BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF034D23

Length=553
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009777101.1|  PREDICTED: root phototropism protein 2             209   1e-60   Nicotiana sylvestris
ref|XP_009611218.1|  PREDICTED: root phototropism protein 2             209   1e-60   Nicotiana tomentosiformis
ref|XP_011089543.1|  PREDICTED: root phototropism protein 2-like        207   7e-60   Sesamum indicum [beniseed]
gb|KHG08105.1|  Root phototropism 2 -like protein                       203   4e-59   Gossypium arboreum [tree cotton]
gb|KJB26283.1|  hypothetical protein B456_004G235100                    203   6e-59   Gossypium raimondii
gb|KJB26284.1|  hypothetical protein B456_004G235100                    204   1e-58   Gossypium raimondii
gb|KJB26282.1|  hypothetical protein B456_004G235100                    203   1e-58   Gossypium raimondii
emb|CDP04035.1|  unnamed protein product                                201   9e-58   Coffea canephora [robusta coffee]
ref|XP_010244564.1|  PREDICTED: root phototropism protein 2             201   1e-57   Nelumbo nucifera [Indian lotus]
ref|XP_006432049.1|  hypothetical protein CICLE_v10000673mg             192   6e-56   
ref|XP_007017103.1|  Phototropic-responsive NPH3 family protein         196   1e-55   
emb|CBI15802.3|  unnamed protein product                                184   1e-54   Vitis vinifera
ref|XP_006432045.1|  hypothetical protein CICLE_v10000673mg             192   2e-54   
gb|EYU36889.1|  hypothetical protein MIMGU_mgv1a003487mg                192   3e-54   Erythranthe guttata [common monkey flower]
ref|XP_006432046.1|  hypothetical protein CICLE_v10000673mg             192   3e-54   Citrus clementina [clementine]
ref|XP_006353728.1|  PREDICTED: root phototropism protein 2-like        190   1e-53   Solanum tuberosum [potatoes]
gb|KDO54918.1|  hypothetical protein CISIN_1g007944mg                   189   2e-53   Citrus sinensis [apfelsine]
ref|XP_004243653.1|  PREDICTED: root phototropism protein 2             189   2e-53   Solanum lycopersicum
gb|KDO54917.1|  hypothetical protein CISIN_1g007944mg                   189   4e-53   Citrus sinensis [apfelsine]
ref|XP_010650806.1|  PREDICTED: root phototropism protein 2 isofo...    185   6e-52   
gb|KHN24717.1|  Root phototropism protein 2                             174   7e-52   Glycine soja [wild soybean]
ref|XP_002264896.1|  PREDICTED: root phototropism protein 2 isofo...    185   1e-51   Vitis vinifera
gb|KDP45678.1|  hypothetical protein JCGZ_17285                         184   2e-51   Jatropha curcas
ref|XP_010677799.1|  PREDICTED: root phototropism protein 2             184   2e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002325631.1|  ROOT PHOTOTROPISM 2 family protein                 183   4e-51   Populus trichocarpa [western balsam poplar]
ref|XP_010023564.1|  PREDICTED: root phototropism protein 2             183   6e-51   Eucalyptus grandis [rose gum]
ref|XP_002533880.1|  Root phototropism protein, putative                182   1e-50   
ref|XP_011041764.1|  PREDICTED: root phototropism protein 2-like        182   1e-50   Populus euphratica
ref|XP_004147730.1|  PREDICTED: root phototropism protein 2-like        182   2e-50   Cucumis sativus [cucumbers]
gb|KGN53487.1|  hypothetical protein Csa_4G056750                       182   2e-50   Cucumis sativus [cucumbers]
ref|XP_011011776.1|  PREDICTED: root phototropism protein 2-like        181   3e-50   Populus euphratica
ref|XP_002319980.1|  ROOT PHOTOTROPISM 2 family protein                 181   4e-50   
ref|XP_004294714.1|  PREDICTED: root phototropism protein 2             181   4e-50   Fragaria vesca subsp. vesca
ref|XP_008451888.1|  PREDICTED: root phototropism protein 2 isofo...    181   4e-50   Cucumis melo [Oriental melon]
ref|XP_006293884.1|  hypothetical protein CARUB_v10022870mg             181   4e-50   Capsella rubella
ref|XP_003544940.2|  PREDICTED: root phototropism protein 2-like        181   5e-50   Glycine max [soybeans]
gb|ACJ85866.1|  unknown                                                 176   7e-50   Medicago truncatula
gb|KEH28209.1|  root phototropism-like protein                          179   8e-50   Medicago truncatula
ref|XP_010094443.1|  Root phototropism protein 2                        179   2e-49   Morus notabilis
ref|XP_003616056.1|  Root phototropism protein                          179   2e-49   Medicago truncatula
dbj|BAJ33924.1|  unnamed protein product                                179   2e-49   Eutrema halophilum
ref|XP_003519296.1|  PREDICTED: root phototropism protein 2             179   2e-49   
ref|XP_008451887.1|  PREDICTED: root phototropism protein 2 isofo...    179   4e-49   
ref|XP_011015900.1|  PREDICTED: root phototropism protein 2-like        178   4e-49   Populus euphratica
ref|XP_010469846.1|  PREDICTED: root phototropism protein 2 isofo...    178   4e-49   
ref|XP_007142019.1|  hypothetical protein PHAVU_008G245700g             177   5e-49   Phaseolus vulgaris [French bean]
ref|XP_007206420.1|  hypothetical protein PRUPE_ppa003347mg             177   6e-49   Prunus persica
ref|XP_009374407.1|  PREDICTED: root phototropism protein 2-like        177   9e-49   Pyrus x bretschneideri [bai li]
ref|XP_010522018.1|  PREDICTED: root phototropism protein 2-like        177   1e-48   Tarenaya hassleriana [spider flower]
ref|XP_010414259.1|  PREDICTED: root phototropism protein 2-like        177   1e-48   Camelina sativa [gold-of-pleasure]
gb|AAB63086.1|  unknown protein                                         173   2e-48   Arabidopsis thaliana [mouse-ear cress]
gb|ADL36608.1|  BZIP domain class transcription factor                  176   2e-48   Malus domestica [apple tree]
ref|XP_002881117.1|  hypothetical protein ARALYDRAFT_481966             176   2e-48   
ref|XP_010557176.1|  PREDICTED: root phototropism protein 2             176   2e-48   Tarenaya hassleriana [spider flower]
ref|NP_001280895.1|  root phototropism protein 2-like                   176   3e-48   Malus domestica [apple tree]
ref|XP_010510344.1|  PREDICTED: root phototropism protein 2-like        176   3e-48   Camelina sativa [gold-of-pleasure]
ref|XP_003553189.1|  PREDICTED: root phototropism protein 2-like        175   3e-48   Glycine max [soybeans]
gb|EPS73802.1|  hypothetical protein M569_00954                         175   4e-48   Genlisea aurea
ref|XP_006842585.1|  hypothetical protein AMTR_s00077p00161250          175   5e-48   Amborella trichopoda
ref|XP_006591739.1|  PREDICTED: root phototropism protein 2-like        174   6e-48   Glycine max [soybeans]
ref|XP_008239637.1|  PREDICTED: root phototropism protein 2 isofo...    174   8e-48   Prunus mume [ume]
ref|NP_001031446.1|  Root phototropism protein 2                        174   8e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008239576.1|  PREDICTED: root phototropism protein 2 isofo...    174   8e-48   Prunus mume [ume]
ref|XP_004490729.1|  PREDICTED: root phototropism protein 2-like        174   1e-47   Cicer arietinum [garbanzo]
ref|XP_009355145.1|  PREDICTED: root phototropism protein 2-like        174   1e-47   Pyrus x bretschneideri [bai li]
dbj|BAF02185.1|  hypothetical protein                                   174   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850147.1|  Root phototropism protein 2                           174   1e-47   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01791.1|  hypothetical protein                                   174   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007146905.1|  hypothetical protein PHAVU_006G080400g             174   2e-47   Phaseolus vulgaris [French bean]
ref|XP_008366216.1|  PREDICTED: root phototropism protein 2-like        173   2e-47   
gb|AAF33112.1|AF181683_1  RPT2                                          173   3e-47   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001280845.1|  root phototropism protein 2-like                   172   7e-47   Malus domestica [apple tree]
gb|ACJ85743.1|  unknown                                                 164   1e-46   Medicago truncatula
gb|KFK22949.1|  root phototropism protein 2                             169   5e-46   Arabis alpina [alpine rockcress]
ref|XP_008349518.1|  PREDICTED: LOW QUALITY PROTEIN: root phototr...    169   7e-46   
emb|CDY23992.1|  BnaC03g16990D                                          167   4e-45   Brassica napus [oilseed rape]
ref|XP_003600551.1|  Root phototropism protein                          166   7e-45   
gb|AES70802.2|  root phototropism-like protein                          166   7e-45   Medicago truncatula
ref|XP_003600550.1|  Root phototropism protein                          166   1e-44   Medicago truncatula
ref|XP_004500391.1|  PREDICTED: root phototropism protein 2-like        166   1e-44   Cicer arietinum [garbanzo]
emb|CDX84827.1|  BnaA03g14030D                                          165   2e-44   
ref|XP_009132742.1|  PREDICTED: root phototropism protein 2-like        165   2e-44   Brassica rapa
ref|XP_009384760.1|  PREDICTED: root phototropism protein 2-like ...    161   3e-43   
ref|XP_009384759.1|  PREDICTED: root phototropism protein 2-like ...    161   4e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010044625.1|  PREDICTED: root phototropism protein 2-like        161   4e-43   Eucalyptus grandis [rose gum]
gb|KCW86718.1|  hypothetical protein EUGRSUZ_B03325                     161   5e-43   Eucalyptus grandis [rose gum]
emb|CDY10743.1|  BnaA05g11930D                                          161   7e-43   Brassica napus [oilseed rape]
ref|XP_009144295.1|  PREDICTED: root phototropism protein 2             161   7e-43   Brassica rapa
ref|XP_009402206.1|  PREDICTED: root phototropism protein 2 isofo...    160   1e-42   
emb|CDY02075.1|  BnaC04g14260D                                          152   6e-40   
ref|XP_011080638.1|  PREDICTED: root phototropism protein 2             152   6e-40   Sesamum indicum [beniseed]
ref|XP_009402205.1|  PREDICTED: root phototropism protein 2 isofo...    152   8e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010922790.1|  PREDICTED: root phototropism protein 2             139   5e-35   Elaeis guineensis
gb|KHN18647.1|  Root phototropism protein 2                             132   8e-34   Glycine soja [wild soybean]
ref|XP_009374446.1|  PREDICTED: putative disease resistance prote...    128   3e-30   Pyrus x bretschneideri [bai li]
gb|EMS47631.1|  Root phototropism protein 2                             124   3e-30   Triticum urartu
gb|AAV50010.1|  phototropic response-like protein                       114   1e-28   Malus domestica [apple tree]
ref|XP_008803009.1|  PREDICTED: root phototropism protein 2             120   2e-28   Phoenix dactylifera
ref|XP_004978520.1|  PREDICTED: root phototropism protein 2-like        119   1e-27   Setaria italica
dbj|BAF95168.1|  similar to ROOT PHOTOTROPISM2 protein binding          108   4e-27   Ipomoea nil [qian niu]
ref|XP_008669932.1|  PREDICTED: root phototropism protein 2-like        114   5e-26   Zea mays [maize]
dbj|BAJ91259.1|  predicted protein                                      113   1e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92463.1|  predicted protein                                      112   2e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004977394.1|  PREDICTED: root phototropism protein 2-like        111   4e-25   Setaria italica
ref|XP_002463481.1|  hypothetical protein SORBIDRAFT_01g000540          108   6e-25   
ref|XP_002450159.1|  hypothetical protein SORBIDRAFT_05g001300          110   2e-24   
ref|XP_003577852.1|  PREDICTED: root phototropism protein 2             109   3e-24   Brachypodium distachyon [annual false brome]
ref|XP_006663162.1|  PREDICTED: root phototropism protein 2-like        104   7e-23   
gb|ABG22339.1|  RPT2, putative, expressed                             94.7    4e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EEC68739.1|  hypothetical protein OsI_37246                        92.8    2e-18   Oryza sativa Indica Group [Indian rice]
ref|NP_001065596.1|  Os11g0118300                                     91.3    6e-18   
gb|ABA95649.1|  RPT2, putative, expressed                             91.3    6e-18   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001066000.1|  Os12g0117400                                     91.3    6e-18   
gb|EEC67555.1|  hypothetical protein OsI_34888                        90.5    1e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_008661889.1|  PREDICTED: LOC100281201 isoform X1               82.4    7e-15   
gb|AFW55920.1|  putative phototropic-responsive NPH3 family protein   82.4    8e-15   
ref|NP_001147592.1|  LOC100281201                                     81.6    1e-14   
ref|XP_010277091.1|  PREDICTED: BTB/POZ domain-containing protein...  74.3    4e-12   
ref|XP_010277089.1|  PREDICTED: BTB/POZ domain-containing protein...  74.3    4e-12   
ref|XP_010272171.1|  PREDICTED: BTB/POZ domain-containing protein...  73.6    6e-12   Nelumbo nucifera [Indian lotus]
ref|XP_011006800.1|  PREDICTED: BTB/POZ domain-containing protein...  70.1    9e-11   Populus euphratica
ref|XP_011012052.1|  PREDICTED: BTB/POZ domain-containing protein...  70.1    9e-11   Populus euphratica
ref|XP_011006799.1|  PREDICTED: BTB/POZ domain-containing protein...  70.1    9e-11   Populus euphratica
ref|XP_011012051.1|  PREDICTED: BTB/POZ domain-containing protein...  70.1    9e-11   Populus euphratica
ref|XP_002970426.1|  hypothetical protein SELMODRAFT_231529           69.7    1e-10   
ref|XP_002978505.1|  hypothetical protein SELMODRAFT_443843           69.7    1e-10   Selaginella moellendorffii
ref|XP_008787157.1|  PREDICTED: BTB/POZ domain-containing protein...  69.3    2e-10   Phoenix dactylifera
gb|KHN36285.1|  BTB/POZ domain-containing protein                     68.6    3e-10   Glycine soja [wild soybean]
gb|EEC74727.1|  hypothetical protein OsI_10455                        68.2    5e-10   Oryza sativa Indica Group [Indian rice]
gb|AAN77296.1|  Hypothetical protein                                  67.8    5e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003517336.1|  PREDICTED: BTB/POZ domain-containing protein...  67.8    6e-10   Glycine max [soybeans]
ref|XP_002533158.1|  Root phototropism protein, putative              67.8    6e-10   Ricinus communis
ref|XP_002441790.1|  hypothetical protein SORBIDRAFT_08g002330        67.4    7e-10   
ref|XP_009411062.1|  PREDICTED: BTB/POZ domain-containing protein...  67.0    9e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006579934.1|  PREDICTED: BTB/POZ domain-containing protein...  67.0    9e-10   Glycine max [soybeans]
ref|XP_003538794.2|  PREDICTED: BTB/POZ domain-containing protein...  67.0    1e-09   Glycine max [soybeans]
ref|XP_006590635.1|  PREDICTED: BTB/POZ domain-containing protein...  67.0    1e-09   Glycine max [soybeans]
gb|KHN12984.1|  BTB/POZ domain-containing protein                     67.0    1e-09   Glycine soja [wild soybean]
ref|XP_006380639.1|  hypothetical protein POPTR_0007s10060g           66.6    1e-09   Populus trichocarpa [western balsam poplar]
ref|XP_006380638.1|  hypothetical protein POPTR_0007s10060g           66.2    2e-09   
ref|XP_010412681.1|  PREDICTED: putative BTB/POZ domain-containin...  63.9    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010412682.1|  PREDICTED: putative BTB/POZ domain-containin...  63.9    9e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010905283.1|  PREDICTED: BTB/POZ domain-containing protein...  63.2    2e-08   Elaeis guineensis
ref|XP_010905282.1|  PREDICTED: BTB/POZ domain-containing protein...  63.2    2e-08   Elaeis guineensis
ref|XP_006600924.1|  PREDICTED: BTB/POZ domain-containing protein...  62.4    3e-08   Glycine max [soybeans]
ref|XP_002983725.1|  hypothetical protein SELMODRAFT_228979           62.4    3e-08   Selaginella moellendorffii
ref|XP_002465671.1|  hypothetical protein SORBIDRAFT_01g043470        62.0    4e-08   
ref|XP_004511862.1|  PREDICTED: BTB/POZ domain-containing protein...  62.0    4e-08   Cicer arietinum [garbanzo]
ref|XP_004511860.1|  PREDICTED: BTB/POZ domain-containing protein...  62.0    5e-08   Cicer arietinum [garbanzo]
ref|XP_004511859.1|  PREDICTED: BTB/POZ domain-containing protein...  61.6    6e-08   
ref|XP_004511857.1|  PREDICTED: BTB/POZ domain-containing protein...  61.6    6e-08   
ref|XP_002989054.1|  hypothetical protein SELMODRAFT_272040           61.6    6e-08   Selaginella moellendorffii
ref|XP_009115684.1|  PREDICTED: BTB/POZ domain-containing protein...  61.2    6e-08   Brassica rapa
ref|XP_009115683.1|  PREDICTED: BTB/POZ domain-containing protein...  61.2    6e-08   Brassica rapa
ref|XP_008238282.1|  PREDICTED: BTB/POZ domain-containing protein...  60.8    1e-07   
ref|XP_009342777.1|  PREDICTED: BTB/POZ domain-containing protein...  60.8    1e-07   Pyrus x bretschneideri [bai li]
ref|XP_008354715.1|  PREDICTED: BTB/POZ domain-containing protein...  60.8    1e-07   
ref|XP_010426528.1|  PREDICTED: putative BTB/POZ domain-containin...  60.8    1e-07   Camelina sativa [gold-of-pleasure]
emb|CDP02580.1|  unnamed protein product                              60.5    1e-07   Coffea canephora [robusta coffee]
ref|XP_008341358.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  60.5    1e-07   
ref|XP_002284242.2|  PREDICTED: BTB/POZ domain-containing protein...  60.5    1e-07   Vitis vinifera
emb|CAN71562.1|  hypothetical protein VITISV_007563                   60.5    1e-07   Vitis vinifera
ref|XP_006664283.1|  PREDICTED: root phototropism protein 2-like      59.7    1e-07   Oryza brachyantha
gb|KJB48679.1|  hypothetical protein B456_008G080700                  59.7    2e-07   Gossypium raimondii
ref|XP_010559028.1|  PREDICTED: BTB/POZ domain-containing protein...  60.1    2e-07   Tarenaya hassleriana [spider flower]
ref|XP_010559030.1|  PREDICTED: BTB/POZ domain-containing protein...  60.1    2e-07   Tarenaya hassleriana [spider flower]
ref|XP_007047478.1|  Phototropic-responsive NPH3 family protein       60.1    2e-07   
gb|KDO78972.1|  hypothetical protein CISIN_1g006971mg                 60.1    2e-07   Citrus sinensis [apfelsine]
ref|XP_006466487.1|  PREDICTED: BTB/POZ domain-containing protein...  60.1    2e-07   Citrus sinensis [apfelsine]
ref|XP_010028107.1|  PREDICTED: BTB/POZ domain-containing protein...  60.1    2e-07   Eucalyptus grandis [rose gum]
ref|XP_006426057.1|  hypothetical protein CICLE_v10025164mg           60.1    2e-07   Citrus clementina [clementine]
ref|XP_010028106.1|  PREDICTED: BTB/POZ domain-containing protein...  60.1    2e-07   Eucalyptus grandis [rose gum]
gb|KHG27515.1|  hypothetical protein F383_13864                       59.7    2e-07   Gossypium arboreum [tree cotton]
ref|XP_009782405.1|  PREDICTED: BTB/POZ domain-containing protein...  60.1    2e-07   Nicotiana sylvestris
ref|XP_003520918.1|  PREDICTED: BTB/POZ domain-containing protein...  59.7    2e-07   Glycine max [soybeans]
ref|XP_010086959.1|  BTB/POZ domain-containing protein                59.7    2e-07   
gb|KJB48677.1|  hypothetical protein B456_008G080700                  59.3    3e-07   Gossypium raimondii
ref|XP_010028108.1|  PREDICTED: BTB/POZ domain-containing protein...  59.3    3e-07   Eucalyptus grandis [rose gum]
ref|XP_004149698.1|  PREDICTED: BTB/POZ domain-containing protein...  59.3    3e-07   
gb|KJB48678.1|  hypothetical protein B456_008G080700                  59.3    3e-07   Gossypium raimondii
gb|AES90666.2|  phototropic-responsive NPH3 family protein            58.9    4e-07   Medicago truncatula
ref|XP_004509079.1|  PREDICTED: BTB/POZ domain-containing protein...  58.9    4e-07   Cicer arietinum [garbanzo]
gb|ACL53070.1|  unknown                                               58.5    5e-07   Zea mays [maize]
ref|XP_007156731.1|  hypothetical protein PHAVU_002G012500g           58.5    5e-07   Phaseolus vulgaris [French bean]
gb|EPS72379.1|  hypothetical protein M569_02379                       58.5    5e-07   Genlisea aurea
ref|XP_003597110.1|  Root phototropism protein                        58.5    5e-07   
tpg|DAA43883.1|  TPA: putative phototropic-responsive NPH3 family...  58.5    6e-07   
ref|XP_010685004.1|  PREDICTED: BTB/POZ domain-containing protein...  58.5    6e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007155848.1|  hypothetical protein PHAVU_003G236800g           58.5    6e-07   Phaseolus vulgaris [French bean]
gb|KEH27511.1|  phototropic-responsive NPH3 family protein            58.2    6e-07   Medicago truncatula
ref|XP_007133999.1|  hypothetical protein PHAVU_010G010500g           58.2    7e-07   Phaseolus vulgaris [French bean]
ref|XP_009630229.1|  PREDICTED: BTB/POZ domain-containing protein...  58.2    7e-07   Nicotiana tomentosiformis
ref|XP_007201187.1|  hypothetical protein PRUPE_ppa002993mg           58.2    8e-07   Prunus persica
gb|KDP32052.1|  hypothetical protein JCGZ_12513                       58.2    8e-07   Jatropha curcas
ref|XP_011089103.1|  PREDICTED: BTB/POZ domain-containing protein...  58.2    8e-07   Sesamum indicum [beniseed]
ref|XP_009780159.1|  PREDICTED: BTB/POZ domain-containing protein...  58.2    8e-07   Nicotiana sylvestris
ref|XP_006339816.1|  PREDICTED: BTB/POZ domain-containing protein...  57.4    1e-06   Solanum tuberosum [potatoes]
gb|ACL52494.1|  unknown                                               57.4    1e-06   Zea mays [maize]
emb|CDY30615.1|  BnaAnng03900D                                        57.4    1e-06   Brassica napus [oilseed rape]
gb|KFK28391.1|  hypothetical protein AALP_AA8G509000                  57.0    2e-06   Arabis alpina [alpine rockcress]
ref|XP_008235484.1|  PREDICTED: BTB/POZ domain-containing protein...  57.0    2e-06   Prunus mume [ume]
ref|XP_004231910.1|  PREDICTED: BTB/POZ domain-containing protein...  57.0    2e-06   Solanum lycopersicum
ref|XP_007208165.1|  hypothetical protein PRUPE_ppa002888mg           56.6    2e-06   Prunus persica
ref|XP_006290338.1|  hypothetical protein CARUB_v10016995mg           56.2    3e-06   
ref|XP_006364419.1|  PREDICTED: BTB/POZ domain-containing protein...  56.2    3e-06   Solanum tuberosum [potatoes]
ref|XP_011089989.1|  PREDICTED: BTB/POZ domain-containing protein...  56.2    3e-06   Sesamum indicum [beniseed]
emb|CDY37857.1|  BnaAnng05180D                                        56.2    4e-06   Brassica napus [oilseed rape]
gb|KFK34271.1|  hypothetical protein AALP_AA5G123300                  55.8    4e-06   Arabis alpina [alpine rockcress]
ref|XP_010503666.1|  PREDICTED: putative BTB/POZ domain-containin...  55.8    4e-06   Camelina sativa [gold-of-pleasure]
ref|XP_009628088.1|  PREDICTED: BTB/POZ domain-containing protein...  55.8    4e-06   Nicotiana tomentosiformis
dbj|BAK07863.1|  predicted protein                                    55.8    4e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010524688.1|  PREDICTED: BTB/POZ domain-containing protein...  55.8    4e-06   Tarenaya hassleriana [spider flower]
ref|NP_001152299.1|  transposon protein Mutator sub-class             55.5    5e-06   Zea mays [maize]
dbj|BAJ33928.1|  unnamed protein product                              55.5    5e-06   Eutrema halophilum
ref|XP_006395119.1|  hypothetical protein EUTSA_v10003813mg           55.5    6e-06   
ref|XP_008457766.1|  PREDICTED: BTB/POZ domain-containing protein...  55.5    6e-06   
gb|KDP26391.1|  hypothetical protein JCGZ_17549                       55.5    6e-06   Jatropha curcas
ref|XP_008457767.1|  PREDICTED: BTB/POZ domain-containing protein...  55.1    7e-06   Cucumis melo [Oriental melon]
ref|XP_004985270.1|  PREDICTED: BTB/POZ domain-containing protein...  55.1    7e-06   Setaria italica
emb|CBI33715.3|  unnamed protein product                              55.1    8e-06   Vitis vinifera
ref|XP_002521098.1|  protein binding protein, putative                54.7    1e-05   Ricinus communis
ref|XP_010939121.1|  PREDICTED: BTB/POZ domain-containing protein...  54.7    1e-05   Elaeis guineensis
ref|XP_006349069.1|  PREDICTED: BTB/POZ domain-containing protein...  54.7    1e-05   Solanum tuberosum [potatoes]
ref|XP_006393938.1|  hypothetical protein EUTSA_v10003858mg           54.3    1e-05   Eutrema salsugineum [saltwater cress]
dbj|BAJ34215.1|  unnamed protein product                              54.3    1e-05   Eutrema halophilum
ref|XP_009379310.1|  PREDICTED: BTB/POZ domain-containing protein...  53.9    2e-05   Pyrus x bretschneideri [bai li]
ref|XP_009379312.1|  PREDICTED: BTB/POZ domain-containing protein...  53.9    2e-05   
ref|XP_009792130.1|  PREDICTED: BTB/POZ domain-containing protein...  53.9    2e-05   Nicotiana sylvestris
ref|XP_006349068.1|  PREDICTED: BTB/POZ domain-containing protein...  53.9    2e-05   Solanum tuberosum [potatoes]
ref|XP_010486408.1|  PREDICTED: putative BTB/POZ domain-containin...  53.9    2e-05   Camelina sativa [gold-of-pleasure]
emb|CDY57361.1|  BnaC08g48680D                                        53.5    2e-05   Brassica napus [oilseed rape]
gb|KJB26098.1|  hypothetical protein B456_004G225600                  53.5    2e-05   Gossypium raimondii
ref|XP_009130549.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  53.5    3e-05   Brassica rapa
emb|CAN78287.1|  hypothetical protein VITISV_008137                   53.1    3e-05   Vitis vinifera
emb|CDP03873.1|  unnamed protein product                              53.1    3e-05   Coffea canephora [robusta coffee]
gb|KFK38267.1|  hypothetical protein AALP_AA3G091600                  53.1    3e-05   Arabis alpina [alpine rockcress]
ref|XP_002265786.1|  PREDICTED: BTB/POZ domain-containing protein...  53.1    3e-05   Vitis vinifera
emb|CBI37309.3|  unnamed protein product                              53.1    3e-05   Vitis vinifera
ref|XP_010652501.1|  PREDICTED: BTB/POZ domain-containing protein...  53.1    3e-05   Vitis vinifera
ref|XP_010652500.1|  PREDICTED: BTB/POZ domain-containing protein...  52.8    4e-05   Vitis vinifera
ref|XP_001769248.1|  predicted protein                                52.8    4e-05   
ref|XP_002301784.2|  hypothetical protein POPTR_0002s24380g           52.8    4e-05   Populus trichocarpa [western balsam poplar]
ref|XP_010484507.1|  PREDICTED: BTB/POZ domain-containing protein...  52.8    5e-05   Camelina sativa [gold-of-pleasure]
ref|XP_006386870.1|  hypothetical protein POPTR_0002s24380g           52.4    5e-05   
gb|AAU05485.1|  At5g67385                                             52.8    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011024680.1|  PREDICTED: BTB/POZ domain-containing protein...  52.8    5e-05   Populus euphratica
ref|XP_010484509.1|  PREDICTED: BTB/POZ domain-containing protein...  52.4    5e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010464139.1|  PREDICTED: BTB/POZ domain-containing protein...  52.4    5e-05   Camelina sativa [gold-of-pleasure]
ref|XP_004251006.1|  PREDICTED: BTB/POZ domain-containing protein...  52.4    5e-05   
gb|KHG00255.1|  hypothetical protein F383_19997                       52.4    5e-05   Gossypium arboreum [tree cotton]
gb|KJB42465.1|  hypothetical protein B456_007G154300                  52.4    5e-05   Gossypium raimondii
ref|XP_009371616.1|  PREDICTED: BTB/POZ domain-containing protein...  52.4    6e-05   Pyrus x bretschneideri [bai li]
ref|NP_680473.2|  phototropic-responsive NPH3-like protein            52.4    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010036820.1|  PREDICTED: BTB/POZ domain-containing protein...  52.4    6e-05   Eucalyptus grandis [rose gum]
ref|XP_006845260.1|  hypothetical protein AMTR_s00005p00262560        52.4    6e-05   
ref|XP_011089687.1|  PREDICTED: BTB/POZ domain-containing protein...  52.4    6e-05   Sesamum indicum [beniseed]
ref|XP_011089689.1|  PREDICTED: BTB/POZ domain-containing protein...  52.4    6e-05   Sesamum indicum [beniseed]
ref|XP_009611132.1|  PREDICTED: BTB/POZ domain-containing protein...  52.4    6e-05   Nicotiana tomentosiformis
ref|XP_011089686.1|  PREDICTED: BTB/POZ domain-containing protein...  52.4    6e-05   Sesamum indicum [beniseed]
ref|XP_006841959.1|  hypothetical protein AMTR_s00144p00020600        52.4    6e-05   Amborella trichopoda
ref|XP_007049780.1|  Phototropic-responsive NPH3 family protein       52.0    7e-05   
ref|XP_011099322.1|  PREDICTED: BTB/POZ domain-containing protein...  52.0    8e-05   Sesamum indicum [beniseed]
ref|XP_006443605.1|  hypothetical protein CICLE_v10019330mg           52.0    8e-05   Citrus clementina [clementine]
ref|XP_009757420.1|  PREDICTED: BTB/POZ domain-containing protein...  52.0    8e-05   Nicotiana sylvestris
ref|XP_009406358.1|  PREDICTED: BTB/POZ domain-containing protein...  52.0    8e-05   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN13450.1|  BTB/POZ domain-containing protein                     52.0    8e-05   Glycine soja [wild soybean]
ref|XP_003551322.2|  PREDICTED: BTB/POZ domain-containing protein...  52.0    9e-05   Glycine max [soybeans]
ref|XP_006356774.1|  PREDICTED: BTB/POZ domain-containing protein...  51.6    9e-05   Solanum tuberosum [potatoes]
ref|XP_010464475.1|  PREDICTED: putative BTB/POZ domain-containin...  51.6    1e-04   Camelina sativa [gold-of-pleasure]
ref|NP_199691.1|  phototropic-responsive NPH3 protein                 51.6    1e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KHG21232.1|  hypothetical protein F383_08117                       51.6    1e-04   Gossypium arboreum [tree cotton]
ref|XP_011459733.1|  PREDICTED: BTB/POZ domain-containing protein...  51.2    1e-04   Fragaria vesca subsp. vesca
ref|XP_002866705.1|  signal transducer                                51.2    1e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_010278266.1|  PREDICTED: BTB/POZ domain-containing protein...  51.2    1e-04   Nelumbo nucifera [Indian lotus]
ref|XP_008382632.1|  PREDICTED: BTB/POZ domain-containing protein...  51.2    1e-04   
ref|XP_008368005.1|  PREDICTED: BTB/POZ domain-containing protein...  50.4    2e-04   
ref|XP_009622877.1|  PREDICTED: BTB/POZ domain-containing protein...  51.2    2e-04   Nicotiana tomentosiformis
gb|AAS79592.1|  putative non-phototropic hypocotyl 3-like protein     50.8    2e-04   Ipomoea trifida
ref|XP_009334929.1|  PREDICTED: BTB/POZ domain-containing protein...  50.8    2e-04   Pyrus x bretschneideri [bai li]
gb|ADV56692.1|  NPH3 family protein                                   50.8    2e-04   
ref|XP_009337389.1|  PREDICTED: BTB/POZ domain-containing protein...  50.8    2e-04   
gb|EYU40606.1|  hypothetical protein MIMGU_mgv1a003057mg              50.8    2e-04   
ref|XP_007163074.1|  hypothetical protein PHAVU_001G203800g           50.8    2e-04   
ref|XP_010317168.1|  PREDICTED: BTB/POZ domain-containing protein...  50.8    2e-04   
ref|XP_009364840.1|  PREDICTED: BTB/POZ domain-containing protein...  50.8    2e-04   
ref|XP_008385468.1|  PREDICTED: BTB/POZ domain-containing protein...  50.8    2e-04   
gb|AAO16690.1|  hypothetical protein-like protein                     50.8    2e-04   
ref|XP_010100164.1|  BTB/POZ domain-containing protein                50.8    2e-04   
ref|XP_004233453.1|  PREDICTED: BTB/POZ domain-containing protein...  50.8    2e-04   
emb|CDX86278.1|  BnaA06g29950D                                        50.4    2e-04   
ref|XP_002863924.1|  phototropic-responsive NPH3 family protein       50.4    2e-04   
ref|XP_009151678.1|  PREDICTED: BTB/POZ domain-containing protein...  50.4    2e-04   
gb|KJB43880.1|  hypothetical protein B456_007G221600                  50.4    2e-04   
ref|XP_009337391.1|  PREDICTED: BTB/POZ domain-containing protein...  50.4    2e-04   
gb|KJB43882.1|  hypothetical protein B456_007G221600                  50.4    2e-04   
ref|XP_004247086.1|  PREDICTED: BTB/POZ domain-containing protein...  50.4    2e-04   
emb|CDX85365.1|  BnaC07g26760D                                        50.4    3e-04   
ref|XP_006281736.1|  hypothetical protein CARUB_v10027892mg           50.4    3e-04   
gb|EYU44474.1|  hypothetical protein MIMGU_mgv1a027075mg              50.4    3e-04   
ref|XP_004982336.1|  PREDICTED: uncharacterized protein LOC101754459  50.4    3e-04   
ref|XP_003558544.1|  PREDICTED: BTB/POZ domain-containing protein...  50.4    3e-04   
gb|KJB43883.1|  hypothetical protein B456_007G221600                  50.1    3e-04   
ref|XP_008228112.1|  PREDICTED: BTB/POZ domain-containing protein...  50.4    3e-04   
ref|XP_003604967.1|  BTB/POZ domain-containing protein                50.1    3e-04   
gb|KJB27631.1|  hypothetical protein B456_005G002800                  50.1    3e-04   
gb|KFK31290.1|  hypothetical protein AALP_AA6G093300                  50.1    3e-04   
ref|XP_006650337.1|  PREDICTED: BTB/POZ domain-containing protein...  50.1    3e-04   
ref|XP_007204975.1|  hypothetical protein PRUPE_ppa002796mg           50.1    3e-04   
gb|KHG06087.1|  hypothetical protein F383_05585                       50.1    3e-04   
ref|XP_004247004.1|  PREDICTED: BTB/POZ domain-containing protein...  49.7    4e-04   
ref|NP_187478.1|  phototropic-responsive NPH3 family protein          49.7    5e-04   
ref|XP_010245988.1|  PREDICTED: BTB/POZ domain-containing protein...  49.7    5e-04   
ref|XP_002464177.1|  hypothetical protein SORBIDRAFT_01g013680        49.7    5e-04   
ref|XP_006404081.1|  hypothetical protein EUTSA_v10010248mg           49.3    5e-04   
ref|XP_010245989.1|  PREDICTED: BTB/POZ domain-containing protein...  49.3    6e-04   
ref|XP_006280202.1|  hypothetical protein CARUB_v10026107mg           49.3    6e-04   
ref|XP_010245990.1|  PREDICTED: BTB/POZ domain-containing protein...  49.3    6e-04   
ref|XP_007144554.1|  hypothetical protein PHAVU_007G165600g           49.3    6e-04   
gb|KDO64171.1|  hypothetical protein CISIN_1g035818mg                 49.3    6e-04   
ref|XP_004144382.1|  PREDICTED: BTB/POZ domain-containing protein...  49.3    6e-04   
ref|XP_007144555.1|  hypothetical protein PHAVU_007G165600g           49.3    6e-04   
ref|XP_009410501.1|  PREDICTED: BTB/POZ domain-containing protein...  49.3    6e-04   
ref|XP_010243298.1|  PREDICTED: BTB/POZ domain-containing protein...  49.3    7e-04   
ref|XP_009410500.1|  PREDICTED: BTB/POZ domain-containing protein...  49.3    7e-04   
gb|KGN58361.1|  hypothetical protein Csa_3G627720                     49.3    7e-04   
ref|XP_006481239.1|  PREDICTED: BTB/POZ domain-containing protein...  49.3    7e-04   
ref|XP_003561994.1|  PREDICTED: BTB/POZ domain-containing protein...  48.9    7e-04   
ref|XP_010109730.1|  BTB/POZ domain-containing protein                48.9    7e-04   
ref|XP_010482146.1|  PREDICTED: BTB/POZ domain-containing protein...  48.9    7e-04   
ref|XP_010439675.1|  PREDICTED: BTB/POZ domain-containing protein...  48.9    8e-04   
ref|XP_007199752.1|  hypothetical protein PRUPE_ppa002803mg           48.9    8e-04   
ref|XP_008235006.1|  PREDICTED: BTB/POZ domain-containing protein...  48.9    8e-04   
ref|XP_010543146.1|  PREDICTED: BTB/POZ domain-containing protein...  48.9    8e-04   
ref|XP_010244571.1|  PREDICTED: BTB/POZ domain-containing protein...  48.9    8e-04   
ref|XP_009378916.1|  PREDICTED: BTB/POZ domain-containing protein...  48.9    8e-04   
ref|XP_008389180.1|  PREDICTED: BTB/POZ domain-containing protein...  48.9    8e-04   
ref|XP_010244572.1|  PREDICTED: BTB/POZ domain-containing protein...  48.9    9e-04   
ref|XP_011460693.1|  PREDICTED: BTB/POZ domain-containing protein...  48.9    9e-04   
ref|XP_008803011.1|  PREDICTED: BTB/POZ domain-containing protein...  48.5    0.001   
gb|EYU42051.1|  hypothetical protein MIMGU_mgv1a003173mg              48.5    0.001   



