEYY+R ++TEKSDVYSFGVVLFE+LCAR  +I N    +VSLA 
Sbjct  712  SHVSTNVKGSFGYLDPEYYKRNRLTEKSDVYSFGVVLFEILCARPPLIHNAETEQVSLAN  771

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W RR Y+ G +++IVDP+LKG IA EC  ++ EI  +CL + G+ RP++ND+VW LEFAL
Sbjct  772  WARRCYQNGTMAQIVDPSLKGTIAPECFEKFCEIGMSCLLEDGMHRPSINDIVWLLEFAL  831

Query  380  QLQDAADKR  354
            QLQ+ AD+R
Sbjct  832  QLQEDADQR  840



>ref|NP_001050022.1| Os03g0333200 [Oryza sativa Japonica Group]
 gb|ABF95782.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11936.1| Os03g0333200 [Oryza sativa Japonica Group]
 gb|EEE59005.1| hypothetical protein OsJ_10725 [Oryza sativa Japonica Group]
Length=893

 Score =   181 bits (459),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P L + +VSLAE
Sbjct  696  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPTLAKEEVSLAE  755

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +IVDP+LKG+IA +C  ++ E A  C+ DQGIDRP+M DV+W LEFAL
Sbjct  756  WALHCQKKGILDQIVDPHLKGKIAPQCFKKFAETAEKCVSDQGIDRPSMGDVLWNLEFAL  815

Query  380  QLQDAADKRGGL  345
            Q+Q++A++ G L
Sbjct  816  QMQESAEESGSL  827



>ref|XP_002463853.1| hypothetical protein SORBIDRAFT_01g007450 [Sorghum bicolor]
 gb|EER90851.1| hypothetical protein SORBIDRAFT_01g007450 [Sorghum bicolor]
Length=839

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LPR++V+LAE
Sbjct  678  THVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPAINPALPRDQVNLAE  737

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y  G++S+I+DP++ GQI  + L  + E A  CL D G+DRP+M DV+W LEFAL
Sbjct  738  WALTWYRKGELSKIIDPHIAGQIRPDSLEMFAEAAEKCLADYGVDRPSMGDVLWKLEFAL  797

Query  380  QLQDAADKRGGLS  342
            QLQ+  D   G S
Sbjct  798  QLQEKGDVVDGTS  810



>ref|XP_003633771.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=894

 Score =   181 bits (458),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVLFEVLCAR  +   + + +VSLA+
Sbjct  686  AHVSTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLFEVLCARPPLNQTVEKERVSLAQ  745

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y  G + +IVDP LKG+IA +CL ++ EIA +CL+DQGI+RP+M DVVWGL+FA+
Sbjct  746  WAPSCYRDGKLEQIVDPFLKGKIAPDCLQKFGEIAVSCLQDQGIERPSMTDVVWGLQFAM  805

Query  380  QLQDAADK  357
            QLQ++A++
Sbjct  806  QLQESAEQ  813



>ref|NP_001159308.1| uncharacterized protein LOC100304400 [Zea mays]
 gb|ACN25746.1| unknown [Zea mays]
Length=357

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYS+GVVLFEVLCAR A+ P+LPR +VSLA+
Sbjct  173  THVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSYGVVLFEVLCARPALNPSLPREQVSLAD  232

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
                    G + +I+DP LKG+IA +CL +Y E A  CL D G+DRP+M DV+W LEFAL
Sbjct  233  HALSCQRKGTLEDIIDPVLKGKIAPDCLKKYAETAEKCLCDHGVDRPSMGDVLWNLEFAL  292

Query  380  QLQDAADKRG  351
            Q+QD  +  G
Sbjct  293  QMQDTFENGG  302



>ref|NP_187120.1| receptor-like protein kinase ANXUR1 [Arabidopsis thaliana]
 sp|Q9SR05.1|ANX1_ARATH RecName: Full=Receptor-like protein kinase ANXUR1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF04910.1|AC011437_25 putative protein kinase [Arabidopsis thaliana]
 gb|AEE74120.1| receptor-like protein kinase ANXUR1 [Arabidopsis thaliana]
Length=850

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 119/173 (69%), Gaps = 7/173 (4%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSL +W
Sbjct  673  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLGDW  732

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
                   G++ +I+DPNLKG+I +ECL ++ + A  CL D G++RP M DV+W LEFALQ
Sbjct  733  AMNCKRKGNLEDIIDPNLKGKINAECLKKFADTAEKCLNDSGLERPTMGDVLWNLEFALQ  792

Query  377  LQDAADKRGGLSPPRTPERPGFPL-LAKGGDGEAANKSDEDYGGAFTTSENAE  222
            LQ+ AD     +  RTP   G    L +G  G A N +  D     ++ +N E
Sbjct  793  LQETADG----TRHRTPNNGGSSEDLGRG--GMAVNVAGRDDVSDLSSEDNTE  839



>emb|CDX78012.1| BnaA09g32070D [Brassica napus]
Length=851

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE LCAR A+ P L + +VSLAE
Sbjct  669  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAE  728

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +IVDP+LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  729  WAPYCYKKGMLDQIVDPHLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFAL  788

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  789  QLQESAEESG  798



>ref|XP_009385224.1| PREDICTED: receptor-like protein kinase ANXUR1 [Musa acuminata 
subsp. malaccensis]
Length=863

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            SHVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCARAA+ P+LPR +VSLA+
Sbjct  687  SHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARAALNPSLPREQVSLAD  746

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W  +  + G +++I+DP L+G+I  ECL ++ E A  CL D G+DRP+M +V+W LEFAL
Sbjct  747  WALQCQKRGVLADIIDPQLEGKIGRECLHKFAETAETCLLDHGVDRPSMGNVLWNLEFAL  806

Query  380  QLQDA  366
            QLQ++
Sbjct  807  QLQES  811



>emb|CDY05602.1| BnaC02g39350D [Brassica napus]
Length=854

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSL +W
Sbjct  672  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLGDW  731

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
                   G++ +I+DPNLKG+I +ECL ++ + A  CL D G+DRP+M DV+W LEFALQ
Sbjct  732  ALNCKRKGNLDDIIDPNLKGKINAECLKKFADTAEKCLSDSGLDRPSMGDVLWNLEFALQ  791

Query  377  LQDAAD  360
            +Q+ AD
Sbjct  792  VQETAD  797



>ref|XP_010660596.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=895

 Score =   181 bits (458),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVLFEVLCAR  +   + + +VSLA+
Sbjct  687  AHVSTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLFEVLCARPPLNQTVEKERVSLAQ  746

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y  G + +IVDP LKG+IA +CL ++ EIA +CL+DQGI+RP+M+DVVWGL+FA+
Sbjct  747  WAPACYRDGKLEQIVDPFLKGKIAPDCLQKFGEIAVSCLQDQGIERPSMSDVVWGLQFAM  806

Query  380  QLQDAADK  357
            QLQ++A++
Sbjct  807  QLQESAEQ  814



>emb|CDP06378.1| unnamed protein product [Coffea canephora]
Length=889

 Score =   180 bits (457),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  684  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPALPKEQVSLAE  743

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +++DP LKG+IA+EC  +  E A  C+ D G DRP+M DV+W LEFAL
Sbjct  744  WALHCYKKGILDQVMDPYLKGKIAAECFKKIAETAVKCVADVGTDRPSMGDVLWNLEFAL  803

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  804  QLQESAEESG  813



>gb|AAK63934.1|AC084282_15 putative protein kinase [Oryza sativa Japonica Group]
Length=843

 Score =   180 bits (456),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LPR++V+LAE
Sbjct  681  THVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPAINPTLPRDQVNLAE  740

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W R  +  G++++I+DP++ GQI  + L  + E A  CL D G+DRP+M DV+W LEFAL
Sbjct  741  WARTWHRKGELNKIIDPHISGQIRPDSLEIFAEAAEKCLADYGVDRPSMGDVLWKLEFAL  800

Query  380  QLQDAADKRGGLS  342
            QLQ+  D   G S
Sbjct  801  QLQEKGDIVDGTS  813



>ref|XP_009129817.1| PREDICTED: receptor-like protein kinase ANXUR2 [Brassica rapa]
Length=854

 Score =   180 bits (456),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSL +W
Sbjct  672  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLGDW  731

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
                   G++ +I+DPNLKG+I +ECL ++ + A  CL D G+DRP+M DV+W LEFALQ
Sbjct  732  ALNCKRKGNLDDIIDPNLKGKINAECLKKFADTAEKCLSDSGLDRPSMGDVLWNLEFALQ  791

Query  377  LQDAAD  360
            +Q+ AD
Sbjct  792  VQETAD  797



>gb|KHN07112.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=819

 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            SHVST VKGSFGY+DPEYY+R ++TEKSDVYSFGVVLFE+LCAR  +I N    +VSLA 
Sbjct  674  SHVSTNVKGSFGYLDPEYYKRYRLTEKSDVYSFGVVLFEILCARPPLIHNAETEQVSLAN  733

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W RR Y+ G +++IVDP+LKG IA EC  ++ EI  +CL + G+ RP++ND+VW LEFAL
Sbjct  734  WARRCYQNGTMAQIVDPSLKGTIAPECFEKFCEIGMSCLLEDGMHRPSINDIVWLLEFAL  793

Query  380  QLQDAADKR  354
            QLQ+ AD+R
Sbjct  794  QLQEDADQR  802



>emb|CDY33885.1| BnaA02g31020D [Brassica napus]
Length=841

 Score =   180 bits (456),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P+LP+ +VSL +W
Sbjct  659  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLGDW  718

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
                   G++ +I+DPNLKG+I +ECL ++ + A  CL D G+DRP+M DV+W LEFALQ
Sbjct  719  ALNCKRKGNLDDIIDPNLKGKINAECLKKFADTAEKCLSDSGLDRPSMGDVLWNLEFALQ  778

Query  377  LQDAAD  360
            +Q+ AD
Sbjct  779  VQETAD  784



>ref|XP_007140062.1| hypothetical protein PHAVU_008G081000g [Phaseolus vulgaris]
 gb|ESW12056.1| hypothetical protein PHAVU_008G081000g [Phaseolus vulgaris]
Length=899

 Score =   180 bits (457),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P L + +VSLAE
Sbjct  697  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPALAKEQVSLAE  756

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y  G + +++DP LKG+IA EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  757  WAAHCYLKGTLDQLIDPYLKGKIAPECFKKFAETAMKCVADQGIERPSMGDVLWNLEFAL  816

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  817  QLQESAEESG  826



>gb|ABF98993.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EEE59968.1| hypothetical protein OsJ_12665 [Oryza sativa Japonica Group]
Length=892

 Score =   180 bits (457),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LPR++V+LAE
Sbjct  730  THVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPAINPTLPRDQVNLAE  789

