BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF034C17

Length=735
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789305.1|  PREDICTED: serine carboxypeptidase II-2            306   3e-98   Nicotiana sylvestris
ref|XP_009630744.1|  PREDICTED: serine carboxypeptidase II-2            303   5e-97   Nicotiana tomentosiformis
ref|XP_004242620.1|  PREDICTED: serine carboxypeptidase II-2            301   5e-96   Solanum lycopersicum
ref|XP_006343604.1|  PREDICTED: serine carboxypeptidase II-2-like       300   1e-95   Solanum tuberosum [potatoes]
emb|CDP02851.1|  unnamed protein product                                290   1e-91   Coffea canephora [robusta coffee]
gb|EYU34325.1|  hypothetical protein MIMGU_mgv1a005646mg                290   1e-91   Erythranthe guttata [common monkey flower]
ref|XP_011079368.1|  PREDICTED: serine carboxypeptidase II-2            282   1e-88   Sesamum indicum [beniseed]
ref|XP_002275081.1|  PREDICTED: serine carboxypeptidase II-2            268   2e-83   Vitis vinifera
ref|XP_007202013.1|  hypothetical protein PRUPE_ppa005192mg             268   3e-83   Prunus persica
emb|CAN75200.1|  hypothetical protein VITISV_014887                     268   1e-82   Vitis vinifera
ref|XP_004287151.1|  PREDICTED: serine carboxypeptidase II-2            266   2e-82   Fragaria vesca subsp. vesca
ref|XP_010273729.1|  PREDICTED: serine carboxypeptidase II-2            266   3e-82   Nelumbo nucifera [Indian lotus]
ref|XP_007013884.1|  Serine carboxypeptidase-like 29                    265   4e-82   Theobroma cacao [chocolate]
ref|XP_008243035.1|  PREDICTED: serine carboxypeptidase II-2            265   4e-82   Prunus mume [ume]
ref|XP_010111113.1|  Serine carboxypeptidase-like 29                    261   2e-80   
ref|XP_011018073.1|  PREDICTED: serine carboxypeptidase II-2-like       257   3e-80   Populus euphratica
ref|XP_011018071.1|  PREDICTED: serine carboxypeptidase II-2-like...    257   4e-79   Populus euphratica
emb|CBI36578.3|  unnamed protein product                                257   6e-79   Vitis vinifera
ref|XP_002273324.2|  PREDICTED: serine carboxypeptidase II-2            257   1e-78   Vitis vinifera
ref|XP_009358402.1|  PREDICTED: serine carboxypeptidase II-2            256   2e-78   Pyrus x bretschneideri [bai li]
ref|XP_006453577.1|  hypothetical protein CICLE_v10008112mg             255   3e-78   Citrus clementina [clementine]
gb|EPS71160.1|  hypothetical protein M569_03591                         254   3e-78   Genlisea aurea
gb|KDP38717.1|  hypothetical protein JCGZ_04070                         255   4e-78   Jatropha curcas
gb|AFK34001.1|  unknown                                                 246   7e-78   Medicago truncatula
ref|XP_008394291.1|  PREDICTED: serine carboxypeptidase II-2            254   8e-78   
ref|XP_007138291.1|  hypothetical protein PHAVU_009G196000g             254   9e-78   Phaseolus vulgaris [French bean]
ref|XP_006474032.1|  PREDICTED: serine carboxypeptidase-like 29-like    254   9e-78   Citrus sinensis [apfelsine]
ref|XP_002528403.1|  serine carboxypeptidase, putative                  254   1e-77   Ricinus communis
ref|XP_010687643.1|  PREDICTED: serine carboxypeptidase II-2            253   1e-77   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH38195.1|  serine carboxypeptidase-like protein                    249   2e-76   Medicago truncatula
ref|XP_003595892.1|  Serine carboxypeptidase II-2                       249   4e-76   Medicago truncatula
gb|KHN02055.1|  Serine carboxypeptidase II-2                            249   7e-76   Glycine soja [wild soybean]
ref|XP_009410194.1|  PREDICTED: serine carboxypeptidase II-2-like       248   1e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003595890.1|  Serine carboxypeptidase II-2                       248   1e-75   Medicago truncatula
ref|XP_003522937.2|  PREDICTED: serine carboxypeptidase II-2-like       249   1e-75   Glycine max [soybeans]
ref|XP_003595891.1|  Serine carboxypeptidase-like protein               248   1e-75   Medicago truncatula
ref|XP_008790132.1|  PREDICTED: serine carboxypeptidase II-2 isof...    248   2e-75   Phoenix dactylifera
gb|KHG11306.1|  Serine carboxypeptidase-like 29                         248   3e-75   Gossypium arboreum [tree cotton]
ref|XP_010040844.1|  PREDICTED: serine carboxypeptidase II-2-like       247   3e-75   Eucalyptus grandis [rose gum]
ref|XP_010048771.1|  PREDICTED: serine carboxypeptidase II-2            247   4e-75   Eucalyptus grandis [rose gum]
ref|XP_010905043.1|  PREDICTED: serine carboxypeptidase II-2            247   5e-75   Elaeis guineensis
ref|XP_002324616.2|  hypothetical protein POPTR_0018s11210g             246   5e-75   
ref|XP_004964646.1|  PREDICTED: serine carboxypeptidase II-2-like       246   9e-75   Setaria italica
gb|ACF84647.1|  unknown                                                 239   1e-74   Zea mays [maize]
ref|XP_006453578.1|  hypothetical protein CICLE_v10008112mg             244   8e-74   Citrus clementina [clementine]
ref|XP_003596536.1|  Serine carboxypeptidase                            244   4e-73   
gb|AIN39846.1|  hypothetical protein                                    232   5e-73   Zoysia matrella [Japanese carpet grass]
gb|AES66787.2|  serine carboxypeptidase-like protein                    241   1e-72   Medicago truncatula