>ref|XP_009777101.1| PREDICTED: root phototropism protein 2 [Nicotiana sylvestris]
Length=574

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 117/140 (84%), Gaps = 4/140 (3%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALY+DQLKIRSG +D  + P+A+ATRNQLQADV+LVKENEAL
Sbjct  439  ARVHASQNKRLPVQIVLHALYFDQLKIRSGGDDTSNLPDAMATRNQLQADVSLVKENEAL  498

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            RTELL+MKM+I+D+Q            +  S  RKPTFFSS+SKKLGKLNPFKHGSKDTS
Sbjct  499  RTELLKMKMYISDIQK----TSQGTTSAKPSLSRKPTFFSSVSKKLGKLNPFKHGSKDTS  554

Query  191  NLDDGEVDITKPRRRRFSIS  132
             +DD  VDITKPRRRRFSIS
Sbjct  555  MIDDATVDITKPRRRRFSIS  574



>ref|XP_009611218.1| PREDICTED: root phototropism protein 2 [Nicotiana tomentosiformis]
Length=575

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 116/140 (83%), Gaps = 4/140 (3%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALY+DQLKIRSG +D  + P A+ATRNQLQADV+LVKENEAL
Sbjct  440  ARVHASQNKRLPVQIVLHALYFDQLKIRSGGDDTSNLPEAMATRNQLQADVSLVKENEAL  499

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            RTELL+MKM+I+D+Q            +  S  RKPTFFSS+SKKLGKLNPFKHGSKDTS
Sbjct  500  RTELLKMKMYISDIQK----TSQGTTSAKPSLSRKPTFFSSVSKKLGKLNPFKHGSKDTS  555

Query  191  NLDDGEVDITKPRRRRFSIS  132
             +DD  VDITKPRRRRFSIS
Sbjct  556  MIDDATVDITKPRRRRFSIS  575



>ref|XP_011089543.1| PREDICTED: root phototropism protein 2-like [Sesamum indicum]
Length=563

 Score =   207 bits (526),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 116/140 (83%), Gaps = 8/140 (6%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSGA+D K TP+A+ TRNQLQAD +LVKENEAL
Sbjct  432  ARVHASQNKRLPVQIVLHALYYDQLKLRSGADDHK-TPDALTTRNQLQADTSLVKENEAL  490

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            RTELL+MKM+I D+Q    +             +KPTFFSS+SK LGKLNPFKHGSKDTS
Sbjct  491  RTELLKMKMYIQDIQKSQGTTSKGSA-------KKPTFFSSVSKTLGKLNPFKHGSKDTS  543

Query  191  NLDDGEVDITKPRRRRFSIS  132
            N+DDG VD+TKPRRRRFSIS
Sbjct  544  NIDDGMVDLTKPRRRRFSIS  563



>gb|KHG08105.1| Root phototropism 2 -like protein [Gossypium arboreum]
Length=507

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 117/141 (83%), Gaps = 5/141 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG  D ++ P+A+ TRNQLQADV+LVKENEAL
Sbjct  371  ARVHASQNKRLPVQIVLHALYYDQLKLRSGGADDRNQPDAVTTRNQLQADVSLVKENEAL  430

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            RTELL+MKM+I+DMQ        +   S +   RKPTFFSSMSK LGKLNPF+HGSKDTS
Sbjct  431  RTELLKMKMYISDMQK----NNQTGTSSKSIGTRKPTFFSSMSKTLGKLNPFRHGSKDTS  486

Query  191  NLDDG-EVDITKPRRRRFSIS  132
            ++DD   VD+TKPRRRRFSIS
Sbjct  487  HIDDNLGVDVTKPRRRRFSIS  507



>gb|KJB26283.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=532

 Score =   203 bits (517),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 117/141 (83%), Gaps = 5/141 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG  D ++ P+A+ TRNQLQADV+LVKENEAL
Sbjct  396  ARVHASQNKRLPVQIVLHALYYDQLKLRSGGADDRNQPDAVTTRNQLQADVSLVKENEAL  455

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            RTELL+MKM+I+DMQ        +   S +   RKPTFFSSMSK LGKLNPF+HGSKDTS
Sbjct  456  RTELLKMKMYISDMQK----NNQTGTSSKSVGTRKPTFFSSMSKTLGKLNPFRHGSKDTS  511

Query  191  NLDDG-EVDITKPRRRRFSIS  132
            ++DD   VD+TKPRRRRFSIS
Sbjct  512  HIDDNLGVDVTKPRRRRFSIS  532



>gb|KJB26284.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=574

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 117/141 (83%), Gaps = 5/141 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG  D ++ P+A+ TRNQLQADV+LVKENEAL
Sbjct  438  ARVHASQNKRLPVQIVLHALYYDQLKLRSGGADDRNQPDAVTTRNQLQADVSLVKENEAL  497

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            RTELL+MKM+I+DMQ        +   S +   RKPTFFSSMSK LGKLNPF+HGSKDTS
Sbjct  498  RTELLKMKMYISDMQK----NNQTGTSSKSVGTRKPTFFSSMSKTLGKLNPFRHGSKDTS  553

Query  191  NLDDG-EVDITKPRRRRFSIS  132
            ++DD   VD+TKPRRRRFSIS
Sbjct  554  HIDDNLGVDVTKPRRRRFSIS  574



>gb|KJB26282.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=558

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 117/141 (83%), Gaps = 5/141 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG  D ++ P+A+ TRNQLQADV+LVKENEAL
Sbjct  422  ARVHASQNKRLPVQIVLHALYYDQLKLRSGGADDRNQPDAVTTRNQLQADVSLVKENEAL  481

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            RTELL+MKM+I+DMQ        +   S +   RKPTFFSSMSK LGKLNPF+HGSKDTS
Sbjct  482  RTELLKMKMYISDMQK----NNQTGTSSKSVGTRKPTFFSSMSKTLGKLNPFRHGSKDTS  537

Query  191  NLDDG-EVDITKPRRRRFSIS  132
            ++DD   VD+TKPRRRRFSIS
Sbjct  538  HIDDNLGVDVTKPRRRRFSIS  558



>emb|CDP04035.1| unnamed protein product [Coffea canephora]
Length=573

 Score =   201 bits (512),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 113/140 (81%), Gaps = 5/140 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG ED K  PNAI TR QLQAD +L +ENE L
Sbjct  439  ARVHASQNKRLPVQIVLHALYYDQLKLRSGTEDQK-MPNAITTRRQLQADTSLARENEEL  497

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            RTELL+MKM+IAD+Q        +   SS    ++PTFFSSMSK LGKLNPFKHGSKDTS
Sbjct  498  RTELLKMKMYIADLQKTQGPSTKATAASS----KRPTFFSSMSKTLGKLNPFKHGSKDTS  553

Query  191  NLDDGEVDITKPRRRRFSIS  132
            NLDD  VDI+KPRRRRFSIS
Sbjct  554  NLDDALVDISKPRRRRFSIS  573



>ref|XP_010244564.1| PREDICTED: root phototropism protein 2 [Nelumbo nucifera]
Length=571

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 116/140 (83%), Gaps = 6/140 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG  D + T +A+ TRNQ+QADV+L+KENEAL
Sbjct  438  ARVHASQNKRLPVQIVLHALYYDQLKLRSGVIDDRKTQDALMTRNQIQADVSLIKENEAL  497

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            RTELL+MKM+I+D+Q       +    S +   RKPTFFSS+SK LGKLNPF+HGSKDTS
Sbjct  498  RTELLKMKMYISDLQK------NQGTSSKSGGSRKPTFFSSVSKTLGKLNPFRHGSKDTS  551

Query  191  NLDDGEVDITKPRRRRFSIS  132
            N+DD  +D+TKPRRRRFS+S
Sbjct  552  NIDDSAIDLTKPRRRRFSVS  571



>ref|XP_006432049.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45289.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
Length=382

 Score =   192 bits (488),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +STP+A ATRNQLQADV+L+KENEAL
Sbjct  240  ARVHASQNKRLPVQIVLHALYYDQLKLRSGLDNDRSTPDAAATRNQLQADVSLIKENEAL  299

Query  371  RTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDT  195
            R+EL +MK++I+DMQ     +   S   S  S  +K TFFSSMSK  GKLNPFKHGSKDT
Sbjct  300  RSELTRMKLYISDMQKGNNQAGTGSSSKSGTSGHKKHTFFSSMSKTFGKLNPFKHGSKDT  359

Query  194  SNLDD--GEVDITKPRRRRFSIS  132
            SN+DD    +D TKPRRRRFSIS
Sbjct  360  SNIDDDVAAMDGTKPRRRRFSIS  382



>ref|XP_007017103.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOY34722.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=576

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 117/143 (82%), Gaps = 7/143 (5%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAED--PKSTPNAIATRNQLQADVTLVKENE  378
            ARVHASQNKRLPVQIVLHALYYDQLK+RSGA D   ++  +A+ATRNQLQADV+LVKENE
Sbjct  438  ARVHASQNKRLPVQIVLHALYYDQLKLRSGAVDDRERNAADAVATRNQLQADVSLVKENE  497

Query  377  ALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKD  198
            ALR+EL +MKM+I+D+Q             SA+  RKPTFFSSMSK LGKLNPF+HGSKD
Sbjct  498  ALRSELKKMKMYISDLQK----NNQGTCSKSAAGNRKPTFFSSMSKTLGKLNPFRHGSKD  553

Query  197  TSNLDDG-EVDITKPRRRRFSIS  132
            TSN+DD   VD+TKPRRRRFSIS
Sbjct  554  TSNIDDSLGVDVTKPRRRRFSIS  576



>emb|CBI15802.3| unnamed protein product [Vitis vinifera]
Length=213

 Score =   184 bits (466),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 117/141 (83%), Gaps = 7/141 (5%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSGA+D     +A++TR+ LQADV+LV+ENEAL
Sbjct  79   ARVHASQNKRLPVQIVLHALYYDQLKLRSGADDAH---DAMSTRSHLQADVSLVRENEAL  135

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            R+EL++MKM+I+D+Q   S+ G    G  +    KPTFFSSMSK LGKLNPF+HGSKDTS
Sbjct  136  RSELMKMKMYISDIQKNSSAGGGKGLGGGSK---KPTFFSSMSKTLGKLNPFRHGSKDTS  192

Query  191  NLDD-GEVDITKPRRRRFSIS  132
            N+DD   VD+TKPRRRRFSIS
Sbjct  193  NIDDETAVDVTKPRRRRFSIS  213



>ref|XP_006432045.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006432047.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45285.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45287.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
Length=541

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +STP+A ATRNQLQADV+L+KENEAL
Sbjct  399  ARVHASQNKRLPVQIVLHALYYDQLKLRSGLDNDRSTPDAAATRNQLQADVSLIKENEAL  458

Query  371  RTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDT  195
            R+EL +MK++I+DMQ     +   S   S  S  +K TFFSSMSK  GKLNPFKHGSKDT
Sbjct  459  RSELTRMKLYISDMQKGNNQAGTGSSSKSGTSGHKKHTFFSSMSKTFGKLNPFKHGSKDT  518

Query  194  SNLDD--GEVDITKPRRRRFSIS  132
            SN+DD    +D TKPRRRRFSIS
Sbjct  519  SNIDDDVAAMDGTKPRRRRFSIS  541



>gb|EYU36889.1| hypothetical protein MIMGU_mgv1a003487mg [Erythranthe guttata]
Length=582

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 118/148 (80%), Gaps = 8/148 (5%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIATRNQLQADVTLVKENEA  375
            ARVHASQNKRLPVQIVLHALYYDQL +RSGA ED   TP+A +TRNQLQADV+L KENEA
Sbjct  435  ARVHASQNKRLPVQIVLHALYYDQLMLRSGADEDDHKTPDAGSTRNQLQADVSLAKENEA  494

Query  374  LRTELLQMKMFIADMQ-------NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  216
            LRTELL+MKM+I D+Q          S+  S+   +SAS  RKP FFSSMSK LGKLNPF
Sbjct  495  LRTELLKMKMYIQDIQRPQGTTSKAVSTSTSTSASASASTSRKPKFFSSMSKTLGKLNPF  554

Query  215  KHGSKDTSNLDDGEVDITKPRRRRFSIS  132
            KHGSKDT NLD+G  D+TKPRRRRFSIS
Sbjct  555  KHGSKDTLNLDEGMPDLTKPRRRRFSIS  582



>ref|XP_006432046.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006432048.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006464960.1| PREDICTED: root phototropism protein 2-like isoform X1 [Citrus 
sinensis]
 gb|ESR45286.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45288.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
Length=584

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +STP+A ATRNQLQADV+L+KENEAL
Sbjct  442  ARVHASQNKRLPVQIVLHALYYDQLKLRSGLDNDRSTPDAAATRNQLQADVSLIKENEAL  501

Query  371  RTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDT  195
            R+EL +MK++I+DMQ     +   S   S  S  +K TFFSSMSK  GKLNPFKHGSKDT
Sbjct  502  RSELTRMKLYISDMQKGNNQAGTGSSSKSGTSGHKKHTFFSSMSKTFGKLNPFKHGSKDT  561

Query  194  SNLDD--GEVDITKPRRRRFSIS  132
            SN+DD    +D TKPRRRRFSIS
Sbjct  562  SNIDDDVAAMDGTKPRRRRFSIS  584



>ref|XP_006353728.1| PREDICTED: root phototropism protein 2-like [Solanum tuberosum]
Length=576

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 118/143 (83%), Gaps = 7/143 (5%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDP--KSTPNAIATRNQLQADVTLVKENE  378
            ARVHASQNKRLPVQIVLHALY+DQLK+RSGA D    + P A+ATRNQLQADV+LVKENE
Sbjct  438  ARVHASQNKRLPVQIVLHALYFDQLKLRSGAADDTNNNMPEAMATRNQLQADVSLVKENE  497

Query  377  ALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKD  198
             LRTELL+MKM+IAD+Q       +S +G+S   ++K TFFSS+SK LGK NPFKHGSKD
Sbjct  498  VLRTELLKMKMYIADIQK----TTTSTQGTSKGGLKKTTFFSSVSKTLGKFNPFKHGSKD  553

Query  197  TSNL-DDGEVDITKPRRRRFSIS  132
            TSN+ DD  +D+TKPRRRRFSIS
Sbjct  554  TSNIVDDAALDLTKPRRRRFSIS  576



>gb|KDO54918.1| hypothetical protein CISIN_1g007944mg [Citrus sinensis]
Length=541

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 115/143 (80%), Gaps = 3/143 (2%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +STP+A ATRNQLQADV L+KENEAL
Sbjct  399  ARVHASQNKRLPVQIVLHALYYDQLKLRSGLDNDRSTPDAAATRNQLQADVLLIKENEAL  458

Query  371  RTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDT  195
            R+EL +MK++I+D+Q     +   S   S  S  +K TFFSSMSK  GKLNPFKHGSKDT
Sbjct  459  RSELTRMKLYISDVQKGNNQAGTGSSSKSGTSGHKKHTFFSSMSKTFGKLNPFKHGSKDT  518

Query  194  SNLDD--GEVDITKPRRRRFSIS  132
            SN+DD    +D TKPRRRRFSIS
Sbjct  519  SNIDDDVAAMDGTKPRRRRFSIS  541



>ref|XP_004243653.1| PREDICTED: root phototropism protein 2 [Solanum lycopersicum]
Length=576

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 119/143 (83%), Gaps = 7/143 (5%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST--PNAIATRNQLQADVTLVKENE  378
            ARVHASQNKRLPVQIVLHALY+DQLKIRSGA D  +   P A+ATRNQLQADV+LVKENE
Sbjct  438  ARVHASQNKRLPVQIVLHALYFDQLKIRSGAADDSNNNMPEAMATRNQLQADVSLVKENE  497

Query  377  ALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKD  198
             LRTELL+MKM+IAD+Q       +S +G+S  +++K TFFSS+SK LGK NPFKHGSKD
Sbjct  498  VLRTELLKMKMYIADIQK----TTNSSQGTSKGSLKKTTFFSSVSKTLGKFNPFKHGSKD  553

Query  197  TSNL-DDGEVDITKPRRRRFSIS  132
            TS++ DD  +D+TKPRRRRFSIS
Sbjct  554  TSSIVDDAALDLTKPRRRRFSIS  576



>gb|KDO54917.1| hypothetical protein CISIN_1g007944mg [Citrus sinensis]
Length=584

 Score =   189 bits (480),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 115/143 (80%), Gaps = 3/143 (2%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +STP+A ATRNQLQADV L+KENEAL
Sbjct  442  ARVHASQNKRLPVQIVLHALYYDQLKLRSGLDNDRSTPDAAATRNQLQADVLLIKENEAL  501

Query  371  RTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDT  195
            R+EL +MK++I+D+Q     +   S   S  S  +K TFFSSMSK  GKLNPFKHGSKDT
Sbjct  502  RSELTRMKLYISDVQKGNNQAGTGSSSKSGTSGHKKHTFFSSMSKTFGKLNPFKHGSKDT  561

Query  194  SNLDD--GEVDITKPRRRRFSIS  132
            SN+DD    +D TKPRRRRFSIS
Sbjct  562  SNIDDDVAAMDGTKPRRRRFSIS  584



>ref|XP_010650806.1| PREDICTED: root phototropism protein 2 isoform X2 [Vitis vinifera]
Length=527

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 115/141 (82%), Gaps = 7/141 (5%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSGA+D     +A++TR+ LQADV+LV+ENEAL
Sbjct  393  ARVHASQNKRLPVQIVLHALYYDQLKLRSGADDAH---DAMSTRSHLQADVSLVRENEAL  449

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            R+EL++MKM+I+D+Q    +  +          +KPTFFSSMSK LGKLNPF+HGSKDTS
Sbjct  450  RSELMKMKMYISDIQK---NSSAGGGKGLGGGSKKPTFFSSMSKTLGKLNPFRHGSKDTS  506

Query  191  NLDD-GEVDITKPRRRRFSIS  132
            N+DD   VD+TKPRRRRFSIS
Sbjct  507  NIDDETAVDVTKPRRRRFSIS  527



>gb|KHN24717.1| Root phototropism protein 2 [Glycine soja]
Length=152

 Score =   174 bits (442),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 116/148 (78%), Gaps = 13/148 (9%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-RNQLQADVTLVKENEA  375
            ARVHASQNKRLPVQIVLHALYYDQL++RSGAE+ +     +AT +NQLQ DVTLV+ENE 
Sbjct  10   ARVHASQNKRLPVQIVLHALYYDQLRLRSGAEERE-----VATEKNQLQMDVTLVRENEE  64

Query  374  LRTELLQMKMFIADMQNkgssqgs-------svkgssasaVRKPTFFSSMSKKLGKLNPF  216
            LRTEL++MKM+I+D+Q   ++          +   ++    +K TFFSS+SK LGKLNPF
Sbjct  65   LRTELMKMKMYISDLQQNKNTNNGANPQGHGTTSSAANPNPKKATFFSSVSKTLGKLNPF  124

Query  215  KHGSKDTSNLDDGEVDITKPRRRRFSIS  132
            ++GSKDT++L+DG VD+TKPRRRRFS+S
Sbjct  125  RNGSKDTTHLEDGNVDLTKPRRRRFSVS  152



>ref|XP_002264896.1| PREDICTED: root phototropism protein 2 isoform X1 [Vitis vinifera]
Length=572

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 115/141 (82%), Gaps = 7/141 (5%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSGA+D     +A++TR+ LQADV+LV+ENEAL
Sbjct  438  ARVHASQNKRLPVQIVLHALYYDQLKLRSGADDAH---DAMSTRSHLQADVSLVRENEAL  494

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            R+EL++MKM+I+D+Q    +  +          +KPTFFSSMSK LGKLNPF+HGSKDTS
Sbjct  495  RSELMKMKMYISDIQK---NSSAGGGKGLGGGSKKPTFFSSMSKTLGKLNPFRHGSKDTS  551

Query  191  NLDD-GEVDITKPRRRRFSIS  132
            N+DD   VD+TKPRRRRFSIS
Sbjct  552  NIDDETAVDVTKPRRRRFSIS  572



>gb|KDP45678.1| hypothetical protein JCGZ_17285 [Jatropha curcas]
Length=575

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 115/142 (81%), Gaps = 7/142 (5%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIA-TRNQLQADVTLVKENEA  375
            AR+HASQNKRLPVQIVLHALYYDQLK+RSG  +  +    ++ T+NQLQ DV+L++ENEA
Sbjct  439  ARLHASQNKRLPVQIVLHALYYDQLKLRSGVVESSTPETPVSNTKNQLQTDVSLIRENEA  498

Query  374  LRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDT  195
            LR+EL +MK++I+DMQ   +   S+  GS     RKPTFFSSMSK LGKLNPFKHGSKDT
Sbjct  499  LRSELTKMKLYISDMQKNSNQGSSTKSGS-----RKPTFFSSMSKTLGKLNPFKHGSKDT  553

Query  194  SNLDDGE-VDITKPRRRRFSIS  132
            S+LDDG  +DITKPRRRRFSIS
Sbjct  554  SHLDDGAGIDITKPRRRRFSIS  575



>ref|XP_010677799.1| PREDICTED: root phototropism protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=581

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 114/140 (81%), Gaps = 5/140 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQ+VLHALYYDQLK+RSGA D    P+AIATR Q++AD +L KENEAL
Sbjct  447  ARVHASQNKRLPVQMVLHALYYDQLKLRSGAND-GPLPDAIATRGQVKADASLAKENEAL  505

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            ++EL++MKM+I+DMQ   ++   +   +      K TFFSSMSK LGKLNPFKHGSKDTS
Sbjct  506  KSELMKMKMYISDMQKNKATTSRTSTATGMP---KRTFFSSMSKTLGKLNPFKHGSKDTS  562

Query  191  NLDDGEVDITKPRRRRFSIS  132
            +LDD EVD+TKPRRRRFSIS
Sbjct  563  HLDD-EVDLTKPRRRRFSIS  581



>ref|XP_002325631.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
 gb|EEF00013.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
Length=575

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 117/143 (82%), Gaps = 6/143 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            AR+HASQNKRLPVQIVLH LYYDQLK+RSGA+D    P+A ATR+QLQ+DV+LV ENEAL
Sbjct  436  ARLHASQNKRLPVQIVLHTLYYDQLKLRSGADD---QPDAAATRSQLQSDVSLVSENEAL  492

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaV--RKPTFFSSMSKKLGKLNPFKHGSKD  198
            R+EL +MK++I+DMQ    S   S+  ++A+    RK TFFSSMSK LGKLNPFKHGSKD
Sbjct  493  RSELTKMKLYISDMQKDKGSSAKSISAAAATTSGPRKHTFFSSMSKTLGKLNPFKHGSKD  552

Query  197  TSNLDDG-EVDITKPRRRRFSIS  132
            TS++DD   VDITKPRRRRFS+S
Sbjct  553  TSHIDDNIAVDITKPRRRRFSVS  575



>ref|XP_010023564.1| PREDICTED: root phototropism protein 2 [Eucalyptus grandis]
 gb|KCW59867.1| hypothetical protein EUGRSUZ_H02604 [Eucalyptus grandis]
Length=570

 Score =   183 bits (464),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 114/140 (81%), Gaps = 7/140 (5%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            AR+HASQNKRLPVQIVLHALYYDQLK+RSG ED K  P+A+ TR+QLQAD +L+KENE L
Sbjct  438  ARLHASQNKRLPVQIVLHALYYDQLKLRSGTEDHKG-PDAVTTRHQLQADSSLIKENEDL  496

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            R+EL++MKM+I+D+Q       +    S+    ++ TFFSSMSK LGKLNPF+HGSKDTS
Sbjct  497  RSELMKMKMYISDLQK-----TNHGTTSAKGGPKRHTFFSSMSKTLGKLNPFRHGSKDTS  551

Query  191  NLDDGEVDITKPRRRRFSIS  132
            N++D  VDITKPR+RRFSIS
Sbjct  552  NIEDA-VDITKPRKRRFSIS  570



>ref|XP_002533880.1| Root phototropism protein, putative [Ricinus communis]
 gb|EEF28503.1| Root phototropism protein, putative [Ricinus communis]
Length=549

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 114/143 (80%), Gaps = 9/143 (6%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIA--TRNQLQADVTLVKENE  378
            AR+HASQNKRLPVQIVLH LY+DQLK+RSG  D +STP A+A  T++QLQ DV+L++ENE
Sbjct  413  ARLHASQNKRLPVQIVLHCLYFDQLKLRSGVAD-RSTPEAMAPNTKSQLQTDVSLIRENE  471

Query  377  ALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKD  198
            ALR+EL++MK++I DMQ       S    S+    RK TFFSSMSK LGKLNPFKHGSKD
Sbjct  472  ALRSELMKMKLYITDMQK-----SSQGTTSARGGPRKTTFFSSMSKTLGKLNPFKHGSKD  526

Query  197  TSNLDD-GEVDITKPRRRRFSIS  132
            TS++DD   VDITKPRRRRFSIS
Sbjct  527  TSHIDDSAGVDITKPRRRRFSIS  549



>ref|XP_011041764.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=574

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 119/142 (84%), Gaps = 5/142 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            AR+HASQNKRLP+QIVLH LYYDQLK+RSGA+D    P+A ATR+QLQ+DV+LV ENEAL
Sbjct  436  ARIHASQNKRLPLQIVLHTLYYDQLKLRSGADD---QPDAAATRSQLQSDVSLVSENEAL  492

Query  371  RTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDT  195
            R+EL +MK++I++MQ NKGSS  S    ++ S  RK TFFSSMSK LGKLNPFKHGSKDT
Sbjct  493  RSELKKMKLYISEMQKNKGSSAKSISAAAATSGPRKHTFFSSMSKTLGKLNPFKHGSKDT  552

Query  194  SNLDDG-EVDITKPRRRRFSIS  132
            S++DD   VDITKPRRRRFS+S
Sbjct  553  SHIDDNLAVDITKPRRRRFSVS  574



>ref|XP_004147730.1| PREDICTED: root phototropism protein 2-like [Cucumis sativus]
 ref|XP_004164428.1| PREDICTED: root phototropism protein 2-like [Cucumis sativus]
Length=582

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 114/143 (80%), Gaps = 7/143 (5%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIAT--RNQLQADVTLVKEN  381
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG  +D KST    AT  R Q QADV+LVKEN
Sbjct  444  ARVHASQNKRLPVQIVLHALYYDQLKLRSGTPDDRKSTQEDAATMARTQAQADVSLVKEN  503

Query  380  EALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSK  201
            EALR+EL++MK++I+DMQ       S    +S S   K TFFSS+SK LGKLNPF+HGSK
Sbjct  504  EALRSELMKMKLYISDMQKSSQGTSSIKVPTSRS---KGTFFSSVSKTLGKLNPFRHGSK  560

Query  200  DTSNLDDGEVDITKPRRRRFSIS  132
            DTSN+DDG +DITKPRRRRFSIS
Sbjct  561  DTSNIDDG-IDITKPRRRRFSIS  582



>gb|KGN53487.1| hypothetical protein Csa_4G056750 [Cucumis sativus]
Length=572

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 114/143 (80%), Gaps = 7/143 (5%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIAT--RNQLQADVTLVKEN  381
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG  +D KST    AT  R Q QADV+LVKEN
Sbjct  434  ARVHASQNKRLPVQIVLHALYYDQLKLRSGTPDDRKSTQEDAATMARTQAQADVSLVKEN  493

Query  380  EALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSK  201
            EALR+EL++MK++I+DMQ       S    +S S   K TFFSS+SK LGKLNPF+HGSK
Sbjct  494  EALRSELMKMKLYISDMQKSSQGTSSIKVPTSRS---KGTFFSSVSKTLGKLNPFRHGSK  550

Query  200  DTSNLDDGEVDITKPRRRRFSIS  132
            DTSN+DDG +DITKPRRRRFSIS
Sbjct  551  DTSNIDDG-IDITKPRRRRFSIS  572



>ref|XP_011011776.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=595

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 117/144 (81%), Gaps = 7/144 (5%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            AR+HASQNKRLPVQIVLHALYYDQLK+RSG +D    P+A+ATR+QLQ+DV+LV+ENEAL
Sbjct  455  ARLHASQNKRLPVQIVLHALYYDQLKLRSGVDD---QPDAVATRSQLQSDVSLVRENEAL  511

Query  371  RTELLQMKMFIADM---QNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSK  201
            R+EL++MK++I+DM   Q   +   ++    + +  RK +FFSSMSK LGKLNPFKHGSK
Sbjct  512  RSELMKMKLYISDMQKNQGSSTKGIAAAAAPTTTGSRKHSFFSSMSKTLGKLNPFKHGSK  571

Query  200  DTSNLDDG-EVDITKPRRRRFSIS  132
            DT +++D   VDITKPRRRRFSIS
Sbjct  572  DTLHINDNIGVDITKPRRRRFSIS  595



>ref|XP_002319980.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
 gb|EEE95903.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
Length=578

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 116/144 (81%), Gaps = 7/144 (5%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            AR+HASQNKRLPVQIVLHALYYDQLK+RSG  D    P+A+ATR+QLQ+DV+LV+ENEAL
Sbjct  438  ARLHASQNKRLPVQIVLHALYYDQLKLRSGVND---QPDAVATRSQLQSDVSLVRENEAL  494

Query  371  RTELLQMKMFIADM---QNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSK  201
            R+EL++MK++I+DM   Q   +   ++    + +  RK +FFSSMSK LGKLNPFKHGSK
Sbjct  495  RSELMKMKLYISDMQKNQGSSTKGIAATAAPTTTGSRKHSFFSSMSKTLGKLNPFKHGSK  554

Query  200  DTSNLDDG-EVDITKPRRRRFSIS  132
            DT +++D   VDITKPRRRRFSIS
Sbjct  555  DTFHINDNIGVDITKPRRRRFSIS  578



>ref|XP_004294714.1| PREDICTED: root phototropism protein 2 [Fragaria vesca subsp. 
vesca]
Length=581

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 119/144 (83%), Gaps = 5/144 (3%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            AR+HASQNKRLPVQIVLHALYYDQLK+RSG E+ ++  +A +TRNQ+QADV+L KENE L
Sbjct  439  ARLHASQNKRLPVQIVLHALYYDQLKLRSGEEENETQIDAASTRNQVQADVSLAKENEVL  498