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W R  +  G++++I+DP++ GQI  + L  + E A  CL D G+DRP+M DV+W LEFAL
Sbjct  790  WARTWHRKGELNKIIDPHISGQIRPDSLEIFAEAAEKCLADYGVDRPSMGDVLWKLEFAL  849

Query  380  QLQDAADKRGGLS  342
            QLQ+  D   G S
Sbjct  850  QLQEKGDIVDGTS  862



>ref|NP_001044372.1| Os01g0769700 [Oryza sativa Japonica Group]
 dbj|BAB56062.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAD53342.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF06286.1| Os01g0769700 [Oryza sativa Japonica Group]
 gb|EEE55446.1| hypothetical protein OsJ_03602 [Oryza sativa Japonica Group]
Length=896

 Score =   180 bits (457),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 112/149 (75%), Gaps = 2/149 (1%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P L + +VSLAE
Sbjct  699  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLAKEEVSLAE  758

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +IVDP+LKG+IA +C  ++ E A  C+ D+GIDRP+M DV+W LEFAL
Sbjct  759  WALHCQKKGILDQIVDPHLKGKIAPQCFKKFAETAEKCVSDEGIDRPSMGDVLWNLEFAL  818

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKG  294
            Q+Q++A+  G +    + E  G PL+  G
Sbjct  819  QMQESAEDSGSIGCGMSDE--GTPLVMPG  845



>ref|XP_011001679.1| PREDICTED: receptor-like protein kinase FERONIA [Populus euphratica]
Length=894

 Score =   180 bits (457),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  693  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  752

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    ++ G + +I+DP LKG+I  EC  ++ E A  C+ DQ IDRP+M DV+W LEFAL
Sbjct  753  WAAHCHKKGILDQILDPYLKGKITPECFKKFAETAMKCVSDQSIDRPSMGDVLWNLEFAL  812

Query  380  QLQDAAD  360
            QLQ++A+
Sbjct  813  QLQESAE  819



>ref|XP_010099328.1| Receptor-like protein kinase FERONIA [Morus notabilis]
 gb|EXB77674.1| Receptor-like protein kinase FERONIA [Morus notabilis]
Length=867

 Score =   180 bits (456),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 134/216 (62%), Gaps = 16/216 (7%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGS GY+DPEYYRR+Q++EKSDVYSFGVVL EVLC R  ++ N  + +VSL+E
Sbjct  661  AHVSTVVKGSIGYLDPEYYRRQQLSEKSDVYSFGVVLCEVLCGRPPIMRNARKGEVSLSE  720

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +  Y    + +I+D NL G+IA ECL +Y EI   C+ D G +RP+MNDVVWGLEFA+
Sbjct  721  WAQHCYHNRTLHQIIDRNLTGKIAPECLKKYSEIVVTCMHDNGTERPSMNDVVWGLEFAM  780

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAA--NKSDEDYGGAFTTSENAEKLFRT  207
            QLQ  A+   G+         G  ++   G+ E A  N ++  + G FT S       R+
Sbjct  781  QLQQNAEDNDGI---------GGAIMEANGEDEVAFFNNNNSSWDGTFTCSWEESLGLRS  831

Query  206  Kssatat-----stsddSLRGQSHTIFSELSNQLGR  114
                  +     ST+D+S++G S  +FSE+ +  GR
Sbjct  832  SGMTKISSSEQGSTTDESMKGMSGAVFSEIKDSKGR  867



>ref|XP_011021061.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA, partial [Populus euphratica]
Length=834

 Score =   179 bits (455),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST V+GS GYVDPEYYRR+ +TEKSDVYSF VVLFEVLCAR  VIP+LP++  SLA+
Sbjct  693  THVSTVVRGSIGYVDPEYYRRQHLTEKSDVYSFAVVLFEVLCARPPVIPSLPKDLSSLAD  752

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W R+ Y+ G + +IVDP+LKG+++   L ++ EIA +CL  QGI RP M DVVWGLEFAL
Sbjct  753  WARKCYQRGTLDQIVDPHLKGEVSPVSLNKFAEIANSCLHGQGIVRPKMGDVVWGLEFAL  812

Query  380  QLQDAADKRGG  348
            QLQ  A+K   
Sbjct  813  QLQQTAEKNAN  823



>ref|XP_010421701.1| PREDICTED: receptor-like protein kinase ANXUR2 [Camelina sativa]
Length=858

 Score =   180 bits (456),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 116/174 (67%), Gaps = 7/174 (4%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSL +W
Sbjct  677  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLPKEQVSLGDW  736

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
                   G + +I+DPNLKG+I  ECL ++ + A  CL D G+DRP M DV+W LEFALQ
Sbjct  737  AMNCKRKGTLEDIIDPNLKGKINPECLKKFADTAEKCLSDSGLDRPTMGDVLWNLEFALQ  796

Query  377  LQDAADKRGGLSPPRTPERPGFPL-LAKGGDGEAANKSDE--DYGGAFTTSENA  225
            LQ+ AD        RTP   G      +GG   A N + E  D     ++ EN+
Sbjct  797  LQETADGPRN----RTPSHGGGSADFGRGGGAVALNVAIEENDVADDLSSQENS  846



>ref|XP_009416326.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416327.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=882

 Score =   180 bits (456),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LP+ +VSLAE
Sbjct  685  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLPKEQVSLAE  744

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +I+DP LKG+IA +CL ++ E A  C+ D G +RP+M DV+W LEFAL
Sbjct  745  WAAHCQKKGILDQIIDPYLKGKIAPQCLKKFAETAEKCVADVGTERPSMGDVLWNLEFAL  804

Query  380  QLQDAADKRGGLS  342
            QLQ++A++ G +S
Sbjct  805  QLQESAEESGSIS  817



>ref|XP_009115840.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
 ref|XP_009115841.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
Length=895

 Score =   180 bits (456),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE LCAR A+ P L + +VSLAE
Sbjct  691  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAE  750

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +IVDP+LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  751  WAPYCYKKGMLDQIVDPHLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFAL  810

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  811  QLQESAEESG  820



>ref|XP_002308259.1| kinase family protein [Populus trichocarpa]
 gb|EEE91782.1| kinase family protein [Populus trichocarpa]
Length=893

 Score =   180 bits (456),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  692  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  751

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    ++ G + +I+DP LKG+IA EC  ++ E A  C+ D+ IDRP+M DV+W LEFAL
Sbjct  752  WAAHCHKKGILDQILDPYLKGKIAPECFKKFAETAMKCVSDESIDRPSMGDVLWNLEFAL  811

Query  380  QLQDAAD  360
            QLQ++A+
Sbjct  812  QLQESAE  818



>ref|XP_007032827.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03753.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=866

 Score =   180 bits (456),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 111/165 (67%), Gaps = 10/165 (6%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEYY R+Q+TEKSDVYSFGVVLFE LCAR  VI NLP+ +VSLA 
Sbjct  668  THVSTVVKGSFGYLDPEYYLRQQLTEKSDVYSFGVVLFEALCARPPVIQNLPKQQVSLAN  727

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            WGR   + G + +I+DP L G+IA ECL ++ EIA +C+ D+ I+RP M+DVVW LEFA 
Sbjct  728  WGRICCQRGTLDQIIDPYLTGEIAPECLKKFGEIAKSCVSDKAIERPTMSDVVWSLEFAS  787

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGA  246
            QLQD  +K             G   + K    E  +  DE + G+
Sbjct  788  QLQDTTEKTND----------GMKKVQKSEGKEVVSTDDEIFSGS  822



>gb|ABT18100.1| FERONIA receptor-like kinase [Arabidopsis thaliana]
Length=893

 Score =   180 bits (456),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P L + +VSLAE
Sbjct  690  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAE  749

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  750  WAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFAL  809

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  810  QLQESAEENG  819



>gb|KJB71482.1| hypothetical protein B456_011G124900 [Gossypium raimondii]
Length=893

 Score =   180 bits (456),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  691  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  750

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    ++ G + +I+DP LKG+I  EC  ++ E A  C+ D+GI+RP+M DV+W LEFAL
Sbjct  751  WAAHCHKKGILDQIMDPYLKGKITPECFKKFAETAMKCVADEGIERPSMGDVLWNLEFAL  810

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  811  QLQESAEESG  820



>ref|XP_009412649.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412650.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=889

 Score =   180 bits (456),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLAE
Sbjct  693  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLPKEQVSLAE  752

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +I+DP LKG+IA++C  ++ E A  C+ D G +RP+M DV+W LEFAL
Sbjct  753  WAVHCQKKGTLDQIMDPYLKGKIAAQCFKKFAETAKKCVADAGTERPSMGDVLWNLEFAL  812

Query  380  QLQDAADKRGGL  345
            QLQ++A++ G L
Sbjct  813  QLQESAEENGSL  824



>ref|NP_190723.1| receptor-like protein kinase FERONIA [Arabidopsis thaliana]
 sp|Q9SCZ4.1|FERON_ARATH RecName: Full=Receptor-like protein kinase FERONIA; AltName: 
Full=Protein SIRENE; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB63019.1| receptor-protein kinase-like protein [Arabidopsis thaliana]
 gb|AEE78805.1| receptor-like protein kinase FERONIA [Arabidopsis thaliana]
Length=895

 Score =   180 bits (456),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P L + +VSLAE
Sbjct  692  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAE  751

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  752  WAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFAL  811

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  812  QLQESAEENG  821



>ref|XP_010503851.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=895

 Score =   180 bits (456),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P L + +VSLAE
Sbjct  692  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAE  751

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  752  WAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFAL  811

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  812  QLQESAEESG  821



>gb|AAK59558.1| putative receptor-protein kinase [Arabidopsis thaliana]
Length=895

 Score =   180 bits (456),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P L + +VSLAE
Sbjct  692  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAE  751

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  752  WAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFAL  811

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  812  QLQESAEENG  821



>emb|CDO98765.1| unnamed protein product [Coffea canephora]
Length=859

 Score =   179 bits (455),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 110/158 (70%), Gaps = 12/158 (8%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLC R A+ PNLP+ +VSLA+
Sbjct  682  THVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCGRPALDPNLPKEQVSLAD  741

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W  R +  G + +I+DP +KG++A ECL  + E A  CL DQGIDRP+M  V+W LE+ L
Sbjct  742  WALRCHSRGVLDDIIDPCIKGEMAPECLKHFAETAAKCLSDQGIDRPSMGAVLWNLEYCL  801

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKS  267
            QLQ+             P+ P F +  K  D  A +++
Sbjct  802  QLQN------------NPDGPEFVVQQKANDAYAMHET  827



>ref|XP_010032549.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 gb|KCW51941.1| hypothetical protein EUGRSUZ_J01388 [Eucalyptus grandis]
Length=910