ref|XP_004488608.1|  PREDICTED: serine carboxypeptidase II-2-like       240   2e-72   Cicer arietinum [garbanzo]
gb|EMT26558.1|  putative Serine carboxypeptidase II-2                   238   2e-72   
ref|NP_001057009.1|  Os06g0186400                                       240   3e-72   
ref|XP_004144720.1|  PREDICTED: serine carboxypeptidase-like 29-like    239   3e-72   Cucumis sativus [cucumbers]
sp|P55748.1|CBP22_HORVU  RecName: Full=Serine carboxypeptidase II...    238   5e-72   Hordeum vulgare [barley]
gb|ABK24285.1|  unknown                                                 238   6e-72   Picea sitchensis
ref|NP_001146398.1|  Serine carboxypeptidase K10B2.2 precursor          239   6e-72   Zea mays [maize]
dbj|BAJ99024.1|  predicted protein                                      238   7e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008452541.1|  PREDICTED: serine carboxypeptidase II-2            238   8e-72   Cucumis melo [Oriental melon]
gb|KGN61064.1|  hypothetical protein Csa_2G036620                       240   1e-71   
ref|XP_009395827.1|  PREDICTED: serine carboxypeptidase II-2-like       237   3e-71   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK02147.1|  predicted protein                                      236   4e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB76659.1|  hypothetical protein B456_012G098600                    236   7e-71   Gossypium raimondii
ref|XP_003564183.1|  PREDICTED: serine carboxypeptidase II-2            236   8e-71   Brachypodium distachyon [annual false brome]
ref|XP_004162685.1|  PREDICTED: serine carboxypeptidase-like 29-like    236   9e-71   
ref|XP_006655861.1|  PREDICTED: serine carboxypeptidase II-2-like       235   2e-70   Oryza brachyantha
ref|XP_006845388.1|  hypothetical protein AMTR_s00019p00053910          234   5e-70   Amborella trichopoda
ref|XP_002324520.1|  serine carboxypeptidase S10 family protein         231   6e-69   
ref|XP_009137969.1|  PREDICTED: serine carboxypeptidase-like 29         229   2e-68   Brassica rapa
emb|CDY13387.1|  BnaA03g51050D                                          229   4e-68   Brassica napus [oilseed rape]
ref|XP_009127491.1|  PREDICTED: serine carboxypeptidase-like 29         229   4e-68   Brassica rapa
emb|CDX68696.1|  BnaC01g07570D                                          229   7e-68   
emb|CDX72270.1|  BnaC07g42920D                                          232   1e-67   
ref|XP_010526302.1|  PREDICTED: serine carboxypeptidase-like 29         227   3e-67   Tarenaya hassleriana [spider flower]
ref|XP_010253608.1|  PREDICTED: serine carboxypeptidase-like 27         226   4e-67   Nelumbo nucifera [Indian lotus]
emb|CDY28217.1|  BnaA01g06320D                                          225   7e-67   Brassica napus [oilseed rape]
gb|ACG38162.1|  serine carboxypeptidase K10B2.2 precursor               224   1e-66   Zea mays [maize]
ref|XP_008654560.1|  PREDICTED: uncharacterized protein LOC100273...    224   1e-66   
gb|ACF79757.1|  unknown                                                 224   1e-66   Zea mays [maize]
emb|CDY55623.1|  BnaC03g77560D                                          224   2e-66   Brassica napus [oilseed rape]
ref|XP_010669644.1|  PREDICTED: serine carboxypeptidase-like 27         223   3e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006470942.1|  PREDICTED: serine carboxypeptidase II-2-like       219   4e-66   
ref|XP_002312024.1|  serine carboxypeptidase S10 family protein         223   4e-66   Populus trichocarpa [western balsam poplar]
dbj|BAH20278.1|  AT4G30810                                              220   8e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002457307.1|  hypothetical protein SORBIDRAFT_03g005360          222   1e-65   Sorghum bicolor [broomcorn]
gb|KDP25725.1|  hypothetical protein JCGZ_23946                         222   1e-65   Jatropha curcas
ref|XP_010527107.1|  PREDICTED: serine carboxypeptidase-like 29         214   1e-65   Tarenaya hassleriana [spider flower]
ref|XP_011031767.1|  PREDICTED: serine carboxypeptidase-like 27         222   1e-65   Populus euphratica
emb|CDY28216.1|  BnaA01g06330D                                          222   1e-65   Brassica napus [oilseed rape]
ref|XP_003556225.1|  PREDICTED: serine carboxypeptidase-like 27-l...    222   1e-65   Glycine max [soybeans]
ref|XP_011076996.1|  PREDICTED: serine carboxypeptidase-like 27         222   2e-65   Sesamum indicum [beniseed]
ref|XP_010525795.1|  PREDICTED: serine carboxypeptidase-like 29         216   2e-65   Tarenaya hassleriana [spider flower]
emb|CDY23258.1|  BnaA08g12880D                                          222   2e-65   Brassica napus [oilseed rape]
ref|XP_009127511.1|  PREDICTED: serine carboxypeptidase-like 29         222   2e-65   Brassica rapa
gb|KFK29659.1|  hypothetical protein AALP_AA7G162000                    222   2e-65   Arabis alpina [alpine rockcress]
ref|XP_009378094.1|  PREDICTED: serine carboxypeptidase-like 27         221   3e-65   Pyrus x bretschneideri [bai li]
ref|XP_010264739.1|  PREDICTED: serine carboxypeptidase-like 27         221   3e-65   Nelumbo nucifera [Indian lotus]
ref|XP_008368824.1|  PREDICTED: serine carboxypeptidase-like 27         221   3e-65   Malus domestica [apple tree]
ref|XP_009592854.1|  PREDICTED: serine carboxypeptidase-like 27         220   5e-65   Nicotiana tomentosiformis