Query  371  RTELLQMKMFIADMQN----kgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGS  204
            RTELL+MKM+I+D++      G+S  ++  G      RKPTFFSS+SKKLGKLNPFK+GS
Sbjct  499  RTELLKMKMYISDIKKSGGGAGASAATTSSGKGGGGPRKPTFFSSVSKKLGKLNPFKNGS  558

Query  203  KDTSNLDDGEVDITKPRRRRFSIS  132
            KDTSN+DD  VD+TKPRRRRFSIS
Sbjct  559  KDTSNIDDC-VDVTKPRRRRFSIS  581



>ref|XP_008451888.1| PREDICTED: root phototropism protein 2 isoform X2 [Cucumis melo]
Length=582

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 114/143 (80%), Gaps = 7/143 (5%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIAT--RNQLQADVTLVKEN  381
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG  +D KST    A+  R Q QADV+LVKEN
Sbjct  444  ARVHASQNKRLPVQIVLHALYYDQLKLRSGTPDDRKSTQEDAASMARTQAQADVSLVKEN  503

Query  380  EALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSK  201
            EALR+EL++MK++I+DMQ       S    +S S   K TFFSS+SK LGKLNPF+HGSK
Sbjct  504  EALRSELMKMKLYISDMQRSSQGTSSIKVPTSRS---KGTFFSSVSKTLGKLNPFRHGSK  560

Query  200  DTSNLDDGEVDITKPRRRRFSIS  132
            DTSN+DDG +DITKPRRRRFSIS
Sbjct  561  DTSNIDDG-IDITKPRRRRFSIS  582



>ref|XP_006293884.1| hypothetical protein CARUB_v10022870mg [Capsella rubella]
 gb|EOA26782.1| hypothetical protein CARUB_v10022870mg [Capsella rubella]
Length=593

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 116/150 (77%), Gaps = 10/150 (7%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQADVTLVK  387
            AR+HASQNKRLPV IVLHALYYDQLK+RSG ED +       P A+ TR+QLQAD TL K
Sbjct  444  ARLHASQNKRLPVNIVLHALYYDQLKLRSGVEDQEERAVVVLPEALKTRSQLQADTTLAK  503

Query  386  ENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP---TFFSSMSKKLGKLNPF  216
            ENEALR+EL++MKM+++DMQ   +  G+S   SS+    K    TFFSS+SKKLGKLNPF
Sbjct  504  ENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSNKKSKNTFFSSVSKKLGKLNPF  563

Query  215  KHGSKDTSNLDD--GEVDITKPRRRRFSIS  132
            KHGSKDTSN+D+    VDITKPRRRRFSIS
Sbjct  564  KHGSKDTSNIDEDLAGVDITKPRRRRFSIS  593



>ref|XP_003544940.2| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=579

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 114/140 (81%), Gaps = 2/140 (1%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHAS+NKRLP+QIVLHALYYDQL IRSG  + K    A+A + QLQADV+LV+ENE L
Sbjct  442  ARVHASKNKRLPLQIVLHALYYDQLHIRSGTAEEK-VALAVAEKKQLQADVSLVRENEEL  500

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            R+EL++MKMFI+DMQ  G    SS + +   A +KPTFFSSMSKKL KLNPFK+GSKDTS
Sbjct  501  RSELMKMKMFISDMQKHGHGTSSSGRENIGLA-KKPTFFSSMSKKLSKLNPFKNGSKDTS  559

Query  191  NLDDGEVDITKPRRRRFSIS  132
            ++DD  VD+TKPRRRRFSIS
Sbjct  560  HIDDAPVDLTKPRRRRFSIS  579



>gb|ACJ85866.1| unknown [Medicago truncatula]
Length=376

 Score =   176 bits (447),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 109/140 (78%), Gaps = 5/140 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLKIRSGA   +   +    RNQLQ DVTLV+ENE L
Sbjct  242  ARVHASQNKRLPVQIVLHALYYDQLKIRSGATAERDAED----RNQLQTDVTLVRENEEL  297

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            RTEL++MKM+++D+Q  G    +S         +  TFFSS+SKKLGKLNPFK+GSKDTS
Sbjct  298  RTELIRMKMYVSDLQKNGHGGTTSSSEVGKEV-KNSTFFSSVSKKLGKLNPFKNGSKDTS  356

Query  191  NLDDGEVDITKPRRRRFSIS  132
            +++D  VD+TKPRRRRFSIS
Sbjct  357  HIEDVGVDLTKPRRRRFSIS  376



>gb|KEH28209.1| root phototropism-like protein [Medicago truncatula]
Length=536

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 110/140 (79%), Gaps = 5/140 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLKIRSGA   +   +    RNQLQ DVTLV+ENE L
Sbjct  402  ARVHASQNKRLPVQIVLHALYYDQLKIRSGATAERDAED----RNQLQTDVTLVRENEEL  457

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            RTEL++MKM+++D+Q  G    +S         +K TFFSS+SKKLGKLNPFK+GSKDTS
Sbjct  458  RTELIRMKMYVSDLQKNGHGGTTSSSEVGKEV-KKSTFFSSVSKKLGKLNPFKNGSKDTS  516

Query  191  NLDDGEVDITKPRRRRFSIS  132
            +++D  VD+TKPRRRRFSIS
Sbjct  517  HIEDVGVDLTKPRRRRFSIS  536



>ref|XP_010094443.1| Root phototropism protein 2 [Morus notabilis]
 gb|EXB56024.1| Root phototropism protein 2 [Morus notabilis]
Length=574

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 111/140 (79%), Gaps = 3/140 (2%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG  D      A   R+QLQADV+LV+ENEAL
Sbjct  438  ARVHASQNKRLPVQIVLHALYYDQLKLRSGVADDHDAKEAATARSQLQADVSLVRENEAL  497

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            R EL +MK++I D+Q   + Q ++    +  + ++PTFFSS+SK LGKLNPFKHGSKDTS
Sbjct  498  RAELTKMKLYITDIQK--NGQTTATSSRAVGSTKRPTFFSSVSKTLGKLNPFKHGSKDTS  555

Query  191  NLDDGEVDITKPRRRRFSIS  132
            +++D  VDI+KPRRRRFSIS
Sbjct  556  HIED-VVDISKPRRRRFSIS  574



>ref|XP_003616056.1| Root phototropism protein [Medicago truncatula]
 gb|AES99014.1| root phototropism-like protein [Medicago truncatula]
Length=579

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 110/140 (79%), Gaps = 5/140 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLKIRSGA   +   +    RNQLQ DVTLV+ENE L
Sbjct  445  ARVHASQNKRLPVQIVLHALYYDQLKIRSGATAERDAED----RNQLQTDVTLVRENEEL  500

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            RTEL++MKM+++D+Q  G    +S         +K TFFSS+SKKLGKLNPFK+GSKDTS
Sbjct  501  RTELIRMKMYVSDLQKNGHGGTTSSSEVGKEV-KKSTFFSSVSKKLGKLNPFKNGSKDTS  559

Query  191  NLDDGEVDITKPRRRRFSIS  132
            +++D  VD+TKPRRRRFSIS
Sbjct  560  HIEDVGVDLTKPRRRRFSIS  579



>dbj|BAJ33924.1| unnamed protein product [Thellungiella halophila]
Length=597

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 117/154 (76%), Gaps = 14/154 (9%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----TPNAIATRNQLQADVTLVKE  384
            AR+HASQNKRLPV IVLHALYYDQLK+RSG ED +      P A+ATR Q++AD +L KE
Sbjct  444  ARLHASQNKRLPVNIVLHALYYDQLKLRSGVEDKEGAVVMVPEALATRGQVKADTSLAKE  503

Query  383  NEALRTELLQMKMFIADMQN--------kgssqgssvkgssasaVRKPTFFSSMSKKLGK  228
            NEALR+EL++MKM+++D+Q          G+S  +S    ++    KPTFFSS+SKKLGK
Sbjct  504  NEALRSELMKMKMYVSDLQKNKQSGGGGAGASSSNSSSLVNSKKSNKPTFFSSVSKKLGK  563

Query  227  LNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  132
            LNPF+HGSKDTSN+D+    VDITKPRRRRFSIS
Sbjct  564  LNPFRHGSKDTSNIDEDLAGVDITKPRRRRFSIS  597



>ref|XP_003519296.1| PREDICTED: root phototropism protein 2 [Glycine max]
Length=580

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHAS+NKRLP+QIVLHALYYDQL+IRSG    K    A A + QLQADV+LV+ENE L
Sbjct  442  ARVHASKNKRLPLQIVLHALYYDQLQIRSGTAADKQAVVAAAEKKQLQADVSLVRENEEL  501

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            R+EL++MKMFI+D+Q       SS    +    +KPTFFSSMSKKL KLNPFK+GSKDTS
Sbjct  502  RSELMKMKMFISDLQK-NVHGTSSSGRENIGPTKKPTFFSSMSKKLSKLNPFKNGSKDTS  560

Query  191  NLDDGEVDITKPRRRRFSIS  132
            ++DD  VD+TKPR+RRFSIS
Sbjct  561  HIDDAPVDLTKPRKRRFSIS  580



>ref|XP_008451887.1| PREDICTED: root phototropism protein 2 isoform X1 [Cucumis melo]
Length=666

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 114/143 (80%), Gaps = 7/143 (5%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIAT--RNQLQADVTLVKEN  381
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG  +D KST    A+  R Q QADV+LVKEN
Sbjct  528  ARVHASQNKRLPVQIVLHALYYDQLKLRSGTPDDRKSTQEDAASMARTQAQADVSLVKEN  587

Query  380  EALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSK  201
            EALR+EL++MK++I+DMQ       S    +S S   K TFFSS+SK LGKLNPF+HGSK
Sbjct  588  EALRSELMKMKLYISDMQRSSQGTSSIKVPTSRS---KGTFFSSVSKTLGKLNPFRHGSK  644

Query  200  DTSNLDDGEVDITKPRRRRFSIS  132
            DTSN+DDG +DITKPRRRRFSIS
Sbjct  645  DTSNIDDG-IDITKPRRRRFSIS  666



>ref|XP_011015900.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=579

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 118/147 (80%), Gaps = 10/147 (7%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            AR+HASQNKRLP+QIVLH LYYDQLK+RSGA+D    P+A ATR+QLQ+DV+LV ENEAL
Sbjct  436  ARIHASQNKRLPLQIVLHTLYYDQLKLRSGADD---QPDAAATRSQLQSDVSLVSENEAL  492

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaV------RKPTFFSSMSKKLGKLNPFKH  210
            R+EL +MK++I++MQ    S   S+  ++A+A       RK TFFSSMSK LGKLNPFKH
Sbjct  493  RSELKKMKLYISEMQKNKGSSAKSISAAAAAAAAATSGPRKHTFFSSMSKTLGKLNPFKH  552

Query  209  GSKDTSNLDDG-EVDITKPRRRRFSIS  132
            GSKDTS++DD   VDITKPRRRRFS+S
Sbjct  553  GSKDTSHIDDNLAVDITKPRRRRFSVS  579



>ref|XP_010469846.1| PREDICTED: root phototropism protein 2 isoform X1 [Camelina sativa]
 ref|XP_010469847.1| PREDICTED: root phototropism protein 2 isoform X2 [Camelina sativa]
Length=595

 Score =   178 bits (452),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 117/152 (77%), Gaps = 12/152 (8%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPK------STPNAIATRNQLQADVTLV  390
            AR+HASQNKRLPV IVLHALYYDQLK+RSG E+ +      + P A+ TR+QLQAD TL 
Sbjct  444  ARLHASQNKRLPVNIVLHALYYDQLKLRSGVEEHEERAVVVNLPEALKTRSQLQADTTLA  503

Query  389  KENEALRTELLQMKMFIADMQ----NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLN  222
            KENEALR+EL++MKM+++DMQ      G+S  +S    S +   K TFFSS+SKKLGKLN
Sbjct  504  KENEALRSELMKMKMYVSDMQKNKNGAGASSSNSTSLVSNNKKSKHTFFSSVSKKLGKLN  563

Query  221  PFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  132
            PF+HGSKDTSNLD+    VDITKPRRRRFSIS
Sbjct  564  PFRHGSKDTSNLDEDLAGVDITKPRRRRFSIS  595



>ref|XP_007142019.1| hypothetical protein PHAVU_008G245700g [Phaseolus vulgaris]
 gb|ESW14013.1| hypothetical protein PHAVU_008G245700g [Phaseolus vulgaris]
Length=580

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHAS+NKRLP+QIVLHALYYDQL +RSGA + K    A   + QLQADV+LV+ENE L
Sbjct  442  ARVHASKNKRLPLQIVLHALYYDQLHLRSGAAEDKEAGAAAVEKKQLQADVSLVRENEEL  501

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            R+EL++MKM+I DMQ  G+   SS K +SA A R PTF SSMSKKL KLNPFK+GSKDTS
Sbjct  502  RSELMKMKMYITDMQKNGNGTSSSGKETSAPAKR-PTFLSSMSKKLSKLNPFKNGSKDTS  560

Query  191  NLDDGEVDITKPRRRRFSIS  132
            ++DD  VD+TKPRRRRFSIS
Sbjct  561  HIDDAPVDLTKPRRRRFSIS  580



>ref|XP_007206420.1| hypothetical protein PRUPE_ppa003347mg [Prunus persica]
 gb|EMJ07619.1| hypothetical protein PRUPE_ppa003347mg [Prunus persica]
Length=583

 Score =   177 bits (450),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 110/146 (75%), Gaps = 6/146 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG ++     +A+ TR+Q+Q DV+L +ENE+L
Sbjct  438  ARVHASQNKRLPVQIVLHALYYDQLKLRSGVDENDMMQDAVTTRSQVQQDVSLARENESL  497

Query  371  RTELLQMKMFIADMQNk------gssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  210
            RTELL+MKM+I D+Q             ++  G      RK TFFSS+SKKLGKLNPFK 
Sbjct  498  RTELLRMKMYITDLQKSGPAAKGSLGSATTSSGKGGGGPRKGTFFSSVSKKLGKLNPFKQ  557

Query  209  GSKDTSNLDDGEVDITKPRRRRFSIS  132
            GSKDTSN+ D  VDITKPRRRRFSIS
Sbjct  558  GSKDTSNIMDEGVDITKPRRRRFSIS  583



>ref|XP_009374407.1| PREDICTED: root phototropism protein 2-like [Pyrus x bretschneideri]
Length=577

 Score =   177 bits (449),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG  D     +A+ TR+Q+Q DV+L +ENE L
Sbjct  438  ARVHASQNKRLPVQIVLHALYYDQLKLRSGV-DENDVQDAVTTRSQVQHDVSLARENEEL  496

Query  371  RTELLQMKMFIADMQNkgss-qgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDT  195
            RTELL+MKM+I D+Q  GS+   ++  G      +K TFFSS+SKKLGKLNPFK GSKDT
Sbjct  497  RTELLKMKMYITDLQKTGSAGIATTSSGKGGGGPKKATFFSSVSKKLGKLNPFKQGSKDT  556

Query  194  SNLDDGEVDITKPRRRRFSIS  132
            SN+ D  VDITKPRRRRFSIS
Sbjct  557  SNIMDEGVDITKPRRRRFSIS  577



>ref|XP_010522018.1| PREDICTED: root phototropism protein 2-like [Tarenaya hassleriana]
Length=572

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 110/141 (78%), Gaps = 6/141 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            AR+HASQNKRLPV IVLHALYYD LK+RSG ED +  P A+  R QLQ DV+L KENEAL
Sbjct  437  ARLHASQNKRLPVNIVLHALYYDNLKLRSGKED-RDVPEAMEIRGQLQKDVSLEKENEAL  495

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            RTEL++MKM+++DMQ    S G+S     +    K TFFSS+SK LGKLNPF+HG+KDTS
Sbjct  496  RTELMKMKMYVSDMQKNQGSVGASSLSKKS----KYTFFSSVSKTLGKLNPFRHGAKDTS  551

Query  191  NLDDGE-VDITKPRRRRFSIS  132
            N+DD   VDITKPRRRRFSIS
Sbjct  552  NIDDDSGVDITKPRRRRFSIS  572



>ref|XP_010414259.1| PREDICTED: root phototropism protein 2-like [Camelina sativa]
Length=595

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 117/152 (77%), Gaps = 12/152 (8%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPK------STPNAIATRNQLQADVTLV  390
            AR+HASQNKRLPV IVLHALYYDQLK+RSG E+ +      + P A+ TR+QLQAD TL 
Sbjct  444  ARLHASQNKRLPVNIVLHALYYDQLKLRSGVEEQEERAVVVNLPEALKTRSQLQADTTLA  503

Query  389  KENEALRTELLQMKMFIADMQ----NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLN  222
            KENEALR+EL++MK++++DMQ      G+S  +S    S +   K TFFSS+SKKLGKLN
Sbjct  504  KENEALRSELMKMKLYVSDMQKNKNGAGTSSSNSTSLVSNNKKSKHTFFSSVSKKLGKLN  563

Query  221  PFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  132
            PF+HGSKDTSNLD+    VDITKPRRRRFSIS
Sbjct  564  PFRHGSKDTSNLDEDLAGVDITKPRRRRFSIS  595



>gb|AAB63086.1| unknown protein [Arabidopsis thaliana]
Length=415

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 115/150 (77%), Gaps = 10/150 (7%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQADVTLVK  387
            AR+HASQNKRLPV IVLHALYYDQLK+RSG  + +       P A+ TR+QLQAD TL K
Sbjct  266  ARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTRSQLQADTTLAK  325

Query  386  ENEALRTELLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  216
            ENEALR+EL++MKM+++DMQ   N   +  S+     +S   K TFFSS+SKKLGKLNPF
Sbjct  326  ENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSSVSKKLGKLNPF  385

Query  215  KHGSKDTSNLDD--GEVDITKPRRRRFSIS  132
            K+GSKDTS++D+  G VDITKPRRRRFSIS
Sbjct  386  KNGSKDTSHIDEDLGGVDITKPRRRRFSIS  415



>gb|ADL36608.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG  D     +AI TR+++Q DV+L +ENE L
Sbjct  438  ARVHASQNKRLPVQIVLHALYYDQLKLRSGV-DENDVQDAITTRSRVQHDVSLARENEEL  496

Query  371  RTELLQMKMFIADMQNkgss-qgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDT  195
            RTELL+MKM+I DMQ  GS+   ++  G      +K TFFSS+SKKLGKLNPFK GSKDT
Sbjct  497  RTELLKMKMYITDMQKTGSAGIATTSSGKGGGGPKKATFFSSVSKKLGKLNPFKQGSKDT  556

Query  194  SNLDDGEVDITKPRRRRFSIS  132
            SN+ D  VDI+KPRRRRFSIS
Sbjct  557  SNIIDDGVDISKPRRRRFSIS  577



>ref|XP_002881117.1| hypothetical protein ARALYDRAFT_481966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57376.1| hypothetical protein ARALYDRAFT_481966 [Arabidopsis lyrata subsp. 
lyrata]
Length=593

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 115/150 (77%), Gaps = 10/150 (7%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQADVTLVK  387
            AR+HASQNKRLPV IVLHALYYDQLK+RSG E+ +       P A+ TR+QLQAD TL K
Sbjct  444  ARLHASQNKRLPVNIVLHALYYDQLKLRSGVEEQEERAVVVLPEALKTRSQLQADTTLAK  503

Query  386  ENEALRTELLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  216
            ENEALR+EL++MKM+++DMQ   N   +  S+     +S   K TFFSS+SKKLGKLNPF
Sbjct  504  ENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKNKHTFFSSVSKKLGKLNPF  563

Query  215  KHGSKDTSNLDD--GEVDITKPRRRRFSIS  132
            K+GSKDTSN+D+    VDITKPRRRRFSIS
Sbjct  564  KNGSKDTSNIDEDLAGVDITKPRRRRFSIS  593



>ref|XP_010557176.1| PREDICTED: root phototropism protein 2 [Tarenaya hassleriana]
Length=575

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 106/141 (75%), Gaps = 5/141 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            AR+HASQNKRLPV IVLHALYYDQLK+RSG E+ +  P  +A R QLQ DV+L KENEAL
Sbjct  439  ARLHASQNKRLPVNIVLHALYYDQLKLRSGVEE-RDAPEGLAIRGQLQTDVSLAKENEAL  497

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            RTEL +MKM+I+DMQ        +   S  S     TFFSS+SK LGKLNPF+ GSKDT 
Sbjct  498  RTELTKMKMYISDMQKNQGGGVGASSSSKKSKH---TFFSSVSKTLGKLNPFRQGSKDTL  554

Query  191  NLDD-GEVDITKPRRRRFSIS  132
            NLDD G VDITKPRRRRFSIS
Sbjct  555  NLDDAGGVDITKPRRRRFSIS  575



>ref|NP_001280895.1| root phototropism protein 2-like [Malus domestica]
 gb|ADL36607.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 109/141 (77%), Gaps = 2/141 (1%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG  D     +AI TR+Q+Q DV+L +ENE L
Sbjct  438  ARVHASQNKRLPVQIVLHALYYDQLKLRSGV-DENDVQDAITTRSQVQHDVSLARENEEL  496

Query  371  RTELLQMKMFIADMQNkg-ssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDT  195
            RTELL+MKM+I D+   G ++  ++         +K  FFSSMSKKLG+LNPFK GSKDT
Sbjct  497  RTELLKMKMYITDLHKTGPAAVATTSSCKGGGGPKKAKFFSSMSKKLGRLNPFKQGSKDT  556

Query  194  SNLDDGEVDITKPRRRRFSIS  132
            SN+ D +VDITKPRRRRFSIS
Sbjct  557  SNIMDEDVDITKPRRRRFSIS  577



>ref|XP_010510344.1| PREDICTED: root phototropism protein 2-like [Camelina sativa]
Length=596

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 116/153 (76%), Gaps = 13/153 (8%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPK------STPNAIATRNQLQADVTLV  390
            AR+HASQNKRLPV IVLHALYYDQLK+RSG E+ +      + P A+ TR+QLQAD TL 
Sbjct  444  ARLHASQNKRLPVNIVLHALYYDQLKLRSGVEEQEERAVVVNLPEALKTRSQLQADTTLA  503

Query  389  KENEALRTELLQMKMFIADMQ---NkgssqgssvkgssasaVRKP--TFFSSMSKKLGKL  225
            KENEALR+EL++MKM+++DMQ   N   +  S+     ++  +K    FFSS+SKKLGKL
Sbjct  504  KENEALRSELMKMKMYVSDMQKNKNGAGASSSNSTSLVSNNNKKSKHNFFSSVSKKLGKL  563

Query  224  NPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  132
            NPF+HGSKDTSNLD+    VDITKPRRRRFSIS
Sbjct  564  NPFRHGSKDTSNLDEDLAGVDITKPRRRRFSIS  596



>ref|XP_003553189.1| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=573

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 116/143 (81%), Gaps = 7/143 (5%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQL++RSGAE+    P     +NQLQ DV+LV+ENE L
Sbjct  435  ARVHASQNKRLPVQIVLHALYYDQLRLRSGAEERDVEPE----KNQLQMDVSLVRENEEL  490

Query  371  RTELLQMKMFIADMQNkgssqgs---svkgssasaVRKPTFFSSMSKKLGKLNPFKHGSK  201
            RTEL++MKM+I+D+QNK ++  +       +S++  +K TFFSS+SK LGKLNPF++GSK
Sbjct  491  RTELMKMKMYISDLQNKNTNNDANPQVHGTTSSATPKKATFFSSVSKTLGKLNPFRNGSK  550

Query  200  DTSNLDDGEVDITKPRRRRFSIS  132
            DT++L+D  VD+TKPRRRRFS+S
Sbjct  551  DTTHLEDASVDLTKPRRRRFSMS  573



>gb|EPS73802.1| hypothetical protein M569_00954 [Genlisea aurea]
Length=566

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 105/140 (75%), Gaps = 5/140 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQL++RSG       PNA +TR Q QAD  LVKENE L
Sbjct  432  ARVHASQNKRLPVQIVLHALYYDQLQLRSGGGGDYEKPNAASTRFQAQADTDLVKENEKL  491

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            RTELL+MKM++ ++Q        +   +S+ A +KPTFFSSMSK LGKLNPF+ GSKDT 
Sbjct  492  RTELLKMKMYVQEIQE-----SKNQGTTSSKAAKKPTFFSSMSKTLGKLNPFRIGSKDTL  546

Query  191  NLDDGEVDITKPRRRRFSIS  132
             +DD   D+ KPRRRRFSIS
Sbjct  547  QIDDAASDVRKPRRRRFSIS  566



>ref|XP_006842585.1| hypothetical protein AMTR_s00077p00161250 [Amborella trichopoda]
 gb|ERN04260.1| hypothetical protein AMTR_s00077p00161250 [Amborella trichopoda]
Length=564

 Score =   175 bits (443),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 109/141 (77%), Gaps = 11/141 (8%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLKIRSG ED K+  +A  TRNQ+QAD++L+KENE+L
Sbjct  434  ARVHASQNKRLPVQIVLHALYYDQLKIRSGKEDAKNF-DASFTRNQVQADISLIKENESL  492

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            ++EL +MK ++  +Q        S          K TFFSSMSKKLG+LNPF+HGSKDT 
Sbjct  493  KSELAKMKSYVDGLQKGKGIATKSS---------KKTFFSSMSKKLGRLNPFRHGSKDTL  543

Query  191  NLDDGE-VDITKPRRRRFSIS  132
            N++DG  VDITKPR+RRFSIS
Sbjct  544  NVEDGNAVDITKPRKRRFSIS  564



>ref|XP_006591739.1| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=516

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 116/148 (78%), Gaps = 13/148 (9%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-RNQLQADVTLVKENEA  375
            ARVHASQNKRLPVQIVLHALYYDQL++RSGAE+ +     +AT +NQLQ DVTLV+ENE 
Sbjct  374  ARVHASQNKRLPVQIVLHALYYDQLRLRSGAEERE-----VATEKNQLQMDVTLVRENEE  428

Query  374  LRTELLQMKMFIADMQNkgssqgs-------svkgssasaVRKPTFFSSMSKKLGKLNPF  216
            LRTEL++MKM+I+D+Q   ++          +   ++    +K TFFSS+SK LGKLNPF
Sbjct  429  LRTELMKMKMYISDLQQNKNTNNGANPQGHGTTSSAANPNPKKATFFSSVSKTLGKLNPF  488

Query  215  KHGSKDTSNLDDGEVDITKPRRRRFSIS  132
            ++GSKDT++L+DG VD+TKPRRRRFS+S
Sbjct  489  RNGSKDTTHLEDGNVDLTKPRRRRFSVS  516



>ref|XP_008239637.1| PREDICTED: root phototropism protein 2 isoform X2 [Prunus mume]
Length=584

 Score =   174 bits (442),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 112/147 (76%), Gaps = 7/147 (5%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +   +A+ TR+Q+Q DV+L +ENE+L
Sbjct  438  ARVHASQNKRLPVQIVLHALYYDQLKLRSGVDENEMMQDAVTTRSQVQQDVSLARENESL  497

Query  371  RTELLQMKMFIADMQNk------gssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  210
            RTELL+MKM+I+D+Q             ++  G      RK TFFSS+SKKLGKLNPFK 
Sbjct  498  RTELLRMKMYISDLQKSGPAAKGSLGAATTSSGKGGGGPRKGTFFSSVSKKLGKLNPFKQ  557

Query  209  GSK-DTSNLDDGEVDITKPRRRRFSIS  132
            GSK DTSN+ D  VDITKPRRRRFSIS
Sbjct  558  GSKDDTSNIMDEGVDITKPRRRRFSIS  584



>ref|NP_001031446.1| Root phototropism protein 2 [Arabidopsis thaliana]
 ref|NP_001077982.1| Root phototropism protein 2 [Arabidopsis thaliana]
 dbj|BAD43060.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08402.1| Root phototropism protein 2 [Arabidopsis thaliana]
 gb|AEC08403.1| Root phototropism protein 2 [Arabidopsis thaliana]
Length=545

 Score =   174 bits (441),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 115/150 (77%), Gaps = 10/150 (7%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQADVTLVK  387
            AR+HASQNKRLPV IVLHALYYDQLK+RSG  + +       P A+ TR+QLQAD TL K
Sbjct  396  ARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTRSQLQADTTLAK  455

Query  386  ENEALRTELLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  216
            ENEALR+EL++MKM+++DMQ   N   +  S+     +S   K TFFSS+SKKLGKLNPF
Sbjct  456  ENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSSVSKKLGKLNPF  515

Query  215  KHGSKDTSNLDD--GEVDITKPRRRRFSIS  132
            K+GSKDTS++D+  G VDITKPRRRRFSIS
Sbjct  516  KNGSKDTSHIDEDLGGVDITKPRRRRFSIS  545



>ref|XP_008239576.1| PREDICTED: root phototropism protein 2 isoform X1 [Prunus mume]
Length=584

 Score =   174 bits (442),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 112/147 (76%), Gaps = 7/147 (5%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +   +A+ TR+Q+Q DV+L +ENE+L
Sbjct  438  ARVHASQNKRLPVQIVLHALYYDQLKLRSGVDENEMMQDAVTTRSQVQQDVSLARENESL  497

Query  371  RTELLQMKMFIADMQNk------gssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  210
            RTELL+MKM+I+D+Q             ++  G      RK TFFSS+SKKLGKLNPFK 
Sbjct  498  RTELLRMKMYISDLQKSGPAAKGSLGAATTSSGKGGGGPRKGTFFSSVSKKLGKLNPFKQ  557

Query  209  GSK-DTSNLDDGEVDITKPRRRRFSIS  132
            GSK DTSN+ D  VDITKPRRRRFSIS
Sbjct  558  GSKDDTSNIMDEGVDITKPRRRRFSIS  584



>ref|XP_004490729.1| PREDICTED: root phototropism protein 2-like [Cicer arietinum]
Length=573

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 109/140 (78%), Gaps = 8/140 (6%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALY+DQLK+RSGA   +   +  A RNQLQ DVTLV+ENE L
Sbjct  442  ARVHASQNKRLPVQIVLHALYFDQLKLRSGAVVER---DVTAERNQLQTDVTLVRENEEL  498

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            R+EL++MKM++ D++       SS +       +K TFFSS+SKKLGKLNPFK+G+KDTS
Sbjct  499  RSELMRMKMYVTDLKKNVDGTTSSSREV-----KKSTFFSSVSKKLGKLNPFKNGAKDTS  553

Query  191  NLDDGEVDITKPRRRRFSIS  132
             ++DG VD+ KPRRRRFSIS
Sbjct  554  TIEDGPVDLIKPRRRRFSIS  573



>ref|XP_009355145.1| PREDICTED: root phototropism protein 2-like [Pyrus x bretschneideri]
Length=577

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 108/141 (77%), Gaps = 2/141 (1%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG E+     +A  TR Q+Q DV+L +ENE L
Sbjct  438  ARVHASQNKRLPVQIVLHALYYDQLKLRSGVEE-NDVQDATMTRRQVQHDVSLARENEEL  496

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaV-RKPTFFSSMSKKLGKLNPFKHGSKDT  195
            RTELL+MKM+I D+Q  G +  ++          +K TFFSS+SKKLG+LNPFK GSKDT
Sbjct  497  RTELLKMKMYITDLQKTGPAGVATTSSCKGGGGPKKATFFSSVSKKLGRLNPFKQGSKDT  556

Query  194  SNLDDGEVDITKPRRRRFSIS  132
             N+ D +VD+TKPRRRRFSIS
Sbjct  557  MNIVDEDVDLTKPRRRRFSIS  577



>dbj|BAF02185.1| hypothetical protein [Arabidopsis thaliana]
Length=593

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 115/150 (77%), Gaps = 10/150 (7%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQADVTLVK  387
            AR+HASQNKRLPV IVLHALYYDQLK+RSG  + +       P A+ TR+QLQAD TL K
Sbjct  444  ARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTRSQLQADTTLAK  503

Query  386  ENEALRTELLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  216
            ENEALR+EL++MKM+++DMQ   N   +  S+     +S   K TFFSS+SKKLGKLNPF
Sbjct  504  ENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSSVSKKLGKLNPF  563

Query  215  KHGSKDTSNLDD--GEVDITKPRRRRFSIS  132
            K+GSKDTS++D+  G VDITKPRRRRFSIS
Sbjct  564  KNGSKDTSHIDEDLGGVDITKPRRRRFSIS  593



>ref|NP_850147.1| Root phototropism protein 2 [Arabidopsis thaliana]
 sp|Q682S0.2|RPT2_ARATH RecName: Full=Root phototropism protein 2; AltName: Full=BTB/POZ 
domain-containing protein RPT2 [Arabidopsis thaliana]
 gb|AAK59568.1| unknown protein [Arabidopsis thaliana]
 gb|AAL07245.1| unknown protein [Arabidopsis thaliana]
 gb|AAN31821.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD94074.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD94572.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD95385.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01595.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01673.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF02233.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC08401.1| Root phototropism protein 2 [Arabidopsis thaliana]
Length=593

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 115/150 (77%), Gaps = 10/150 (7%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQADVTLVK  387
            AR+HASQNKRLPV IVLHALYYDQLK+RSG  + +       P A+ TR+QLQAD TL K
Sbjct  444  ARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTRSQLQADTTLAK  503

Query  386  ENEALRTELLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  216
            ENEALR+EL++MKM+++DMQ   N   +  S+     +S   K TFFSS+SKKLGKLNPF
Sbjct  504  ENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSSVSKKLGKLNPF  563

Query  215  KHGSKDTSNLDD--GEVDITKPRRRRFSIS  132
            K+GSKDTS++D+  G VDITKPRRRRFSIS
Sbjct  564  KNGSKDTSHIDEDLGGVDITKPRRRRFSIS  593



>dbj|BAF01791.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01873.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01940.1| hypothetical protein [Arabidopsis thaliana]
Length=593

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 115/150 (77%), Gaps = 10/150 (7%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQADVTLVK  387
            AR+HASQNKRLPV IVLHALYYDQLK+RSG  + +       P A+ TR+QLQAD TL K
Sbjct  444  ARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTRSQLQADTTLAK  503

Query  386  ENEALRTELLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  216
            ENEALR+EL++MKM+++DMQ   N   +  S+     +S   K TFFSS+SKKLGKLNPF
Sbjct  504  ENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSSVSKKLGKLNPF  563

Query  215  KHGSKDTSNLDD--GEVDITKPRRRRFSIS  132
            K+GSKDTS++D+  G VDITKPRRRRFSIS
Sbjct  564  KNGSKDTSHIDEDLGGVDITKPRRRRFSIS  593



>ref|XP_007146905.1| hypothetical protein PHAVU_006G080400g [Phaseolus vulgaris]
 gb|ESW18899.1| hypothetical protein PHAVU_006G080400g [Phaseolus vulgaris]
Length=573

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 118/144 (82%), Gaps = 9/144 (6%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-RNQLQADVTLVKENEA  375
            AR+HASQNKRLPVQIVLHALYYDQL++RSGAE+ +     +AT +N+L  DV+LV+ENE 
Sbjct  435  ARLHASQNKRLPVQIVLHALYYDQLRLRSGAEERE-----VATEKNELHMDVSLVRENEE  489

Query  374  LRTELLQMKMFIADMQNkgssqgssv---kgssasaVRKPTFFSSMSKKLGKLNPFKHGS  204
            LRTELL+MKM+I+DMQNK  +   S      +S+ + +K TFFSS+SK LG+LNPF++GS
Sbjct  490  LRTELLKMKMYISDMQNKNVNNAESTHGNGTTSSGSTKKATFFSSVSKTLGRLNPFRNGS  549

Query  203  KDTSNLDDGEVDITKPRRRRFSIS  132
            KDT++L+DG VD++KPRRRRFS+S
Sbjct  550  KDTTHLEDGNVDLSKPRRRRFSMS  573



>ref|XP_008366216.1| PREDICTED: root phototropism protein 2-like [Malus domestica]
Length=577

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 110/141 (78%), Gaps = 2/141 (1%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG  D     +AI TR+Q+Q DV+L +ENE L
Sbjct  438  ARVHASQNKRLPVQIVLHALYYDQLKLRSGX-DENDVQDAITTRSQVQHDVSLARENEEL  496

Query  371  RTELLQMKMFIADMQNkgss-qgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDT  195
            RTELL+MK +I D+Q  GS+   ++  G      +K TFFSS+SKKLGKLNPFK GSKDT
Sbjct  497  RTELLKMKXYITDLQKTGSAGIATTSSGKGGGGPKKATFFSSVSKKLGKLNPFKXGSKDT  556

Query  194  SNLDDGEVDITKPRRRRFSIS  132
            SN+ D  VDI+KPRRRRFSIS
Sbjct  557  SNIIDDGVDISKPRRRRFSIS  577



>gb|AAF33112.1|AF181683_1 RPT2 [Arabidopsis thaliana]
Length=593

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 115/150 (77%), Gaps = 10/150 (7%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQADVTLVK  387
            AR+HASQNKRLPV IVLHALYYDQLK+RSG  + +       P A+ TR+QLQAD TL K
Sbjct  444  ARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTRSQLQADTTLAK  503

Query  386  ENEALRTELLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  216
            ENEALR+EL++MKM+++DMQ   N   +  S+     +S   K TFFSS+S+KLGKLNPF
Sbjct  504  ENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSSVSRKLGKLNPF  563

Query  215  KHGSKDTSNLDD--GEVDITKPRRRRFSIS  132
            K+GSKDTS++D+  G VDITKPRRRRFSIS
Sbjct  564  KNGSKDTSHIDEDLGGVDITKPRRRRFSIS  593



>ref|NP_001280845.1| root phototropism protein 2-like [Malus domestica]
 gb|ADL36603.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   172 bits (435),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 108/141 (77%), Gaps = 2/141 (1%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG  D     +AI TR+Q+Q DV+L +ENE L
Sbjct  438  ARVHASQNKRLPVQIVLHALYYDQLKLRSGV-DENDVQDAITTRSQVQHDVSLARENEEL  496

Query  371  RTELLQMKMFIADMQNkg-ssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDT  195
            RTELL+MKM+I D+   G ++  ++         +K  FFS +SKKLG+LNPFK GSKDT
Sbjct  497  RTELLKMKMYITDLHKTGPAAVATTSSCKGGGGPKKAKFFSYVSKKLGRLNPFKQGSKDT  556

Query  194  SNLDDGEVDITKPRRRRFSIS  132
            SN+ D +VDITKPRRRRFSIS
Sbjct  557  SNIVDEDVDITKPRRRRFSIS  577



>gb|ACJ85743.1| unknown [Medicago truncatula]
Length=257

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 110/140 (79%), Gaps = 6/140 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG++D +    A   RN+L  DV+LV ENE L
Sbjct  124  ARVHASQNKRLPVQIVLHALYYDQLKLRSGSDDGE-CDGAATERNRLATDVSLVGENEEL  182

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            R+EL +MKM+I DMQ     +  +   +S S+ +K TFFSS+SKKLGKL  FK+G+KDT+
Sbjct  183  RSELTKMKMYITDMQQ---QKNVTPGTTSLSSSKKTTFFSSVSKKLGKL--FKNGAKDTA  237

Query  191  NLDDGEVDITKPRRRRFSIS  132
            +L+DG VD+TKPRRRRFSIS
Sbjct  238  HLEDGPVDLTKPRRRRFSIS  257



>gb|KFK22949.1| root phototropism protein 2 [Arabis alpina]
Length=596

 Score =   169 bits (429),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 116/153 (76%), Gaps = 13/153 (8%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST----PNAIATRNQLQADVTLVKE  384
            AR+HASQNKRLPV IVLHALYYDQLK+RSG E+ + T    P A+ATR Q++AD +L KE
Sbjct  444  ARLHASQNKRLPVNIVLHALYYDQLKLRSGVEEKQGTVVIVPEALATRGQVKADTSLAKE  503

Query  383  NEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR-------KPTFFSSMSKKLGKL  225
            NEALR+EL++MKM+++D+Q    S G +   +S++ V        K  FFSS+SKKLGK 
Sbjct  504  NEALRSELMKMKMYVSDLQKNKQSGGGASSSNSSALVSSSNKKNIKQNFFSSVSKKLGKF  563

Query  224  NPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  132
            NPF+HGSKDTS++D+    VDITKPRRRRFSIS
Sbjct  564  NPFRHGSKDTSHIDEDLAGVDITKPRRRRFSIS  596



>ref|XP_008349518.1| PREDICTED: LOW QUALITY PROTEIN: root phototropism protein 2-like 
[Malus domestica]
Length=577

 Score =   169 bits (428),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 109/141 (77%), Gaps = 2/141 (1%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNK  PVQIVLHALYYDQLK+RSG  +     +AI TR+Q+Q DV+L +ENE L
Sbjct  438  ARVHASQNKTTPVQIVLHALYYDQLKLRSGXXE-NDVQDAITTRSQVQHDVSLARENEEL  496

Query  371  RTELLQMKMFIADMQNkgss-qgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDT  195
            RTELL+MKM+I D+Q  GS+   ++  G      +K TFFSS+SKKLGKLNPFK GSKDT
Sbjct  497  RTELLKMKMYITDLQKTGSAGIATTSSGKGGGGPKKATFFSSVSKKLGKLNPFKXGSKDT  556

Query  194  SNLDDGEVDITKPRRRRFSIS  132
            SN+ D  VDI+KPRRRRFSIS
Sbjct  557  SNIIDDGVDISKPRRRRFSIS  577



>emb|CDY23992.1| BnaC03g16990D [Brassica napus]
Length=565

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 109/146 (75%), Gaps = 13/146 (9%)
 Frame = -3

Query  548  RVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST----PNAIATRNQLQADVTLVKEN  381
            R+HASQNKRLPV IVLHALYYDQLK+RS  ED + T    P A+ TR     D +L KEN
Sbjct  426  RLHASQNKRLPVNIVLHALYYDQLKLRSEVEDKEGTPVIVPEALGTR-----DSSLAKEN  480

Query  380  EALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSK  201
            E LR+EL++MKM+++D+QN  ++  SS    S     K TFFSS+SKKLGKLNPF+HGSK
Sbjct  481  EDLRSELMKMKMYVSDLQNNVAAGASSSNAPSNKKNSKHTFFSSVSKKLGKLNPFRHGSK  540

Query  200  DTSNLD---DGEVDITKPRRRRFSIS  132
            DTSN+D   DG VDITKPRRRRFSIS
Sbjct  541  DTSNIDEDLDG-VDITKPRRRRFSIS  565



>ref|XP_003600551.1| Root phototropism protein [Medicago truncatula]
Length=513

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 111/140 (79%), Gaps = 6/140 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG++D +    A   RN+L  DV+LV+ENE L
Sbjct  380  ARVHASQNKRLPVQIVLHALYYDQLKLRSGSDDGE-CDGAATERNRLATDVSLVRENEEL  438

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            R+EL +MKM+I DMQ     +  +   +S S+ +K TFFSS+SKKLGKL  FK+G+KDT+
Sbjct  439  RSELTKMKMYITDMQQ---QKNVTPGTTSLSSSKKTTFFSSVSKKLGKL--FKNGAKDTA  493

Query  191  NLDDGEVDITKPRRRRFSIS  132
            +L+DG VD+TKPRRRRFSIS
Sbjct  494  HLEDGPVDLTKPRRRRFSIS  513



>gb|AES70802.2| root phototropism-like protein [Medicago truncatula]
Length=526

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 111/140 (79%), Gaps = 6/140 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG++D +    A   RN+L  DV+LV+ENE L
Sbjct  393  ARVHASQNKRLPVQIVLHALYYDQLKLRSGSDDGE-CDGAATERNRLATDVSLVRENEEL  451

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            R+EL +MKM+I DMQ     +  +   +S S+ +K TFFSS+SKKLGKL  FK+G+KDT+
Sbjct  452  RSELTKMKMYITDMQQ---QKNVTPGTTSLSSSKKTTFFSSVSKKLGKL--FKNGAKDTA  506

Query  191  NLDDGEVDITKPRRRRFSIS  132
            +L+DG VD+TKPRRRRFSIS
Sbjct  507  HLEDGPVDLTKPRRRRFSIS  526



>ref|XP_003600550.1| Root phototropism protein [Medicago truncatula]
 gb|AES70801.1| root phototropism-like protein [Medicago truncatula]
Length=568

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 111/140 (79%), Gaps = 6/140 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQNKRLPVQIVLHALYYDQLK+RSG++D +    A   RN+L  DV+LV+ENE L
Sbjct  435  ARVHASQNKRLPVQIVLHALYYDQLKLRSGSDDGE-CDGAATERNRLATDVSLVRENEEL  493

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            R+EL +MKM+I DMQ     +  +   +S S+ +K TFFSS+SKKLGKL  FK+G+KDT+
Sbjct  494  RSELTKMKMYITDMQQ---QKNVTPGTTSLSSSKKTTFFSSVSKKLGKL--FKNGAKDTA  548

Query  191  NLDDGEVDITKPRRRRFSIS  132
            +L+DG VD+TKPRRRRFSIS
Sbjct  549  HLEDGPVDLTKPRRRRFSIS  568



>ref|XP_004500391.1| PREDICTED: root phototropism protein 2-like [Cicer arietinum]
Length=569

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 109/140 (78%), Gaps = 5/140 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQ KRLPVQIVLHALYYDQL++RSG++D  +   A   +N+L  DV+LV+ENE L
Sbjct  435  ARVHASQKKRLPVQIVLHALYYDQLRLRSGSDDGDT---AATKKNRLNTDVSLVRENEEL  491

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            R+EL +MKM+++DMQ K  SQ      S ++  +K  FFSS+SK LGKLNPFKH +KDT+
Sbjct  492  RSELAKMKMYVSDMQQKNVSQVHGTTSSHST--KKTKFFSSVSKTLGKLNPFKHEAKDTT  549

Query  191  NLDDGEVDITKPRRRRFSIS  132
            +LDDG VD+ KPRRRRFSIS
Sbjct  550  HLDDGPVDLIKPRRRRFSIS  569



>emb|CDX84827.1| BnaA03g14030D [Brassica napus]
Length=565

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 106/143 (74%), Gaps = 5/143 (3%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            AR+HASQNKRLPV IVLH LYYDQLK+RS  ED + TP  I        D +L KENE L
Sbjct  425  ARLHASQNKRLPVNIVLHTLYYDQLKLRSEVEDKEGTP-VIVPEGLGTRDSSLAKENEDL  483

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            R+EL++MKM+++D+QN  ++  SS    S     K TFFSS+SKKLGKLNPF+HGSKDTS
Sbjct  484  RSELMKMKMYVSDLQNNVAAGASSSNAPSNKKNSKHTFFSSVSKKLGKLNPFRHGSKDTS  543

Query  191  NLD---DGEVDITKPRRRRFSIS  132
            N+D   DG VDITKPRRRRFSIS
Sbjct  544  NIDEDLDG-VDITKPRRRRFSIS  565



>ref|XP_009132742.1| PREDICTED: root phototropism protein 2-like [Brassica rapa]
Length=575

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 106/143 (74%), Gaps = 5/143 (3%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            AR+HASQNKRLPV IVLH LYYDQLK+RS  ED + TP  I        D +L KENE L
Sbjct  435  ARLHASQNKRLPVNIVLHTLYYDQLKLRSEVEDKEGTP-VIVPEGLGTRDSSLAKENEDL  493

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            R+EL++MKM+++D+QN  ++  SS    S     K TFFSS+SKKLGKLNPF+HGSKDTS
Sbjct  494  RSELMKMKMYVSDLQNNVAAGASSSNAPSNKKNSKHTFFSSVSKKLGKLNPFRHGSKDTS  553

Query  191  NLD---DGEVDITKPRRRRFSIS  132
            N+D   DG VDITKPRRRRFSIS
Sbjct  554  NIDEDLDG-VDITKPRRRRFSIS  575



>ref|XP_009384760.1| PREDICTED: root phototropism protein 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=538

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 106/144 (74%), Gaps = 6/144 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS--TPNA-IATRNQLQADVTLVKEN  381
            AR+HASQNKRLP+QIVLHALYYDQLK RSG ED  +   P A +   + L ADV+L++EN
Sbjct  397  ARLHASQNKRLPLQIVLHALYYDQLKQRSGMEDEAAAGAPGATLGPDHGLNADVSLIREN  456

Query  380  EALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSK  201
            EALR+EL +MKM++++M       G        +  +K  FFSS+S+ LGKLNPFK GSK
Sbjct  457  EALRSELARMKMYVSEMHR--GGGGGGQGSGVKARSKKAMFFSSVSRTLGKLNPFKQGSK  514

Query  200  DTSNLDDG-EVDITKPRRRRFSIS  132
            DTSN+DDG  VD+TKPRRRRFSIS
Sbjct  515  DTSNMDDGVVVDVTKPRRRRFSIS  538



>ref|XP_009384759.1| PREDICTED: root phototropism protein 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=582

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 106/144 (74%), Gaps = 6/144 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS--TPNA-IATRNQLQADVTLVKEN  381
            AR+HASQNKRLP+QIVLHALYYDQLK RSG ED  +   P A +   + L ADV+L++EN
Sbjct  441  ARLHASQNKRLPLQIVLHALYYDQLKQRSGMEDEAAAGAPGATLGPDHGLNADVSLIREN  500

Query  380  EALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSK  201
            EALR+EL +MKM++++M       G        +  +K  FFSS+S+ LGKLNPFK GSK
Sbjct  501  EALRSELARMKMYVSEMHR--GGGGGGQGSGVKARSKKAMFFSSVSRTLGKLNPFKQGSK  558

Query  200  DTSNLDDG-EVDITKPRRRRFSIS  132
            DTSN+DDG  VD+TKPRRRRFSIS
Sbjct  559  DTSNMDDGVVVDVTKPRRRRFSIS  582



>ref|XP_010044625.1| PREDICTED: root phototropism protein 2-like [Eucalyptus grandis]
 gb|KCW86717.1| hypothetical protein EUGRSUZ_B03325 [Eucalyptus grandis]
Length=570

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 105/140 (75%), Gaps = 6/140 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            AR+HASQNKR P QIVLHALY DQLK+RSG  D +   + +ATR+Q+ ADV+L++ENE L
Sbjct  437  ARIHASQNKRFPAQIVLHALYNDQLKLRSGM-DNRDVCDPMATRSQVLADVSLIRENETL  495

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            R+EL+ MK  I+DMQN      S    SS    +K TFFSSM+K LGKLNPF+ GSKD S
Sbjct  496  RSELMMMKKNISDMQN----PKSQGTTSSKGGAKKTTFFSSMTKTLGKLNPFRQGSKDAS  551

Query  191  NLDDGEVDITKPRRRRFSIS  132
            N+DD  VDITKPRRRRFSIS
Sbjct  552  NIDD-LVDITKPRRRRFSIS  570



>gb|KCW86718.1| hypothetical protein EUGRSUZ_B03325 [Eucalyptus grandis]
Length=577

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 105/140 (75%), Gaps = 6/140 (4%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            AR+HASQNKR P QIVLHALY DQLK+RSG  D +   + +ATR+Q+ ADV+L++ENE L
Sbjct  444  ARIHASQNKRFPAQIVLHALYNDQLKLRSGM-DNRDVCDPMATRSQVLADVSLIRENETL  502

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            R+EL+ MK  I+DMQN      S    SS    +K TFFSSM+K LGKLNPF+ GSKD S
Sbjct  503  RSELMMMKKNISDMQN----PKSQGTTSSKGGAKKTTFFSSMTKTLGKLNPFRQGSKDAS  558

Query  191  NLDDGEVDITKPRRRRFSIS  132
            N+DD  VDITKPRRRRFSIS
Sbjct  559  NIDD-LVDITKPRRRRFSIS  577



>emb|CDY10743.1| BnaA05g11930D [Brassica napus]
Length=581

 Score =   161 bits (407),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 116/148 (78%), Gaps = 8/148 (5%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST----PNAIATRNQLQADVTLVKE  384
            AR+HASQNKRLPV IVLHALYYDQLK+RSG ED +      P A+ATR Q++AD +L KE
Sbjct  434  ARLHASQNKRLPVNIVLHALYYDQLKLRSGVEDKEGAVVVLPEAVATRGQVKADASLAKE  493

Query  383  NEALRTELLQMKMFIADMQNkgssqgssvkgs--sasaVRKPTFFSSMSKKLGKLNPFKH  210
            NEALR+EL++MKM+++D+Q  G + G+S   +  S     K TFFSS+SKKLGKLNPF+H
Sbjct  494  NEALRSELMKMKMYVSDLQKSGGAAGASSSNAPPSNKKSSKSTFFSSVSKKLGKLNPFRH  553

Query  209  GSKDTSNLDD--GEVDITKPRRRRFSIS  132
            GSKDTSN+D+    VDITKPRRRRFSIS
Sbjct  554  GSKDTSNIDEDLAGVDITKPRRRRFSIS  581



>ref|XP_009144295.1| PREDICTED: root phototropism protein 2 [Brassica rapa]
Length=591

 Score =   161 bits (407),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 116/148 (78%), Gaps = 8/148 (5%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST----PNAIATRNQLQADVTLVKE  384
            AR+HASQNKRLPV IVLHALYYDQLK+RSG ED +      P A+ATR Q++AD +L KE
Sbjct  444  ARLHASQNKRLPVNIVLHALYYDQLKLRSGVEDKEGAVVVLPEAVATRGQVKADASLAKE  503

Query  383  NEALRTELLQMKMFIADMQNkgssqgssvkgs--sasaVRKPTFFSSMSKKLGKLNPFKH  210
            NEALR+EL++MKM+++D+Q  G + G+S   +  S     K TFFSS+SKKLGKLNPF+H
Sbjct  504  NEALRSELMKMKMYVSDLQKSGGAAGASSSNAPPSNKKSSKSTFFSSVSKKLGKLNPFRH  563

Query  209  GSKDTSNLDD--GEVDITKPRRRRFSIS  132
            GSKDTSN+D+    VDITKPRRRRFSIS
Sbjct  564  GSKDTSNIDEDLAGVDITKPRRRRFSIS  591



>ref|XP_009402206.1| PREDICTED: root phototropism protein 2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=540

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 110/145 (76%), Gaps = 7/145 (5%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT---RNQ-LQADVTLVKE  384
            AR+HASQNKRLP+QIVLHALYYDQLK+RSG  D ++   A+     R++ L+ADV+L++E
Sbjct  398  ARLHASQNKRLPLQIVLHALYYDQLKLRSGI-DGEAAAGALGVTLGRDEGLKADVSLIRE  456

Query  383  NEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGS  204
            NE LR+EL +MKM+++++Q  G   G           +K +FFSS+S+ LGKLNPFK GS
Sbjct  457  NETLRSELAKMKMYVSELQR-GGGGGGGEGSGVKIGSKKTSFFSSVSRTLGKLNPFKQGS  515

Query  203  KDTSNLDDG-EVDITKPRRRRFSIS  132
            KDTSN+DDG  VD+TKPRRRRFSIS
Sbjct  516  KDTSNIDDGVGVDVTKPRRRRFSIS  540



>emb|CDY02075.1| BnaC04g14260D [Brassica napus]
Length=580

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 115/147 (78%), Gaps = 7/147 (5%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----TPNAIATRNQLQADVTLVKE  384
            AR+HASQNKRLPV IVLHALYYDQLK+RSG ED +      P A+ATR Q++AD +L KE
Sbjct  434  ARLHASQNKRLPVNIVLHALYYDQLKLRSGVEDKEGAVVVVPEAVATRGQVKADASLAKE  493

Query  383  NEALRTELLQMKMFIADMQNkgssqgssvkg-ssasaVRKPTFFSSMSKKLGKLNPFKHG  207
            NEALR+EL++MKM+++D+Q  G++  SS     S     K TFFSS+SKKLGKLNPF+HG
Sbjct  494  NEALRSELMKMKMYVSDLQKSGAAGASSSNAPPSNKKSSKSTFFSSVSKKLGKLNPFRHG  553

Query  206  SKDTSNLDD--GEVDITKPRRRRFSIS  132
            SKDTSN+D+    VDITKPRRRRFSIS
Sbjct  554  SKDTSNIDEDLAGVDITKPRRRRFSIS  580



>ref|XP_011080638.1| PREDICTED: root phototropism protein 2 [Sesamum indicum]
Length=570

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 96/140 (69%), Gaps = 7/140 (5%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            ARVHASQN RLPVQIVLHAL+YDQLK+  G  D     +A   RN LQ DV+LVKENEAL
Sbjct  438  ARVHASQNNRLPVQIVLHALHYDQLKLTRGIYDDHLLLDAPRARNYLQIDVSLVKENEAL  497

Query  371  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  192
            RTELL+M+M + DMQ               S V+K TFFSS+SK LG LNPFKH  KDTS
Sbjct  498  RTELLRMRMCMRDMQR-------IQGTPYRSRVKKHTFFSSLSKTLGILNPFKHARKDTS  550

Query  191  NLDDGEVDITKPRRRRFSIS  132
            N+DD  VD T  RR RFSIS
Sbjct  551  NVDDEMVDSTTLRRGRFSIS  570



>ref|XP_009402205.1| PREDICTED: root phototropism protein 2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   152 bits (384),  Expect = 8e-40, Method: Composition-based stats.
 Identities = 85/145 (59%), Positives = 110/145 (76%), Gaps = 7/145 (5%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT---RNQ-LQADVTLVKE  384
            AR+HASQNKRLP+QIVLHALYYDQLK+RSG  D ++   A+     R++ L+ADV+L++E
Sbjct  439  ARLHASQNKRLPLQIVLHALYYDQLKLRSGI-DGEAAAGALGVTLGRDEGLKADVSLIRE  497

Query  383  NEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGS  204
            NE LR+EL +MKM+++++Q  G   G           +K +FFSS+S+ LGKLNPFK GS
Sbjct  498  NETLRSELAKMKMYVSELQR-GGGGGGGEGSGVKIGSKKTSFFSSVSRTLGKLNPFKQGS  556

Query  203  KDTSNLDDG-EVDITKPRRRRFSIS  132
            KDTSN+DDG  VD+TKPRRRRFSIS
Sbjct  557  KDTSNIDDGVGVDVTKPRRRRFSIS  581



>ref|XP_010922790.1| PREDICTED: root phototropism protein 2 [Elaeis guineensis]
Length=577

 Score =   139 bits (349),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 81/143 (57%), Positives = 105/143 (73%), Gaps = 10/143 (7%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA--EDPKSTPNA-IATRNQLQADVTLVKEN  381
            AR+HASQN RLP+QIVL ALYYDQLK+RSGA  E+  + PN+  A R    AD +L++EN
Sbjct  440  ARLHASQNNRLPLQIVLQALYYDQLKLRSGAEPENAVTPPNSAAAARAGAMADASLMREN  499

Query  380  EALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSK  201
            EALR+EL +MK+ ++++Q       S       +  ++PTFFSS SK L KLNPF+HGSK
Sbjct  500  EALRSELTRMKLCLSELQR------SQGTSGLKAGPKRPTFFSSFSKTLEKLNPFRHGSK  553

Query  200  DTSNLDDG-EVDITKPRRRRFSI  135
            DT+++DDG  VD+TKPRRRRFSI
Sbjct  554  DTASIDDGVGVDLTKPRRRRFSI  576



>gb|KHN18647.1| Root phototropism protein 2 [Glycine soja]
Length=312

 Score =   132 bits (333),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 97/143 (68%), Gaps = 29/143 (20%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-RNQLQADVTLVKE--N  381
            ARVHASQNKRLPVQIVLHALYYDQL++RSGAE+ +     +AT +NQLQ DVTL K   N
Sbjct  196  ARVHASQNKRLPVQIVLHALYYDQLRLRSGAEERE-----VATEKNQLQMDVTLNKNTNN  250

Query  380  EALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSK  201
            +A                            +S++  +K TFFSS+SK LGKLNPF++GSK
Sbjct  251  DA---------------------NPQGHGTTSSATPKKATFFSSVSKTLGKLNPFRNGSK  289

Query  200  DTSNLDDGEVDITKPRRRRFSIS  132
            DT++L+D  VD+TKPRRRRFS+S
Sbjct  290  DTTHLEDASVDLTKPRRRRFSMS  312



>ref|XP_009374446.1| PREDICTED: putative disease resistance protein RGA3 [Pyrus x 
bretschneideri]
Length=1090

 Score =   128 bits (321),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 70/116 (60%), Positives = 85/116 (73%), Gaps = 2/116 (2%)
 Frame = -3

Query  551   ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
             ARVHASQNKRLPVQIVLHALYYDQ K+RSG  D     +A+ TR+Q+Q DV+L +ENE L
Sbjct  970   ARVHASQNKRLPVQIVLHALYYDQPKLRSGV-DENDVQDAVTTRSQVQHDVSLARENEEL  1028

Query  371   RTELLQMKMFIADMQNk-gssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHG  207
             R ELL+MKM+I D+Q    +   ++  G      +K TFFSS+SKKLGKLNPFK G
Sbjct  1029  RMELLKMKMYITDLQKTGSAGIATTSSGKGGGGPKKATFFSSVSKKLGKLNPFKQG  1084



>gb|EMS47631.1| Root phototropism protein 2 [Triticum urartu]
Length=386

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 96/151 (64%), Gaps = 11/151 (7%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA-----EDPKSTPNAIATRNQLQADVTLVK  387
            AR+HASQNKRLP+Q VL ALYYDQLK+RS       ED  +   A + R Q +AD  L +
Sbjct  236  ARIHASQNKRLPLQAVLSALYYDQLKLRSAGVGHDDEDSDARSEAGSARMQAKADAALAR  295

Query  386  ENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHG  207
            ENEALR+EL +M+  ++    +    GS    ++    +K +FF SMS+ L +LNPF+ G
Sbjct  296  ENEALRSELARMRAHLSSGVQQSKGSGSRTAATATVPGKKASFFGSMSRTLSRLNPFRAG  355

Query  206  ---SKDTSNLDD---GEVDITKPRRRRFSIS  132
               SKDTS++ D   G +++ KP+RRR SIS
Sbjct  356  GGWSKDTSSIRDSRGGAMNVVKPKRRRSSIS  386



>gb|AAV50010.1| phototropic response-like protein [Malus domestica]
Length=114

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 78/109 (72%), Gaps = 1/109 (1%)
 Frame = -3

Query  455  DPKSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkg-ssqgssvkgssas  279
            D     +AI TR+Q+Q DV+L +ENE LRTELL+MKM+I D+   G ++  ++       
Sbjct  6    DENDVQDAITTRSQVQHDVSLARENEELRTELLKMKMYITDLHKTGPAAVATTSSCKGGG  65

Query  278  aVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
              +K  FFS +SKKLG+LNPFK GSKDTSN+ D +VDITKPRRRRFSIS
Sbjct  66   GPKKAKFFSYVSKKLGRLNPFKQGSKDTSNIVDEDVDITKPRRRRFSIS  114



>ref|XP_008803009.1| PREDICTED: root phototropism protein 2 [Phoenix dactylifera]
Length=583

 Score =   120 bits (302),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 71/150 (47%), Positives = 99/150 (66%), Gaps = 19/150 (13%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA---EDPKSTPNAIATRNQLQADVTLVKEN  381
            AR+HA++N RLP+QI+LHALY+DQLK+RSGA   +    + +A A R    AD +L++EN
Sbjct  443  ARLHAARNNRLPLQIILHALYFDQLKLRSGAAAKDAVAPSNSAAAARAGAMADASLMREN  502

Query  380  EALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSK  201
            EALR+EL +M++ ++++Q                  ++PTF SS SK LGKLNPF+HGS 
Sbjct  503  EALRSELTRMQLCLSELQG---------GSGLKGRPKRPTFLSSFSKTLGKLNPFRHGSM  553

Query  200  DTSNLDDGEVDI-------TKPRRRRFSIS  132
            D S++D+G V +        KPRRRRFSIS
Sbjct  554  DASSIDNGGVGVLGEALTKPKPRRRRFSIS  583



>ref|XP_004978520.1| PREDICTED: root phototropism protein 2-like [Setaria italica]
Length=604

 Score =   119 bits (297),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 71/148 (48%), Positives = 98/148 (66%), Gaps = 13/148 (9%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS--GAEDPKSTPNAIATRNQLQADVTLVKENE  378
            AR+HASQNKRLP+Q VL ALYYDQLK+RS  GA D  +   A   R Q +AD +L +ENE
Sbjct  462  ARLHASQNKRLPLQAVLSALYYDQLKLRSAAGAGDDDTQSAAGKARAQARADASLARENE  521

Query  377  ALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHG-SK  201
            ALR+EL +M+ +++ MQ            S + A +K +F  S+S+ L +LNPFK G +K
Sbjct  522  ALRSELARMRAYLSGMQ-----PSRGSGSSPSPAAKKTSFLGSVSRTLSRLNPFKGGWAK  576

Query  200  DTSNLDDG-----EVDITKPRRRRFSIS  132
            DT+++ DG     E+ + +P+RRRFSIS
Sbjct  577  DTASVADGRDGRKEMHVVRPKRRRFSIS  604



>dbj|BAF95168.1| similar to ROOT PHOTOTROPISM2 protein binding [Ipomoea nil]
Length=71

 Score =   108 bits (271),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = -3

Query  341  IADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDIT  162
            IADMQNKGSSQGSSVKGSSASAVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDIT
Sbjct  2    IADMQNKGSSQGSSVKGSSASAVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDIT  61

Query  161  KPRRRRFSIS  132
            KPRRRRFSIS
Sbjct  62   KPRRRRFSIS  71



>ref|XP_008669932.1| PREDICTED: root phototropism protein 2-like [Zea mays]
 tpg|DAA39312.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
Length=577

 Score =   114 bits (284),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 72/156 (46%), Positives = 98/156 (63%), Gaps = 17/156 (11%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-----GAEDPKSTPNAIA-TRNQLQADVTLV  390
            AR+HASQNKRLP+Q VL  LYYDQLKIRS     G E+   T +A    R Q +ADV+L 
Sbjct  421  ARMHASQNKRLPLQAVLSVLYYDQLKIRSADGSGGTEEGWETQSAAGKARAQARADVSLA  480

Query  389  KENEALRTELLQMKMFIADMQNkgssqgssvkgs------sasaVRKPTFFSSMSKKLGK  228
            +ENEALR EL +M+ +++ MQ      GS    S      + +  +K +F  S+S+ L +
Sbjct  481  RENEALRLELARMRAYVSGMQQSSKGSGSRPSSSSLVPGPATATGKKASFLGSVSRTLSR  540

Query  227  LNPFKHG-SKDTSNLDDGE----VDITKPRRRRFSI  135
            LNPFK G +KDT+++ DG     + + KP+RRRFSI
Sbjct  541  LNPFKGGWAKDTTSIADGRDRTSMHVVKPKRRRFSI  576



>dbj|BAJ91259.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=568

 Score =   113 bits (282),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 71/151 (47%), Positives = 97/151 (64%), Gaps = 15/151 (10%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA-----EDPKSTPNAIATRNQLQADVTLVK  387
            AR+HASQNKRLP+Q VL ALYYDQLK+RS A     ED  +   A + R Q +AD  L +
Sbjct  422  ARLHASQNKRLPLQAVLSALYYDQLKLRSAAVSHDDEDNDARSEAGSARMQAKADAALAR  481

Query  386  ENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHG  207
            EN+ALR+EL +M+  ++     G  Q       +A+  +K +FF SMS+ L +LNPF+ G
Sbjct  482  ENQALRSELARMRAHMS----SGVQQSKGSGSRTAATGKKASFFGSMSRTLSRLNPFRAG  537

Query  206  ---SKDTSNLDD---GEVDITKPRRRRFSIS  132
               SKDTS++ D   G +++ KP+RRR SIS
Sbjct  538  GGWSKDTSSIRDSRGGAMNVVKPKRRRSSIS  568



>dbj|BAJ92463.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=568

 Score =   112 bits (280),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 70/151 (46%), Positives = 97/151 (64%), Gaps = 15/151 (10%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA-----EDPKSTPNAIATRNQLQADVTLVK  387
            AR+HASQNKRLP+Q VL ALYYDQLK+RS A     ED  +   A + R Q +AD  L +
Sbjct  422  ARLHASQNKRLPLQAVLSALYYDQLKLRSAAVSHDDEDNDARSEAGSARMQAKADAALAR  481

Query  386  ENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHG  207
            EN+ALR+EL +M+  ++     G  Q       +A+  +K +FF SMS+ L +LNPF+ G
Sbjct  482  ENQALRSELARMRAHMS----SGVQQSKGSGSRTAATGKKASFFGSMSRTLSRLNPFRAG  537

Query  206  ---SKDTSNLDD---GEVDITKPRRRRFSIS  132
               S+DTS++ D   G +++ KP+RRR SIS
Sbjct  538  GGWSRDTSSIGDSRGGAMNVVKPKRRRSSIS  568