 Score =   180 bits (456),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKG+FGY+DPEYYRR+Q+T+KSDVYSFGVVLFEVLCAR AV     + ++SLA 
Sbjct  695  AHVSTVVKGTFGYLDPEYYRRQQLTDKSDVYSFGVVLFEVLCARPAVNRTAQKKQISLAA  754

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +   ++G + +IVDP+LKG IA ECL ++ EIA +CL+D+G  RP+MNDVVWGLEFAL
Sbjct  755  WAQSCCKSGSIDKIVDPHLKGAIAPECLNKFCEIAMSCLQDEGTKRPSMNDVVWGLEFAL  814

Query  380  QLQDAADKR  354
            QLQ ++++R
Sbjct  815  QLQVSSEQR  823



>gb|EAY97521.1| hypothetical protein OsI_19449 [Oryza sativa Indica Group]
Length=859

 Score =   179 bits (455),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLA+
Sbjct  663  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARNALSPSLPKEQVSLAD  722

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W  R  + G + EI+DP LKG+IA +C +++ E A  C+ D+ +DRP+M DV+W LEFAL
Sbjct  723  WALRCQKKGVLGEIIDPLLKGKIAPQCFLKFAETAEKCVADRSVDRPSMGDVLWNLEFAL  782

Query  380  QLQDAADKRGGLS  342
            QLQ++ +    L+
Sbjct  783  QLQESTEDSSSLT  795



>ref|XP_008810848.1| PREDICTED: receptor-like protein kinase FERONIA [Phoenix dactylifera]
Length=891

 Score =   180 bits (456),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P LP+ +VSLAE
Sbjct  693  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPTLPKEQVSLAE  752

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +I+DP LKG+IA  C  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  753  WALHCQKKGILDQIIDPYLKGKIAPPCFKKFAETAEKCVADQGIERPSMGDVLWNLEFAL  812

Query  380  QLQDAADKRGGL  345
            QLQ+ A++ G L
Sbjct  813  QLQEGAEESGSL  824



>gb|EEE63237.1| hypothetical protein OsJ_18047 [Oryza sativa Japonica Group]
Length=859

 Score =   179 bits (455),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLA+
Sbjct  663  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARNALSPSLPKEQVSLAD  722

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W  R  + G + EI+DP LKG+IA +C +++ E A  C+ D+ +DRP+M DV+W LEFAL
Sbjct  723  WALRCQKKGVLGEIIDPLLKGKIAPQCFLKFAETAEKCVADRSVDRPSMGDVLWNLEFAL  782

Query  380  QLQDAADKRGGLS  342
            QLQ++ +    L+
Sbjct  783  QLQESTEDSSSLT  795



>ref|XP_010426729.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=894

 Score =   180 bits (456),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P L + +VSLAE
Sbjct  691  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAE  750

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  751  WAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFAL  810

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  811  QLQESAEESG  820



>ref|XP_009385155.1| PREDICTED: receptor-like protein kinase ANXUR2 [Musa acuminata 
subsp. malaccensis]
Length=852

 Score =   179 bits (455),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 107/141 (76%), Gaps = 1/141 (1%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ PNLPR +VSLA+
Sbjct  680  THVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPNLPREQVSLAD  739

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     +   +++IVDP L+G+I  ECL ++ E A  CL D G+DRP+M DV+W LEFAL
Sbjct  740  WALHCQKKAVLADIVDPLLEGKIGPECLKKFAETAEKCLLDHGVDRPSMGDVLWNLEFAL  799

Query  380  QLQDAADKRGGLSPPRTPERP  318
            QLQ++ +  G      T ERP
Sbjct  800  QLQESFES-GKPVTEETTERP  819



>gb|EYU42039.1| hypothetical protein MIMGU_mgv1a001343mg [Erythranthe guttata]
Length=837

 Score =   179 bits (454),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYS+GVVLFE++CAR A+ P LP+ +VSLAE
Sbjct  635  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSYGVVLFEIICARPALNPTLPKEQVSLAE  694

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +  ++ G + +++DP LKG+IA EC  ++ E A  C+ D G DRP+M DV+W LEFAL
Sbjct  695  WAQHCHKKGILEQMMDPYLKGKIAPECFKKFAETAVKCVSDVGTDRPSMGDVLWNLEFAL  754

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  755  QLQESAEESG  764



>ref|XP_010515573.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=896

 Score =   180 bits (456),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P L + +VSLAE
Sbjct  693  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAE  752

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  753  WAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFAL  812

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  813  QLQESAEESG  822



>ref|XP_006403905.1| hypothetical protein EUTSA_v10010114mg [Eutrema salsugineum]
 gb|ESQ45358.1| hypothetical protein EUTSA_v10010114mg [Eutrema salsugineum]
Length=891

 Score =   179 bits (455),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P L + +VSLAE
Sbjct  691  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAE  750

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  751  WAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFAL  810

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  811  QLQESAEESG  820



>ref|XP_002877809.1| hypothetical protein ARALYDRAFT_485507 [Arabidopsis lyrata subsp. 
lyrata]
 gb|ABT18096.1| FERONIA receptor-like kinase [Arabidopsis lyrata]
 gb|EFH54068.1| hypothetical protein ARALYDRAFT_485507 [Arabidopsis lyrata subsp. 
lyrata]
Length=891

 Score =   179 bits (455),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P L + +VSLAE
Sbjct  688  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAE  747

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  748  WAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFAL  807

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  808  QLQESAEESG  817



>gb|ABT18099.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=898

 Score =   180 bits (456),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P L + +VSLAE
Sbjct  695  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAE  754

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  755  WAPYCYKKGMLDQIVDPYLKGKITPECFKKFSETAMKCVLDQGIERPSMGDVLWNLEFAL  814

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  815  QLQESAEENG  824



>ref|XP_004981691.1| PREDICTED: probable receptor-like protein kinase At5g61350-like 
[Setaria italica]
Length=847

 Score =   179 bits (454),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LPR++V+LAE
Sbjct  686  THVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPAINPALPRDQVNLAE  745

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y  G++++I+DP++ GQI  + L  + E A  CL D G+DRP+M DV+W LEFAL
Sbjct  746  WALTWYRKGELNKIIDPHIAGQIRPDSLEMFAEAAEKCLADYGVDRPSMGDVLWKLEFAL  805

Query  380  QLQDAADKRGGLS  342
            QLQ+  D   G S
Sbjct  806  QLQEKGDVVDGTS  818



>emb|CBI21198.3| unnamed protein product [Vitis vinifera]
Length=932

 Score =   180 bits (456),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVLFEVLCAR  +   + + +VSLA+
Sbjct  715  AHVSTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLFEVLCARPPLNQTVEKERVSLAQ  774

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y  G + +IVDP LKG+IA +CL ++ EIA +CL+DQGI+RP+M+DVVWGL+FA+
Sbjct  775  WAPACYRDGKLEQIVDPFLKGKIAPDCLQKFGEIAVSCLQDQGIERPSMSDVVWGLQFAM  834

Query  380  QLQDAADK  357
            QLQ++A++
Sbjct  835  QLQESAEQ  842



>ref|XP_010229562.1| PREDICTED: probable receptor-like protein kinase At5g61350 [Brachypodium 
distachyon]
Length=847

 Score =   179 bits (454),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LPR++V+LAE
Sbjct  685  THVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPAINPALPRDQVNLAE  744

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W R  +  G++++I+DP++ GQI  + L  + E A  CL D G+DRP+M DV+W LEFAL
Sbjct  745  WARSWHRKGELNKIIDPHIAGQIRPDSLEMFAEAAEKCLADYGVDRPSMGDVLWKLEFAL  804

Query  380  QLQDAAD  360
            QLQ+  D
Sbjct  805  QLQEKGD  811



>emb|CDY33271.1| BnaA01g19380D [Brassica napus]
Length=856

 Score =   179 bits (454),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE LCAR A+ P L + +VSLAE
Sbjct  666  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAE  725

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +IVDP+LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  726  WAPYCYKKGMLDQIVDPHLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFAL  785

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  786  QLQESAEESG  795



>ref|XP_009383157.1| PREDICTED: probable receptor-like protein kinase At5g61350 [Musa 
acuminata subsp. malaccensis]
Length=872

 Score =   179 bits (455),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 110/151 (73%), Gaps = 9/151 (6%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LPR +V+LAE
Sbjct  700  THVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPALPREQVNLAE  759

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W  + +  G + +I+DP+L G I+S  L +YVE A  CL + G+DRP+M DV+W LE+AL
Sbjct  760  WAMQWHRKGQLEKIIDPHLVGTISSASLKKYVEAAEKCLAEHGVDRPSMGDVLWNLEYAL  819

Query  380  QLQDA---------ADKRGGLSPPRTPERPG  315
            QLQ+A         A+K     P  +P R G
Sbjct  820  QLQEASMGQPSDDPAEKSAANIPLESPARNG  850



>ref|XP_009136619.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
Length=896

 Score =   179 bits (455),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE LCAR A+ P L + +VSLAE
Sbjct  691  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAE  750

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +IVDP+LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  751  WAPYCYKKGMLDQIVDPHLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFAL  810

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  811  QLQESAEESG  820



>ref|XP_010032628.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 gb|KCW52053.1| hypothetical protein EUGRSUZ_J01493 [Eucalyptus grandis]
Length=885

 Score =   179 bits (455),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 120/169 (71%), Gaps = 5/169 (3%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKG+FGY+DPEYYRR+++T+KSDVYSFGVVLFEVLCAR AV    P  ++SLAE
Sbjct  686  THVSTAVKGTFGYLDPEYYRRQRLTDKSDVYSFGVVLFEVLCARPAVSRMAPMEQISLAE  745

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +   ++G + E+VDP+LKG I  ECL ++ EIA +CL+D+G  RP+MNDVVWGL+FAL
Sbjct  746  WAQSCCKSGAIEEMVDPHLKGSIVPECLNKFCEIAMSCLQDEGTKRPSMNDVVWGLKFAL  805

Query  380  QLQDAAD----KRGGLSPPRTPERPGFPLLAKGGDGEAA-NKSDEDYGG  249
            QLQ + +       G+S   + +        +G D + A + SD D GG
Sbjct  806  QLQVSTELEVTDHMGVSVHNSDDNNHDVAPIRGNDSDGAFSTSDSDSGG  854



>ref|XP_007151348.1| hypothetical protein PHAVU_004G038800g [Phaseolus vulgaris]
 gb|ESW23342.1| hypothetical protein PHAVU_004G038800g [Phaseolus vulgaris]
Length=891

 Score =   179 bits (455),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGS GY+DPEYY+R+++TEKSDVYSFGVVLFE+LCAR  +I    + +V LAE
Sbjct  689  AHVSTVVKGSMGYLDPEYYKRQRLTEKSDVYSFGVVLFELLCARPPLIRTAEKKQVLLAE  748