ref|XP_004968265.1|  PREDICTED: serine carboxypeptidase 2-like          222   5e-65   Setaria italica
ref|XP_009802382.1|  PREDICTED: serine carboxypeptidase-like 27         220   5e-65   Nicotiana sylvestris
dbj|BAK06862.1|  predicted protein                                      213   6e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX68695.1|  BnaC01g07580D                                          221   6e-65   
emb|CDO99730.1|  unnamed protein product                                220   7e-65   Coffea canephora [robusta coffee]
gb|KJB78938.1|  hypothetical protein B456_013G026200                    220   8e-65   Gossypium raimondii
ref|NP_567854.1|  serine carboxypeptidase-like 29                       220   9e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006850617.1|  hypothetical protein AMTR_s00034p00161680          220   9e-65   Amborella trichopoda
ref|XP_011040963.1|  PREDICTED: serine carboxypeptidase-like 27         219   1e-64   Populus euphratica
ref|XP_009108967.1|  PREDICTED: serine carboxypeptidase-like 29         220   1e-64   
gb|KJB76568.1|  hypothetical protein B456_012G094900                    214   2e-64   Gossypium raimondii
ref|XP_006350225.1|  PREDICTED: serine carboxypeptidase-like 27-like    218   2e-64   Solanum tuberosum [potatoes]
ref|XP_002869361.1|  hypothetical protein ARALYDRAFT_491673             219   3e-64   
ref|XP_007219592.1|  hypothetical protein PRUPE_ppa023509mg             216   4e-64   
gb|KHG25905.1|  Serine carboxypeptidase-like 27                         218   4e-64   Gossypium arboreum [tree cotton]
ref|XP_006645520.1|  PREDICTED: serine carboxypeptidase II-1-like       216   5e-64   Oryza brachyantha
ref|XP_006589433.1|  PREDICTED: serine carboxypeptidase-like 27-like    218   6e-64   Glycine max [soybeans]
gb|KHN17121.1|  Serine carboxypeptidase-like 27                         218   6e-64   Glycine soja [wild soybean]
gb|AFK43035.1|  unknown                                                 217   7e-64   Medicago truncatula
dbj|BAO04184.1|  hypothetical protein                                   217   7e-64   Delphinium grandiflorum
ref|XP_006412667.1|  hypothetical protein EUTSA_v10025076mg             218   9e-64   Eutrema salsugineum [saltwater cress]
ref|XP_003591950.1|  Serine carboxypeptidase-like protein               217   9e-64   Medicago truncatula
ref|XP_003560871.1|  PREDICTED: serine carboxypeptidase 2-like          217   1e-63   Brachypodium distachyon [annual false brome]
ref|NP_001044713.1|  Os01g0833500                                       216   2e-63   
ref|XP_002315292.2|  serine carboxypeptidase S10 family protein         216   2e-63   Populus trichocarpa [western balsam poplar]
gb|EAY76388.1|  hypothetical protein OsI_04319                          216   2e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_004236634.1|  PREDICTED: serine carboxypeptidase-like 27         216   2e-63   Solanum lycopersicum
ref|XP_008233341.1|  PREDICTED: serine carboxypeptidase-like 27         216   2e-63   Prunus mume [ume]
ref|XP_010541227.1|  PREDICTED: serine carboxypeptidase-like 29         213   2e-63   
ref|XP_007143689.1|  hypothetical protein PHAVU_007G093300g             216   3e-63   Phaseolus vulgaris [French bean]
ref|XP_010447670.1|  PREDICTED: serine carboxypeptidase-like 29         216   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_006410747.1|  hypothetical protein EUTSA_v10016650mg             215   3e-63   Eutrema salsugineum [saltwater cress]
ref|XP_003564543.1|  PREDICTED: serine carboxypeptidase-like 27         216   3e-63   Brachypodium distachyon [annual false brome]
ref|XP_006286217.1|  hypothetical protein CARUB_v10007783mg             216   3e-63   Capsella rubella
ref|XP_004496292.1|  PREDICTED: serine carboxypeptidase-like 27-l...    215   4e-63   Cicer arietinum [garbanzo]
ref|XP_002457308.1|  hypothetical protein SORBIDRAFT_03g005370          215   5e-63   Sorghum bicolor [broomcorn]
ref|XP_010438130.1|  PREDICTED: serine carboxypeptidase-like 29         216   5e-63   Camelina sativa [gold-of-pleasure]
ref|NP_001042076.1|  Os01g0158200                                       215   5e-63   
gb|KDO48447.1|  hypothetical protein CISIN_1g012819mg                   215   6e-63   Citrus sinensis [apfelsine]
emb|CAN74854.1|  hypothetical protein VITISV_028701                     215   6e-63   Vitis vinifera
gb|KJB76563.1|  hypothetical protein B456_012G094900                    215   6e-63   Gossypium raimondii
ref|XP_002274723.1|  PREDICTED: serine carboxypeptidase-like 27         214   7e-63   Vitis vinifera
gb|KJB76569.1|  hypothetical protein B456_012G094900                    214   7e-63   Gossypium raimondii
dbj|BAJ99174.1|  predicted protein                                      214   8e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAB08188.1|  unnamed protein product                                215   8e-63   Oryza sativa Japonica Group [Japonica rice]
gb|KHG08205.1|  Serine carboxypeptidase-like 27                         214   9e-63   Gossypium arboreum [tree cotton]
ref|XP_003591947.1|  Serine carboxypeptidase-like protein               214   1e-62   Medicago truncatula
tpg|DAA53383.1|  TPA: hypothetical protein ZEAMMB73_784297              211   1e-62   
ref|XP_008381976.1|  PREDICTED: serine carboxypeptidase-like 27         214   1e-62   