>ref|XP_004977394.1| PREDICTED: root phototropism protein 2-like [Setaria italica]
Length=560

 Score =   111 bits (277),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 68/148 (46%), Positives = 97/148 (66%), Gaps = 13/148 (9%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS--GAEDPKSTPNAIATRNQLQADVTLVKENE  378
            AR+HASQNKRLP+Q VL ALYYDQLK+RS  GA D  +   A   R Q +AD +L +ENE
Sbjct  418  ARLHASQNKRLPLQAVLSALYYDQLKLRSAAGAGDDDTQSAAGKARAQARADASLARENE  477

Query  377  ALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHG-SK  201
            ALR+EL +M+ +++ +Q            S + A +K +F  S+S+ L +LNPFK G +K
Sbjct  478  ALRSELARMRAYLSGVQ-----PSKGSGSSPSPAAKKTSFLGSVSRTLSRLNPFKGGWAK  532

Query  200  DTSNLDDG-----EVDITKPRRRRFSIS  132
            DT+++ DG     ++ + +P+RRR SIS
Sbjct  533  DTASVADGRDGRKDMHVVRPKRRRSSIS  560



>ref|XP_002463481.1| hypothetical protein SORBIDRAFT_01g000540 [Sorghum bicolor]
 gb|EER90479.1| hypothetical protein SORBIDRAFT_01g000540 [Sorghum bicolor]
Length=264

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 97/157 (62%), Gaps = 18/157 (11%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDP-------KSTPNAIATRNQLQADVTL  393
            AR+HA QNKRLP+Q +L ALYYDQLK+RS            +S   A   R Q +AD +L
Sbjct  107  ARLHAPQNKRLPLQALLDALYYDQLKLRSADGGDGAEGGGWESQSAAGKARAQARADASL  166

Query  392  VKENEALRTELLQMKMFIADMQNkgssqgssvkgs------sasaVRKPTFFSSMSKKLG  231
             +ENEALR+EL +M+ +++ MQ   +  GS    +      +++A +K +F  S+S+ L 
Sbjct  167  ARENEALRSELARMRAYVSGMQQHSNGSGSRSSLASASLVPASAAGKKASFLGSVSQTLS  226

Query  230  KLNPFKHG-SKDTSNLDDGE----VDITKPRRRRFSI  135
            +LNPFK G +KD +++ DG     + + KP+RRRFSI
Sbjct  227  QLNPFKGGWAKDMASIADGRDRSAMHVVKPKRRRFSI  263



>ref|XP_002450159.1| hypothetical protein SORBIDRAFT_05g001300 [Sorghum bicolor]
 gb|EES09147.1| hypothetical protein SORBIDRAFT_05g001300 [Sorghum bicolor]
Length=587

 Score =   110 bits (274),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 70/160 (44%), Positives = 100/160 (63%), Gaps = 23/160 (14%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAE------------DPKSTPNAIATRNQLQ  408
            AR+HASQNKRLP+Q VL ALYYDQLK+RS               +P+S   A   R Q +
Sbjct  429  ARLHASQNKRLPLQAVLSALYYDQLKLRSADGGGGDGAEGGAGWEPQSA--AGKARAQAR  486

Query  407  ADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgs----sasaVRKPTFFSSMSK  240
            AD +L +ENEALR+EL +M+ +++ MQ      GS    +    +++A +K +F  S+S+
Sbjct  487  ADASLARENEALRSELARMRAYVSGMQQHSKGSGSRSSSASLVPASAAGKKASFLGSVSR  546

Query  239  KLGKLNPFKHG-SKDTSNLDDGE----VDITKPRRRRFSI  135
             L +LNPFK G +KDT+++ DG     + + KP+RRRFSI
Sbjct  547  TLSRLNPFKGGWAKDTASIADGRDRSAMHVVKPKRRRFSI  586



>ref|XP_003577852.1| PREDICTED: root phototropism protein 2 [Brachypodium distachyon]
Length=606

 Score =   109 bits (272),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 72/152 (47%), Positives = 92/152 (61%), Gaps = 17/152 (11%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA----EDPKSTPNAIATRNQLQADVTLVKE  384
            AR+HASQNKRLP+Q VL ALYYDQLK+RSG     ED +S   A + R Q +AD  L +E
Sbjct  458  ARLHASQNKRLPLQAVLSALYYDQLKLRSGQLTGDEDDRS--EAGSARMQAKADAALARE  515

Query  383  NEALRTELLQMKMFIADMQNkgssqgs-----svkgssasaVRKPTFFSSMSKKLGKLNP  219
            NEALR+EL +M+  ++   +            S   ++     K  FF SMS+ L +LNP
Sbjct  516  NEALRSELGRMRAHMSSSSSGSGRGQRSKGSGSRTPAAMKGKMKVGFFGSMSRTLSRLNP  575

Query  218  FKHG----SKDTSNLDDGEVDITKPRRRRFSI  135
            F+ G    SKDTSN+ D    I KP+RRRFSI
Sbjct  576  FRAGGGRWSKDTSNIADAA--IVKPKRRRFSI  605



>ref|XP_006663162.1| PREDICTED: root phototropism protein 2-like [Oryza brachyantha]
Length=506

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 96/156 (62%), Gaps = 16/156 (10%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI----------ATRNQLQAD  402
             R+HASQNKRLP+Q VL ALYYDQLK+RSG         +           + R Q +A+
Sbjct  351  GRLHASQNKRLPLQAVLSALYYDQLKLRSGNGGGVGGDESGGWDAYGGMMRSARMQAKAE  410

Query  401  VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPT----FFSSMSKKL  234
             +L +ENE LR+EL +M+ +++ M  + S  G S   ++AS+ +K T       S+S+ L
Sbjct  411  ASLARENEELRSELARMRAYMSGMGVQQSKGGGSSSRTTASSGKKGTTSLWLLGSVSRTL  470

Query  233  GKLNPFKHG--SKDTSNLDDGEVDITKPRRRRFSIS  132
             +LNPFK G  +KDTS++ D ++   KP+RRRFS+S
Sbjct  471  SRLNPFKGGIWAKDTSSIGDKKIHSVKPKRRRFSVS  506



>gb|ABG22339.1| RPT2, putative, expressed [Oryza sativa Japonica Group]
Length=539

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 85/155 (55%), Gaps = 26/155 (17%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----------TPNAIATRNQLQAD  402
             R+HASQN RLP+Q VL ALYYD+LK+RSG E              +  A + R Q + +
Sbjct  396  GRLHASQNNRLPLQAVLSALYYDRLKLRSGDEGGGGWDAYGNGVMRSSAAGSARKQAKEE  455

Query  401  VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLN  222
             +L +ENEALR+EL +M+ +++ MQ +     SS                S  + L +LN
Sbjct  456  ASLARENEALRSELARMRAYVSGMQQQSKGSSSSR-----------GKKGSWLRTLSRLN  504

Query  221  PFKHG--SKDTSNLDDGEVDI---TKPRRRRFSIS  132
            PFK G   KDTS + DG+ D     K +RRRFSIS
Sbjct  505  PFKAGIWGKDTSGIVDGKTDAMNSVKSKRRRFSIS  539



>gb|EEC68739.1| hypothetical protein OsI_37246 [Oryza sativa Indica Group]
Length=570

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 64/155 (41%), Positives = 85/155 (55%), Gaps = 26/155 (17%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----------TPNAIATRNQLQAD  402
             R+HASQN RLP+Q VL ALYYDQLK+RSG E              +  A + R Q + +
Sbjct  427  GRLHASQNNRLPLQAVLSALYYDQLKLRSGDEGGGGWDAYGNGVMRSSAAGSARKQAKEE  486

Query  401  VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLN  222
             +L +ENEALR+EL +M+ +++ MQ +     SS                S  + L +LN
Sbjct  487  ASLARENEALRSELARMRAYVSGMQQQSKGSSSSRGKK-----------GSWLRTLSRLN  535

Query  221  PFKHG--SKDTSNLDDGEVDI---TKPRRRRFSIS  132
            PFK G   KDTS + DG+ D     K +RRRFSIS
Sbjct  536  PFKAGIWGKDTSGIVDGKTDAMNSVKSKRRRFSIS  570



>ref|NP_001065596.1| Os11g0118300 [Oryza sativa Japonica Group]
 gb|ABA91174.1| RPT2, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF27441.1| Os11g0118300 [Oryza sativa Japonica Group]
 dbj|BAG89308.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51536.1| hypothetical protein OsJ_32738 [Oryza sativa Japonica Group]
Length=571

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 63/155 (41%), Positives = 85/155 (55%), Gaps = 26/155 (17%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----------TPNAIATRNQLQAD  402
             R+HASQN RLP+Q VL ALYYD+LK+RSG E              +  A + R Q + +
Sbjct  428  GRLHASQNNRLPLQAVLSALYYDRLKLRSGDEGGGGWDAYGNGVMRSSAAGSARKQAKEE  487

Query  401  VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLN  222
             +L +ENEALR+EL +M+ +++ MQ +     SS                S  + L +LN
Sbjct  488  ASLARENEALRSELARMRAYVSGMQQQSKGSSSSRGKK-----------GSWLRTLSRLN  536

Query  221  PFKHG--SKDTSNLDDGEVDI---TKPRRRRFSIS  132
            PFK G   KDTS + DG+ D     K +RRRFSIS
Sbjct  537  PFKAGIWGKDTSGIVDGKTDAMNSVKSKRRRFSIS  571



>gb|ABA95649.1| RPT2, putative, expressed [Oryza sativa Japonica Group]
 gb|EEE52651.1| hypothetical protein OsJ_35014 [Oryza sativa Japonica Group]
Length=570

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 63/155 (41%), Positives = 85/155 (55%), Gaps = 26/155 (17%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----------TPNAIATRNQLQAD  402
             R+HASQN RLP+Q VL ALYYD+LK+RSG E              +  A + R Q + +
Sbjct  427  GRLHASQNNRLPLQAVLSALYYDRLKLRSGDEGGGGWDAYGNGVMRSSAAGSARKQAKEE  486

Query  401  VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLN  222
             +L +ENEALR+EL +M+ +++ MQ +     SS                S  + L +LN
Sbjct  487  ASLARENEALRSELARMRAYVSGMQQQSKGSSSSRGKK-----------GSWLRTLSRLN  535

Query  221  PFKHG--SKDTSNLDDGEVDI---TKPRRRRFSIS  132
            PFK G   KDTS + DG+ D     K +RRRFSIS
Sbjct  536  PFKAGIWGKDTSGIVDGKTDAMNSVKSKRRRFSIS  570



>ref|NP_001066000.1| Os12g0117400 [Oryza sativa Japonica Group]
 dbj|BAF29019.1| Os12g0117400, partial [Oryza sativa Japonica Group]
Length=591

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 63/155 (41%), Positives = 85/155 (55%), Gaps = 26/155 (17%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----------TPNAIATRNQLQAD  402
             R+HASQN RLP+Q VL ALYYD+LK+RSG E              +  A + R Q + +
Sbjct  448  GRLHASQNNRLPLQAVLSALYYDRLKLRSGDEGGGGWDAYGNGVMRSSAAGSARKQAKEE  507

Query  401  VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLN  222
             +L +ENEALR+EL +M+ +++ MQ +     SS                S  + L +LN
Sbjct  508  ASLARENEALRSELARMRAYVSGMQQQSKGSSSSRGKK-----------GSWLRTLSRLN  556

Query  221  PFKHG--SKDTSNLDDGEVDI---TKPRRRRFSIS  132
            PFK G   KDTS + DG+ D     K +RRRFSIS
Sbjct  557  PFKAGIWGKDTSGIVDGKTDAMNSVKSKRRRFSIS  591



>gb|EEC67555.1| hypothetical protein OsI_34888 [Oryza sativa Indica Group]
Length=571

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 63/155 (41%), Positives = 84/155 (54%), Gaps = 26/155 (17%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----------TPNAIATRNQLQAD  402
             R+HASQN RLP+Q VL ALYYDQLK+RSG E              +  A +   Q + +
Sbjct  428  GRLHASQNNRLPLQAVLSALYYDQLKLRSGDEGGSGWDAYGNGVMRSSAAGSAWKQAKEE  487

Query  401  VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLN  222
             +L +ENEALR+EL +M+ +++ MQ +     SS                S  + L +LN
Sbjct  488  ASLARENEALRSELARMRAYVSGMQQQSKGSSSSRGKK-----------GSWLRTLSRLN  536

Query  221  PFKHG--SKDTSNLDDGEVDI---TKPRRRRFSIS  132
            PFK G   KDTS + DG+ D     K +RRRFSIS
Sbjct  537  PFKAGIWGKDTSGIVDGKTDAMNSVKAKRRRFSIS  571



>ref|XP_008661889.1| PREDICTED: LOC100281201 isoform X1 [Zea mays]
Length=636

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 61/156 (39%), Positives = 85/156 (54%), Gaps = 17/156 (11%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAE-----DPKSTPNAIATRNQLQADVTLVK  387
            AR HASQNKRLP+Q  L ALYYD+LK+RS A      D +S+    A      AD  L +
Sbjct  482  ARTHASQNKRLPLQAALSALYYDELKLRSAATADVVLDTQSSAAGRACAQARAADAALAR  541

Query  386  ENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHG  207
            ENEALR+EL +M+ +++ M+       S+   S +   +K +F  S+S+ + +LNPF+ G
Sbjct  542  ENEALRSELARMRAYLSGMER-SKGGRSTPPSSPSRRAKKASFLGSVSRTMSRLNPFRSG  600

Query  206  ----SKDTSNLDDGEVD-------ITKPRRRRFSIS  132
                   TSN   G          +  P+RRR SIS
Sbjct  601  GWMAKVTTSNAAGGGRQSKTMMQHVVTPKRRRASIS  636



>gb|AFW55920.1| putative phototropic-responsive NPH3 family protein [Zea mays]
Length=621

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 61/156 (39%), Positives = 85/156 (54%), Gaps = 17/156 (11%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAE-----DPKSTPNAIATRNQLQADVTLVK  387
            AR HASQNKRLP+Q  L ALYYD+LK+RS A      D +S+    A      AD  L +
Sbjct  467  ARTHASQNKRLPLQAALSALYYDELKLRSAATADVVLDTQSSAAGRACAQARAADAALAR  526

Query  386  ENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHG  207
            ENEALR+EL +M+ +++ M+       S+   S +   +K +F  S+S+ + +LNPF+ G
Sbjct  527  ENEALRSELARMRAYLSGMER-SKGGRSTPPSSPSRRAKKASFLGSVSRTMSRLNPFRSG  585

Query  206  ----SKDTSNLDDGEVD-------ITKPRRRRFSIS  132
                   TSN   G          +  P+RRR SIS
Sbjct  586  GWMAKVTTSNAAGGGRQSKTMMQHVVTPKRRRASIS  621



>ref|NP_001147592.1| LOC100281201 [Zea mays]
 gb|ACG28024.1| RPT2-like protein [Zea mays]
Length=613

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 61/156 (39%), Positives = 85/156 (54%), Gaps = 17/156 (11%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAE-----DPKSTPNAIATRNQLQADVTLVK  387
            AR HASQNKRLP+Q  L ALYYD+LK+RS A      D +S+    A      AD  L +
Sbjct  459  ARTHASQNKRLPLQAALSALYYDELKLRSAATADVVLDTQSSAAGRACAQARAADAALAR  518

Query  386  ENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHG  207
            ENEALR+EL +M+ +++ M+       S+   S +   +K +F  S+S+ + +LNPF+ G
Sbjct  519  ENEALRSELARMRAYLSGMER-SKGGRSTPPSSPSRRAKKASFLGSVSRTMSRLNPFRSG  577

Query  206  ----SKDTSNLDDGEVD-------ITKPRRRRFSIS  132
                   TSN   G          +  P+RRR SIS
Sbjct  578  GWMAKVTTSNAAGGGRQSKTMMQHVVTPKRRRASIS  613



>ref|XP_010277091.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Nelumbo nucifera]
Length=594

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 82/157 (52%), Gaps = 20/157 (13%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQAD---  402
            A  HA+QN RLPVQIV+  LYY+Q ++R        GAE P      + +++   A    
Sbjct  441  ACAHAAQNDRLPVQIVVQVLYYEQRRLRDAMSDNLMGAESPALQKMNLHSKDYHSAPDEL  500

Query  401  VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP------TFFSSMSK  240
            ++L +ENE L+ EL++M+M + +++  G            S  + P      +F SSMSK
Sbjct  501  LSLRRENEDLKMELVKMRMRLKELEKSGEINPPESTPPIPSVDKPPLALPRKSFISSMSK  560

Query  239  KLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  132
            KLG+L PF  G    S+   G    TKP R RR S+S
Sbjct  561  KLGRLYPFMRGEGVKSSDGKGR---TKPSRNRRHSVS  594



>ref|XP_010277089.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010277090.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nelumbo nucifera]
Length=605

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 82/157 (52%), Gaps = 20/157 (13%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQAD---  402
            A  HA+QN RLPVQIV+  LYY+Q ++R        GAE P      + +++   A    
Sbjct  452  ACAHAAQNDRLPVQIVVQVLYYEQRRLRDAMSDNLMGAESPALQKMNLHSKDYHSAPDEL  511

Query  401  VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP------TFFSSMSK  240
            ++L +ENE L+ EL++M+M + +++  G            S  + P      +F SSMSK
Sbjct  512  LSLRRENEDLKMELVKMRMRLKELEKSGEINPPESTPPIPSVDKPPLALPRKSFISSMSK  571

Query  239  KLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  132
            KLG+L PF  G    S+   G    TKP R RR S+S
Sbjct  572  KLGRLYPFMRGEGVKSSDGKGR---TKPSRNRRHSVS  605



>ref|XP_010272171.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Nelumbo 
nucifera]
Length=620

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 80/160 (50%), Gaps = 26/160 (16%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS--------GAEDPKSTPNAIATRNQLQAD--  402
            A  HA+QN RLPVQIV+  LYY+Q ++R         G E P S P  +   N   AD  
Sbjct  467  ACAHAAQNDRLPVQIVVQVLYYEQQRLRDVMGGGNLMGGESP-SLPQKL---NLYSADYH  522

Query  401  ------VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasa----VRKPTFFS  252
                  V+L +ENE L+ EL++M+M +  ++       S     SA        KP+F +
Sbjct  523  SAPDEVVSLRRENEDLKIELVKMRMRLKQLEKSAEIIPSGSTPPSADKPPLPRSKPSFIN  582

Query  251  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
            S+SKKLG+L PF     D     DG+  I   R RR SIS
Sbjct  583  SVSKKLGRLYPFVRA--DGVKPSDGKGRIKPSRNRRHSIS  620



>ref|XP_011006800.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Populus euphratica]
Length=546

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 81/156 (52%), Gaps = 24/156 (15%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTP--NAIATRNQLQAD-  402
            A  HA+QN RLPVQ V+  LYY+Q ++R        G + P   P  N  +T  +  +D 
Sbjct  399  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSPALPPKVNIFSTDIRPVSDE  458

Query  401  -VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  225
              +L +ENE L+ EL++MKM I +++       +S   +    + + +F +S+SKKLG++
Sbjct  459  LSSLRRENEDLKIELVKMKMKIKEIERATVVSTTSSPSADKPPLPRKSFINSVSKKLGRI  518

Query  224  NPFKHGSKDTSNLDDGEVDITKPRR-----RRFSIS  132
            NPF           DG +  TK R      RR SIS
Sbjct  519  NPFVRA--------DGPLSNTKARTRPSKDRRHSIS  546



>ref|XP_011012052.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Populus euphratica]
Length=546

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 81/156 (52%), Gaps = 24/156 (15%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTP--NAIATRNQLQAD-  402
            A  HA+QN RLPVQ V+  LYY+Q ++R        G + P   P  N  +T  +  +D 
Sbjct  399  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSPALPPKVNIFSTDIRPVSDE  458

Query  401  -VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  225
              +L +ENE L+ EL++MKM I +++       +S   +    + + +F +S+SKKLG++
Sbjct  459  LSSLRRENEDLKIELVKMKMKIKEIERATVVSTTSSPSADKPPLPRKSFINSVSKKLGRI  518

Query  224  NPFKHGSKDTSNLDDGEVDITKPRR-----RRFSIS  132
            NPF           DG +  TK R      RR SIS
Sbjct  519  NPFVRA--------DGPLSNTKARTRPSKDRRHSIS  546



>ref|XP_011006799.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Populus euphratica]
Length=599

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 81/156 (52%), Gaps = 24/156 (15%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTP--NAIATRNQLQAD-  402
            A  HA+QN RLPVQ V+  LYY+Q ++R        G + P   P  N  +T  +  +D 
Sbjct  452  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSPALPPKVNIFSTDIRPVSDE  511

Query  401  -VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  225
              +L +ENE L+ EL++MKM I +++       +S   +    + + +F +S+SKKLG++
Sbjct  512  LSSLRRENEDLKIELVKMKMKIKEIERATVVSTTSSPSADKPPLPRKSFINSVSKKLGRI  571

Query  224  NPFKHGSKDTSNLDDGEVDITKPRR-----RRFSIS  132
            NPF           DG +  TK R      RR SIS
Sbjct  572  NPFVRA--------DGPLSNTKARTRPSKDRRHSIS  599



>ref|XP_011012051.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Populus euphratica]
Length=599

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 81/156 (52%), Gaps = 24/156 (15%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTP--NAIATRNQLQAD-  402
            A  HA+QN RLPVQ V+  LYY+Q ++R        G + P   P  N  +T  +  +D 
Sbjct  452  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSPALPPKVNIFSTDIRPVSDE  511

Query  401  -VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  225
              +L +ENE L+ EL++MKM I +++       +S   +    + + +F +S+SKKLG++
Sbjct  512  LSSLRRENEDLKIELVKMKMKIKEIERATVVSTTSSPSADKPPLPRKSFINSVSKKLGRI  571

Query  224  NPFKHGSKDTSNLDDGEVDITKPRR-----RRFSIS  132
            NPF           DG +  TK R      RR SIS
Sbjct  572  NPFVRA--------DGPLSNTKARTRPSKDRRHSIS  599



>ref|XP_002970426.1| hypothetical protein SELMODRAFT_231529 [Selaginella moellendorffii]
 gb|EFJ28556.1| hypothetical protein SELMODRAFT_231529 [Selaginella moellendorffii]
Length=603

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 84/154 (55%), Gaps = 27/154 (18%)
 Frame = -3

Query  542  HASQNKRLPVQIVLHALYYDQLKIRSG-----------------AEDPKSTPNAIATRNQ  414
            HA+QN+RLPVQ+V+  LYY+Q+++R+                  A  P     AI+ R+ 
Sbjct  460  HAAQNERLPVQMVVQVLYYEQMRLRTAMTTSFVDGEQVGPYSQKAAGPGGLSAAISPRDH  519

Query  413  LQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKL  234
                 ++ +EN  L+ E+ +M+M + D++    +    ++ + +S+     F SS++K L
Sbjct  520  YS---SIRRENRELKLEVARMRMRLTDLEKDHVNMKEGIQKTGSSSK----FLSSVTKTL  572

Query  233  GKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
             KLNPF+   KD+SN+ + +  +   RRRR SIS
Sbjct  573  SKLNPFRF--KDSSNVPNAKSGMNS-RRRRHSIS  603



>ref|XP_002978505.1| hypothetical protein SELMODRAFT_443843 [Selaginella moellendorffii]
 gb|EFJ20491.1| hypothetical protein SELMODRAFT_443843 [Selaginella moellendorffii]
Length=615

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 84/154 (55%), Gaps = 27/154 (18%)
 Frame = -3

Query  542  HASQNKRLPVQIVLHALYYDQLKIRSG-----------------AEDPKSTPNAIATRNQ  414
            HA+QN+RLPVQ+V+  LYY+Q+++R+                  A  P     AI+ R+ 
Sbjct  472  HAAQNERLPVQMVVQVLYYEQMRLRTAMTTSFVDGEQVGPYSQKAAGPGGLSAAISPRDH  531

Query  413  LQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKL  234
                 ++ +EN  L+ E+ +M+M + D++    +    ++ + +S+     F SS++K L
Sbjct  532  YS---SIRRENRELKLEVARMRMRLTDLEKDHVNMKEGIQKTGSSSK----FLSSVTKTL  584

Query  233  GKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
             KLNPF+   KD+SN+ + +  +   RRRR SIS
Sbjct  585  SKLNPFRF--KDSSNVPNAKSGMNN-RRRRHSIS  615



>ref|XP_008787157.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Phoenix 
dactylifera]
Length=610

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 76/152 (50%), Gaps = 18/152 (12%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR--------SGAEDP----KSTPNAIATRNQLQ  408
            A  HA+QN RLPVQ+V+  LYY+Q + R        SG E P    K+TP  I   N   
Sbjct  465  ACAHAAQNDRLPVQLVVQVLYYEQQRHRDVMSTGNLSGGESPALSQKATPYGIGYHNAPD  524

Query  407  ADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGK  228
                L +EN  L+ EL +M+M + +++    +  S+ K        K +F +S+SKKLG+
Sbjct  525  ELSRLRRENADLKLELFRMRMQLQEIEKSSGNTTSAGKPPLP----KKSFINSVSKKLGR  580

Query  227  LNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
            L PF     D      G+     P+ RR SIS
Sbjct  581  LYPFMR--SDNEKTLSGKTRKKPPKDRRHSIS  610



>gb|KHN36285.1| BTB/POZ domain-containing protein [Glycine soja]
Length=618

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 86/156 (55%), Gaps = 20/156 (13%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--------  399
            A  HA+QN RLPVQ V+  LYY+Q ++R+     +S  +++ ++ N    D+        
Sbjct  467  ACAHAAQNDRLPVQTVVQVLYYEQQRLRNAMNGSRSGESSVDSKLNVYSTDLHPVSNELS  526

Query  398  TLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSKK  237
            TL +ENE L+ EL+++KM + +++N       +    S++ +  KP     +F SS+SKK
Sbjct  527  TLRRENEDLKLELVKLKMRLKEIENSTLKSTVNSPAVSASPSADKPPLPRRSFMSSVSKK  586

Query  236  LGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  132
            LG+L+PF   +   S    G    TKP + RR SIS
Sbjct  587  LGRLSPFVR-ADGVSPFAKGR---TKPNKNRRHSIS  618



>gb|EEC74727.1| hypothetical protein OsI_10455 [Oryza sativa Indica Group]
Length=626

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 80/167 (48%), Gaps = 32/167 (19%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-----------------  423
            A  HA+QN RLPVQ V+  LY++Q ++R+ ++ P + P+                     
Sbjct  465  ACAHAAQNDRLPVQTVVQVLYHEQRRLRAPSQPPSAAPSYAGGESPALSYRPTPSFNGRH  524

Query  422  RNQLQADVT-LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPT-----  261
            R  +  +V+ L +EN+ LR ELL+MKM + D  +   S G           +KP      
Sbjct  525  RPGVPDEVSRLQRENDELRMELLRMKMRLRD-PSVAFSAGGVPPSGRPPLPKKPGGGGGG  583

Query  260  ----FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
                F +SMSKKLG+LNPF      +  L  G V    P+ RR SIS
Sbjct  584  SSGGFMNSMSKKLGRLNPFLR----SDVLGGGRVRTKPPKDRRHSIS  626



>gb|AAN77296.1| Hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF94554.1| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
 gb|EEE58548.1| hypothetical protein OsJ_09846 [Oryza sativa Japonica Group]
Length=626

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 80/167 (48%), Gaps = 32/167 (19%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-----------------  423
            A  HA+QN RLPVQ V+  LY++Q ++R+ ++ P + P+                     
Sbjct  465  ACAHAAQNDRLPVQTVVQVLYHEQRRLRAPSQPPSAAPSYAGGESPALSYRPTPSFNGRH  524

Query  422  RNQLQADVT-LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPT-----  261
            R  +  +V+ L +EN+ LR ELL+MKM + D  +   S G           +KP      
Sbjct  525  RPGVPDEVSRLQRENDELRMELLRMKMRLRD-PSVAFSAGGVPPSGRPPLPKKPGGGGGG  583

Query  260  ----FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
                F +SMSKKLG+LNPF      +  L  G V    P+ RR SIS
Sbjct  584  SSGGFMNSMSKKLGRLNPFLR----SDVLGGGRVRTKPPKDRRHSIS  626



>ref|XP_003517336.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
Length=618

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 86/160 (54%), Gaps = 28/160 (18%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--------  399
            A  HA+QN RLPVQ V+  LYY+Q ++R+     +S  +++ ++ N    D+        
Sbjct  467  ACAHAAQNDRLPVQTVVQVLYYEQQRLRNAMNGSRSGESSVDSKLNVYSTDLHPVSNELS  526

Query  398  TLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSKK  237
            TL +ENE L+ EL+++KM + +++N       +    S++ +  KP     +F SS+SKK
Sbjct  527  TLRRENEDLKLELVKLKMRLKEIENSTLKSTVNSPAVSASPSADKPPLPRRSFMSSVSKK  586

Query  236  LGKLNPFKHGSKDTSNLDDGEVDI----TKP-RRRRFSIS  132
            LG+L+PF           DG +      TKP + RR SIS
Sbjct  587  LGRLSPFVRA--------DGVLPFPKGRTKPNKNRRHSIS  618



>ref|XP_002533158.1| Root phototropism protein, putative [Ricinus communis]
 gb|EEF29217.1| Root phototropism protein, putative [Ricinus communis]
Length=621

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 75/132 (57%), Gaps = 13/132 (10%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS---GAEDPK--STPNAIATRNQLQAD--VTL  393
            A  HA+QN RLPVQ V+  LYY+Q ++R    G + P   +  N  AT N   +D   +L
Sbjct  473  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMIGGDSPTLPTKVNLYATNNHPVSDEISSL  532

Query  392  VKENEALRTELLQMKMFIADMQNkgssqgssvk-gssasaVRKP-----TFFSSMSKKLG  231
             +ENE L+ EL++MKM + +++  G  +  +     ++ +  KP     +F +S+SKKLG
Sbjct  533  KRENEDLKLELVKMKMRLKEIEKSGGGRSVTSSPALNSPSADKPPLPRKSFINSVSKKLG  592

Query  230  KLNPFKHGSKDT  195
            +L PF  G  D+
Sbjct  593  RLYPFVRGEGDS  604



>ref|XP_002441790.1| hypothetical protein SORBIDRAFT_08g002330 [Sorghum bicolor]
 gb|AAO16688.1| RPT2-like protein [Sorghum bicolor]
 gb|EES15628.1| hypothetical protein SORBIDRAFT_08g002330 [Sorghum bicolor]
Length=665

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 63/200 (32%), Positives = 88/200 (44%), Gaps = 61/200 (31%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIA-TRNQLQADV--------  399
            AR+HASQNKRLP+Q VL ALYYDQLK+RS A+   S  + +A T+ Q  +          
Sbjct  465  ARLHASQNKRLPLQAVLSALYYDQLKLRSAADAATSMGDVVADTQTQSSSAAGRARAQAM  524

Query  398  ---TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTF----------  258
                L +ENEALR EL +M+ +++     G  + SS   S +   +K TF          
Sbjct  525  ADAALARENEALRVELARMRAYMSGTMQHGKGRESSTPASPSRTAKKATFLGTELARMRA  584

Query  257  -------------------------------FSSMSKKLGKLNPFKHG--SKDTSNLDDG  177
                                             S+S+ L +LNPFK G  +  T ++  G
Sbjct  585  YMSGMHHSKGSGATPPASPSRTAAAKTKASLLGSVSRSLSRLNPFKGGWTTNHTGSIAAG  644

Query  176  EV------DITKPRRRRFSI  135
                     +  P+RRR SI
Sbjct  645  GRPCKTMHHVVTPKRRRSSI  664



>ref|XP_009411062.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Musa 
acuminata subsp. malaccensis]
Length=583

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 75/151 (50%), Gaps = 17/151 (11%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDP----KSTPNAIATRNQLQA  405
            A  HA+QN+RLPVQ V+  L+ +Q + R       +G E P    +STP +   R     
Sbjct  439  ACAHAAQNERLPVQTVVQVLFCEQQRFRDATSGSFTGGESPALSLRSTPCSTKHRGGTDE  498

Query  404  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  225
               L +EN+ LR +LL+M+M + +++       S+ K        K +F +S+SKKLG+L
Sbjct  499  LSRLQRENDDLRMQLLRMRMLLKEVEKPSGQIPSAQKPPLP----KKSFINSLSKKLGRL  554

Query  224  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
             PF H          G      P+ RR SIS
Sbjct  555  YPFTHADGVKPFSSKGRT--KPPKDRRHSIS  583



>ref|XP_006579934.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
 gb|KHN06007.1| BTB/POZ domain-containing protein [Glycine soja]
Length=590

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 89/160 (56%), Gaps = 27/160 (17%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR------SGAEDP------KSTPNAI-ATRNQL  411
            A  HA+QN RLPVQ+V+  LYY+Q ++R      +G + P       S+PN +    N+L
Sbjct  438  ACAHAAQNDRLPVQMVVQVLYYEQQRLRDSMDGNAGWDSPNFRDKVNSSPNELNLVSNEL  497

Query  410  QADVTLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSS  249
                 L +ENE L+ E++++KM + +++       SS     ++ +  KP     +F +S
Sbjct  498  S---ILRRENEDLKLEIVKLKMKLKEIERTSIRSASSSPVIFASPSADKPPLPRKSFINS  554

Query  248  MSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  132
            +SKKLG+L+PF  G+  T+ L  G V   KP + RR SIS
Sbjct  555  VSKKLGRLSPFSRGNAATTLL-KGHV---KPDKNRRHSIS  590



>ref|XP_003538794.2| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Glycine max]
Length=618

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 84/156 (54%), Gaps = 20/156 (13%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--------  399
            A  HA+QN RLPVQ V+  LYY+Q ++R       S  +++ ++ N    D+        
Sbjct  467  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGSGSGESSVDSKLNVYSTDLHPVSNELS  526

Query  398  TLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSKK  237
            TL +ENE L+ EL+++KM + +++N       +    S++ +  KP     +F SS+SKK
Sbjct  527  TLRRENEDLKLELVKLKMRLKEIENSTLKSTVNSPVVSASPSADKPPLPRRSFMSSVSKK  586

Query  236  LGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  132
            LG+L+PF   +   S    G    TKP + RR SIS
Sbjct  587  LGRLSPFVR-ADGVSPFAKGR---TKPNKNRRHSIS  618



>ref|XP_006590635.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Glycine max]
Length=628