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W R  Y+ G +++IVDP LKG+IA+ECL ++ EI  +CL D G  RP+MNDVVW LEFAL
Sbjct  749  WARHCYQNGTIAQIVDPALKGRIAAECLKKFCEIGVSCLLDDGTQRPSMNDVVWMLEFAL  808

Query  380  QLQDAADKR  354
            QLQ++A++R
Sbjct  809  QLQESAEQR  817



>emb|CDY16299.1| BnaC01g23340D [Brassica napus]
Length=866

 Score =   179 bits (454),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE LCAR A+ P L + +VSLAE
Sbjct  675  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAE  734

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +IVDP+LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  735  WAPYCYKKGMLDQIVDPHLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFAL  794

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  795  QLQESAEESG  804



>gb|ABT18098.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=892

 Score =   179 bits (455),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P L + +VSLAE
Sbjct  689  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAE  748

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  749  WAPYCYKKGMLDQIVDPYLKGKITPECFKKFSETAMKCVLDQGIERPSMGDVLWNLEFAL  808

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  809  QLQESAEENG  818



>gb|ABT18094.1| FERONIA receptor-like kinase [Brassica oleracea]
Length=895

 Score =   179 bits (454),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE LCAR A+ P L + +VSLAE
Sbjct  690  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAE  749

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +IVDP+LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  750  WAPYCYKKGMLDQIVDPHLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFAL  809

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  810  QLQESAEESG  819



>ref|XP_010230703.1| PREDICTED: receptor-like protein kinase ANXUR1 [Brachypodium 
distachyon]
Length=1610

 Score =   181 bits (459),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 116/168 (69%), Gaps = 0/168 (0%)
 Frame = -2

Query  740   SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
             +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVL AR A+ P LPR++VSLA+
Sbjct  1413  AHVSTMVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLMARPALNPALPRDQVSLAD  1472

Query  560   WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
             +       G ++++VDP +K QIA ECLI++ E A  CL DQG DRP+M DV+W LEFA+
Sbjct  1473  YALSCQRKGTLADVVDPTIKNQIAPECLIKFAETAEKCLADQGTDRPSMGDVLWNLEFAM  1532

Query  380   QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTT  237
             QLQD  D R G    R  +  G P + +  +   +  S    G + T+
Sbjct  1533  QLQDTFDGRSGRPQGRDDDGSGRPAVLEPSNSYGSTASVTTIGTSSTS  1580


 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 75/145 (52%), Gaps = 6/145 (4%)
 Frame = -2

Query  743  VSHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLA  564
            ++++ST V G+FGYV PEY     +  KSDVYS+GVVL E+L  R  V  +    + +L 
Sbjct  561  LNYLSTRVMGTFGYVAPEYAMTGHLIVKSDVYSYGVVLLELLTGRRPVDMSQSSGQENLV  620

Query  563  EWGRRSYETGD-VSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEF  387
             W R      D + E+ DP L GQ   +  ++   IA  C+  +   RP M +VV  L+ 
Sbjct  621  TWTRPVLRDKDRLQELADPRLGGQYPKDDFVRVCTIAAACVSPEANQRPTMGEVVQSLKM  680

Query  386  ALQLQDAADKRGGLSPPRTPERPGF  312
               +Q +A+ +  +  P  P RP  
Sbjct  681  ---VQRSAEFQESI--PTPPARPNI  700



>gb|EEC75192.1| hypothetical protein OsI_11431 [Oryza sativa Indica Group]
Length=893

 Score =   179 bits (454),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 112/149 (75%), Gaps = 2/149 (1%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P L + +VSLAE
Sbjct  696  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPTLAKEEVSLAE  755

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +IVDP+LKG+IA +C  ++ E A  C+ D+GIDRP+M DV+W LEFAL
Sbjct  756  WALHCQKKGILDQIVDPHLKGKIAPQCFKKFAETAEKCVSDEGIDRPSMGDVLWNLEFAL  815

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKG  294
            Q+Q++A+  G +    + E  G PL+  G
Sbjct  816  QMQESAEDSGSIGCGMSDE--GTPLVMPG  842



>ref|XP_010519979.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
ANXUR2 [Tarenaya hassleriana]
Length=860

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 120/180 (67%), Gaps = 9/180 (5%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE+LCAR A+ PNL + +VSLA+W
Sbjct  676  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPNLSKEQVSLADW  735

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
                 + G + +I+DPNLKG+I  ECL ++ + A  CL D G++RP M DV+W LEFALQ
Sbjct  736  ALNCKKKGTLEDIIDPNLKGKINPECLRKFADTAEKCLSDSGVERPTMGDVLWNLEFALQ  795

Query  377  LQDAADKRGGLSPPRTPERPGFPLLAKGGDGEA-----ANKSDEDYGGAFTTSENAEKLF  213
            LQ+ +D     S  R P + G      GG   A     AN   ED+  +  +S++   +F
Sbjct  796  LQETSDG----SHHRKPSQGGGSDEFAGGGAVAVHVAGANNRSEDHDVSDQSSDDNSGIF  851



>ref|XP_002272797.2| PREDICTED: receptor-like protein kinase ANXUR1 [Vitis vinifera]
 emb|CBI22880.3| unnamed protein product [Vitis vinifera]
Length=857

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P+LP+ +VSLA+
Sbjct  680  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPSLPKEQVSLAD  739

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W  +  + G + EI+DP+LKG I  ECL+++ E A  CL D G++RP+M DV+W LEFAL
Sbjct  740  WALQCQKKGILEEIIDPHLKGNITPECLMKFAETAEKCLSDHGLERPSMGDVLWNLEFAL  799

Query  380  QLQD  369
            QLQ+
Sbjct  800  QLQE  803



>ref|XP_011071382.1| PREDICTED: receptor-like protein kinase ANXUR1 [Sesamum indicum]
Length=871

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 116/174 (67%), Gaps = 18/174 (10%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLC R A+ PNLP+++VSLA+
Sbjct  696  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCGRPALNPNLPKDQVSLAD  755

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W   ++  G + EI+DPN+KG+I++ECL  + E A  CL D G DRP + +V+W LE+ L
Sbjct  756  WAMLNHRRGTLGEILDPNIKGEISAECLKHFSETAVKCLSDHGTDRPTIGEVLWNLEYCL  815

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEK  219
            QLQ   D              G  ++AK    + AN +  +YG   +  E  EK
Sbjct  816  QLQTNPD--------------GAKMVAK----QKANNACANYGTLLSIEEEKEK  851



>ref|XP_006290584.1| hypothetical protein CARUB_v10016673mg [Capsella rubella]
 gb|EOA23482.1| hypothetical protein CARUB_v10016673mg [Capsella rubella]
Length=892

 Score =   179 bits (454),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P L + +VSLAE
Sbjct  689  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLEKEQVSLAE  748

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  749  WAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFAL  808

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  809  QLQESAEESG  818



>emb|CDY29022.1| BnaC07g32280D [Brassica napus]
Length=803

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE LCAR A+ P L + +VSLAE
Sbjct  622  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAE  681

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +IVDP+LKG+I  EC  ++ E    C+ DQGI+RP+M DV+W LEFAL
Sbjct  682  WAPYCYKKGMLDQIVDPHLKGKITPECFKKFAETGMKCVLDQGIERPSMGDVLWNLEFAL  741

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  742  QLQESAEESG  751



>ref|XP_002990231.1| hypothetical protein SELMODRAFT_40963, partial [Selaginella moellendorffii]
 gb|EFJ08791.1| hypothetical protein SELMODRAFT_40963, partial [Selaginella moellendorffii]
Length=753

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LPR +V++AE
Sbjct  629  THVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPAINPALPREQVNIAE  688

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W  +    G + +IVD NLKGQ + E L ++ E A  CL +QGIDRPAM DV+W LE+AL
Sbjct  689  WAMQYQRMGALEQIVDANLKGQCSQESLQKFGETAEKCLAEQGIDRPAMGDVLWNLEYAL  748

Query  380  QLQDA  366
            QLQ+A
Sbjct  749  QLQEA  753



>ref|XP_002530995.1| kinase, putative [Ricinus communis]
 gb|EEF31383.1| kinase, putative [Ricinus communis]
Length=888

 Score =   179 bits (454),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST V+GSFGYVDPEYYRR+ +TEKSDVYSFGVVL EVLCAR  VIP LP+ +V+LA+
Sbjct  681  THVSTVVRGSFGYVDPEYYRRQHLTEKSDVYSFGVVLLEVLCARPPVIPGLPKEQVNLAD  740

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W R  Y  G +++I+DPNL G +A  CL+++ EIA +CL+DQGI RPAM+DVV+GL+  L
Sbjct  741  WARICYRRGALNQIIDPNLMGDVAPACLVKFGEIAESCLRDQGILRPAMSDVVFGLQLVL  800

Query  380  QLQDA  366
            QLQ++
Sbjct  801  QLQES  805



>emb|CDP17056.1| unnamed protein product [Coffea canephora]
Length=881

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P+LP+ +VSLA+W
Sbjct  689  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPSLPKEQVSLADW  748

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
                +  G + +IVDP +KG+I++ECL ++ E A  CL D G+DRP+M DV+W LE+ALQ
Sbjct  749  AMHCHRKGALEDIVDPQIKGEISAECLKKFAETAGKCLADHGVDRPSMGDVLWNLEYALQ  808

Query  377  LQDAAD  360
            LQ+  D
Sbjct  809  LQENPD  814



>gb|KCW45810.1| hypothetical protein EUGRSUZ_L00361 [Eucalyptus grandis]
Length=270

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVL EVLCAR  + P+LPR KV+LAE
Sbjct  87   THVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEVLCARPVIDPSLPREKVNLAE  146

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W  +  + G + +I+DP L G+I  + L ++ E A  CL D G+DRP+M DV+W LE+AL
Sbjct  147  WAMKWQKKGQLDQIIDPTLVGKIRPDSLRKFGETAEKCLADYGVDRPSMGDVLWNLEYAL  206

Query  380  QLQDAA  363
            QLQ+A 
Sbjct  207  QLQEAV  212



>emb|CDX90645.1| BnaA03g41360D [Brassica napus]
Length=814

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE LCAR A+ P L + +VSLAE
Sbjct  633  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAE  692

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  693  WAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFAL  752

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  753  QLQESAEESG  762



>ref|XP_008344811.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=357

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +H+ST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVL+EVLCAR A++  +   +++LAE
Sbjct  194  THISTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLWEVLCARPALLHTVESRQINLAE  253

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +  +    + +I+DPN+KGQI  ECL +++EIA +CL D+GI+RP+MNDVV GLEFAL
Sbjct  254  WAKSCHGDETLDQIIDPNVKGQIEVECLNKFIEIAISCLHDKGIERPSMNDVVKGLEFAL  313