ref|XP_004307401.1|  PREDICTED: serine carboxypeptidase-like 27         214   2e-62   Fragaria vesca subsp. vesca
ref|XP_006644961.1|  PREDICTED: serine carboxypeptidase-like 27-like    213   2e-62   Oryza brachyantha
ref|XP_010908844.1|  PREDICTED: serine carboxypeptidase-like 27         213   2e-62   Elaeis guineensis
gb|EMS47606.1|  Serine carboxypeptidase-like 27                         214   2e-62   Triticum urartu
ref|XP_008805039.1|  PREDICTED: serine carboxypeptidase-like 27         213   2e-62   Phoenix dactylifera
ref|XP_002459313.1|  hypothetical protein SORBIDRAFT_02g002260          214   2e-62   Sorghum bicolor [broomcorn]
ref|XP_008446902.1|  PREDICTED: serine carboxypeptidase-like 27         213   3e-62   Cucumis melo [Oriental melon]
gb|AAV43957.1|  putative serine carboxypeptidase II                     214   3e-62   Oryza sativa Japonica Group [Japonica rice]
gb|EEC69980.1|  hypothetical protein OsI_00486                          213   3e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_006436271.1|  hypothetical protein CICLE_v10031497mg             213   3e-62   Citrus clementina [clementine]
ref|XP_004968264.1|  PREDICTED: serine carboxypeptidase-like 27-like    213   4e-62   Setaria italica
ref|XP_006655142.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    213   4e-62   
gb|ABK21145.1|  unknown                                                 209   4e-62   Picea sitchensis
ref|XP_009333715.1|  PREDICTED: serine carboxypeptidase-like 27         212   5e-62   Pyrus x bretschneideri [bai li]
ref|XP_002458719.1|  hypothetical protein SORBIDRAFT_03g038940          212   7e-62   Sorghum bicolor [broomcorn]
ref|XP_003591949.1|  Serine carboxypeptidase-like protein               212   7e-62   
ref|XP_004970465.1|  PREDICTED: serine carboxypeptidase-like 27-like    212   8e-62   Setaria italica
ref|XP_008673013.1|  PREDICTED: LOC100285510 isoform X1                 212   1e-61   
ref|NP_001151874.1|  LOC100285510 precursor                             212   1e-61   
ref|XP_004142401.1|  PREDICTED: serine carboxypeptidase-like 27-like    211   2e-61   Cucumis sativus [cucumbers]
tpg|DAA53384.1|  TPA: serine carboxypeptidase K10B2.2                   211   3e-61   
ref|NP_001150676.1|  serine carboxypeptidase K10B2.2 precursor          211   4e-61   Zea mays [maize]
ref|XP_009141519.1|  PREDICTED: serine carboxypeptidase-like 26         210   4e-61   Brassica rapa
pdb|1BCR|B  Chain B, Complex Of The Wheat Serine Carboxypeptidase...    201   5e-61   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010547376.1|  PREDICTED: serine carboxypeptidase-like 27         210   5e-61   Tarenaya hassleriana [spider flower]
ref|XP_006407773.1|  hypothetical protein EUTSA_v10020705mg             209   6e-61   Eutrema salsugineum [saltwater cress]
pdb|1WHT|B  Chain B, Structure Of The Complex Of L-Benzylsuccinat...    200   6e-61   Triticum aestivum [Canadian hard winter wheat]
pdb|3SC2|B  Chain B, Refined Atomic Model Of Wheat Serine Carboxy...    200   6e-61   unidentified
emb|CDY32091.1|  BnaC04g44750D                                          209   6e-61   Brassica napus [oilseed rape]
emb|CDY40438.1|  BnaA04g20790D                                          209   6e-61   Brassica napus [oilseed rape]
pdb|1WHS|B  Chain B, Structure Of The Complex Of L-Benzylsuccinat...    200   6e-61   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010432944.1|  PREDICTED: serine carboxypeptidase-like 29         210   7e-61   Camelina sativa [gold-of-pleasure]
emb|CDY35977.1|  BnaA05g29730D                                          209   9e-61   Brassica napus [oilseed rape]
sp|P55747.1|CBP21_HORVU  RecName: Full=Serine carboxypeptidase II...    205   1e-60   Hordeum vulgare [barley]
ref|XP_008649461.1|  PREDICTED: serine carboxypeptidase 2-like is...    210   1e-60   Zea mays [maize]
ref|XP_004962519.1|  PREDICTED: serine carboxypeptidase 2-like          209   1e-60   Setaria italica
ref|XP_009147010.1|  PREDICTED: serine carboxypeptidase-like 27 i...    209   1e-60   
gb|KFK38250.1|  hypothetical protein AALP_AA3G088900                    209   1e-60   Arabis alpina [alpine rockcress]
gb|ACU19747.1|  unknown                                                 204   1e-60   Glycine max [soybeans]
ref|XP_009147009.1|  PREDICTED: serine carboxypeptidase-like 27 i...    209   1e-60   Brassica rapa
emb|CDY28004.1|  BnaC05g44060D                                          208   2e-60   Brassica napus [oilseed rape]
ref|XP_009414289.1|  PREDICTED: serine carboxypeptidase-like 27         209   2e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003566409.1|  PREDICTED: serine carboxypeptidase II-1            209   2e-60   
ref|XP_006297635.1|  hypothetical protein CARUB_v10013654mg             208   3e-60   
ref|XP_010486379.1|  PREDICTED: serine carboxypeptidase-like 27         208   3e-60   Camelina sativa [gold-of-pleasure]
ref|NP_187456.1|  serine carboxypeptidase-like 27                       208   3e-60   Arabidopsis thaliana [mouse-ear cress]
gb|EMS66624.1|  Serine carboxypeptidase II-1                            205   3e-60   Triticum urartu
ref|XP_010464446.1|  PREDICTED: serine carboxypeptidase-like 27         207   4e-60   Camelina sativa [gold-of-pleasure]
gb|EMT21139.1|  putative Serine carboxypeptidase II-1                   206   4e-60   