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 84/156 (54%), Gaps = 20/156 (13%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--------  399
            A  HA+QN RLPVQ V+  LYY+Q ++R       S  +++ ++ N    D+        
Sbjct  477  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGSGSGESSVDSKLNVYSTDLHPVSNELS  536

Query  398  TLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSKK  237
            TL +ENE L+ EL+++KM + +++N       +    S++ +  KP     +F SS+SKK
Sbjct  537  TLRRENEDLKLELVKLKMRLKEIENSTLKSTVNSPVVSASPSADKPPLPRRSFMSSVSKK  596

Query  236  LGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  132
            LG+L+PF   +   S    G    TKP + RR SIS
Sbjct  597  LGRLSPFVR-ADGVSPFAKGR---TKPNKNRRHSIS  628



>gb|KHN12984.1| BTB/POZ domain-containing protein [Glycine soja]
Length=640

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 84/156 (54%), Gaps = 20/156 (13%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--------  399
            A  HA+QN RLPVQ V+  LYY+Q ++R       S  +++ ++ N    D+        
Sbjct  489  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGSGSGESSVDSKLNVYSTDLHPVSNELS  548

Query  398  TLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSKK  237
            TL +ENE L+ EL+++KM + +++N       +    S++ +  KP     +F SS+SKK
Sbjct  549  TLRRENEDLKLELVKLKMRLKEIENSTLKSTVNSPVVSASPSADKPPLPRRSFMSSVSKK  608

Query  236  LGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  132
            LG+L+PF   +   S    G    TKP + RR SIS
Sbjct  609  LGRLSPFVR-ADGVSPFAKGR---TKPNKNRRHSIS  640



>ref|XP_006380639.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
 gb|ERP58436.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
Length=601

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 80/151 (53%), Gaps = 13/151 (9%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTP--NAIATRNQLQAD-  402
            A  HA+QN RLPVQ V+  LYY+Q ++R        G + P   P  N  +T  +  +D 
Sbjct  453  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSPDLPPKVNIFSTDIRPVSDE  512

Query  401  -VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  225
              +L +ENE L+ EL++MKM + +++       +S   +    + + +F +S+SKKLG++
Sbjct  513  LSSLRRENEDLKIELVKMKMKMKEIERATVVSTTSSPSADKPPLPRKSFINSVSKKLGRI  572

Query  224  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
            NPF     D   L + +      + RR SIS
Sbjct  573  NPFVRA--DGFPLSNTKARTRPSKDRRHSIS  601



>ref|XP_006380638.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
 gb|ERP58435.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
Length=643

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 80/151 (53%), Gaps = 13/151 (9%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTP--NAIATRNQLQAD-  402
            A  HA+QN RLPVQ V+  LYY+Q ++R        G + P   P  N  +T  +  +D 
Sbjct  495  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSPDLPPKVNIFSTDIRPVSDE  554

Query  401  -VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  225
              +L +ENE L+ EL++MKM + +++       +S   +    + + +F +S+SKKLG++
Sbjct  555  LSSLRRENEDLKIELVKMKMKMKEIERATVVSTTSSPSADKPPLPRKSFINSVSKKLGRI  614

Query  224  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
            NPF     D   L + +      + RR SIS
Sbjct  615  NPFVRA--DGFPLSNTKARTRPSKDRRHSIS  643



>ref|XP_010412681.1| PREDICTED: putative BTB/POZ domain-containing protein At3g49970 
[Camelina sativa]
Length=243

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 79/161 (49%), Gaps = 36/161 (22%)
 Frame = -3

Query  545  VHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-------------RNQLQA  405
             HA+QN RLPVQ V+  LYY+Q  +R    D  S P A AT              N+L  
Sbjct  96   AHAAQNDRLPVQTVVQVLYYEQQSLREILSDSDSPPAAAATVEDTHPPPELSSYNNELS-  154

Query  404  DVTLVKENEALRTELLQMKMFIADMQNkgssqgss-----vkgssasaVRKP-----TFF  255
               L +EN+ L+ EL+++KM   +++    +   +         S ++V KP     +F 
Sbjct  155  --KLNRENQELKLELIKVKMKFKELEKNQKAFEVTSGSDCSSSVSIASVVKPRLPRKSFM  212

Query  254  SSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
            SS+S++LGKLNPF  G K        +V    P+ RR SIS
Sbjct  213  SSVSRQLGKLNPF--GQK--------QVQTKPPKGRRHSIS  243



>ref|XP_010412682.1| PREDICTED: putative BTB/POZ domain-containing protein At3g49970 
[Camelina sativa]
Length=571

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 80/160 (50%), Gaps = 36/160 (23%)
 Frame = -3

Query  542  HASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-------------RNQLQAD  402
            HA+QN RLPVQ V+  LYY+Q  +R    D  S P A AT              N+L   
Sbjct  425  HAAQNDRLPVQTVVQVLYYEQQSLREILSDSDSPPAAAATVEDTHPPPELSSYNNELS--  482

Query  401  VTLVKENEALRTELLQMKMFIADMQN-----kgssqgssvkgssasaVRKP-----TFFS  252
              L +EN+ L+ EL+++KM   +++      + +S        S ++V KP     +F S
Sbjct  483  -KLNRENQELKLELIKVKMKFKELEKNQKAFEVTSGSDCSSSVSIASVVKPRLPRKSFMS  541

Query  251  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
            S+S++LGKLNPF  G K        +V    P+ RR SIS
Sbjct  542  SVSRQLGKLNPF--GQK--------QVQTKPPKGRRHSIS  571



>ref|XP_010905283.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Elaeis guineensis]
Length=533

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 80/152 (53%), Gaps = 19/152 (13%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDP----KSTPNAIATRNQLQA  405
            A  HA+QN RLPVQIV+  L+++Q + R       SG E P    K+TP  +   N    
Sbjct  389  ACAHAAQNDRLPVQIVVQVLHHEQQRRRDVMSGNFSGGESPALSQKATPFGVGYHNAPDE  448

Query  404  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  225
               L +EN  L+ EL +M+M + +++    +  S+ K        K +F +S+SKKLG+L
Sbjct  449  LSRLRRENADLKLELFRMRMQLKEIEKSSGNITSAGKPPLP----KKSFINSVSKKLGRL  504

Query  224  NPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  132
             PF     D+     G+  +TKP + RR SIS
Sbjct  505  YPFMR--SDSVKPPSGK-RMTKPHKDRRHSIS  533



>ref|XP_010905282.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Elaeis guineensis]
Length=609

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 80/152 (53%), Gaps = 19/152 (13%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDP----KSTPNAIATRNQLQA  405
            A  HA+QN RLPVQIV+  L+++Q + R       SG E P    K+TP  +   N    
Sbjct  465  ACAHAAQNDRLPVQIVVQVLHHEQQRRRDVMSGNFSGGESPALSQKATPFGVGYHNAPDE  524

Query  404  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  225
               L +EN  L+ EL +M+M + +++    +  S+ K        K +F +S+SKKLG+L
Sbjct  525  LSRLRRENADLKLELFRMRMQLKEIEKSSGNITSAGKPPLP----KKSFINSVSKKLGRL  580

Query  224  NPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  132
             PF     D+     G+  +TKP + RR SIS
Sbjct  581  YPFMR--SDSVKPPSGK-RMTKPHKDRRHSIS  609



>ref|XP_006600924.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
 gb|KHN28330.1| BTB/POZ domain-containing protein [Glycine soja]
Length=583

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 72/131 (55%), Gaps = 15/131 (11%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR------SGAEDPKSTPNAIATRNQLQADVTLV  390
            A  HA+QN RLPVQ+V+  LYY+Q ++R      +G + P       ++ N+L     L 
Sbjct  438  ACAHAAQNDRLPVQMVVQVLYYEQQRLRDSMDSSAGWDSPNFLDKVNSSPNELS---ILR  494

Query  389  KENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSKKLGK  228
            +EN+ L+ E++++KM + + +       SS     ++ +  KP     +F +S+SKKLG+
Sbjct  495  RENQDLKLEIVKLKMRLKEFERTSIRSASSSPVIYASRSADKPPLPRKSFINSVSKKLGR  554

Query  227  LNPFKHGSKDT  195
            L+PF  G   T
Sbjct  555  LSPFSRGDAAT  565



>ref|XP_002983725.1| hypothetical protein SELMODRAFT_228979 [Selaginella moellendorffii]
 gb|EFJ15221.1| hypothetical protein SELMODRAFT_228979 [Selaginella moellendorffii]
Length=604

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 81/171 (47%), Gaps = 35/171 (20%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-----GAEDPKS----TPNAIATRNQLQADV  399
            A  HA+QN+RLP   ++  LY++QL+I++       E PK     TP A A R+   A  
Sbjct  438  ACSHAAQNERLPAHFIIQVLYFEQLRIKTALANYAIEMPKGDHGPTPIAAALRSSTAAAN  497

Query  398  -------------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPT-  261
                          L +EN+ L+ EL +MK+ ++D++ + S   S        +    + 
Sbjct  498  AAAAAAADANPQSALRRENKELKIELTRMKIRLSDLEKEQSPGVSRASEEKRLSSPTSSA  557

Query  260  --------FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
                    FF ++S++LGKLNPF   S           ++ KPRRRR SIS
Sbjct  558  ASSPGSGRFFYTVSRRLGKLNPFGKSSLKPP----ATPELQKPRRRRHSIS  604



>ref|XP_002465671.1| hypothetical protein SORBIDRAFT_01g043470 [Sorghum bicolor]
 gb|EER92669.1| hypothetical protein SORBIDRAFT_01g043470 [Sorghum bicolor]
Length=598

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 74/153 (48%), Gaps = 22/153 (14%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA--------DVT  396
            A  HA+QN RLPVQ V+  LY++Q ++R   + P S P   A    LQ         +V+
Sbjct  452  ACAHAAQNDRLPVQTVVQVLYHEQRRLREAPKAP-SPPYRPAPTPSLQGRHARTVLDEVS  510

Query  395  -LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPT-----FFSSMSKKL  234
             L +ENE L+ ELL+MKM + +          +         +K       F +++SKKL
Sbjct  511  RLQRENEELKMELLRMKMHMREPPAALPQPSGAPPPGRRPPPKKAAGGSGGFMNNVSKKL  570

Query  233  GKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSI  135
            G+LNPF         LD    +  K RRRR SI
Sbjct  571  GRLNPFLR-------LDAVGTEPPKDRRRRRSI  596



>ref|XP_004511862.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X6 [Cicer arietinum]
Length=627

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 73/136 (54%), Gaps = 25/136 (18%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQAD-------  402
            A  HA+QN RLPVQ V+  LYY+Q ++R   +G E+ +S P+A A  N    D       
Sbjct  468  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGNENVES-PSANAKLNVYSGDTQFHPVS  526

Query  401  ---VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR------KP-----  264
                 L +ENE L+ EL+++KM + +++       ++V  S +          KP     
Sbjct  527  NEITGLRRENEDLKLELVKLKMKLKEIEKSTVKVKATVINSPSVNSSPSGSADKPPLPRR  586

Query  263  TFFSSMSKKLGKLNPF  216
            +F SS+SKKLGKL+PF
Sbjct  587  SFISSVSKKLGKLSPF  602



>ref|XP_004511860.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X4 [Cicer arietinum]
 ref|XP_004511861.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X5 [Cicer arietinum]
Length=628

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 73/136 (54%), Gaps = 25/136 (18%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQAD-------  402
            A  HA+QN RLPVQ V+  LYY+Q ++R   +G E+ +S P+A A  N    D       
Sbjct  469  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGNENVES-PSANAKLNVYSGDTQFHPVS  527

Query  401  ---VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR------KP-----  264
                 L +ENE L+ EL+++KM + +++       ++V  S +          KP     
Sbjct  528  NEITGLRRENEDLKLELVKLKMKLKEIEKSTVKVKATVINSPSVNSSPSGSADKPPLPRR  587

Query  263  TFFSSMSKKLGKLNPF  216
            +F SS+SKKLGKL+PF
Sbjct  588  SFISSVSKKLGKLSPF  603



>ref|XP_004511859.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X3 [Cicer arietinum]
Length=678

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 73/136 (54%), Gaps = 25/136 (18%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQAD-------  402
            A  HA+QN RLPVQ V+  LYY+Q ++R   +G E+ +S P+A A  N    D       
Sbjct  519  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGNENVES-PSANAKLNVYSGDTQFHPVS  577

Query  401  ---VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR------KP-----  264
                 L +ENE L+ EL+++KM + +++       ++V  S +          KP     
Sbjct  578  NEITGLRRENEDLKLELVKLKMKLKEIEKSTVKVKATVINSPSVNSSPSGSADKPPLPRR  637

Query  263  TFFSSMSKKLGKLNPF  216
            +F SS+SKKLGKL+PF
Sbjct  638  SFISSVSKKLGKLSPF  653



>ref|XP_004511857.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Cicer arietinum]
 ref|XP_004511858.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Cicer arietinum]
Length=679

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 73/136 (54%), Gaps = 25/136 (18%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQAD-------  402
            A  HA+QN RLPVQ V+  LYY+Q ++R   +G E+ +S P+A A  N    D       
Sbjct  520  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGNENVES-PSANAKLNVYSGDTQFHPVS  578

Query  401  ---VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR------KP-----  264
                 L +ENE L+ EL+++KM + +++       ++V  S +          KP     
Sbjct  579  NEITGLRRENEDLKLELVKLKMKLKEIEKSTVKVKATVINSPSVNSSPSGSADKPPLPRR  638

Query  263  TFFSSMSKKLGKLNPF  216
            +F SS+SKKLGKL+PF
Sbjct  639  SFISSVSKKLGKLSPF  654



>ref|XP_002989054.1| hypothetical protein SELMODRAFT_272040 [Selaginella moellendorffii]
 gb|EFJ09848.1| hypothetical protein SELMODRAFT_272040 [Selaginella moellendorffii]
Length=607

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 81/174 (47%), Gaps = 38/174 (22%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-----GAEDPKS----TPNAIATRNQLQADV  399
            A  HA+QN+RLP   ++  LY++QL+I++       E PK     TP A A R+   A  
Sbjct  438  ACSHAAQNERLPAHFIIQVLYFEQLRIKTALANYAIEMPKGDHGPTPIAAALRSSTAAAN  497

Query  398  ----------------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRK  267
                             L +EN+ L+ EL +MK+ ++D++ + S   S        +   
Sbjct  498  AAAAAAAAAADANPQSALRRENKELKIELTRMKIRLSDLEKEQSPGVSRASEEKRLSSPT  557

Query  266  PT---------FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
             +         FF ++S++LGKLNPF   S           ++ KPRRRR SIS
Sbjct  558  SSAASSPGSGRFFHTVSRRLGKLNPFGKSSLKPP----ATPELQKPRRRRHSIS  607



>ref|XP_009115684.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Brassica rapa]
Length=566

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 68/140 (49%), Gaps = 24/140 (17%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-------------RNQL  411
            A  HA+QNKRLPV IV   L+ +Q  +R    D  S   A A               N+L
Sbjct  419  ACAHAAQNKRLPVHIVAQVLHQEQQSLRQVLCDSDSPVAATAIAPESPPPPTLSSYNNEL  478

Query  410  QADVTLVKENEALRTELLQMKMFIADMQ--------NkgssqgssvkgssasaVRKPTFF  255
                 L +EN+ L+ ELL++KM + +++        +       S      S +R+ +F 
Sbjct  479  S---KLNRENQDLKLELLKVKMTLKELEREKDFEIKSCSDCSSVSTASVVKSPLRRKSFI  535

Query  254  SSMSKKLGKLNPFKHGSKDT  195
            SS+S+KLGKLNPF H  + T
Sbjct  536  SSVSRKLGKLNPFGHTQRRT  555



>ref|XP_009115683.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Brassica rapa]
Length=567

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 68/140 (49%), Gaps = 24/140 (17%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-------------RNQL  411
            A  HA+QNKRLPV IV   L+ +Q  +R    D  S   A A               N+L
Sbjct  420  ACAHAAQNKRLPVHIVAQVLHQEQQSLRQVLCDSDSPVAATAIAPESPPPPTLSSYNNEL  479

Query  410  QADVTLVKENEALRTELLQMKMFIADMQ--------NkgssqgssvkgssasaVRKPTFF  255
                 L +EN+ L+ ELL++KM + +++        +       S      S +R+ +F 
Sbjct  480  S---KLNRENQDLKLELLKVKMTLKELEREKDFEIKSCSDCSSVSTASVVKSPLRRKSFI  536

Query  254  SSMSKKLGKLNPFKHGSKDT  195
            SS+S+KLGKLNPF H  + T
Sbjct  537  SSVSRKLGKLNPFGHTQRRT  556



>ref|XP_008238282.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Prunus 
mume]
 ref|XP_008238290.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Prunus 
mume]
Length=624

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 78/155 (50%), Gaps = 17/155 (11%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDP--KSTPNAIATRNQLQAD-  402
            A  HA+QN RLPVQ V+  LYY+Q ++R       +G E     S  N  +T      D 
Sbjct  470  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLTGGESSVLPSKGNLYSTDIHPVPDE  529

Query  401  -VTLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMS  243
               L ++NE L+ EL++MKM + +++        S   G+ +++  KP     +F +S+S
Sbjct  530  LSILRRQNEELKIELVKMKMRLKELETSTMRTSMSSPMGNISTSADKPPLPRKSFINSVS  589

Query  242  KKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  138
            KKLG+L+PF      T ++  G     K RR   S
Sbjct  590  KKLGRLSPFVRTDGVTPSIPKGRTRAAKDRRHSIS  624



>ref|XP_009342777.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Pyrus 
x bretschneideri]
Length=629

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 86/163 (53%), Gaps = 31/163 (19%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQA----  405
            A  HA+QN RLPVQ V+  LYY+Q ++R        GAE      + + ++  L +    
Sbjct  475  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNPIGAES-----SVLPSKGSLYSTDIH  529

Query  404  ----DVTLV-KENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TF  258
                ++T++ ++NE L+ EL++MKM + +++   +        G++ ++  KP     +F
Sbjct  530  PVPDELTILRRQNEELKIELVKMKMKLKELETSTTRTTMISPMGNTPTSADKPPLPRKSF  589

Query  257  FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  132
             +S+SKKLGKL+PF      T     G    TKP + RR SIS
Sbjct  590  MNSVSKKLGKLSPFVRADGVTPTGAKGR---TKPAKDRRHSIS  629



>ref|XP_008354715.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Malus 
domestica]
Length=626

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 82/163 (50%), Gaps = 31/163 (19%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQA----  405
            A  HA+QN RLPVQ V+  LYY+Q ++R        GAE      + + ++  L +    
Sbjct  472  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNSIGAES-----SVLPSKGSLYSTDIH  526

Query  404  ----DVTLV-KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR-KP-----TF  258
                ++T++ ++NE L+ EL++MKM + +++   +         +      KP     +F
Sbjct  527  PVPDELTILRRQNEELKMELVKMKMKLKELETSTTRTAMISPMGNTPTSXDKPPLPRKSF  586

Query  257  FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  132
             +S+SKKLGKL+PF      T     G    TKP + RR SIS
Sbjct  587  INSVSKKLGKLSPFVRADGVTPTGAKGR---TKPAKDRRHSIS  626



>ref|XP_010426528.1| PREDICTED: putative BTB/POZ domain-containing protein At3g49970 
[Camelina sativa]
Length=571

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 80/161 (50%), Gaps = 38/161 (24%)
 Frame = -3

Query  542  HASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-------------RNQLQAD  402
            HA+QN RLPVQ V+  LYY+Q  +R    D  S P A AT              N+L   
Sbjct  425  HAAQNDRLPVQTVVQVLYYEQKSLREILSDSDSPPAAAATVEDTLPPPELRTYNNELS--  482

Query  401  VTLVKENEALRTELLQMKMFIADMQN-----kgssqgssvkgssasaVRKP-----TFFS  252
              L +EN+ L+ EL+++KM   +++      + +S        S ++V KP     +F S
Sbjct  483  -KLNRENQDLKLELIKVKMKFKELEKEQKDFEVTSGSDCSSSVSIASVVKPRLPRKSFMS  541

Query  251  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  132
            S+S++LGKLNPF  G K            TKP + RR SIS
Sbjct  542  SVSRQLGKLNPF--GLKQVQ---------TKPAKGRRHSIS  571



>emb|CDP02580.1| unnamed protein product [Coffea canephora]
Length=620

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 67/127 (53%), Gaps = 15/127 (12%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-TPNAIATRNQLQAD--------V  399
            A  HA+QN RLPVQ V+  LYY+Q ++R   +  +  TPN     NQ  A          
Sbjct  468  ACAHAAQNDRLPVQTVVQVLYYEQQRLREAVDGTEGETPNLALKVNQHPAGSHTAPQELS  527

Query  398  TLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSKK  237
            +L KEN+ L+ EL++M+  + +++       ++     +  +  KP     +  SS+S+K
Sbjct  528  SLRKENQDLKLELVKMRTRLRELEKSSDKSYAASPLVITLPSAEKPPLPRKSLISSVSRK  587

Query  236  LGKLNPF  216
            LGK+NPF
Sbjct  588  LGKINPF  594



>ref|XP_008341358.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At5g67385-like [Malus domestica]
Length=568

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 82/163 (50%), Gaps = 31/163 (19%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQA----  405
            A  HA+QN RLPVQ V+  LYY+Q ++R        GAE      + + ++  L +    
Sbjct  414  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNSIGAES-----SVLPSKGSLYSTDIH  468

Query  404  ----DVTLV-KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR-KP-----TF  258
                ++T++ ++NE L+ EL++MKM + +++   +         +      KP     +F
Sbjct  469  PVPDELTILRRQNEELKMELVKMKMKLKELETSTTRTAMISPMGNTPTSXDKPPLPRKSF  528

Query  257  FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  132
             +S+SKKLGKL+PF      T     G    TKP + RR SIS
Sbjct  529  INSVSKKLGKLSPFVRADGVTPTGAKGR---TKPAKDRRHSIS  568



>ref|XP_002284242.2| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Vitis 
vinifera]
Length=636

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 81/172 (47%), Gaps = 35/172 (20%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQ--AD-  402
            A  HA+QN RLPVQ V+  LYY+Q ++R        G E P   P +    N L   +D 
Sbjct  468  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSLMGGESPAIPPKSNLFSNDLHPVSDE  527

Query  401  -VTLVKENEALRTELLQMKMFIADMQ----------------NkgssqgssvkgssasaV  273
             ++L +ENE L+ EL++MKM + +++                +      +S   ++  + 
Sbjct  528  LLSLRRENEDLKLELMKMKMRLKEIEKSAVPSGVPTSLPSAYSSILQSAASSPRNTPPSA  587

Query  272  RKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
             KP     +F +S+SK+LG+L PF           DG+      R RR SIS
Sbjct  588  DKPPLPRKSFMNSVSKRLGRLYPFVRADGVAP---DGKARTKPSRDRRHSIS  636



>emb|CAN71562.1| hypothetical protein VITISV_007563 [Vitis vinifera]
Length=621

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 81/172 (47%), Gaps = 35/172 (20%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQ--AD-  402
            A  HA+QN RLPVQ V+  LYY+Q ++R        G E P   P +    N L   +D 
Sbjct  453  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSLMGGESPAIPPKSNLFSNDLHPVSDE  512

Query  401  -VTLVKENEALRTELLQMKMFIADMQ----------------NkgssqgssvkgssasaV  273
             ++L +ENE L+ EL++MKM + +++                +      +S   ++  + 
Sbjct  513  LLSLRRENEDLKLELMKMKMRLKEIEKSAVPSGVPTSLPSAYSSILQSAASSPRNTPPSA  572

Query  272  RKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
             KP     +F +S+SK+LG+L PF           DG+      R RR SIS
Sbjct  573  DKPPLPRKSFMNSVSKRLGRLYPFVRADGVAP---DGKARTKPSRDRRHSIS  621



>ref|XP_006664283.1| PREDICTED: root phototropism protein 2-like [Oryza brachyantha]
Length=306

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 62/98 (63%), Gaps = 6/98 (6%)
 Frame = -3

Query  407  ADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPT----FFSSMSK  240
             + +  +ENE LR+EL +M+ +++ M  + S  G S   ++AS+ +K T       S+S+
Sbjct  209  GEASRARENEELRSELARMRAYMSGMGVQQSKGGGSSSRTTASSGKKGTTSLWLLGSVSR  268

Query  239  KLGKLNPFKHG--SKDTSNLDDGEVDITKPRRRRFSIS  132
             L +LNPFK G  +KDTS++ D ++   KP+RRRFS+S
Sbjct  269  TLSRLNPFKGGIWAKDTSSIGDKKMHSVKPKRRRFSLS  306



>gb|KJB48679.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=355

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 79/157 (50%), Gaps = 26/157 (17%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--------  399
            A  HA+QN RLPVQ V+  LY++Q ++R        +P  I ++ N    DV        
Sbjct  208  ACAHAAQNDRLPVQTVVQVLYHEQQRLRDVMNGSGDSPAVIPSKVNLYPTDVHPVSGELS  267

Query  398  TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR-------KPTFFSSMSK  240
            +L +EN+ L+ EL++MKM + +++   S++ +      +           K +F +S+SK
Sbjct  268  SLKRENQDLKLELVKMKMRLKEIEKSTSAKTAISSPMGSITPSSDKPPLPKKSFMNSVSK  327

Query  239  KLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  132
            KLG+L PF         +  G    T+P + RR SIS
Sbjct  328  KLGRLYPF---------VPSGAKGRTRPSKDRRHSIS  355



>ref|XP_010559028.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Tarenaya hassleriana]
Length=589

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 75/156 (48%), Gaps = 26/156 (17%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVT--------  396
            A  HA+QN RLPVQ V+  LYY+Q +IR   ++    P             T        
Sbjct  444  ACAHAAQNDRLPVQTVVQVLYYEQQRIRDVMKE-TDIPTDPPPSILPPPKPTSYNEELSK  502

Query  395  LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP-----TFFSSMSKKLG  231
            L +EN+ L+ ELL+MKM + + +       +S    SA ++ KP     +F SS+SKKLG
Sbjct  503  LKRENQDLKLELLKMKMKLKEYEKSEMGSSNSNSPVSAVSMGKPPLPKKSFMSSVSKKLG  562

Query  230  KLNPFK---HGSKDTSNLDDGEVDITKPRRRRFSIS  132
            +L PF    H ++  +           P+ RR SIS
Sbjct  563  RLYPFGISPHNARGRTK---------PPKDRRHSIS  589



>ref|XP_010559030.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Tarenaya hassleriana]
Length=588

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 75/156 (48%), Gaps = 26/156 (17%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVT--------  396
            A  HA+QN RLPVQ V+  LYY+Q +IR   ++    P             T        
Sbjct  443  ACAHAAQNDRLPVQTVVQVLYYEQQRIRDVMKE-TDIPTDPPPSILPPPKPTSYNEELSK  501

Query  395  LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP-----TFFSSMSKKLG  231
            L +EN+ L+ ELL+MKM + + +       +S    SA ++ KP     +F SS+SKKLG
Sbjct  502  LKRENQDLKLELLKMKMKLKEYEKSEMGSSNSNSPVSAVSMGKPPLPKKSFMSSVSKKLG  561

Query  230  KLNPFK---HGSKDTSNLDDGEVDITKPRRRRFSIS  132
            +L PF    H ++  +           P+ RR SIS
Sbjct  562  RLYPFGISPHNARGRTK---------PPKDRRHSIS  588



>ref|XP_007047478.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOX91635.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=623

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 85/160 (53%), Gaps = 24/160 (15%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATR-NQLQAD------  402
            A  HA+QN RLPVQ V+  LYY+Q ++R   +G+     +P AI++R N   AD      
Sbjct  468  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSISSGDSP-AISSRVNLYTADSHPVSD  526

Query  401  --VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssas--aVRKP-----TFFSS  249
               +L +ENE L+ EL++MKM + +++   S + +          +  KP     +F +S
Sbjct  527  ELSSLKRENEDLKLELVKMKMRLKEIEKSSSVKSAVSSPMGIILPSSDKPPLPRKSFMNS  586

Query  248  MSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  132
            +SKKLG+L PF      + +   G    T+P + RR SIS
Sbjct  587  VSKKLGRLYPFVRSDGVSPSSAKGR---TRPSKDRRHSIS  623



>gb|KDO78972.1| hypothetical protein CISIN_1g006971mg [Citrus sinensis]
Length=623

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 74/134 (55%), Gaps = 26/134 (19%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDPKSTPNAIATRNQLQADV--  399
            A  HA+QN RLPVQ V+  LY++Q +IR       +G + P + P+ I   N   AD+  
Sbjct  468  ACAHAAQNDRLPVQTVVQVLYHEQQRIRHVMDGNLTGGDSP-AVPSKI---NLYSADLHP  523

Query  398  ------TLVKENEALRTELLQMKMFIADMQNkgssqgssvk--gssasaVRKP-----TF  258
                  +L +ENE L+ ELL+MKM + +++   +   ++     ++  +  KP     +F
Sbjct  524  VSNELSSLRRENEDLKIELLKMKMKLKEIEKSSAKSSAASSPLVNAQYSADKPPLPRKSF  583

Query  257  FSSMSKKLGKLNPF  216
             +S+SKKLG+L PF
Sbjct  584  INSVSKKLGRLYPF  597



>ref|XP_006466487.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Citrus 
sinensis]
Length=623

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 74/134 (55%), Gaps = 26/134 (19%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDPKSTPNAIATRNQLQADV--  399
            A  HA+QN RLPVQ V+  LY++Q +IR       +G + P + P+ I   N   AD+  
Sbjct  468  ACAHAAQNDRLPVQTVVQVLYHEQQRIRHVMDGNLTGGDSP-AVPSKI---NLYSADLHP  523

Query  398  ------TLVKENEALRTELLQMKMFIADMQNkgssqgssvk--gssasaVRKP-----TF  258
                  +L +ENE L+ ELL+MKM + +++   +   ++     ++  +  KP     +F
Sbjct  524  VSNELSSLRRENEDLKIELLKMKMKLKEIEKSSAKSSAASSPLVNAQYSADKPPLPRKSF  583

Query  257  FSSMSKKLGKLNPF  216
             +S+SKKLG+L PF
Sbjct  584  INSVSKKLGRLYPF  597



>ref|XP_010028107.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Eucalyptus grandis]
 gb|KCW54768.1| hypothetical protein EUGRSUZ_I00715 [Eucalyptus grandis]
Length=614

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 69/132 (52%), Gaps = 24/132 (18%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPKSTPNAIATRNQLQADV---  399
            A  HA+QN RLPVQ V+  LYY+Q ++R       G E P + P  +   N    D+   
Sbjct  465  ACAHAAQNDRLPVQTVVQVLYYEQQRMRDAMNGSLGGESP-AAPRKL---NVYSTDIHPV  520

Query  398  -----TLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFS  252
                  L +ENE L+ EL++MKM + +++            GS+ S+  KP     +F +
Sbjct  521  SDELSRLKRENEDLKIELVKMKMRLREIEKSTLKSAGGSPAGSTPSSADKPPLPRKSFIN  580

Query  251  SMSKKLGKLNPF  216
            SMSKKLG+L PF
Sbjct  581  SMSKKLGRLYPF  592



>ref|XP_006426057.1| hypothetical protein CICLE_v10025164mg [Citrus clementina]
 gb|ESR39297.1| hypothetical protein CICLE_v10025164mg [Citrus clementina]
Length=623

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 74/134 (55%), Gaps = 26/134 (19%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDPKSTPNAIATRNQLQADV--  399
            A  HA+QN RLPVQ V+  LY++Q +IR       +G + P + P+ I   N   AD+  
Sbjct  468  ACAHAAQNDRLPVQTVVQVLYHEQQRIRHVMDGNLTGGDSP-AVPSKI---NLYSADLHP  523

Query  398  ------TLVKENEALRTELLQMKMFIADMQNkgssqgssvk--gssasaVRKP-----TF  258
                  +L +ENE L+ ELL+MKM + +++   +   ++     ++  +  KP     +F
Sbjct  524  VSNELSSLRRENEDLKIELLKMKMKLKEIEKSSAKSSAASSPLVNAQYSADKPPLPRKSF  583

Query  257  FSSMSKKLGKLNPF  216
             +S+SKKLG+L PF
Sbjct  584  INSVSKKLGRLYPF  597



>ref|XP_010028106.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Eucalyptus grandis]
Length=615

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 69/128 (54%), Gaps = 16/128 (13%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPKS--TPNAIATRNQLQADVT  396
            A  HA+QN RLPVQ V+  LYY+Q ++R       G E P +    N  +T     +D  
Sbjct  466  ACAHAAQNDRLPVQTVVQVLYYEQQRMRDAMNGSLGGESPAAPRKLNVYSTDIHPVSDEL  525

Query  395  --LVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSK  240
              L +ENE L+ EL++MKM + +++            GS+ S+  KP     +F +SMSK
Sbjct  526  SRLKRENEDLKIELVKMKMRLREIEKSTLKSAGGSPAGSTPSSADKPPLPRKSFINSMSK  585

Query  239  KLGKLNPF  216
            KLG+L PF
Sbjct  586  KLGRLYPF  593



>gb|KHG27515.1| hypothetical protein F383_13864 [Gossypium arboreum]
Length=471

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 68/128 (53%), Gaps = 16/128 (13%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--------  399
            A  HA+QN RLPVQ V+  LY++Q ++R        +P  I ++ N    DV        
Sbjct  324  ACAHAAQNDRLPVQTVVQVLYHEQQRLRDVMNGSGDSPAVIPSKVNLYPTDVHPVSGELS  383

Query  398  TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR-------KPTFFSSMSK  240
            +L +EN+ L+ EL++MKM + +++   S++ +      +           K +F +S+SK
Sbjct  384  SLKRENQDLKLELVKMKMRLKEIEKSTSAKTAVSSPMGSITPSSDKPPLPKKSFMNSVSK  443

Query  239  KLGKLNPF  216
            KLG+L PF
Sbjct  444  KLGRLYPF  451



>ref|XP_009782405.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Nicotiana 
sylvestris]
Length=620

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 69/130 (53%), Gaps = 21/130 (16%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS---GAEDPKSTPNAI--ATRNQLQADV----  399
            A  HA+QN RLPVQ V+  LYY+Q ++R    G++   + P A+  +  NQ   D+    
Sbjct  467  ACAHAAQNDRLPVQTVVQVLYYEQQRLREVMDGSQLVATEPPALIPSKTNQFSTDIRPIS  526