Query  380  QLQDAA  363
            QL   +
Sbjct  314  QLHQKS  319



>gb|ABT18097.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=891

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 121/174 (70%), Gaps = 6/174 (3%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE LCAR A+ P L + +VSLAE
Sbjct  688  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAE  747

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  748  WAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFAL  807

Query  380  QLQDAADKRG-GLSPPRTPERPGFPLLAKGGDGEAANKSDED-YGGAFTTSENA  225
            QLQ++A++ G G+S     +   +      G+G+  N+   D Y G  T S ++
Sbjct  808  QLQESAEENGKGMSGDMDMDEIKY----NDGNGKGKNEMSSDVYEGNVTDSRSS  857



>gb|ABT18095.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=891

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 121/174 (70%), Gaps = 6/174 (3%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE LCAR A+ P L + +VSLAE
Sbjct  688  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAE  747

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +IVDP LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  748  WAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFAL  807

Query  380  QLQDAADKRG-GLSPPRTPERPGFPLLAKGGDGEAANKSDED-YGGAFTTSENA  225
            QLQ++A++ G G+S     +   +      G+G+  N+   D Y G  T S ++
Sbjct  808  QLQESAEENGKGMSGDMDMDEIKY----NDGNGKGKNEMSSDVYEGNVTDSRSS  857



>emb|CDX73714.1| BnaC08g22890D [Brassica napus]
Length=1176

 Score =   180 bits (456),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -2

Query  740   SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
             +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE LCAR A+ P L + +VSLAE
Sbjct  986   THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAE  1045

Query  560   WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
             W    Y+ G + +IVDP+LKG+I  EC  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  1046  WAPYCYKKGMLDQIVDPHLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFAL  1105

Query  380   QLQDAADKRG  351
             QLQ++A++ G
Sbjct  1106  QLQESAEESG  1115



>ref|XP_006650625.1| PREDICTED: probable receptor-like protein kinase At5g61350-like 
[Oryza brachyantha]
Length=855

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LPR++V+LAE
Sbjct  693  THVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPAINPALPRDQVNLAE  752

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    +  G++++I+DP++ GQI S+ L  + E A  CL D G+DRP+M DV+W LEFAL
Sbjct  753  WALTWHRKGELNKIIDPHISGQIRSDSLEIFAEAAEKCLADYGVDRPSMGDVLWKLEFAL  812

Query  380  QLQDAADKRGGLS  342
            QLQ+  D   G S
Sbjct  813  QLQEKGDIVDGTS  825



>ref|XP_010032550.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 gb|KCW51942.1| hypothetical protein EUGRSUZ_J01389 [Eucalyptus grandis]
Length=908

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKG+FGY+DPEYYRR+Q+T+KSDVYSFGVVLFEVLCAR AV     + ++SLA 
Sbjct  695  AHVSTVVKGTFGYLDPEYYRRQQLTDKSDVYSFGVVLFEVLCARPAVNRTAQKKQISLAA  754

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +   ++G + +IVDP LKG IA ECL ++ EIA +CL+D+G  RP+MNDVVWGLEFAL
Sbjct  755  WAQSCCKSGSIDKIVDPQLKGAIAPECLNKFCEIAMSCLQDEGTKRPSMNDVVWGLEFAL  814

Query  380  QLQDAADK  357
            QLQ +++K
Sbjct  815  QLQVSSEK  822



>ref|XP_010247768.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=876

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 130/217 (60%), Gaps = 21/217 (10%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVLFEVLCAR A+  NL   ++ LA+
Sbjct  673  THISTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLFEVLCARPALDRNLDHRQICLAD  732

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W  +    G + +I+DP L G+IA ECL ++ EIA NCL D+GI+RP M DV+W LEFAL
Sbjct  733  WALQCRRDGTLDQIIDPFLWGKIAPECLRKFAEIAANCLADEGINRPTMADVLWNLEFAL  792

Query  380  QLQDAADKRGG--------LSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENA  225
            QLQ++A+K G         ++  +TP       +   G    ++         FT+  N+
Sbjct  793  QLQESAEKLGDGDFDSVNQMNDKKTPLSSSISEVFVSGGVSGSSDMKSSGTSTFTSDGNS  852

Query  224  EKLFRTKssatatstsddSLRGQSHTIFSELSNQLGR  114
            +    + +               S T+FSE+ N  GR
Sbjct  853  KSYSESDAL-------------MSGTVFSEIGNPKGR  876



>ref|XP_006844774.1| hypothetical protein AMTR_s00016p00259140 [Amborella trichopoda]
 gb|ERN06449.1| hypothetical protein AMTR_s00016p00259140 [Amborella trichopoda]
Length=856

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 109/142 (77%), Gaps = 3/142 (2%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLA+
Sbjct  674  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPSLPKEQVSLAD  733

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +++DP LKG+I  ECL ++ E A  CL D G+DRPAM DV+W LEFAL
Sbjct  734  WALHCQKKGVLEDLIDPFLKGKINPECLKKFSETAEKCLSDSGVDRPAMGDVLWNLEFAL  793

Query  380  QLQDAADK---RGGLSPPRTPE  324
            QLQ+ +++      ++P R PE
Sbjct  794  QLQEGSEEGKIPADVAPARLPE  815



>gb|AAL40864.1| receptor protein kinase-like protein [Capsicum annuum]
Length=648

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P LP+ +VSLAE
Sbjct  447  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAE  506

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G   +I+DP L G++A ECL ++ E A  C+ D G DRP+M DV+W LEFAL
Sbjct  507  WAFHCYKKGTFDQIIDPYLNGKLAPECLKKFTETAVKCVSDVGADRPSMGDVLWNLEFAL  566

Query  380  QLQDAADK  357
            QLQ++ ++
Sbjct  567  QLQESVEE  574



>ref|XP_006289663.1| hypothetical protein CARUB_v10003221mg [Capsella rubella]
 gb|EOA22561.1| hypothetical protein CARUB_v10003221mg [Capsella rubella]
Length=859

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 103/141 (73%), Gaps = 4/141 (3%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+L + +VSL +W
Sbjct  677  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLSKEQVSLGDW  736

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
                   G + +I+DPNLKG+I  ECL ++ + A  CL D G+DRP M DV+W LEFALQ
Sbjct  737  AMNCKRKGTLEDIIDPNLKGKINPECLKKFADTAEKCLSDSGLDRPTMGDVLWNLEFALQ  796

Query  377  LQDAADKRGGLSPPRTPERPG  315
            LQ+ AD     S  RTP   G
Sbjct  797  LQETADG----SRHRTPSHGG  813



>ref|XP_004492579.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cicer arietinum]
Length=896

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFE+LCAR A+ P L + +VSLAE
Sbjct  694  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARPALNPTLAKEQVSLAE  753

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y+ G + +I DP LKG+IA EC  ++ E A  C+ DQ I+RP+M DV+W LEFAL
Sbjct  754  WAAHCYKKGILDQISDPYLKGKIAPECFKKFAETAMKCVADQSIERPSMGDVLWNLEFAL  813

Query  380  QLQDAADKRG  351
            QLQ++A++ G
Sbjct  814  QLQESAEESG  823



>ref|XP_006654257.1| PREDICTED: receptor-like protein kinase FERONIA-like [Oryza brachyantha]
Length=889

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVL EVLCAR A+ P+LPR +VSLA+
Sbjct  688  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEVLCARTALSPSLPREQVSLAD  747

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W       G + +IVDP L+G+IA +C +++ E A  C+ D+  DRP+M DV+W LEFAL
Sbjct  748  WALHCQRKGVLGDIVDPLLRGKIAPQCFMKFAETAEKCVVDRSADRPSMGDVLWNLEFAL  807

Query  380  QLQDAADKRGGLS  342
            QLQ++A+  GGL+
Sbjct  808  QLQESAEDSGGLT  820



>ref|XP_010034433.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 gb|KCW52047.1| hypothetical protein EUGRSUZ_J01487 [Eucalyptus grandis]
Length=870

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 118/177 (67%), Gaps = 9/177 (5%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKG+FGY+DPEYYR +++T+KSDVYSFGVVLFEVLCAR AV    P  ++SLAE
Sbjct  674  THVSTAVKGTFGYLDPEYYRHQRLTDKSDVYSFGVVLFEVLCARPAVSRMAPMEQISLAE  733

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +   ++G V EIVDP+LKG I  ECL ++ EIA +CL+D+G +RP+MNDVVWGL FAL
Sbjct  734  WAQSCCKSGAVEEIVDPHLKGSITPECLNKFCEIAMSCLQDKGANRPSMNDVVWGLNFAL  793

Query  380  QLQ-----DAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENA  225
            QLQ     +A D  G               +   G  EA+N S    GG  ++ E A
Sbjct  794  QLQVSTELEAMDHVGVSVHDSDDSDHDAASIRGSGSDEASNTS----GGWKSSRETA  846



>gb|KEH25126.1| feronia receptor-like kinase [Medicago truncatula]
Length=900

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 118/168 (70%), Gaps = 8/168 (5%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGS GY+DPEYY+R+++TEKSDVYSFGVVLFE+LCAR  +I    + +VSLA+
Sbjct  692  AHVSTVVKGSVGYLDPEYYKRQRLTEKSDVYSFGVVLFEILCARPPLIRTAEKRQVSLAD  751

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            WGR  ++ G +  IVDP++K  IA ECL ++ EIA +CL D G  RP+MNDVVW LEFAL
Sbjct  752  WGRYCHKNGMLGSIVDPSVKWSIAPECLRKFGEIAVSCLLDDGTMRPSMNDVVWMLEFAL  811

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTT  237
            QLQ++A+KR   + P T        L +G D    ++ DE+    F++
Sbjct  812  QLQESAEKREPQAVPHT--------LGRGNDDVEGDRIDENDNDVFSS  851



>ref|XP_002992454.1| hypothetical protein SELMODRAFT_135346 [Selaginella moellendorffii]
 gb|EFJ06392.1| hypothetical protein SELMODRAFT_135346 [Selaginella moellendorffii]
Length=872

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LPR +V++AE
Sbjct  685  THVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPAINPALPREQVNIAE  744

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W  +    G + +IVD NLKGQ + E L ++ E A  CL +QGIDRPAM DV+W LE+AL
Sbjct  745  WAMQYQRMGALEQIVDANLKGQCSQESLQKFGETAEKCLAEQGIDRPAMGDVLWNLEYAL  804

Query  380  QLQDAA  363
            QLQ+A+
Sbjct  805  QLQEAS  810



>ref|XP_010039671.1| PREDICTED: receptor-like protein kinase HERK 1, partial [Eucalyptus 
grandis]
Length=282

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVL EVLCAR  + P+LPR KV+LAE
Sbjct  99   THVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEVLCARPVIDPSLPREKVNLAE  158