ref|XP_008789080.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    207   5e-60   
ref|XP_010920885.1|  PREDICTED: serine carboxypeptidase-like 27         208   6e-60   Elaeis guineensis
ref|XP_008649460.1|  PREDICTED: serine carboxypeptidase 2-like is...    207   8e-60   Zea mays [maize]
gb|KCW65386.1|  hypothetical protein EUGRSUZ_G02816                     207   9e-60   Eucalyptus grandis [rose gum]
ref|XP_007009787.1|  Serine carboxypeptidase-like 27 isoform 1          208   1e-59   
ref|XP_002882565.1|  hypothetical protein ARALYDRAFT_478140             206   1e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_010460785.1|  PREDICTED: serine carboxypeptidase-like 27         206   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_003566533.2|  PREDICTED: serine carboxypeptidase 2-like          206   2e-59   Brachypodium distachyon [annual false brome]
ref|XP_009410600.1|  PREDICTED: serine carboxypeptidase-like 27 i...    206   2e-59   
emb|CAA18212.1|  SERINE CARBOXYPEPTIDASE II-like protein                205   2e-59   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK02399.1|  predicted protein                                      206   2e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDM82001.1|  unnamed protein product                                206   3e-59   Triticum aestivum [Canadian hard winter wheat]
emb|CDP11023.1|  unnamed protein product                                206   3e-59   Coffea canephora [robusta coffee]
ref|XP_010067290.1|  PREDICTED: serine carboxypeptidase-like 27         207   3e-59   Eucalyptus grandis [rose gum]
ref|XP_009410601.1|  PREDICTED: serine carboxypeptidase-like 27 i...    205   3e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010937832.1|  PREDICTED: serine carboxypeptidase-like 27         205   4e-59   Elaeis guineensis
emb|CAI64396.1|  serine carboxypeptidase II                             199   5e-59   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006294202.1|  hypothetical protein CARUB_v10023198mg             203   1e-58   Capsella rubella
ref|XP_009386999.1|  PREDICTED: serine carboxypeptidase-like 27         204   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT12249.1|  Serine carboxypeptidase 2                               204   1e-58   
gb|ACA61621.1|  hypothetical protein AP7_B10.1                          203   2e-58   Arabidopsis lyrata subsp. petraea
gb|KHN13367.1|  Serine carboxypeptidase-like 27                         204   2e-58   Glycine soja [wild soybean]
ref|XP_003548016.1|  PREDICTED: serine carboxypeptidase-like 27-like    204   2e-58   Glycine max [soybeans]
ref|XP_011469672.1|  PREDICTED: serine carboxypeptidase-like 27 i...    202   5e-58   Fragaria vesca subsp. vesca
ref|XP_002881414.1|  hypothetical protein ARALYDRAFT_482550             201   7e-58   
ref|XP_004307399.1|  PREDICTED: serine carboxypeptidase-like 27 i...    201   1e-57   Fragaria vesca subsp. vesca
sp|P08819.2|CBP2_WHEAT  RecName: Full=Serine carboxypeptidase 2; ...    201   1e-57   Triticum aestivum [Canadian hard winter wheat]
prf||1408163B  CPase II B                                               192   1e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010505098.1|  PREDICTED: serine carboxypeptidase-like 26         200   3e-57   Camelina sativa [gold-of-pleasure]
gb|AES62200.2|  serine carboxypeptidase-like protein                    200   4e-57   Medicago truncatula
ref|XP_007154876.1|  hypothetical protein PHAVU_003G155400g             197   4e-57   Phaseolus vulgaris [French bean]
ref|XP_010509560.1|  PREDICTED: serine carboxypeptidase-like 26         199   5e-57   Camelina sativa [gold-of-pleasure]
ref|XP_003519151.1|  PREDICTED: serine carboxypeptidase 24-like i...    199   7e-57   Glycine max [soybeans]
gb|KHN42831.1|  Serine carboxypeptidase 24                              199   8e-57   Glycine soja [wild soybean]
ref|XP_010516783.1|  PREDICTED: serine carboxypeptidase-like 26         199   9e-57   Camelina sativa [gold-of-pleasure]
gb|KJB76567.1|  hypothetical protein B456_012G094900                    199   1e-56   Gossypium raimondii
ref|XP_003549539.1|  PREDICTED: serine carboxypeptidase 24-like         197   3e-56   Glycine max [soybeans]
gb|KDO59486.1|  hypothetical protein CISIN_1g0120681mg                  194   1e-55   Citrus sinensis [apfelsine]
ref|XP_008352213.1|  PREDICTED: serine carboxypeptidase 24-like         192   2e-55   
gb|KFK36474.1|  hypothetical protein AALP_AA4G129400                    195   2e-55   Arabis alpina [alpine rockcress]
ref|NP_181121.1|  serine carboxypeptidase-like 26                       194   5e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007011905.1|  Alpha/beta-Hydrolases superfamily protein          194   6e-55   
emb|CAA70815.1|  serine carboxypeptidase II, CP-MII                     194   6e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006453596.1|  hypothetical protein CICLE_v10008182mg             194   7e-55   Citrus clementina [clementine]
ref|XP_006474013.1|  PREDICTED: serine carboxypeptidase 24-like         194   9e-55   Citrus sinensis [apfelsine]
emb|CDP02317.1|  unnamed protein product                                193   1e-54   Coffea canephora [robusta coffee]
ref|XP_008230880.1|  PREDICTED: serine carboxypeptidase-like 25         187   1e-54   