Query  398  ----TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaV-------RKPT-FF  255
                +L +EN+ L+ ELL+MKM + +++   +   +S                RKP+ F 
Sbjct  527  DEVSSLKRENQELKFELLKMKMRLKEIEKPSNKSATSSPLVITHPSADKPPLPRKPSNFI  586

Query  254  SSMSKKLGKL  225
            SS+SKKLGK 
Sbjct  587  SSVSKKLGKF  596



>ref|XP_003520918.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Glycine 
max]
 gb|KHN29840.1| BTB/POZ domain-containing protein [Glycine soja]
Length=612

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 70/131 (53%), Gaps = 25/131 (19%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPK-----------STPNAIAT  423
            A  HA+QN+RLPVQ ++  LY++QL++R+      G +DPK           +   A++ 
Sbjct  461  AGAHAAQNERLPVQSIVQVLYFEQLRLRNSLSCSYGEDDPKPIHQSWRISSGALSAAMSP  520

Query  422  RNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMS  243
            R+      +L +EN  L+ EL +++M + D++          +  + S  RK  F SS S
Sbjct  521  RDNY---ASLRRENRELKLELARLRMRLNDLER---EHVCMKRDMAKSGSRK--FMSSFS  572

Query  242  KKLGKLNPFKH  210
            KK+GKL+ F H
Sbjct  573  KKIGKLSLFGH  583



>ref|XP_010086959.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB25095.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=624

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 81/164 (49%), Gaps = 31/164 (19%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKST-PNAIATRNQLQADV-  399
            A  HA+QN RLPVQ V+  LYY+Q ++R        G E P S  P+ +   N    D+ 
Sbjct  468  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSLVGGESPASALPSKL---NLYSTDIH  524

Query  398  -------TLVKENEALRTELLQMKMFIADMQNkgssqgssvk--gssasaVRKP-----T  261
                    L +ENE L+ EL++MKM + +++   + + +         S+  KP     +
Sbjct  525  PVSDELSGLRRENEDLKIELVKMKMKMKEIERSTAVKSAVNSPQSVIMSSADKPPRPRKS  584

Query  260  FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  132
            F +S+SK+LG+L PF      T +        TKP + RR SIS
Sbjct  585  FMNSVSKRLGRLYPFVRSDGVTPSYKGR----TKPSKDRRHSIS  624



>gb|KJB48677.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=614

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 79/157 (50%), Gaps = 26/157 (17%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--------  399
            A  HA+QN RLPVQ V+  LY++Q ++R        +P  I ++ N    DV        
Sbjct  467  ACAHAAQNDRLPVQTVVQVLYHEQQRLRDVMNGSGDSPAVIPSKVNLYPTDVHPVSGELS  526

Query  398  TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR-------KPTFFSSMSK  240
            +L +EN+ L+ EL++MKM + +++   S++ +      +           K +F +S+SK
Sbjct  527  SLKRENQDLKLELVKMKMRLKEIEKSTSAKTAISSPMGSITPSSDKPPLPKKSFMNSVSK  586

Query  239  KLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  132
            KLG+L PF         +  G    T+P + RR SIS
Sbjct  587  KLGRLYPF---------VPSGAKGRTRPSKDRRHSIS  614



>ref|XP_010028108.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X3 [Eucalyptus grandis]
Length=597

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 69/128 (54%), Gaps = 16/128 (13%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPKS--TPNAIATRNQLQADVT  396
            A  HA+QN RLPVQ V+  LYY+Q ++R       G E P +    N  +T     +D  
Sbjct  448  ACAHAAQNDRLPVQTVVQVLYYEQQRMRDAMNGSLGGESPAAPRKLNVYSTDIHPVSDEL  507

Query  395  --LVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSK  240
              L +ENE L+ EL++MKM + +++            GS+ S+  KP     +F +SMSK
Sbjct  508  SRLKRENEDLKIELVKMKMRLREIEKSTLKSAGGSPAGSTPSSADKPPLPRKSFINSMSK  567

Query  239  KLGKLNPF  216
            KLG+L PF
Sbjct  568  KLGRLYPF  575



>ref|XP_004149698.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Cucumis 
sativus]
Length=621

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 74/158 (47%), Gaps = 23/158 (15%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQADV------  399
            A  HA+QN RLPVQ V+  LYY+Q ++R   +G+      P   A  N   A+       
Sbjct  467  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSPTGVEVPAVPAKLNIYSAETAAAAAH  526

Query  398  -------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP----TFFS  252
                    L +EN+ L+ EL++MKM + + +    S   +      +A + P    +F +
Sbjct  527  PVSDELSILRRENQDLKLELVKMKMKMREFEKPSISSPQTNTQLQPNAEKPPLPKKSFIN  586

Query  251  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  138
            S+SK+LG+L PF      TS    G V   K RR   S
Sbjct  587  SVSKRLGRLYPFVRADGVTSK---GRVRPAKDRRHSIS  621



>gb|KJB48678.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=501

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 79/157 (50%), Gaps = 26/157 (17%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--------  399
            A  HA+QN RLPVQ V+  LY++Q ++R        +P  I ++ N    DV        
Sbjct  354  ACAHAAQNDRLPVQTVVQVLYHEQQRLRDVMNGSGDSPAVIPSKVNLYPTDVHPVSGELS  413

Query  398  TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR-------KPTFFSSMSK  240
            +L +EN+ L+ EL++MKM + +++   S++ +      +           K +F +S+SK
Sbjct  414  SLKRENQDLKLELVKMKMRLKEIEKSTSAKTAISSPMGSITPSSDKPPLPKKSFMNSVSK  473

Query  239  KLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  132
            KLG+L PF         +  G    T+P + RR SIS
Sbjct  474  KLGRLYPF---------VPSGAKGRTRPSKDRRHSIS  501



>gb|AES90666.2| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=595

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 84/163 (52%), Gaps = 30/163 (18%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDPKSTPNAIATRNQLQADVT-  396
            AR HA+QN RLP Q V   LYY+Q ++R       S   D  STP+    RN   +++  
Sbjct  440  ARTHAAQNNRLPAQNVAQILYYEQQRLRDNMDGTGSVGSDSPSTPD---KRNVYSSELYP  496

Query  395  -------LVKENEALRTELLQMKMFIADMQNkgssqg---ssvkgssasaVRKP-----T  261
                   L +ENE L+ E++++K+ I +M+     +    S +   S+ +  KP     +
Sbjct  497  ATNEVSKLRRENEELKLEIVKLKIKIKEMEKSTVLESPINSPLLNVSSPSADKPPLPRKS  556

Query  260  FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
            F +S+S+KLG+L+PF+         D  ++D    + RR+SIS
Sbjct  557  FLNSVSRKLGRLSPFQRAHPVIRPKDRIQLD----KIRRYSIS  595



>ref|XP_004509079.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Cicer arietinum]
 ref|XP_004509080.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Cicer arietinum]
Length=598

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 81/159 (51%), Gaps = 22/159 (14%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS--------GAEDPKSTPNAIATRNQLQA---  405
            AR HA+QN RLPVQ V   LYYDQ + R+        G+E P +  N     ++L     
Sbjct  443  ARAHAAQNNRLPVQSVAQVLYYDQQRRRNDMDGIGSVGSESPLTPENRNVYSSELYPVSN  502

Query  404  DVT-LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasa-------VRKPTFFSS  249
            +V+ L +ENE L+ E+ ++ M I + +        S    + ++       + K +F +S
Sbjct  503  EVSKLRRENEELKLEIAKLTMKIKESEKCKLESAVSSPLLNVTSPSADKPPLHKKSFLNS  562

Query  248  MSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
            +S+KLG+L+PF       ++  D    + + + RRFSIS
Sbjct  563  VSRKLGRLSPFSRQDPVITHPKD---PVKQDKIRRFSIS  598



>gb|ACL53070.1| unknown [Zea mays]
 tpg|DAA43884.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
Length=500

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 63/125 (50%), Gaps = 13/125 (10%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQAD--V  399
            A  HA+QN RLPVQ V+  L+++Q ++R        G E P   P+      +   D   
Sbjct  350  ACAHAAQNNRLPVQTVVQVLHHEQRRLREAPTSSFYGGESPTPAPSLQGRHGRSVPDEMS  409

Query  398  TLVKENEALRTELLQMKMFIAD----MQNkgssqgssvkgssasaVRKPTFFSSMSKKLG  231
             L +ENE L+ ELL++KM + D     Q+  +           +A     F +++SKKLG
Sbjct  410  QLQRENEELKMELLRLKMNLRDPSAPPQHSDAPPSGRRPLPKKAAGGSGGFINNVSKKLG  469

Query  230  KLNPF  216
            +LNPF
Sbjct  470  RLNPF  474



>ref|XP_007156731.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 ref|XP_007156732.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 gb|ESW28725.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 gb|ESW28726.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
Length=617

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 85/156 (54%), Gaps = 20/156 (13%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--------  399
            A  HA+QN RLPVQ V+  LYY+Q ++R       S  +++ ++ N   +D+        
Sbjct  466  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGNGSGESSVDSKLNVYSSDLQPASNELS  525

Query  398  TLVKENEALRTELLQMKMFIADMQNkg-ssqgssvkgssasaVRKP-----TFFSSMSKK  237
            TL +EN+ L+ EL+++K  + +++     S  +S   S++ +  KP     +F SS+SKK
Sbjct  526  TLRRENQDLKLELVKLKRRLKEIETTTPKSAVNSPAVSASPSADKPPLPRRSFMSSVSKK  585

Query  236  LGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  132
            LG+L+PF   +   +    G    TKP + RR SIS
Sbjct  586  LGRLSPFVR-ADGVAPFAKGR---TKPNKNRRHSIS  617



>gb|EPS72379.1| hypothetical protein M569_02379, partial [Genlisea aurea]
Length=583

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 40/113 (35%), Positives = 62/113 (55%), Gaps = 8/113 (7%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQAD----VTLVKE  384
            A  HA+QN RLPVQ V+  LYY+Q ++R   +  +S+P A A   +   D      L +E
Sbjct  448  ACAHAAQNDRLPVQTVVQVLYYEQQRLREAVDGGESSPAAAAAAAKGSPDSEEVAFLRRE  507

Query  383  NEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  225
            N  L+ E+L++KM + + +   ++     K        K +F SS+S+KLGKL
Sbjct  508  NRELKMEVLRLKMKLKEWETPAAAASVVRKPPLP----KKSFMSSVSQKLGKL  556



>ref|XP_003597110.1| Root phototropism protein [Medicago truncatula]
 ref|XP_003611625.1| Root phototropism protein [Medicago truncatula]
 gb|AES94583.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=630

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 70/140 (50%), Gaps = 29/140 (21%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQADV------  399
            A  HA+QN RLPVQ V+  LYY+Q ++R   +G+E  +S P+     N    D+      
Sbjct  468  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGSETAES-PSIHTKLNVYSGDIQVSNEL  526

Query  398  -TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssas-------------aVRKP-  264
             +L +ENE L+ E++++KM + +++             S               +  KP 
Sbjct  527  TSLRRENEDLKLEVVKLKMKLKEIEISTLKSTVKSTVKSTVNSPIANASPSHSHSADKPP  586

Query  263  ----TFFSSMSKKLGKLNPF  216
                +F SS+SKKLGKL+PF
Sbjct  587  LPRKSFISSVSKKLGKLSPF  606



>tpg|DAA43883.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
Length=597

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 63/125 (50%), Gaps = 13/125 (10%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQAD--V  399
            A  HA+QN RLPVQ V+  L+++Q ++R        G E P   P+      +   D   
Sbjct  447  ACAHAAQNNRLPVQTVVQVLHHEQRRLREAPTSSFYGGESPTPAPSLQGRHGRSVPDEMS  506

Query  398  TLVKENEALRTELLQMKMFIAD----MQNkgssqgssvkgssasaVRKPTFFSSMSKKLG  231
             L +ENE L+ ELL++KM + D     Q+  +           +A     F +++SKKLG
Sbjct  507  QLQRENEELKMELLRLKMNLRDPSAPPQHSDAPPSGRRPLPKKAAGGSGGFINNVSKKLG  566

Query  230  KLNPF  216
            +LNPF
Sbjct  567  RLNPF  571



>ref|XP_010685004.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Beta 
vulgaris subsp. vulgaris]
Length=610

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 66/128 (52%), Gaps = 19/128 (15%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS--GAEDPKSTPNAI-----ATRNQLQADV--  399
            A  HA+QN+RLP+Q ++  LY++QL++R+  G   P+  P  +          L A +  
Sbjct  461  AGAHAAQNERLPLQSIVQVLYFEQLRLRNALGCSLPEEEPKPMFHSWRVNSGALSASMSP  520

Query  398  -----TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKL  234
                 +L +EN  L+ EL +M+M + D++          +    S  RK  F SS SKKL
Sbjct  521  KDNYASLRRENRELKLELARMRMRLNDLEK---DHVCMKRTMQKSGSRK--FMSSFSKKL  575

Query  233  GKLNPFKH  210
            GKL+ F H
Sbjct  576  GKLSFFGH  583



>ref|XP_007155848.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 ref|XP_007155849.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 gb|ESW27842.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 gb|ESW27843.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
Length=591

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 83/161 (52%), Gaps = 28/161 (17%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPKS-------TPNAI-ATRNQ  414
            A  HA+QN RLPVQ V+  LYY+Q ++R       G + P +       +PN +    N+
Sbjct  438  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDSVDGSVGWDSPNNFRDKANLSPNGLNPVSNE  497

Query  413  LQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFS  252
                  L +ENE L+ E++++KM + +++       SS     ++ +  KP     +F +
Sbjct  498  FS---NLRRENEELKLEIVKLKMKLKEIERSSLISASSSPVIYASPSADKPPLPRKSFMN  554

Query  251  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  132
            S+SKKLG+L+PF      T N   G V   KP + RR SIS
Sbjct  555  SVSKKLGRLSPFSRAGAAT-NPVKGRV---KPDKNRRHSIS  591



>gb|KEH27511.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=516

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 70/140 (50%), Gaps = 29/140 (21%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQADV------  399
            A  HA+QN RLPVQ V+  LYY+Q ++R   +G+E  +S P+     N    D+      
Sbjct  354  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGSETAES-PSIHTKLNVYSGDIQVSNEL  412

Query  398  -TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssas-------------aVRKP-  264
             +L +ENE L+ E++++KM + +++             S               +  KP 
Sbjct  413  TSLRRENEDLKLEVVKLKMKLKEIEISTLKSTVKSTVKSTVNSPIANASPSHSHSADKPP  472

Query  263  ----TFFSSMSKKLGKLNPF  216
                +F SS+SKKLGKL+PF
Sbjct  473  LPRKSFISSVSKKLGKLSPF  492



>ref|XP_007133999.1| hypothetical protein PHAVU_010G010500g [Phaseolus vulgaris]
 gb|ESW05993.1| hypothetical protein PHAVU_010G010500g [Phaseolus vulgaris]
Length=610

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 70/131 (53%), Gaps = 25/131 (19%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPK-----------STPNAIAT  423
            A  HA+QN+RLP+Q ++  LY++QL++R+      G +DPK           +   A++ 
Sbjct  459  AGAHAAQNERLPLQSIVQVLYFEQLRLRNSLSCSFGEDDPKPIHQSWRISSGALSAAMSP  518

Query  422  RNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMS  243
            R+      +L +EN  L+ EL +++M + D++          +  + S  RK  F SS S
Sbjct  519  RDNY---ASLRRENRELKLELARLRMRLNDLER---EHACMKRDMAKSGSRK--FMSSFS  570

Query  242  KKLGKLNPFKH  210
            KK+GKL+ F H
Sbjct  571  KKIGKLSLFGH  581



>ref|XP_009630229.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nicotiana tomentosiformis]
Length=618

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 79/151 (52%), Gaps = 12/151 (8%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQAD--VTLVKENE  378
            A  HA+QN+RLPVQ V+  LY++Q ++R   +   +  +  +  N    D   +L +EN+
Sbjct  469  ACAHAAQNERLPVQTVVQVLYHEQQRLRQVMDGSLADADQSSADNNPVTDEFSSLKRENQ  528

Query  377  ALRTELLQMKMFIADMQNkgssqgssvkgssas-------aVRKPTFFSSMSKKLGKLNP  219
             L+ EL++MK  + +++  G    +S      +        +R+ +F SS+S+KLGKL P
Sbjct  529  DLKFELVKMKTRLKEIEKCGDKSDASTPLEITTPISSDKPRLRRKSFISSVSEKLGKLYP  588

Query  218  FKHGSKDTSNLDDGEVDITKP--RRRRFSIS  132
               G+ D   +        KP  R RR+SIS
Sbjct  589  ISFGA-DHVVMPSASKGRYKPISRYRRYSIS  618



>ref|XP_007201187.1| hypothetical protein PRUPE_ppa002993mg [Prunus persica]
 gb|EMJ02386.1| hypothetical protein PRUPE_ppa002993mg [Prunus persica]
Length=614

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 69/130 (53%), Gaps = 24/130 (18%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR-----SGAEDPK-----------STPNAIATR  420
            A  HA+QN+RLP+Q ++  LY++Q+++R     SG ++PK           +   A++ R
Sbjct  464  AGAHAAQNERLPLQSIVQVLYFEQIRLRNSLGCSGEDEPKPMHQSWRISSGALSAAMSPR  523

Query  419  NQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSK  240
            +      +L +EN  L+ EL +++M + D++          +    S  RK  F SS SK
Sbjct  524  DNY---ASLRRENRELKLELARLRMRLNDLER---EHVCMKRDMEKSNSRK--FMSSFSK  575

Query  239  KLGKLNPFKH  210
            KLGKL+ F H
Sbjct  576  KLGKLSFFGH  585



>gb|KDP32052.1| hypothetical protein JCGZ_12513 [Jatropha curcas]
Length=622

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 82/159 (52%), Gaps = 24/159 (15%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQADV------  399
            A  HA+QN RLPVQ V+  LYY+Q ++R   +G      +P      N   A +      
Sbjct  469  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNIIGGDSPALPQKMNLYSAGIPPVSDE  528

Query  398  --TLVKENEALRTELLQMKMFIADMQNkgssqgssvk--gssasaVRKP-----TFFSSM  246
               L +ENE L+ EL++MKM + +++    S+ ++     +S  +  KP     +F +S+
Sbjct  529  ISNLKRENEDLKIELVKMKMRLKEIEKSAGSRSATNSPLSNSTPSADKPPLPRKSFINSV  588

Query  245  SKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  132
            SK+LG+L PF     D+  +  G    TKP + RR SIS
Sbjct  589  SKRLGRLYPFVRAEGDS--IPKGR---TKPSKNRRHSIS  622



>ref|XP_011089103.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Sesamum 
indicum]
Length=612

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 69/132 (52%), Gaps = 25/132 (19%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA------EDPK-----------STPNAIAT  423
            A  HA+QN+RLP+Q ++  LYY+QL++R+        EDPK           +   A++ 
Sbjct  461  AGAHAAQNERLPLQSIVQVLYYEQLRLRNALFCSHPDEDPKPMHQSWRISSGALSAAMSP  520

Query  422  RNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMS  243
            R+      +L +EN  L+ EL +++M + D++          +    S+ RK  F SS +
Sbjct  521  RDNY---ASLRRENRELKLELARLRMRLNDLEK---EHVCMKRNMERSSSRK--FISSFT  572

Query  242  KKLGKLNPFKHG  207
            +++GKLN F H 
Sbjct  573  RRIGKLNIFAHS  584



>ref|XP_009780159.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Nicotiana 
sylvestris]
Length=621

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 78/151 (52%), Gaps = 12/151 (8%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQAD--VTLVKENE  378
            A  HA+QN+RLPVQ V+  LY++Q ++R   +      +  +T N    D   +L +EN+
Sbjct  472  ACAHAAQNERLPVQTVVQVLYFEQQRLRQVMDGSLDGADESSTDNNPVTDEVSSLKRENQ  531

Query  377  ALRTELLQMKMFIADMQNkgssqgssvkgssas-------aVRKPTFFSSMSKKLGKLNP  219
             L+ EL++MK  + +++  G    +S      +        +R+ +F SS+S+ LGKL P
Sbjct  532  DLKFELVKMKTRLNEIEKCGDISATSTPVEITTPISSDKPRLRRKSFISSVSETLGKLYP  591

Query  218  FKHGSKDTSNLDDGEVDITKP--RRRRFSIS  132
               G+ D   +        KP  R RR+SIS
Sbjct  592  ISFGA-DHVIMPSASKGRYKPISRDRRYSIS  621



>ref|XP_006339816.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
tuberosum]
Length=596

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 66/126 (52%), Gaps = 17/126 (13%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIA--------TRNQLQADV-  399
            A  HA+QN RLPVQ V+  LYY+Q ++  G++   + P A+         + N +  +V 
Sbjct  447  ACAHAAQNDRLPVQTVVQVLYYEQQRLHDGSQLVATEPPALVPSKRDHQFSTNPVSDEVS  506

Query  398  TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssas--------aVRKPTFFSSMS  243
            +L +EN+ L+ ELL+MK  + D++    +  ++      +          RK  F SS+S
Sbjct  507  SLKRENQELKFELLKMKTRLIDIEKPNLNTSATSSPLVITHPSAGKPPLPRKSNFMSSVS  566

Query  242  KKLGKL  225
            KKLG+ 
Sbjct  567  KKLGRF  572



>gb|ACL52494.1| unknown [Zea mays]
Length=597

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 62/125 (50%), Gaps = 13/125 (10%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQAD--V  399
            A  HA+QN RLPVQ V+  L+++Q ++R        G E P   P+      +   D   
Sbjct  447  ACAHAAQNNRLPVQTVVQVLHHEQRRLREAPTSSFYGGESPTPAPSLQGRHGRSVPDEMS  506

Query  398  TLVKENEALRTELLQMKMFIAD----MQNkgssqgssvkgssasaVRKPTFFSSMSKKLG  231
             L +ENE L+ ELL++KM + D     Q   +           +A     F +++SKKLG
Sbjct  507  QLQRENEELKMELLRLKMNLRDPSAPPQPSDAPPSGRRPLPKKAAGGSGGFINNVSKKLG  566

Query  230  KLNPF  216
            +LNPF
Sbjct  567  RLNPF  571



>emb|CDY30615.1| BnaAnng03900D [Brassica napus]
Length=499

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 64/124 (52%), Gaps = 13/124 (10%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTP--NAIATRNQLQADVTLVKENE  378
            A  HA+QNKRLP Q +   L      + + A  P+S P     +  N+L     L +EN+
Sbjct  363  ACAHAAQNKRLPQQSLRQVLCDSDSPVAATAIAPESPPPPTLSSYNNELS---KLNRENQ  419

Query  377  ALRTELLQMKMFIADMQ--------NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLN  222
             L+ ELL++KM + +++        N       S      S +R+ +F SS+S+KLGKLN
Sbjct  420  DLKLELLKVKMTLKELEREKDFEIKNCSDCSSVSTASVVKSPLRRKSFISSVSRKLGKLN  479

Query  221  PFKH  210
            PF H
Sbjct  480  PFGH  483



>gb|KFK28391.1| hypothetical protein AALP_AA8G509000 [Arabis alpina]
Length=604

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 72/139 (52%), Gaps = 30/139 (22%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR--------SGAEDPKSTPNAI------ATRNQ  414
            A  HA+QN RLPVQ ++  LYY+Q ++R        S A  P     A+      +  ++
Sbjct  447  ACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSESSAPQPPQQATAVLPPKLSSYNDE  506

Query  413  LQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgs-------sasaVRKP---  264
            L     L +EN+ L+ ELL+MKM + + + +   +  S   S       S +++ KP   
Sbjct  507  LS---KLKRENQDLKLELLKMKMKLKEFEKESDKKSVSTTMSSIPGSPMSTASMDKPPLP  563

Query  263  ---TFFSSMSKKLGKLNPF  216
               +F +S+SKKLGKLNPF
Sbjct  564  PKKSFINSVSKKLGKLNPF  582



>ref|XP_008235484.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Prunus 
mume]
Length=614

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 69/130 (53%), Gaps = 24/130 (18%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR-----SGAEDPK-----------STPNAIATR  420
            A  HA+QN+RLP+Q ++  LY++Q+++R     SG ++PK           +   A++ R
Sbjct  464  AGAHAAQNERLPLQSIVQVLYFEQIRLRNSLGCSGEDEPKPMHQSWRISSGALSAAMSPR  523

Query  419  NQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSK  240
            +      +L +EN  L+ EL +++M + D++          +    S  RK  F SS SK
Sbjct  524  DNY---ASLRRENRELKLELARLRMRLNDLER---EHVCMKRDMEKSNSRK--FMSSFSK  575

Query  239  KLGKLNPFKH  210
            K+GKL+ F H
Sbjct  576  KIGKLSFFGH  585



>ref|XP_004231910.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
lycopersicum]
Length=596

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 71/135 (53%), Gaps = 20/135 (15%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR--------NQLQADV-  399
            A  HA+QN RLPVQ V+  LYY+Q ++ +G++   + P A+ +         N +  +V 
Sbjct  447  ACAHAAQNDRLPVQTVVQVLYYEQQRLHNGSQLVATEPPALVSSKRDDQFSTNPVSDEVS  506

Query  398  TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasa--------VRKPTFFSSMS  243
            +L +EN+ L+ ELL+MK  + +++   S+  +S      +          RK  F SS+S
Sbjct  507  SLKRENQELKFELLKMKTRLIEIEKPKSNTSASSSPLVITQPSAGKPPLPRKSNFMSSVS  566

Query  242  KKLGKL---NPFKHG  207
            KKLG+    +   HG
Sbjct  567  KKLGRFIRADGLTHG  581



>ref|XP_007208165.1| hypothetical protein PRUPE_ppa002888mg [Prunus persica]
 gb|EMJ09364.1| hypothetical protein PRUPE_ppa002888mg [Prunus persica]
Length=624

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 76/155 (49%), Gaps = 17/155 (11%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP--KSTPNAIATRNQLQAD-  402
            A  HA+QN RLPVQ V+  LYY+Q ++R        G E     S  N  +T      D 
Sbjct  470  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLIGGESSVLPSKGNLYSTDIHPVPDE  529

Query  401  -VTLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMS  243
               L ++NE L+ EL++MK  + +++        S   G+ +++  KP     +F +S+S
Sbjct  530  LSILRRQNEELKIELVKMKKRLKELETSTVRTSISSPMGNISTSADKPPLPRKSFINSVS  589

Query  242  KKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  138
            KKLG+L+PF      T ++  G     K RR   S
Sbjct  590  KKLGRLSPFVRTDGVTPSIPKGRTRAAKDRRHSIS  624



>ref|XP_006290338.1| hypothetical protein CARUB_v10016995mg [Capsella rubella]
 gb|EOA23236.1| hypothetical protein CARUB_v10016995mg [Capsella rubella]
Length=532

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/159 (29%), Positives = 81/159 (51%), Gaps = 34/159 (21%)
 Frame = -3

Query  542  HASQNKRLPVQIVLHALYYDQLKIR------------SGAEDPKSTPNAIATRNQLQADV  399
            HA+QN RLPVQ ++  LYY+Q  +R            + A D    P+ +++ N   + +
Sbjct  386  HAAQNDRLPVQTMVQVLYYEQQHLREILSESDSPAVAATARDTLPPPDELSSYNNELSKL  445

Query  398  TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasa----------VRKPTFFSS  249
               +EN+ L+ EL+++KM   +++ + + +  +     +S+          +++ +F SS
Sbjct  446  N--RENQDLKLELIKVKMKFKELEKEKAFEVLTSGSDCSSSVSTASVVKPRLQRKSFISS  503

Query  248  MSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
            +S+KLGKLNPF         L  G+     P+ RR SIS
Sbjct  504  ISRKLGKLNPF--------GLKQGQTK--PPKGRRHSIS  532



>ref|XP_006364419.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
tuberosum]
Length=602

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 77/154 (50%), Gaps = 28/154 (18%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQADVT-  396
            A  HA+QN+RLPVQIV+  LYY+Q ++R        GA DP S P      +   + VT 
Sbjct  447  ACAHAAQNERLPVQIVVQVLYYEQQRLREVMDVSLVGA-DPPSRPPKFNWFSSGISPVTD  505

Query  395  ----LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssas----aVRKP--TFFSSM  246
                L +EN+ L+ EL+++KM   +++ +     +S      +      R P  +F +++
Sbjct  506  EVSSLKRENQDLKFELMKLKMKCREIEKRDDKSAASTPLGITTPPSDKPRLPRKSFITAV  565

Query  245  SKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRR  144
            S+KLGKL P         +    EV I  P +R+
Sbjct  566  SRKLGKLYP---------SFGTDEVTIPSPSKRK  590



>ref|XP_011089989.1| PREDICTED: BTB/POZ domain-containing protein At3g44820-like [Sesamum 
indicum]
Length=628

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 55/86 (64%), Gaps = 12/86 (14%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSG---------AEDPKSTPNAIATRNQLQAD-  402
            A  HASQN+RLP+++VL  L+++Q+++R+           E   + PN  AT  ++Q D 
Sbjct  469  ACAHASQNERLPLRVVLQVLFFEQMQLRTALAGCLHLLDTETAPAGPNE-ATGQRIQRDG  527

Query  401  -VTLVKENEALRTELLQMKMFIADMQ  327
             VT+V+EN+ L+T++ +M+  + +++
Sbjct  528  WVTVVRENQVLKTDMERMRSRVVELE  553



>emb|CDY37857.1| BnaAnng05180D [Brassica napus]
Length=600

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 70/140 (50%), Gaps = 30/140 (21%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST--------------PNAIATRNQ  414
            A  HA+QN RLPVQ ++  LYY+Q ++R    +   +              P  +++ N 
Sbjct  444  ACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPQPTATVLPPPKLSSYND  503

Query  413  LQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP----------  264
              + V   +EN+ L+ ELL+MKM + + + + + + SS   + +S    P          
Sbjct  504  ELSKVK--RENQDLKLELLKMKMKLKEFEKENNEKKSSTTTTMSSNHSSPRSTASMDKPP  561

Query  263  ----TFFSSMSKKLGKLNPF  216
                +F +S+SKKLGKLNPF
Sbjct  562  LPRKSFINSVSKKLGKLNPF  581



>gb|KFK34271.1| hypothetical protein AALP_AA5G123300 [Arabis alpina]
Length=551

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 74/146 (51%), Gaps = 20/146 (14%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEAL  372
            A  HA+QN RL VQ V+  L+Y+Q  +R    D  S P A    ++L     L +EN+ L
Sbjct  420  ASAHAAQNDRLHVQTVVKVLHYEQQSLRQILRDTDS-PAAYNNDDELS---QLNRENQEL  475

Query  371  RTELLQMKM------FIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  210
            + ELL++KM           +   SS  S V  +S    R+ +F S +S+KLGKLNPF  
Sbjct  476  KLELLKVKMNFKEFEEEKTFEVMSSSDYSLVSIASVVKPRRKSFISYVSRKLGKLNPF--  533

Query  209  GSKDTSNLDDGEVDITKPRRRRFSIS  132
                  ++  G   I  P+ RR SIS
Sbjct  534  ------SMTQGR--IIPPKGRRHSIS  551



>ref|XP_010503666.1| PREDICTED: putative BTB/POZ domain-containing protein At3g49970 
[Camelina sativa]
Length=571

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 81/157 (52%), Gaps = 30/157 (19%)
 Frame = -3

Query  542  HASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRN------QLQA---DVT-L  393
            HA+QN RLPVQ V+  LYY+Q  +R    D  S P A  T        +L+    D++ L
Sbjct  425  HAAQNDRLPVQTVVQVLYYEQQSLREILSDSDSPPAAAVTVEDTLTPPELRTYNNDLSKL  484

Query  392  VKENEALRTELLQMKMFIADMQNkgssqgss-----vkgssasaVRKP-----TFFSSMS  243
             +EN+ L+ EL+++KM   +++ +  +   +         S ++V KP     +F SS+S
Sbjct  485  NRENQDLKLELIKVKMKFKELEKEQKAFEVTSGSDCSSSVSIASVVKPRLPRKSFMSSVS  544

Query  242  KKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
            ++LGKLN F  G +        +V    P+ RR SIS
Sbjct  545  RQLGKLNLF--GQR--------QVQTKPPKGRRHSIS  571



>ref|XP_009628088.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Nicotiana 
tomentosiformis]
Length=620

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 67/130 (52%), Gaps = 21/130 (16%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS---GAEDPKSTPNAI--ATRNQLQADV----  399
            A  HA+QN RLPVQ V+  LYY+Q ++R    G++   + P  +  +  N    D+    
Sbjct  467  ACAHAAQNDRLPVQTVVQVLYYEQQRLREVMDGSQLVATEPPTLIPSKTNHFSIDIPPVS  526

Query  398  ----TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaV-------RKPT-FF  255
                +L +EN+ L+ ELL+MKM + +++   +   +S                RKP+ F 
Sbjct  527  DEVSSLKRENQELKFELLKMKMRLKEIEKPSNKSAASSPLVITHPSADKPPLPRKPSNFI  586

Query  254  SSMSKKLGKL  225
            SS+SKKLGK 
Sbjct  587  SSVSKKLGKF  596



>dbj|BAK07863.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=613

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 79/175 (45%), Gaps = 40/175 (23%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR--------------SGAEDP----KSTPNAIA  426
            A  HA+QN RLPVQ V+  LY++Q ++R              +G E P    K TP+   
Sbjct  444  ACAHAAQNDRLPVQTVVQVLYHEQRRLRVPPPSQAPSGAPSYAGGESPALSYKPTPSFNG  503

Query  425  -TRNQLQADVT-LVKENEALRTELLQMKMFIAD---MQNkgssqgssvkgssasaVRKPT  261
              R+   ++V+ L +EN+ LR EL+QMKM + D        +   ++    S+ A  KP 
Sbjct  504  RERSAPSSEVSRLQRENDELRMELMQMKMRLRDPSGAAPAAAPPLAAGATRSSPASGKPP  563

Query  260  F------------FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
                              KKLG+LNPF         L  G+V    P+ RR SIS
Sbjct  564  LPKKQGGASGGGGGGGFMKKLGRLNPFVR-----DPLAGGKVRTKPPKDRRHSIS  613



>ref|XP_010524688.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Tarenaya 
hassleriana]
Length=633

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 66/129 (51%), Gaps = 20/129 (16%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA------EDPKSTPNAIATRNQ--LQADV-  399
            A  HA+QN+RLP+Q ++  LY++QL++RS        E+PK   N     N   L A + 
Sbjct  481  AGAHAAQNERLPLQSIVQVLYFEQLRLRSSLCSSYSDEEPKPKQNQSWRINSGALSAAMS  540