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W  +  + G + +I+DP L G+I  + L ++ E A  CL D G+DRP+M DV+W LE+AL
Sbjct  159  WAMKWQKKGQLDQIIDPTLVGKIRPDSLRKFGETAEKCLADYGVDRPSMGDVLWNLEYAL  218

Query  380  QLQDAA  363
            QLQ+A 
Sbjct  219  QLQEAV  224



>gb|EYU23499.1| hypothetical protein MIMGU_mgv1a023218mg [Erythranthe guttata]
Length=866

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCARAA+ P+LPR++V+LAE
Sbjct  672  THVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARAALDPSLPRDQVNLAE  731

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +   + G + +IVDP + G I  + LI++VE A  CL + G+DRP+M DV+W LEFAL
Sbjct  732  WAKMQNKKGSIKKIVDPVIVGDINQDSLIKFVESAEKCLAEYGVDRPSMGDVLWNLEFAL  791

Query  380  QLQ  372
            QLQ
Sbjct  792  QLQ  794



>gb|EMT15162.1| Putative receptor-like protein kinase [Aegilops tauschii]
Length=836

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 102/133 (77%), Gaps = 0/133 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P LPR++V+L E
Sbjct  674  THVSTAVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPAINPALPRDQVNLGE  733

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W R  +  G++ +I+DPN+ GQI  + L  + E A  CL D G+DRP M DV+W LEFAL
Sbjct  734  WARTWHRKGELGKIIDPNIAGQIRPDSLEMFAEAAEKCLADYGVDRPTMGDVLWKLEFAL  793

Query  380  QLQDAADKRGGLS  342
            QLQ+  D   G S
Sbjct  794  QLQEKGDVVDGAS  806



>gb|KCW87969.1| hypothetical protein EUGRSUZ_A00377, partial [Eucalyptus grandis]
Length=831

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLA+
Sbjct  656  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLPKEQVSLAD  715

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W R     G + +I+DP +KGQ+  EC  ++ E A  CL DQG+DRP M DV+W LE AL
Sbjct  716  WARHCQRKGTLDDIIDPCIKGQVTPECYKKFAETAGKCLADQGLDRPPMGDVLWSLELAL  775

Query  380  QLQDAAD  360
            QLQ+  D
Sbjct  776  QLQENPD  782



>ref|XP_008379440.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=905

 Score =   178 bits (451),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 140/209 (67%), Gaps = 11/209 (5%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +H++T  KGSFGY+DPEYYR  Q+TEKSDVYSFGVVL EVLCAR A++    + ++SLA 
Sbjct  708  THITTVAKGSFGYLDPEYYRLNQLTEKSDVYSFGVVLCEVLCARPALVRGPDKKQMSLAH  767

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +  Y  G++ +I+DPNLKG+I + C+ ++ ++A +C+ D GI+RP+M+DVVWGLEFAL
Sbjct  768  WAKSCYLKGELDQIMDPNLKGKIGTACMNKFADVAMSCMHDNGINRPSMDDVVWGLEFAL  827

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAEKLFRTKs  201
            QL    +++G L         GF +  KG D  A     +  G + +  E+++ + +T  
Sbjct  828  QLHQ-KEEQGEL---------GFDIDKKGEDEVAVMNDSDALGFSSSLGESSDWMTKTN-  876

Query  200  satatstsddSLRGQSHTIFSELSNQLGR  114
            S+   ST+++ ++G S TIFS + +Q GR
Sbjct  877  SSEQNSTTNEPIKGMSRTIFSGIDDQDGR  905



>ref|XP_010318820.1| PREDICTED: probable receptor-like protein kinase At5g61350 [Solanum 
lycopersicum]
Length=847

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 109/150 (73%), Gaps = 8/150 (5%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LPR +V+LAE
Sbjct  664  THVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALDPALPREQVNLAE  723

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W  + ++ G + +I+DP+L G I+ E L +YVE A  CL + G+DRP M DV+W LE+AL
Sbjct  724  WAMQQHKKGSLEKIIDPHLAGTISPEALRKYVEAAEKCLAEYGVDRPTMGDVLWNLEYAL  783

Query  380  QLQDAA--------DKRGGLSPPRTPERPG  315
            QL+ A         +     S P + E+PG
Sbjct  784  QLESATPSSVPVKNENENENSKPSSSEQPG  813



>ref|XP_004304217.1| PREDICTED: receptor-like protein kinase FERONIA [Fragaria vesca 
subsp. vesca]
Length=876

 Score =   177 bits (450),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 139/215 (65%), Gaps = 20/215 (9%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVL EVLCAR A+I    + +++LA 
Sbjct  676  THISTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLCEVLCARPALIRTKEKKQMNLAA  735

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +  Y  G + +I+DPNL+G+I + CL ++VE+A +C+ D G +RP+MNDVVW LEFAL
Sbjct  736  WFKTCYGNGTLDQIIDPNLRGKIVNVCLNKFVEVAISCMHDNGNERPSMNDVVWALEFAL  795

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGG-----DGEAANKSDEDYGGAFTTSENAEKL  216
            +LQ  A+              G  L    G     +    N SDE + G +  S +++  
Sbjct  796  KLQQTAE--------------GLELDFNAGKKNEDEAPLVNDSDERFSGIWADSSSSKNS  841

Query  215  FRTKssatatstsdd-SLRGQSHTIFSELSNQLGR  114
              TK+S++  ++S   S++G S T+FSE+ +  GR
Sbjct  842  RVTKTSSSDQNSSTSESIKGLSGTVFSEIYDPNGR  876



>ref|XP_010034426.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 gb|KCW52040.1| hypothetical protein EUGRSUZ_J01480 [Eucalyptus grandis]
Length=881

 Score =   177 bits (450),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 115/177 (65%), Gaps = 5/177 (3%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKG+FGY+DPEYYR +++T+KSDVYSFGVVLFEVLCAR AV    P  ++SLAE
Sbjct  686  THVSTAVKGTFGYLDPEYYRHQRLTDKSDVYSFGVVLFEVLCARPAVNRMAPMEQISLAE  745

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +   ++G V EIVDP+LKG I  ECL ++ EIA +CL+D+G  R +MNDVVWGL FAL
Sbjct  746  WAQSCCKSGAVEEIVDPHLKGSITPECLNKFCEIAMSCLQDKGAKRSSMNDVVWGLNFAL  805

Query  380  QLQ-----DAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENA  225
            QLQ     +A D  G               +   G  E  N SD D G   ++ E A
Sbjct  806  QLQVSTELEATDHVGVSVHDSDDSDHDAASIRGSGSDEEINTSDSDSGRWKSSRETA  862



>ref|XP_004137258.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cucumis 
sativus]
 gb|KGN53792.1| hypothetical protein Csa_4G129580 [Cucumis sativus]
Length=910

 Score =   177 bits (450),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVL EVLCAR  ++    + +V LAE
Sbjct  702  AHISTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLCEVLCARPPLMRLTDKKQVYLAE  761

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W RR      +++I+DPN+K +I+ ECL +++EIA  C++D GI+RP+MNDVVWGLEFA+
Sbjct  762  WVRRCNRDNTIAQIIDPNIKNEISPECLRKFIEIAVRCIQDDGINRPSMNDVVWGLEFAV  821

Query  380  QLQDAADKR  354
            QLQ+A+ K+
Sbjct  822  QLQEASKKK  830



>ref|XP_010065050.1| PREDICTED: receptor-like protein kinase ANXUR2 [Eucalyptus grandis]
Length=858

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLA+
Sbjct  683  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLPKEQVSLAD  742

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W R     G + +I+DP +KGQ+  EC  ++ E A  CL DQG+DRP M DV+W LE AL
Sbjct  743  WARHCQRKGTLDDIIDPCIKGQVTPECYKKFAETAGKCLADQGLDRPPMGDVLWSLELAL  802

Query  380  QLQDAAD  360
            QLQ+  D
Sbjct  803  QLQENPD  809



>ref|XP_002447169.1| hypothetical protein SORBIDRAFT_06g029710 [Sorghum bicolor]
 gb|EES11497.1| hypothetical protein SORBIDRAFT_06g029710 [Sorghum bicolor]
Length=877

 Score =   177 bits (450),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLA+
Sbjct  683  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALSPSLPKEQVSLAD  742

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W   S + G + +I+DP L+G+I+ +C +++ E A  C+ D  IDRP+M DV+W LEFAL
Sbjct  743  WALHSQKKGILGQIIDPYLQGKISPQCFMKFAETAEKCVADHSIDRPSMADVLWNLEFAL  802

Query  380  QLQDAADKRGGLS  342
            QLQ++A+    ++
Sbjct  803  QLQESAEDSSSVT  815



>ref|XP_006593700.1| PREDICTED: receptor-like protein kinase FERONIA-like [Glycine 
max]
Length=819

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            SHVST VKGSFGY+DPEYY+R ++TEKSDVYSFGVVLFE+LCAR  +I N    +VSLA 
Sbjct  674  SHVSTNVKGSFGYLDPEYYKRNRLTEKSDVYSFGVVLFEILCARPPLIHNAETEQVSLAN  733

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W R  Y+ G +++IVDP+LKG IA EC  ++ EI  +CL + G+ RP++ND+VW LEFAL
Sbjct  734  WARCCYQNGTMAQIVDPSLKGTIAPECFEKFCEIGMSCLLEDGMHRPSINDIVWLLEFAL  793

Query  380  QLQDAADKR  354
            QLQ+ AD+R
Sbjct  794  QLQEDADQR  802



>gb|KCW52051.1| hypothetical protein EUGRSUZ_J01491 [Eucalyptus grandis]
Length=849

 Score =   177 bits (448),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 114/172 (66%), Gaps = 24/172 (14%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKG+FGY+DPEY+R +++T+KSDVYSFGVVLFEVLCAR AV    P  ++SLAE
Sbjct  678  THVSTAVKGTFGYLDPEYFRHQRLTDKSDVYSFGVVLFEVLCARPAVSRMAPMEQISLAE  737

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +   ++G V EIVDP+LKG I  ECL ++ EIA +CL+D+G  RP+MNDVVWGL FAL
Sbjct  738  WAQSCCKSGAVEEIVDPHLKGSITPECLNKFCEIAMSCLQDKGAKRPSMNDVVWGLNFAL  797

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENA  225
            QLQ + +                         EA N SD D GG  ++ E A
Sbjct  798  QLQVSTEL------------------------EAINTSDSDSGGWKSSRETA  825



>ref|XP_010921184.1| PREDICTED: receptor-like protein kinase FERONIA [Elaeis guineensis]
Length=895

 Score =   177 bits (449),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 110/146 (75%), Gaps = 1/146 (1%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR  +   LP+ +VSLAE
Sbjct  696  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPPLNSTLPKEQVSLAE  755

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +I+DP L+G+IA +C  ++ E A  C+ DQGI+RP+M DV+W LEFAL
Sbjct  756  WALHCQKKGILDQIIDPYLRGRIAPQCFKKFAETAEKCVADQGIERPSMGDVLWNLEFAL  815

Query  380  QLQDAADKRGGLSPPRTPERPGFPLL  303
            QLQ++A++ G L    T E  G PL+
Sbjct  816  QLQESAEESGCLIDGATSEE-GTPLM  840



>ref|XP_008813242.1| PREDICTED: receptor-like protein kinase FERONIA [Phoenix dactylifera]
Length=894

 Score =   177 bits (449),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 111/146 (76%), Gaps = 1/146 (1%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR  +   LP+ +VSLAE
Sbjct  696  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPPLNSALPKEQVSLAE  755

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +I+DP L+G+IAS+C  ++ E A  C+ D+G++RP+M DV+W LEFAL
Sbjct  756  WALHCQKKGFLDQIIDPYLRGRIASQCFKKFAETAEKCVSDKGMERPSMGDVLWNLEFAL  815

Query  380  QLQDAADKRGGLSPPRTPERPGFPLL  303
            QLQ++A++ G L    T E  G PL+
Sbjct  816  QLQESAEESGSLMDGATSEE-GTPLM  840



>ref|XP_002874434.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50693.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=857

 Score =   177 bits (448),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 102/139 (73%), Gaps = 4/139 (3%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+L + +VSL +W
Sbjct  677  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLSKEQVSLGDW  736

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
                   G + +I+DPNLKG+I  ECL ++ + A  CL D G+DRP M DV+W LEFALQ
Sbjct  737  AMNCKRKGTLEDIIDPNLKGKINPECLKKFADTAEKCLSDSGLDRPTMGDVLWNLEFALQ  796

Query  377  LQDAADKRGGLSPPRTPER  321
            LQ+ AD     S  RTP  
Sbjct  797  LQETADG----SRHRTPSH  811



>ref|XP_010914574.1| PREDICTED: receptor-like protein kinase ANXUR2 [Elaeis guineensis]
Length=865

 Score =   177 bits (448),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P+LPR++VSLA+
Sbjct  680  THVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPALNPSLPRDQVSLAD  739

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +I+DP LKG+I  ECL ++ + A  CL DQG+DRP M DV+W LEFAL
Sbjct  740  WALHCKKKGFLEDIIDPVLKGKIDPECLKKFADTAEKCLSDQGVDRPTMGDVLWNLEFAL  799

Query  380  QLQD  369
            QLQ+
Sbjct  800  QLQE  803



>ref|XP_007217052.1| hypothetical protein PRUPE_ppa001190mg [Prunus persica]
 gb|EMJ18251.1| hypothetical protein PRUPE_ppa001190mg [Prunus persica]
Length=885

 Score =   177 bits (448),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +H+ST VKGSFGY+DPEYYRR Q+TEKSDVYSFGVVLFEVLCAR A +    + ++SLAE
Sbjct  682  THISTMVKGSFGYLDPEYYRRNQLTEKSDVYSFGVVLFEVLCARPAFLRTAGKKQMSLAE  741

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +  +  G + +I+DP+LKG+I   CL ++VE+A +C+ D GI RP+MNDVVWGLE+AL
Sbjct  742  WAKSCHREGTLDKIIDPSLKGKIGKACLNKFVEMAISCIHDNGIQRPSMNDVVWGLEYAL  801

Query  380  QLQDAADK  357
            QL   A++
Sbjct  802  QLHQKAER  809



>ref|XP_004962463.1| PREDICTED: receptor-like protein kinase FERONIA-like [Setaria 
italica]
Length=873

 Score =   177 bits (448),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLA+
Sbjct  679  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALSPSLPKEQVSLAD  738

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +I+DP L+G+I+ +C +++ E A  C+ D  IDRP+M DV+W LEFAL
Sbjct  739  WALHCQKKGILGQIIDPYLQGKISLQCFMKFAETAEKCVADHSIDRPSMADVLWNLEFAL  798

Query  380  QLQDAADKRGGLS  342
            QLQ++A+    L+
Sbjct  799  QLQESAEDNSSLT  811



>gb|EMS48200.1| Receptor-like protein kinase HERK 1 [Triticum urartu]
Length=807

 Score =   176 bits (446),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+++TEKSDVYSFGVVLFEVLC R A+ P+LPR +VSLA+
Sbjct  621  THVSTMVKGSFGYLDPEYFRRQKLTEKSDVYSFGVVLFEVLCGRPALNPSLPREQVSLAD  680

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
                    G + EIVDP L+G+IA +CL ++ E A  CL DQG+DRP+M DV+W LEFAL
Sbjct  681  HALSCQRKGTLEEIVDPVLEGKIAPDCLKKFAETAEKCLADQGVDRPSMGDVLWNLEFAL  740

Query  380  QLQDAADKRGGLSPP  336
            Q+QD  D  G   PP
Sbjct  741  QMQDTFDNGG--KPP  753



>gb|KJB80895.1| hypothetical protein B456_013G120400 [Gossypium raimondii]
Length=851

 Score =   176 bits (447),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P+LP+ +VSLA+W
Sbjct  672  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPSLPKEQVSLADW  731

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
                ++ G + +I+DP+LK +I  ECL ++   A  CL DQGIDRP M DV+W LEFALQ
Sbjct  732  ALSCHKKGTLDDIIDPHLKDKIDPECLKKFAGTAVKCLSDQGIDRPHMGDVLWNLEFALQ  791

Query  377  LQDAA  363
            LQ+ A
Sbjct  792  LQETA  796



>ref|XP_004962493.1| PREDICTED: receptor-like protein kinase ANXUR1-like [Setaria 
italica]
Length=869

 Score =   176 bits (447),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LPR +VSLA+
Sbjct  686  THVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLPREQVSLAD  745

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
                    G + +I+DP LKG+IA +CL +Y E A  CL D G+DRP+M DV+W LEFAL
Sbjct  746  HAMSCQRKGTLQDIMDPLLKGKIAPDCLKKYAETAEKCLADHGVDRPSMGDVLWNLEFAL  805

Query  380  QLQDAADKRG  351
            Q+QD  +  G
Sbjct  806  QMQDTFENGG  815



>ref|XP_009414253.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414254.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=887

 Score =   177 bits (448),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 108/141 (77%), Gaps = 3/141 (2%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P LP+ +VSLAE
Sbjct  691  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLPKEQVSLAE  750

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + ++VDP L G+IA +C  ++ E A  C+ D GI+RP+M DV+W LEFAL
Sbjct  751  WALHCQKKGILDQLVDPFLTGKIAPQCFKKFAETAEKCVADFGIERPSMGDVLWSLEFAL  810

Query  380  QLQDAADKRG---GLSPPRTP  327
            QLQ++A++ G   G+S   TP
Sbjct  811  QLQESAEESGSIIGISDDTTP  831



>ref|XP_008344357.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA [Malus domestica]
Length=492

 Score =   173 bits (438),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +H+STAVKGSFGY+DPEYYRR+Q+T KSDVYSFGVVL EVLCAR AV+      +++LAE
Sbjct  329  THISTAVKGSFGYLDPEYYRRQQLTVKSDVYSFGVVLCEVLCARPAVVHATETRQMNLAE  388

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +  +  G++ +I+DPN+KG+I +ECL +YVEIA +C+ D G++RP+MNDVV GLEFAL
Sbjct  389  WTKSCHRDGELDQIIDPNMKGKIETECLNKYVEIAMSCINDSGMERPSMNDVVRGLEFAL  448

Query  380  QLQDAADKR  354
            QL     +R
Sbjct  449  QLHQNRGER  457



>ref|XP_009391670.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=887

 Score =   176 bits (447),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLAE
Sbjct  691  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLPKEQVSLAE  750

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W       G + +I+DP LKG+IA +C  ++ E A  C+ D G +RP+M DV+W LEFAL
Sbjct  751  WALHCQRKGMLDQIIDPYLKGKIAPQCFKKFAETAEKCVADIGTERPSMGDVLWNLEFAL  810

Query  380  QLQDAADKRGGL  345
            QLQ++A++ G +
Sbjct  811  QLQESAEESGSI  822



>ref|NP_198220.1| receptor-like protein kinase ANXUR2 [Arabidopsis thaliana]
 sp|Q3E8W4.1|ANX2_ARATH RecName: Full=Receptor-like protein kinase ANXUR2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AED93826.1| receptor-like protein kinase ANXUR2 [Arabidopsis thaliana]
Length=858

 Score =   176 bits (446),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 102/137 (74%), Gaps = 4/137 (3%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HV+T VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+L + +VSL +W
Sbjct  677  HVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLSKEQVSLGDW  736

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
                   G + +I+DPNLKG+I  ECL ++ + A  CL D G+DRP M DV+W LEFALQ
Sbjct  737  AMNCKRKGTLEDIIDPNLKGKINPECLKKFADTAEKCLSDSGLDRPTMGDVLWNLEFALQ  796

Query  377  LQDAADKRGGLSPPRTP  327
            LQ+ AD     S  RTP
Sbjct  797  LQETADG----SRHRTP  809



>dbj|BAK06468.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=891

 Score =   176 bits (447),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+++TEKSDVYSFGVVLFEVLCAR A+ P+LPR +VSLA+
Sbjct  705  THVSTMVKGSFGYLDPEYFRRQKLTEKSDVYSFGVVLFEVLCARPALNPSLPREQVSLAD  764

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
                    G + EI+DP L+G++A +CL ++ E A  CL DQG+DRP+M DV+W LEFAL
Sbjct  765  HALSCQRRGTLEEIIDPVLEGKVAPDCLKKFAETAEKCLSDQGVDRPSMGDVLWNLEFAL  824

Query  380  QLQDAADKRGGLSPP  336
            Q+QD  D  G   PP
Sbjct  825  QMQDTFDNGG--KPP  837



>ref|XP_008464585.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
Length=898

 Score =   176 bits (447),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVL EVLCAR  ++    + +  +A 
Sbjct  700  AHISTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLCEVLCARPPLMRVADKKQTHIAG  759

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +R  +   +++I+DPN+K +I+ ECL ++VEIA +C++D+GI RP+MNDVVW LEFAL
Sbjct  760  WVQRCAQNNTIAQIIDPNIKNEISPECLRKFVEIAVSCIQDEGIRRPSMNDVVWSLEFAL  819

Query  380  QLQDAADKRGG  348
            QLQDA+ K GG
Sbjct  820  QLQDASKKNGG  830



>ref|XP_011009253.1| PREDICTED: receptor-like protein kinase FERONIA [Populus euphratica]
Length=833