gb|KDP38690.1|  hypothetical protein JCGZ_04043                         187   2e-54   Jatropha curcas
ref|XP_006297594.1|  hypothetical protein CARUB_v10013616mg             193   2e-54   Capsella rubella
sp|P08818.2|CBP2_HORVU  RecName: Full=Serine carboxypeptidase 2; ...    192   2e-54   Hordeum vulgare [barley]
ref|XP_007032750.1|  Serine carboxypeptidase-like 25 isoform 3          191   3e-54   
ref|XP_008394313.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    192   3e-54   
ref|XP_009358427.1|  PREDICTED: serine carboxypeptidase 24              192   4e-54   Pyrus x bretschneideri [bai li]
gb|KJB75608.1|  hypothetical protein B456_012G048700                    192   5e-54   Gossypium raimondii
ref|XP_010656616.1|  PREDICTED: serine carboxypeptidase 24 isofor...    189   5e-54   
gb|EMT08964.1|  Serine carboxypeptidase 2                               190   5e-54   
ref|XP_004232164.1|  PREDICTED: serine carboxypeptidase-like 25         191   5e-54   Solanum lycopersicum
gb|KHG16869.1|  Serine carboxypeptidase-like 25                         192   7e-54   Gossypium arboreum [tree cotton]
ref|XP_011009402.1|  PREDICTED: serine carboxypeptidase-like 25 i...    190   7e-54   Populus euphratica
ref|XP_002440854.1|  hypothetical protein SORBIDRAFT_09g008660          192   7e-54   
ref|XP_008460256.1|  PREDICTED: serine carboxypeptidase-like 25 i...    189   7e-54   Cucumis melo [Oriental melon]
ref|XP_008645971.1|  PREDICTED: serine carboxypeptidase-like 34         182   8e-54   Zea mays [maize]
ref|XP_004288721.2|  PREDICTED: serine carboxypeptidase 24              191   8e-54   Fragaria vesca subsp. vesca
ref|XP_010108549.1|  Serine carboxypeptidase 24                         191   1e-53   
ref|XP_004137284.1|  PREDICTED: serine carboxypeptidase-like 25-like    191   1e-53   Cucumis sativus [cucumbers]
ref|XP_006408447.1|  hypothetical protein EUTSA_v10020652mg             191   1e-53   Eutrema salsugineum [saltwater cress]
ref|XP_004489523.1|  PREDICTED: serine carboxypeptidase-like 25-like    191   1e-53   Cicer arietinum [garbanzo]
emb|CBI21207.3|  unnamed protein product                                191   1e-53   Vitis vinifera
ref|XP_006373361.1|  hypothetical protein POPTR_0017s12960g             186   2e-53   
ref|XP_002280058.1|  PREDICTED: serine carboxypeptidase-like 25         190   2e-53   Vitis vinifera
ref|XP_010265560.1|  PREDICTED: serine carboxypeptidase 24-like i...    189   2e-53   Nelumbo nucifera [Indian lotus]
ref|XP_008790133.1|  PREDICTED: serine carboxypeptidase II-2 isof...    189   2e-53   Phoenix dactylifera
emb|CAN79972.1|  hypothetical protein VITISV_010072                     189   2e-53   Vitis vinifera
gb|EMT11707.1|  Serine carboxypeptidase-like 27                         192   2e-53   
ref|XP_008460255.1|  PREDICTED: serine carboxypeptidase-like 25 i...    190   2e-53   Cucumis melo [Oriental melon]
ref|XP_006338367.1|  PREDICTED: serine carboxypeptidase-like 25-like    190   2e-53   Solanum tuberosum [potatoes]
ref|XP_011009401.1|  PREDICTED: serine carboxypeptidase-like 25 i...    190   3e-53   Populus euphratica
ref|XP_007032748.1|  Serine carboxypeptidase-like 25 isoform 1          191   3e-53   
ref|XP_002275684.1|  PREDICTED: serine carboxypeptidase 24 isofor...    190   3e-53   Vitis vinifera
ref|XP_010265559.1|  PREDICTED: serine carboxypeptidase 24-like i...    189   3e-53   Nelumbo nucifera [Indian lotus]
emb|CDY39224.1|  BnaA03g50360D                                          189   3e-53   Brassica napus [oilseed rape]
ref|XP_002306020.2|  serine carboxypeptidase S10 family protein         189   3e-53   
ref|XP_009137947.1|  PREDICTED: serine carboxypeptidase 24              189   4e-53   Brassica rapa
ref|XP_004304228.1|  PREDICTED: serine carboxypeptidase-like 25         189   4e-53   Fragaria vesca subsp. vesca
ref|XP_006482750.1|  PREDICTED: serine carboxypeptidase-like 25-l...    189   4e-53   
ref|XP_006845845.1|  hypothetical protein AMTR_s00154p00033550          189   4e-53   
gb|KDP27243.1|  hypothetical protein JCGZ_19942                         189   5e-53   
ref|XP_010549997.1|  PREDICTED: serine carboxypeptidase-like 25         189   5e-53   
ref|XP_006482748.1|  PREDICTED: serine carboxypeptidase-like 25-l...    189   6e-53   
ref|XP_006431295.1|  hypothetical protein CICLE_v10011605mg             189   6e-53   
gb|KFK29637.1|  hypothetical protein AALP_AA7G159500                    189   6e-53   
ref|NP_194790.1|  serine carboxypeptidase 24                            189   6e-53   
gb|AAK44013.1|AF370198_1  putative serine carboxypeptidase II           189   7e-53   
ref|XP_006482747.1|  PREDICTED: serine carboxypeptidase-like 25-l...    189   7e-53   
ref|XP_006482749.1|  PREDICTED: serine carboxypeptidase-like 25-l...    189   7e-53   
ref|XP_009365880.1|  PREDICTED: serine carboxypeptidase-like 25         188   9e-53   
ref|XP_007204505.1|  hypothetical protein PRUPE_ppa019210mg             187   9e-53   
ref|XP_010548637.1|  PREDICTED: serine carboxypeptidase 24              188   9e-53   
ref|XP_010485446.1|  PREDICTED: serine carboxypeptidase-like 25         188   1e-52   
ref|XP_006412682.1|  hypothetical protein EUTSA_v10025119mg             188   1e-52   
ref|NP_186860.1|  serine carboxypeptidase-like 25                       188   1e-52   