Query  398  ------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKK  237
                  +L +EN  L+ EL +++M + D++          +    S  RK  F SS SKK
Sbjct  541  PKDNYASLRRENRELKLELARLRMRLNDLEK---EHICMKRDMQRSHSRK--FMSSFSKK  595

Query  236  LGKLNPFKH  210
            +GKL  F H
Sbjct  596  IGKLTFFGH  604



>ref|NP_001152299.1| transposon protein Mutator sub-class [Zea mays]
 gb|ACG46890.1| transposon protein Mutator sub-class [Zea mays]
Length=597

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 61/125 (49%), Gaps = 13/125 (10%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQAD--V  399
            A  HA+ N RLPVQ V+  L+++Q ++R        G E P   P+      +   D   
Sbjct  447  ACAHAAHNNRLPVQTVVQVLHHEQRRLREAPTSSFYGGESPTPAPSLQGRHGRSVPDEMS  506

Query  398  TLVKENEALRTELLQMKMFIAD----MQNkgssqgssvkgssasaVRKPTFFSSMSKKLG  231
             L +ENE L+ ELL++KM + D     Q   +           +A     F +++SKKLG
Sbjct  507  QLQRENEELKMELLRLKMNLRDPSAPPQPSDAPPSGRRPLPKKAAGGSGGFINNVSKKLG  566

Query  230  KLNPF  216
            +LNPF
Sbjct  567  RLNPF  571



>dbj|BAJ33928.1| unnamed protein product [Thellungiella halophila]
Length=617

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 64/132 (48%), Gaps = 23/132 (17%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQAD----------  402
            A  HA+QN+RLP+Q ++  LY++QLK+RS      S   A   ++Q Q            
Sbjct  462  AGAHAAQNERLPLQSIVQVLYFEQLKLRSSLCSSYSDEEAKPKQHQQQQSWRINSGALSA  521

Query  401  --------VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSM  246
                     +L +EN  L+ EL +++M + D++          +    S  RK  F SS 
Sbjct  522  AMSPKDNYASLRRENRELKLELARLRMRLNDLEK---EHICMKRDMHRSHSRK--FMSSF  576

Query  245  SKKLGKLNPFKH  210
            SKK+GKL+ F H
Sbjct  577  SKKMGKLSFFGH  588



>ref|XP_006395119.1| hypothetical protein EUTSA_v10003813mg [Eutrema salsugineum]
 gb|ESQ32405.1| hypothetical protein EUTSA_v10003813mg [Eutrema salsugineum]
Length=640

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 64/132 (48%), Gaps = 23/132 (17%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQAD----------  402
            A  HA+QN+RLP+Q ++  LY++QLK+RS      S   A   ++Q Q            
Sbjct  485  AGAHAAQNERLPLQSIVQVLYFEQLKLRSSLCSSYSDEEAKPKQHQQQQSWRINSGALSA  544

Query  401  --------VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSM  246
                     +L +EN  L+ EL +++M + D++          +    S  RK  F SS 
Sbjct  545  AMSPKDNYASLRRENRELKLELARLRMRLNDLEK---EHICMKRDMHRSHSRK--FMSSF  599

Query  245  SKKLGKLNPFKH  210
            SKK+GKL+ F H
Sbjct  600  SKKMGKLSFFGH  611



>ref|XP_008457766.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Cucumis melo]
Length=621

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 81/160 (51%), Gaps = 25/160 (16%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDPK--------STPNAIATRN  417
            A  HA+QN RLPVQ V+  LYY+Q ++R       +G E P         S   A A  +
Sbjct  465  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSPTGVEVPTVPAKLSIYSAETAAAAAH  524

Query  416  QLQADVTLV-KENEALRTELLQMKMFIADMQN-kgssqgssvkgssasaVRKP-----TF  258
             +  +++++ +EN+ L+ EL++MKM + + +    SS  ++ +    +   KP     +F
Sbjct  525  PVSDELSILRRENQDLKLELVKMKMKMREFEKPSISSPQTNTRLQPTTTAEKPPLPKKSF  584

Query  257  FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  138
             +S+SK+LG+L PF      TS    G V   K RR   S
Sbjct  585  INSVSKRLGRLYPFVRADGVTSK---GRVRPAKDRRHSIS  621



>gb|KDP26391.1| hypothetical protein JCGZ_17549 [Jatropha curcas]
Length=619

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 41/128 (32%), Positives = 66/128 (52%), Gaps = 19/128 (15%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPK--------STPNAIATRNQ  414
            A  HA+QN+RLP+Q ++  LY++Q+++R+      G ED K        S+    A  + 
Sbjct  468  AGAHAAQNERLPLQAIVQVLYFEQIRLRNALCCSYGEEDHKPMHQSWRISSGALSAAMSP  527

Query  413  LQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKL  234
                 +L +EN  L+ EL +++M + D++          +    S  RK  F SS SKK+
Sbjct  528  RDNYASLRRENRELKLELARLRMRLNDLEK---EHVCMKRDMQKSHSRK--FMSSFSKKI  582

Query  233  GKLNPFKH  210
            GKL+ F H
Sbjct  583  GKLSFFGH  590



>ref|XP_008457767.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Cucumis melo]
Length=620

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 81/160 (51%), Gaps = 25/160 (16%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDPK--------STPNAIATRN  417
            A  HA+QN RLPVQ V+  LYY+Q ++R       +G E P         S   A A  +
Sbjct  464  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSPTGVEVPTVPAKLSIYSAETAAAAAH  523

Query  416  QLQADVTLV-KENEALRTELLQMKMFIADMQN-kgssqgssvkgssasaVRKP-----TF  258
             +  +++++ +EN+ L+ EL++MKM + + +    SS  ++ +    +   KP     +F
Sbjct  524  PVSDELSILRRENQDLKLELVKMKMKMREFEKPSISSPQTNTRLQPTTTAEKPPLPKKSF  583

Query  257  FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  138
             +S+SK+LG+L PF      TS    G V   K RR   S
Sbjct  584  INSVSKRLGRLYPFVRADGVTSK---GRVRPAKDRRHSIS  620



>ref|XP_004985270.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Setaria 
italica]
Length=614

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 81/170 (48%), Gaps = 35/170 (21%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-------------GAEDP------KSTPNAI  429
            A  HA+QN RLPVQ V+  LY++Q ++R              G E P      K TP+ +
Sbjct  449  ACAHAAQNDRLPVQTVVQVLYHEQRRLREAPTHAPSGASSFYGGESPPPSLPYKPTPSLM  508

Query  428  ATRNQLQA----DVT-LVKENEALRTELLQMKMFIADMQN-kgssqgssvkgssasaVRK  267
                +  A    +V+ L +EN+ L+ ELL++KM + D       +  +       S  +K
Sbjct  509  GRHARGGAAPAEEVSQLQRENDELKMELLRLKMRLRDPSAPLPPTGAAPPPSGRHSMPKK  568

Query  266  P----TFFSSMSKKLGKLNPF-KHGSKDTSNLDDGEVDITKPRRRRFSIS  132
            P     F +++SKKLGKLNPF +H +         +V    P+ RR SI 
Sbjct  569  PGAGGGFMNNVSKKLGKLNPFVRHDAMGVP-----KVRTKPPKDRRHSIG  613



>emb|CBI33715.3| unnamed protein product [Vitis vinifera]
Length=529

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%), Gaps = 11/86 (13%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQ--AD-  402
            A  HA+QN RLPVQ V+  LYY+Q ++R        G E P   P +    N L   +D 
Sbjct  431  ACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSLMGGESPAIPPKSNLFSNDLHPVSDE  490

Query  401  -VTLVKENEALRTELLQMKMFIADMQ  327
             ++L +ENE L+ EL++MKM + +++
Sbjct  491  LLSLRRENEDLKLELMKMKMRLKEIE  516



>ref|XP_002521098.1| protein binding protein, putative [Ricinus communis]
 gb|EEF41249.1| protein binding protein, putative [Ricinus communis]
Length=610

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 68/131 (52%), Gaps = 25/131 (19%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPK-----------STPNAIAT  423
            A  HA+QN+RLP+Q ++  LY++Q+++R+      G ED K           +   A++ 
Sbjct  459  AGAHAAQNERLPLQAIVQVLYFEQIRLRNALCCPYGDEDHKPMHQSWRISSGALSAAMSP  518

Query  422  RNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMS  243
            R+      +L +EN  L+ EL +++M + D++          +    S  RK  F SS S
Sbjct  519  RDNY---ASLRRENRELKLELARLRMRLNDLEK---EHVCMKREMQKSHSRK--FMSSFS  570

Query  242  KKLGKLNPFKH  210
            KK+GKL+ F H
Sbjct  571  KKIGKLSFFGH  581



>ref|XP_010939121.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Elaeis 
guineensis]
Length=606

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 72/151 (48%), Gaps = 17/151 (11%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP----KSTPNAIATRNQLQA  405
            A  H ++N RLPV IV+  LYY+Q ++R        G E P    K+T   I   N    
Sbjct  462  ACAHVARNDRLPVPIVVQVLYYEQQRLRDVTSGNLIGGESPALSQKATSYGIGYHNAPDE  521

Query  404  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  225
               L +EN+ L+ EL++++M + +++    +  ++ K        K +F  S+S KLG L
Sbjct  522  LSRLRRENDDLKLELVRLRMQLKEIEKSSGNIAAADKPPLP----KKSFIHSISNKLGHL  577

Query  224  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
              F H   DT  L   +     P+  R SIS
Sbjct  578  FAFMHS--DTVKLLSDKTRRKPPKVLRHSIS  606



>ref|XP_006349069.1| PREDICTED: BTB/POZ domain-containing protein At3g44820-like isoform 
X2 [Solanum tuberosum]
Length=522

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 52/90 (58%), Gaps = 14/90 (16%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR-------------SGAEDPKSTPNAIATR-NQ  414
            A  HASQN RLP+++VL  L+++QL++R             SG   P + P+ +A +  Q
Sbjct  361  ACAHASQNDRLPLRVVLQVLFFEQLQLRTALAGCFQVLDTESGPAAPVTGPSDMAGQIVQ  420

Query  413  LQADVTLVKENEALRTELLQMKMFIADMQN  324
                VT+V+EN+ L+ +L +MK  + +++ 
Sbjct  421  RDGWVTVVRENQGLKVDLERMKSRVGELEE  450



>ref|XP_006393938.1| hypothetical protein EUTSA_v10003858mg [Eutrema salsugineum]
 gb|ESQ31224.1| hypothetical protein EUTSA_v10003858mg [Eutrema salsugineum]
Length=603

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 72/134 (54%), Gaps = 24/134 (18%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST-----------PNAIATRNQLQA  405
            A  HA+QN RLPVQ ++  LYY+Q ++R    +   +           P  +++ N   +
Sbjct  450  ACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPPPPPPPATVLPPKLSSYNDELS  509

Query  404  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgs------sasaVRKP-----TF  258
               L +EN+ L+ ELL+MKM + + + +   + S+   S      S +++ KP     TF
Sbjct  510  --KLKRENQDLKLELLKMKMKLKEFEKESEKKSSTTMSSNPSSPISTASMDKPPLPRKTF  567

Query  257  FSSMSKKLGKLNPF  216
             +S+S+KLGKLNPF
Sbjct  568  INSVSRKLGKLNPF  581



>dbj|BAJ34215.1| unnamed protein product [Thellungiella halophila]
Length=603

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 72/134 (54%), Gaps = 24/134 (18%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST-----------PNAIATRNQLQA  405
            A  HA+QN RLPVQ ++  LYY+Q ++R    +   +           P  +++ N   +
Sbjct  450  ACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPPPPPPPATVLPPKLSSYNDELS  509

Query  404  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgs------sasaVRKP-----TF  258
               L +EN+ L+ ELL+MKM + + + +   + S+   S      S +++ KP     TF
Sbjct  510  --KLKRENQDLKLELLKMKMKLKEFEKESEKKSSTTMSSNPSSPISTASMDKPPLPRKTF  567

Query  257  FSSMSKKLGKLNPF  216
             +S+S+KLGKLNPF
Sbjct  568  INSVSRKLGKLNPF  581



>ref|XP_009379310.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Pyrus x bretschneideri]
Length=625

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 73/154 (47%), Gaps = 16/154 (10%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDP--KSTPNAIATRNQLQAD--  402
            A  HA+QN RLPV  V+  LYY+Q ++R       G E     S  +  +T   +  D  
Sbjct  472  ASAHAAQNDRLPVHTVVQVLYYEQQRLRDVMNGNIGGESSVLPSKGSVYSTDVHMVPDEL  531

Query  401  VTLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSK  240
              L ++NE L+ EL +MKM + +++   +    S   G++  +  KP     +F + +SK
Sbjct  532  TILRRQNEELKIELGKMKMKLKELETSTARTAMSSPMGNTPISADKPPLPRKSFMNLVSK  591

Query  239  KLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  138
            +LGKL+PF      T     G     K RR   S
Sbjct  592  RLGKLSPFVRADGVTPTGTKGRTKSAKDRRHSIS  625



>ref|XP_009379312.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Pyrus x bretschneideri]
Length=505

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 73/154 (47%), Gaps = 16/154 (10%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDP--KSTPNAIATRNQLQAD--  402
            A  HA+QN RLPV  V+  LYY+Q ++R       G E     S  +  +T   +  D  
Sbjct  352  ASAHAAQNDRLPVHTVVQVLYYEQQRLRDVMNGNIGGESSVLPSKGSVYSTDVHMVPDEL  411

Query  401  VTLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSK  240
              L ++NE L+ EL +MKM + +++   +    S   G++  +  KP     +F + +SK
Sbjct  412  TILRRQNEELKIELGKMKMKLKELETSTARTAMSSPMGNTPISADKPPLPRKSFMNLVSK  471

Query  239  KLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  138
            +LGKL+PF      T     G     K RR   S
Sbjct  472  RLGKLSPFVRADGVTPTGTKGRTKSAKDRRHSIS  505



>ref|XP_009792130.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Nicotiana 
sylvestris]
Length=606

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 63/128 (49%), Gaps = 25/128 (20%)
 Frame = -3

Query  542  HASQNKRLPVQIVLHALYYDQLKIRSGA------EDPKST-----------PNAIATRNQ  414
            HA+QN+RLP+Q ++  LY++QL++R+        +D K T             A++ R+ 
Sbjct  463  HAAQNERLPLQSIVQVLYFEQLRLRNALFCSYHDDDHKPTHQSWRINSGALSAAMSPRDN  522

Query  413  LQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKL  234
                 +L +EN  L+ EL +M+M + D++             +        F S+ SKK+
Sbjct  523  Y---ASLRRENRELKLELTRMRMRLNDLEK-----DHVCMKKNMEKSNSGGFMSNFSKKI  574

Query  233  GKLNPFKH  210
            GKLN F H
Sbjct  575  GKLNIFGH  582



>ref|XP_006349068.1| PREDICTED: BTB/POZ domain-containing protein At3g44820-like isoform 
X1 [Solanum tuberosum]
Length=631

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 30/89 (34%), Positives = 52/89 (58%), Gaps = 14/89 (16%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR-------------SGAEDPKSTPNAIATR-NQ  414
            A  HASQN RLP+++VL  L+++QL++R             SG   P + P+ +A +  Q
Sbjct  470  ACAHASQNDRLPLRVVLQVLFFEQLQLRTALAGCFQVLDTESGPAAPVTGPSDMAGQIVQ  529

Query  413  LQADVTLVKENEALRTELLQMKMFIADMQ  327
                VT+V+EN+ L+ +L +MK  + +++
Sbjct  530  RDGWVTVVRENQGLKVDLERMKSRVGELE  558



>ref|XP_010486408.1| PREDICTED: putative BTB/POZ domain-containing protein At3g08660 
[Camelina sativa]
Length=581

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 37/144 (26%), Positives = 72/144 (50%), Gaps = 9/144 (6%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSG--AEDPKSTPNAIATRNQLQA------DVT  396
            A  H +QN RLPVQ+V+  LY +QL+++     E  + +   +++R Q +A        +
Sbjct  438  ASNHVAQNDRLPVQMVVRVLYSEQLRLKKALSGESEEGSSWVLSSRVQSRAVSPRDTYAS  497

Query  395  LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  216
            L +EN  L+ E+ +M++ +++++    +         +      TF +S+SK +G++  F
Sbjct  498  LRRENRDLKLEISRMRVRVSELEK-EHNLMKHEMIEKSGNNNGGTFLTSLSKGIGRIAIF  556

Query  215  KHGSKDTSNLDDGEVDITKPRRRR  144
               ++  +N     V    P RRR
Sbjct  557  GRENRRMNNRKSRSVSERNPIRRR  580



>emb|CDY57361.1| BnaC08g48680D [Brassica napus]
Length=499

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 63/124 (51%), Gaps = 13/124 (10%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTP--NAIATRNQLQADVTLVKENE  378
            A  H +QNKRLP Q +   L      + + A  P+S P     +  N+L     L +EN+
Sbjct  363  ACAHVAQNKRLPQQSLRQVLCDSDSPVAATAIAPESPPPPTLSSYNNELSK---LNRENQ  419

Query  377  ALRTELLQMKMFIADMQ--------NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLN  222
             L+ ELL++KM + +++        +       S      S +R+ +F SS+S+KLGKLN
Sbjct  420  DLKLELLKVKMTLKELEREKDFEIKSCSDCSSVSTASVVKSPLRRKSFISSVSRKLGKLN  479

Query  221  PFKH  210
            PF H
Sbjct  480  PFGH  483



>gb|KJB26098.1| hypothetical protein B456_004G225600 [Gossypium raimondii]
Length=612

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 38/130 (29%), Positives = 61/130 (47%), Gaps = 21/130 (16%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA------EDPK----------STPNAIATR  420
            A  HA+QN+RLP+Q ++  LY++QL++R+        +D K          S+    A  
Sbjct  459  AGAHAAQNERLPIQSIVQVLYFEQLRLRNALCCSYPDDDHKPAVHHQSWRISSGALSAAM  518

Query  419  NQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSK  240
            +      +L +EN  L+ EL +M+M + D++                  R   F  S SK
Sbjct  519  SPRDNYASLRRENRELKLELTRMRMRLNDLEK-----EHVCMKRDMVKSRSRRFMRSFSK  573

Query  239  KLGKLNPFKH  210
            K+GKL+ F H
Sbjct  574  KIGKLSLFGH  583



>ref|XP_009130549.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At5g67385-like [Brassica rapa]
Length=600

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 69/140 (49%), Gaps = 30/140 (21%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST--------------PNAIATRNQ  414
            A  HA+QN RLPVQ ++  LYY+Q ++R    +   +              P  +++ N 
Sbjct  444  ACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPQPTATVLPPPKLSSYND  503

Query  413  LQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP----------  264
              + V   +EN+ L+ ELL+MKM + + + + + + SS   + +S    P          
Sbjct  504  ELSKVK--RENQDLKLELLKMKMKLKEFEKENNEKKSSTTTTMSSNHSSPRSTASMDKPP  561

Query  263  ----TFFSSMSKKLGKLNPF  216
                +F +S+SKKLGKL PF
Sbjct  562  LPRKSFINSVSKKLGKLXPF  581



>emb|CAN78287.1| hypothetical protein VITISV_008137 [Vitis vinifera]
Length=582

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 68/131 (52%), Gaps = 25/131 (19%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA------EDPK-----------STPNAIAT  423
            A  HA+QN+RLP+Q ++  LY++QL++R+        ED K           +   A++ 
Sbjct  436  AGAHAAQNERLPLQSIVQVLYFEQLRLRNALCTSYADEDQKPVHQSWRISSGALSAAMSP  495

Query  422  RNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMS  243
            R+      +L +EN  L+ EL +++M + D++ +       ++ S +       F SS S
Sbjct  496  RDNY---ASLRRENRELKLELARLRMRLNDLEKEHVHMKRDMEKSHSL-----NFMSSFS  547

Query  242  KKLGKLNPFKH  210
            +K+GKLN F H
Sbjct  548  RKIGKLNFFGH  558



>emb|CDP03873.1| unnamed protein product [Coffea canephora]
Length=585

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 67/131 (51%), Gaps = 25/131 (19%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA------EDPK-----------STPNAIAT  423
            A  HA+QN+RLP+Q ++  LY++QL++R+        +D K           +   A++ 
Sbjct  439  AGAHAAQNERLPLQSIVQVLYFEQLRLRNALFCSYPDDDHKPLHQSWRISSGALSAAMSP  498

Query  422  RNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMS  243
            R+      +L +EN  L+ EL +++M + D++          K    S  RK  F SS S
Sbjct  499  RDNY---ASLRRENRELKLELARLRMRLNDLEK---EHVCMKKSMERSNSRK--FMSSFS  550

Query  242  KKLGKLNPFKH  210
            KK+GKLN F H
Sbjct  551  KKMGKLNFFGH  561



>gb|KFK38267.1| hypothetical protein AALP_AA3G091600 [Arabis alpina]
Length=589

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 37/143 (26%), Positives = 70/143 (49%), Gaps = 9/143 (6%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQAD--------VT  396
            A  H +QN RLPVQ+V+  LY +QL+++  A    S    +   + LQ+          +
Sbjct  446  ASNHVAQNDRLPVQMVVRVLYSEQLRLKK-AMSGDSEEGFLFLSSGLQSRAVSPRDTYAS  504

Query  395  LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  216
            L +EN  L+ E+ +M++ +++++ +       +   S +     TF +S+SK +G++  F
Sbjct  505  LRRENRELKLEIARMRVRVSELEKEQMLMKQGMLEKSGNNNNGGTFLTSLSKGIGRITIF  564

Query  215  KHGSKDTSNLDDGEVDITKPRRR  147
               ++   +     V   KP RR
Sbjct  565  GGENRRKVHRKSWSVSERKPSRR  587



>ref|XP_002265786.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 isoform 
X1 [Vitis vinifera]
Length=616

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 68/131 (52%), Gaps = 25/131 (19%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA------EDPK-----------STPNAIAT  423
            A  HA+QN+RLP+Q ++  LY++QL++R+        ED K           +   A++ 
Sbjct  470  AGAHAAQNERLPLQSIVQVLYFEQLRLRNALCTSYADEDQKPVHQSWRISSGALSAAMSP  529

Query  422  RNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMS  243
            R+      +L +EN  L+ EL +++M + D++ +       ++ S +       F SS S
Sbjct  530  RDNY---ASLRRENRELKLELARLRMRLNDLEKEHVHMKRDMEKSHSL-----NFMSSFS  581

Query  242  KKLGKLNPFKH  210
            +K+GKLN F H
Sbjct  582  RKIGKLNFFGH  592



>emb|CBI37309.3| unnamed protein product [Vitis vinifera]
Length=605

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 68/131 (52%), Gaps = 25/131 (19%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA------EDPK-----------STPNAIAT  423
            A  HA+QN+RLP+Q ++  LY++QL++R+        ED K           +   A++ 
Sbjct  459  AGAHAAQNERLPLQSIVQVLYFEQLRLRNALCTSYADEDQKPVHQSWRISSGALSAAMSP  518

Query  422  RNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMS  243
            R+      +L +EN  L+ EL +++M + D++ +       ++ S +       F SS S
Sbjct  519  RDNY---ASLRRENRELKLELARLRMRLNDLEKEHVHMKRDMEKSHSL-----NFMSSFS  570

Query  242  KKLGKLNPFKH  210
            +K+GKLN F H
Sbjct  571  RKIGKLNFFGH  581



>ref|XP_010652501.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 isoform 
X3 [Vitis vinifera]
Length=586

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 68/131 (52%), Gaps = 25/131 (19%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA------EDPK-----------STPNAIAT  423
            A  HA+QN+RLP+Q ++  LY++QL++R+        ED K           +   A++ 
Sbjct  440  AGAHAAQNERLPLQSIVQVLYFEQLRLRNALCTSYADEDQKPVHQSWRISSGALSAAMSP  499

Query  422  RNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMS  243
            R+      +L +EN  L+ EL +++M + D++ +       ++ S +       F SS S
Sbjct  500  RDNY---ASLRRENRELKLELARLRMRLNDLEKEHVHMKRDMEKSHSL-----NFMSSFS  551

Query  242  KKLGKLNPFKH  210
            +K+GKLN F H
Sbjct  552  RKIGKLNFFGH  562



>ref|XP_010652500.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 isoform 
X2 [Vitis vinifera]
Length=593

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 68/131 (52%), Gaps = 25/131 (19%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA------EDPK-----------STPNAIAT  423
            A  HA+QN+RLP+Q ++  LY++QL++R+        ED K           +   A++ 
Sbjct  447  AGAHAAQNERLPLQSIVQVLYFEQLRLRNALCTSYADEDQKPVHQSWRISSGALSAAMSP  506

Query  422  RNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMS  243
            R+      +L +EN  L+ EL +++M + D++ +       ++ S +       F SS S
Sbjct  507  RDNY---ASLRRENRELKLELARLRMRLNDLEKEHVHMKRDMEKSHSL-----NFMSSFS  558

Query  242  KKLGKLNPFKH  210
            +K+GKLN F H
Sbjct  559  RKIGKLNFFGH  569



>ref|XP_001769248.1| predicted protein [Physcomitrella patens]
 gb|EDQ65960.1| predicted protein, partial [Physcomitrella patens]
Length=586

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 83/168 (49%), Gaps = 34/168 (20%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSG-----AEDP--------KSTPNAIATRNQL  411
            A  HA+QN+RLPVQ+V+  LY++QL++R+        DP        + T   +AT    
Sbjct  425  ACTHAAQNERLPVQVVVQVLYFEQLRLRNAMSTINTRDPVLRLQLSQRMTVGNVATGQPP  484

Query  410  QADVTLV-KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKL  234
              +   V +EN  L+ E+ +M+M + +++   ++    +  +   +     F  SMSKKL
Sbjct  485  NENYESVRRENRDLKLEIARMRMRMTELERDQNNLKVDIVKNGGGSR----FIDSMSKKL  540

Query  233  GKLNPF-KHGSKDTSNLDDGEVDI-------------TKPRRRRFSIS  132
             KLNPF +  S+D  N   GE+                KPRRRR S+S
Sbjct  541  SKLNPFQRRESRDFKN--SGELGTNSSGTPLTPDTRSAKPRRRRHSVS  586



>ref|XP_002301784.2| hypothetical protein POPTR_0002s24380g [Populus trichocarpa]
 gb|EEE81057.2| hypothetical protein POPTR_0002s24380g [Populus trichocarpa]
Length=610

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 67/128 (52%), Gaps = 19/128 (15%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA------EDPKSTPNAI-ATRNQLQADV--  399
            A  HA+QN+RLP+Q ++  LY++Q+++R+        +D K   N+   +   L A +  
Sbjct  459  AGAHAAQNERLPLQAIVQVLYFEQIRLRNALCCSYADDDHKPMHNSWRISSGALSAAMSP  518

Query  398  -----TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKL  234
                 +L +EN  L+ EL +++M + D++          +    S  RK  F SS SKK+
Sbjct  519  RDNYASLRRENRELKLELARLRMRLNDLEK---EHVCMKRDMQKSHSRK--FMSSFSKKI  573

Query  233  GKLNPFKH  210
            GKL+ F H
Sbjct  574  GKLSIFGH  581



>ref|XP_010484507.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Camelina sativa]
 ref|XP_010484508.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Camelina sativa]
Length=603

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 79/161 (49%), Gaps = 27/161 (17%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIATRNQLQADVT-------  396
            A  HA+QN RLPVQ ++  LYY+Q ++R     D  S          L   ++       
Sbjct  449  ACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPAAAVLPPKLSSYNDELS  508

Query  395  -LVKENEALRTELLQMKMFIADMQNkgssqgssvkgss-------asaVRKP-----TFF  255
             L +EN+ L+ ELL+MKM + + + +   + SS   S+        +++ KP     +F 
Sbjct  509  KLKRENQDLKLELLKMKMKLKEFEKESDKKSSSSTISTNPNSPISTASMDKPPLPRKSFI  568

Query  254  SSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
            +S+S+KLGKLNPF  G    S    G      P+ RR SIS
Sbjct  569  NSVSRKLGKLNPF--GITPYS----GRGRTKPPKDRRHSIS  603



>ref|XP_006386870.1| hypothetical protein POPTR_0002s24380g [Populus trichocarpa]
 gb|ERP64667.1| hypothetical protein POPTR_0002s24380g [Populus trichocarpa]
Length=499

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 67/128 (52%), Gaps = 19/128 (15%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA------EDPKSTPNAI-ATRNQLQADV--  399
            A  HA+QN+RLP+Q ++  LY++Q+++R+        +D K   N+   +   L A +  
Sbjct  348  AGAHAAQNERLPLQAIVQVLYFEQIRLRNALCCSYADDDHKPMHNSWRISSGALSAAMSP  407

Query  398  -----TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKL  234
                 +L +EN  L+ EL +++M + D++          +    S  RK  F SS SKK+
Sbjct  408  RDNYASLRRENRELKLELARLRMRLNDLEK---EHVCMKRDMQKSHSRK--FMSSFSKKI  462

Query  233  GKLNPFKH  210
            GKL+ F H
Sbjct  463  GKLSIFGH  470



>gb|AAU05485.1| At5g67385 [Arabidopsis thaliana]
 gb|AAU95431.1| At5g67385 [Arabidopsis thaliana]
Length=604

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 77/162 (48%), Gaps = 28/162 (17%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV------  390
            A  HA+QN RLPVQ ++  LYY+Q ++R    +   +P     +        L       
Sbjct  449  ACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPQPAAVLPPKLSSYTDEL  508

Query  389  ----KENEALRTELLQMKMFIADMQNkgssqgssvkgss-------asaVRKP-----TF  258
                +EN+ L+ ELL+MKM + + + +   + SS   S+        ++  KP     +F
Sbjct  509  SKLKRENQDLKLELLKMKMKLKEFEKESEKKTSSSTISTNPSSPISTASTGKPPLPRKSF  568

Query  257  FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
             +S+SKKLGKLNPF      +    +G      P+ RR SIS
Sbjct  569  INSVSKKLGKLNPF------SITPYNGRGRTKPPKDRRHSIS  604



>ref|XP_011024680.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Populus 
euphratica]
Length=610

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 67/128 (52%), Gaps = 19/128 (15%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA------EDPKSTPNAI-ATRNQLQADV--  399
            A  HA+QN+RLP+Q ++  LY++Q+++R+        +D K   N+   +   L A +  
Sbjct  459  AGAHAAQNERLPLQAIVQVLYFEQIRLRNALCCSYADDDHKPMHNSWRISSGALSAAMSP  518

Query  398  -----TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKL  234
                 +L +EN  L+ EL +++M + D++          +    S  RK  F SS SKK+
Sbjct  519  RDNYASLRRENRELKLELARLRMRLNDLEK---EHVCMKRDMQKSHSRK--FMSSFSKKI  573

Query  233  GKLNPFKH  210
            GKL+ F H
Sbjct  574  GKLSIFGH  581



>ref|XP_010484509.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Camelina sativa]
Length=548

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 79/161 (49%), Gaps = 27/161 (17%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIATRNQLQADVT-------  396
            A  HA+QN RLPVQ ++  LYY+Q ++R     D  S          L   ++       
Sbjct  394  ACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPAAAVLPPKLSSYNDELS  453

Query  395  -LVKENEALRTELLQMKMFIADMQNkgssqgssvkgss-------asaVRKP-----TFF  255
             L +EN+ L+ ELL+MKM + + + +   + SS   S+        +++ KP     +F 
Sbjct  454  KLKRENQDLKLELLKMKMKLKEFEKESDKKSSSSTISTNPNSPISTASMDKPPLPRKSFI  513

Query  254  SSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
            +S+S+KLGKLNPF  G    S    G      P+ RR SIS
Sbjct  514  NSVSRKLGKLNPF--GITPYS----GRGRTKPPKDRRHSIS  548



>ref|XP_010464139.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Camelina 
sativa]
Length=603

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 79/161 (49%), Gaps = 27/161 (17%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIATRNQLQADVT-------  396
            A  HA+QN RLPVQ ++  LYY+Q ++R     D  S          L   ++       
Sbjct  449  ACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPAAAVLPPKLSSYNDELS  508

Query  395  -LVKENEALRTELLQMKMFIADMQNkgssqgssvkgss-------asaVRKP-----TFF  255
             L +EN+ L+ ELL+MKM + + + +   + SS   S+        +++ KP     +F 
Sbjct  509  KLKRENQDLKLELLKMKMKLKEFEKESDKKSSSSTISTNPNSPISTTSMDKPPLPRKSFI  568

Query  254  SSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  132
            +S+S+KLGKLNPF  G    S    G      P+ RR SIS
Sbjct  569  NSVSRKLGKLNPF--GITPYS----GRGRTKPPKDRRHSIS  603



>ref|XP_004251006.1| PREDICTED: BTB/POZ domain-containing protein At3g44820 [Solanum 
lycopersicum]
Length=631

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 30/89 (34%), Positives = 51/89 (57%), Gaps = 14/89 (16%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR-------------SGAEDPKSTPNAIATR-NQ  414
            A  HASQN RLP+++VL  L++ QL++R             SG   P + P+ +A +  Q
Sbjct  470  ACAHASQNDRLPLRVVLQVLFFGQLQLRTAVAGRFQVLDTESGPAAPVTGPSDMAGQIVQ  529

Query  413  LQADVTLVKENEALRTELLQMKMFIADMQ  327
                VT+V+EN+ L+ +L +MK  + +++
Sbjct  530  RDGWVTVVRENQGLKVDLERMKSRVGELE  558



>gb|KHG00255.1| hypothetical protein F383_19997 [Gossypium arboreum]
Length=611

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 67/129 (52%), Gaps = 20/129 (16%)
 Frame = -3

Query  551  ARVHASQNKRLPVQIVLHALYYDQLKIR-----SGAEDPKSTPNAIATRNQLQAD-----  402
            A  HA+QN+RLP+Q ++  LY++QL++R     S A+D +   N  + R    A      
Sbjct  459  AGAHAAQNERLPLQSIVQVLYFEQLRLRNALCCSYADDDRKPVNHQSWRISSSALSAAMS  518

Query  401  -----VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKK  237
                  +L +EN  L+ EL +M+M + D++          +  + S+ RK  F SS +KK
Sbjct  519  PKDNYASLRRENRELKLELARMRMRLNDLEK---EHVCMKRDMAKSSSRK--FMSSFTKK  573

Query  236  LGKLNPFKH  210
            +G L+ F H
Sbjct  574  IGGLSLFGH  582



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760