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 100/130 (77%), Gaps = 3/130 (2%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST V+GS GYVDPEYYRR+ +TEKSDVYSFGVVLFEVLCAR  VIP+ P+ + SLAE
Sbjct  694  THVSTVVRGSIGYVDPEYYRRQHLTEKSDVYSFGVVLFEVLCARPPVIPSSPKEQASLAE  753

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W RR Y+ G + +IVD   KG++A   L ++ EIA +CL  QGI+RP M DVVWGLEFAL
Sbjct  754  WARRCYQRGTLDQIVD---KGEVAPVSLNKFAEIANSCLHGQGIERPKMGDVVWGLEFAL  810

Query  380  QLQDAADKRG  351
            QLQ  A+K  
Sbjct  811  QLQQTAEKNA  820



>ref|NP_001237588.1| FERONIA receptor-like kinase [Glycine max]
 gb|ACM89471.1| FERONIA receptor-like kinase [Glycine max]
Length=708

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = -2

Query  746  AVSHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSL  567
            A +HVST VKGS GY+DPEYY+R+++TEKSDVYSFGVVLFE+LCAR  +I    + +VSL
Sbjct  502  AKAHVSTVVKGSIGYLDPEYYKRQRLTEKSDVYSFGVVLFELLCARPPLIRTAEKKQVSL  561

Query  566  AEWGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEF  387
            A+W R   + G + +IVDP LKG++A ECL ++ E+A +CL D G  RP+MNDVVW LEF
Sbjct  562  ADWARHCCQNGTIGQIVDPTLKGRMAPECLRKFCEVAVSCLLDDGTLRPSMNDVVWMLEF  621

Query  386  ALQLQDAADKR  354
            ALQLQ++A++R
Sbjct  622  ALQLQESAEQR  632



>tpg|DAA51500.1| TPA: putative receptor-like protein kinase family protein [Zea 
mays]
Length=847

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P LPR++V+LAE
Sbjct  686  THVSTAVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPAINPALPRDQVNLAE  745

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y  G++++I+DP++ GQ+  + L  + E A  CL D G+DRP+M DV+W LEFAL
Sbjct  746  WALTWYRKGELNKIIDPHIAGQLRPDSLEMFAEAAEKCLADYGVDRPSMGDVLWKLEFAL  805

Query  380  QLQDAAD  360
            QLQ+  D
Sbjct  806  QLQEKGD  812



>ref|XP_008665441.1| PREDICTED: probable receptor-like protein kinase At5g61350 [Zea 
mays]
Length=837

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P LPR++V+LAE
Sbjct  676  THVSTAVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPAINPALPRDQVNLAE  735

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W    Y  G++++I+DP++ GQ+  + L  + E A  CL D G+DRP+M DV+W LEFAL
Sbjct  736  WALTWYRKGELNKIIDPHIAGQLRPDSLEMFAEAAEKCLADYGVDRPSMGDVLWKLEFAL  795

Query  380  QLQDAAD  360
            QLQ+  D
Sbjct  796  QLQEKGD  802



>ref|XP_008464586.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
Length=914

 Score =   176 bits (447),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/218 (43%), Positives = 138/218 (63%), Gaps = 25/218 (11%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVL E+LCAR  ++ +  + +V LAE
Sbjct  713  THISTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLCEILCARPPLVHSADKKEVYLAE  772

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W R+ +    V++ +D N++ +I+ ECL +++EIA +C++D G+ RP+MNDVVWGLEFAL
Sbjct  773  WVRQCHRNNTVAQTIDKNIRNEISPECLRKFIEIAVSCVEDDGVKRPSMNDVVWGLEFAL  832

Query  380  QLQDAADKR------GGLSPPRTPERPGF--PLLAKGGDGEAANKSDEDYG-GAFTTSEN  228
            QLQ+A+ K+      G      + ER      L +  G G    + D + G  ++ T+ N
Sbjct  833  QLQEASKKKVDEDDVGSGKRDSSEERWWLDETLFSSTGSG----RRDSELGVSSYVTTSN  888

Query  227  AEKLFRTKssatatstsddSLRGQSHTIFSELSNQLGR  114
            ++    T +            +G S T+FSE+ +  GR
Sbjct  889  SDDSSYTHT------------KGMSGTVFSEIKDPAGR  914



>ref|XP_007030540.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY11042.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
Length=858

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  737  HVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAEW  558
            HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFE LCAR A+ P+LP+ +VSLA+W
Sbjct  670  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPSLPKEQVSLADW  729

Query  557  GRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFALQ  378
                 + G + +I+DP+LKG+I  ECL ++ + A  CL D G++RP M DV+W LEFALQ
Sbjct  730  ALHCQKKGVLEDIIDPHLKGKIDPECLKKFADTAEKCLSDHGLERPHMGDVLWNLEFALQ  789

Query  377  LQDAAD  360
            LQ+ AD
Sbjct  790  LQETAD  795



>ref|XP_004154760.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA-like [Cucumis sativus]
Length=910

 Score =   176 bits (446),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +H+ST VKGSFGY+DPEYYRR+Q+TEKSDVYSFGVVL EVLCAR  ++    + +V LAE
Sbjct  702  AHISTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLCEVLCARPPLMRLTDKKQVYLAE  761

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W RR      + +I+DPN+K +I+ ECL +++EIA  C++D GI+RP+MNDVVWGLEFA+
Sbjct  762  WVRRCNRDNRLXQIIDPNIKNEISPECLRKFIEIAVRCIQDDGINRPSMNDVVWGLEFAV  821

Query  380  QLQDAADKR  354
            QLQ+A+ K+
Sbjct  822  QLQEASKKK  830



>ref|XP_008355123.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=404

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +H+ST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVL+EVLCAR A++  +   +++LAE
Sbjct  244  THISTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLWEVLCARPALLHTVETRQINLAE  303

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W +  +    + +I+DPN+KGQI  ECL ++VEIA +C+ D+GI+RP+MNDVV GLEFAL
Sbjct  304  WAKSCHGDETLDQIIDPNVKGQIEVECLNKFVEIAISCVHDKGIERPSMNDVVKGLEFAL  363

Query  380  QLQDAA  363
            QL   +
Sbjct  364  QLHQKS  369



>ref|XP_010258502.1| PREDICTED: receptor-like protein kinase ANXUR1 [Nelumbo nucifera]
Length=855

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 108/153 (71%), Gaps = 3/153 (2%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            SHVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P+LP+ +VSLA+
Sbjct  678  SHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLPKEQVSLAD  737

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +IVDP+LKG+I  EC  ++ E A  CL D G+DRP+M DV+W LE+ L
Sbjct  738  WALHCQKKGVLEDIVDPHLKGKITPECFKKFAETAEKCLSDHGLDRPSMGDVLWNLEYCL  797

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKGGDGE  282
            Q+Q+  D   G+   +       P+ A   D E
Sbjct  798  QVQENPD---GVKMEKDDSETNAPMAASSSDIE  827



>gb|EMS63765.1| Receptor-like protein kinase FERONIA [Triticum urartu]
Length=819

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 110/149 (74%), Gaps = 2/149 (1%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q+TEKSDVYSFGVVLFEVLCAR A+ P L + +VSLAE
Sbjct  622  THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPTLAKEEVSLAE  681

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W     + G + +IVDP LKG+I  +C  ++ E A  C+ D GI+RP+M DV+W LEFAL
Sbjct  682  WALHCQKKGILDQIVDPYLKGKIVPQCFKKFAETAEKCVADNGIERPSMGDVLWNLEFAL  741

Query  380  QLQDAADKRGGLSPPRTPERPGFPLLAKG  294
            Q+Q++A++ G +    + E  G PL+  G
Sbjct  742  QMQESAEESGSIGCGMSDE--GTPLVMVG  768



>ref|XP_006840306.1| hypothetical protein AMTR_s00045p00071050 [Amborella trichopoda]
 gb|ERN01981.1| hypothetical protein AMTR_s00045p00071050 [Amborella trichopoda]
Length=857

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 119/178 (67%), Gaps = 5/178 (3%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVSTAVKGSFGY+DPEY+RR+Q+T+KSDVYSFGVVLFEVLCAR A+ P LPR +V+LAE
Sbjct  673  THVSTAVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPAINPALPREQVNLAE  732

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W  + +  G + +I+DP++ G I +  L +YVE A  CL D G+DRP+M DV+W LE+AL
Sbjct  733  WALQWHRKGLLQKIIDPHVIGSINAASLKKYVEAAEKCLADYGVDRPSMGDVLWNLEYAL  792

Query  380  QLQDAADKRGGLSPPRT-----PERPGFPLLAKGGDGEAANKSDEDYGGAFTTSENAE  222
            QLQ+AA    G   P        +RP   L        + + SD++ G   ++   A+
Sbjct  793  QLQEAASSAVGEDDPSANHILHQQRPPTVLDTTAKGSHSRSSSDDESGPTLSSPMFAQ  850



>dbj|BAJ93584.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=885

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGSFGY+DPEY+RR+Q++EKSDVYSFGVVLFEVLCAR A+ P+LP+ ++SLA+
Sbjct  687  THVSTVVKGSFGYLDPEYFRRQQLSEKSDVYSFGVVLFEVLCARPALSPSLPKEQISLAD  746

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W  R  + G + +I+DP L+G+IA +C +++ E A  C+ D+ +DRP+M DV+W LEFAL
Sbjct  747  WALRCQKQGVLGQIIDPMLQGRIAPQCFVKFTETAEKCVADRSVDRPSMGDVLWNLEFAL  806

Query  380  QLQDAADKRGGLS  342
            QLQ++ +    L+
Sbjct  807  QLQESDEDTSSLT  819



>ref|XP_006493304.1| PREDICTED: receptor-like protein kinase FERONIA-like [Citrus 
sinensis]
Length=893

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -2

Query  740  SHVSTAVKGSFGYVDPEYYRRRQVTEKSDVYSFGVVLFEVLCARAAVIPNLPRNKVSLAE  561
            +HVST VKGS GY+DPEYYR +Q+TEKSDVYSFGVVLFEVLCAR  ++    + +VSLA 
Sbjct  687  THVSTVVKGSVGYLDPEYYRLQQLTEKSDVYSFGVVLFEVLCARPPILRTADKKQVSLAV  746

Query  560  WGRRSYETGDVSEIVDPNLKGQIASECLIQYVEIACNCLKDQGIDRPAMNDVVWGLEFAL  381
            W ++ Y+ G + +IVDP LKG+I  ECL +Y E+A +CL D+GI RP+M+DVVWGLEFAL
Sbjct  747  WAQQCYQNGTIDQIVDPFLKGKIKPECLNKYAEVAMSCLNDEGIRRPSMSDVVWGLEFAL  806

Query  380  QLQDAA  363
            QLQ+++
Sbjct  807  QLQESS  812



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1374325004630