ref|XP_006296368.1|  hypothetical protein CARUB_v10025540mg             187   1e-52   
gb|AAM65698.1|  putative serine carboxypeptidase II                     188   1e-52   
gb|KJB07561.1|  hypothetical protein B456_001G032600                    186   2e-52   
ref|XP_007216267.1|  hypothetical protein PRUPE_ppa017321mg             187   2e-52   
gb|KEH21654.1|  serine carboxypeptidase-like protein                    187   2e-52   
ref|XP_010942076.1|  PREDICTED: serine carboxypeptidase 24 isofor...    185   2e-52   
ref|XP_008243007.1|  PREDICTED: serine carboxypeptidase 24              187   2e-52   
ref|XP_010463602.1|  PREDICTED: serine carboxypeptidase-like 25         187   2e-52   
ref|XP_009771074.1|  PREDICTED: serine carboxypeptidase-like 25         187   2e-52   
ref|XP_002869369.1|  hypothetical protein ARALYDRAFT_491690             187   3e-52   
ref|XP_009596929.1|  PREDICTED: serine carboxypeptidase-like 25         187   3e-52   
gb|AAC63669.1|  putative serine carboxypeptidase II                     186   3e-52   
ref|XP_008443851.1|  PREDICTED: serine carboxypeptidase 24-like i...    187   3e-52   
ref|XP_010445019.1|  PREDICTED: serine carboxypeptidase-like 25         187   3e-52   
ref|XP_002324116.2|  serine carboxypeptidase S10 family protein         187   3e-52   
ref|XP_008443850.1|  PREDICTED: serine carboxypeptidase 24-like i...    187   3e-52   
ref|XP_011033395.1|  PREDICTED: serine carboxypeptidase 24-like         187   3e-52   
ref|NP_179979.4|  serine carboxypeptidase-like 23                       186   3e-52   
gb|KHG14577.1|  Serine carboxypeptidase 24 -like protein                187   4e-52   
ref|XP_002308408.1|  BRI1 SUPPRESSOR 1 family protein                   186   4e-52   
ref|XP_009792407.1|  PREDICTED: serine carboxypeptidase 24-like         187   4e-52   
ref|XP_008443849.1|  PREDICTED: serine carboxypeptidase 24-like i...    187   4e-52   
ref|XP_002527614.1|  serine carboxypeptidase, putative                  186   4e-52   
ref|XP_010032541.1|  PREDICTED: serine carboxypeptidase-like 25         187   4e-52   
ref|XP_010273635.1|  PREDICTED: serine carboxypeptidase 24-like         186   4e-52   
ref|XP_002884303.1|  hypothetical protein ARALYDRAFT_477440             187   4e-52   
sp|O82229.2|SCP23_ARATH  RecName: Full=Putative serine carboxypep...    186   5e-52   
ref|XP_006373364.1|  hypothetical protein POPTR_0017s12960g             187   5e-52   
ref|XP_008357780.1|  PREDICTED: serine carboxypeptidase-like 25 i...    186   5e-52   
gb|KJB07564.1|  hypothetical protein B456_001G032600                    187   5e-52   
gb|KJB07559.1|  hypothetical protein B456_001G032600                    187   5e-52   
gb|KJB07563.1|  hypothetical protein B456_001G032600                    187   6e-52   
ref|XP_008357779.1|  PREDICTED: serine carboxypeptidase-like 25 i...    186   6e-52   
ref|XP_006841720.1|  hypothetical protein AMTR_s00003p00256450          184   6e-52   
ref|XP_007032749.1|  Serine carboxypeptidase-like 25 isoform 2          186   6e-52   
ref|XP_010551814.1|  PREDICTED: serine carboxypeptidase-like 25 i...    186   7e-52   
ref|XP_007139483.1|  hypothetical protein PHAVU_008G033300g             186   7e-52   
ref|XP_010429355.1|  PREDICTED: putative serine carboxypeptidase-...    186   7e-52   
ref|XP_010551812.1|  PREDICTED: serine carboxypeptidase-like 25 i...    186   7e-52   
ref|XP_009147382.1|  PREDICTED: serine carboxypeptidase-like 25         186   8e-52   
ref|XP_002529402.1|  serine carboxypeptidase, putative                  186   8e-52   
ref|XP_010323187.1|  PREDICTED: serine carboxypeptidase 24 isofor...    184   9e-52   
ref|XP_010432964.1|  PREDICTED: serine carboxypeptidase 24 isofor...    184   1e-51   
emb|CDY43258.1|  BnaC05g48510D                                          186   1e-51   
ref|XP_004146676.1|  PREDICTED: serine carboxypeptidase 24-like         186   1e-51   
ref|XP_004161865.1|  PREDICTED: serine carboxypeptidase 24-like         186   1e-51   
ref|XP_009631140.1|  PREDICTED: serine carboxypeptidase 24-like         185   1e-51   
gb|KCW78823.1|  hypothetical protein EUGRSUZ_C00253                     183   1e-51   
gb|AFK37459.1|  unknown                                                 185   1e-51   
ref|XP_010447693.1|  PREDICTED: serine carboxypeptidase 24-like         185   1e-51   
ref|XP_010260044.1|  PREDICTED: serine carboxypeptidase-like 25 i...    185   1e-51   
ref|XP_011079399.1|  PREDICTED: serine carboxypeptidase 24              185   2e-51   
ref|XP_010432963.1|  PREDICTED: serine carboxypeptidase 24 isofor...    185   2e-51   
ref|XP_010089631.1|  Serine carboxypeptidase-like 25                    185   2e-51   
emb|CDP10248.1|  unnamed protein product                                184   2e-51   
ref|XP_008810326.1|  PREDICTED: serine carboxypeptidase 24              183   2e-51   
ref|XP_006285794.1|  hypothetical protein CARUB_v10007268mg             184   2e-51   
gb|KFK37671.1|  hypothetical protein AALP_AA3G013500                    184   2e-51   
ref|XP_002983919.1|  serine carboxypeptidase-like enzyme                184   3e-51   
ref|XP_010942075.1|  PREDICTED: serine carboxypeptidase 24 isofor...    185   3e-51   
ref|XP_006294162.1|  hypothetical protein CARUB_v10023155mg             184   3e-51   
ref|XP_011000079.1|  PREDICTED: serine carboxypeptidase-like 25         184   3e-51   
emb|CAN70886.1|  hypothetical protein VITISV_009829                     182   3e-51   
emb|CDX76845.1|  BnaC08g34310D                                          183   3e-51   
gb|KHN13554.1|  Serine carboxypeptidase-like 25                         184   4e-51   
ref|XP_003552566.1|  PREDICTED: serine carboxypeptidase-like 25-l...    184   4e-51   
ref|XP_002325127.2|  BRI1 SUPPRESSOR 1 family protein                   183   4e-51   
ref|XP_010323186.1|  PREDICTED: serine carboxypeptidase 24 isofor...    184   5e-51   
ref|XP_004242603.2|  PREDICTED: serine carboxypeptidase 24 isofor...    184   5e-51   
ref|XP_002960751.1|  serine carboxypeptidase-like enzyme                183   6e-51   
ref|XP_003530438.1|  PREDICTED: serine carboxypeptidase-like 25-l...    183   7e-51   
ref|XP_006404896.1|  hypothetical protein EUTSA_v10000274mg             179   7e-51   
ref|XP_010047069.1|  PREDICTED: serine carboxypeptidase 24-like         183   7e-51   
gb|KHN41581.1|  Serine carboxypeptidase-like 25                         183   7e-51   
ref|XP_006343642.1|  PREDICTED: serine carboxypeptidase 24-like         183   8e-51   
gb|EYU44197.1|  hypothetical protein MIMGU_mgv1a005600mg                183   9e-51   
ref|NP_001077950.1|  serine carboxypeptidase-like 22                    181   9e-51   
ref|XP_002878712.1|  hypothetical protein ARALYDRAFT_320208             183   1e-50   
ref|XP_011098746.1|  PREDICTED: serine carboxypeptidase-like 25         183   1e-50   
ref|XP_009117259.1|  PREDICTED: serine carboxypeptidase-like 22         182   1e-50   
ref|XP_010258045.1|  PREDICTED: serine carboxypeptidase-like 25         183   1e-50   
gb|KFK32686.1|  hypothetical protein AALP_AA6G275800                    182   2e-50   
gb|EPS67928.1|  hypothetical protein M569_06845                         182   2e-50   
ref|NP_179978.2|  serine carboxypeptidase-like 22                       182   2e-50   
ref|XP_009420309.1|  PREDICTED: serine carboxypeptidase 24-like         182   2e-50   
emb|CDY34805.1|  BnaA09g41720D                                          182   3e-50   
ref|XP_011083950.1|  PREDICTED: serine carboxypeptidase 24-like i...    180   3e-50   
dbj|BAD25095.1|  putative carboxypeptidase D                            179   4e-50   
ref|NP_001145702.1|  hypothetical protein                               179   4e-50   
gb|AAC63668.1|  putative serine carboxypeptidase II                     181   4e-50   
gb|ACF87497.1|  unknown                                                 177   5e-50   
ref|XP_002451122.1|  hypothetical protein SORBIDRAFT_05g024440          181   6e-50   
ref|XP_010472396.1|  PREDICTED: serine carboxypeptidase-like 22         181   8e-50   
ref|XP_006845380.1|  hypothetical protein AMTR_s00019p00043630          180   8e-50   
ref|XP_011018040.1|  PREDICTED: serine carboxypeptidase 24-like i...    180   9e-50   
ref|XP_011022271.1|  PREDICTED: serine carboxypeptidase-like 34         180   1e-49   
ref|XP_009399563.1|  PREDICTED: serine carboxypeptidase 24-like         180   1e-49   
ref|XP_011083949.1|  PREDICTED: serine carboxypeptidase 24-like i...    180   1e-49   
ref|XP_004953203.1|  PREDICTED: serine carboxypeptidase-like 34-like    180   2e-49   
ref|XP_008677402.1|  PREDICTED: lysosomal protective protein isof...    179   3e-49   
ref|XP_009413121.1|  PREDICTED: serine carboxypeptidase-like 34         179   3e-49   
ref|XP_010429353.1|  PREDICTED: serine carboxypeptidase-like 22         179   3e-49   
ref|XP_010417140.1|  PREDICTED: serine carboxypeptidase-like 22         179   3e-49   
ref|XP_003570294.1|  PREDICTED: serine carboxypeptidase 24              179   4e-49   
gb|ABF70080.1|  serine carboxypeptidase (carboxypeptidase D), put...    179   4e-49   
dbj|BAD19262.1|  putative carboxypeptidase D                            177   4e-49   
ref|NP_001047514.1|  Os02g0634700                                       179   4e-49   
gb|EEC73659.1|  hypothetical protein OsI_08191                          179   4e-49   
gb|KDO52736.1|  hypothetical protein CISIN_1g0420602mg                  174   5e-49   
ref|NP_001152245.1|  lysosomal protective protein precursor             178   6e-49   
ref|XP_008643436.1|  PREDICTED: hypothetical protein isoform X2         178   6e-49   
ref|XP_002452495.1|  hypothetical protein SORBIDRAFT_04g026900          178   7e-49   
ref|XP_008643435.1|  PREDICTED: hypothetical protein isoform X1         178   7e-49   
ref|XP_003572740.1|  PREDICTED: serine carboxypeptidase-like 34         178   1e-48   
ref|XP_010669643.1|  PREDICTED: serine carboxypeptidase-like 28         178   1e-48   
ref|XP_001785856.1|  predicted protein                                  177   1e-48   
gb|AFK36150.1|  unknown                                                 172   1e-48   
gb|EPS59460.1|  hypothetical protein M569_15347                         172   1e-48   
emb|CDY65614.1|  BnaCnng47980D                                          172   2e-48   
gb|EAY87844.1|  hypothetical protein OsI_09265                          177   2e-48   
ref|NP_001048377.1|  Os02g0794500                                       177   2e-48   
ref|XP_003593501.1|  Serine carboxypeptidase-like protein               177   3e-48   
ref|XP_010933315.1|  PREDICTED: serine carboxypeptidase-like 34         175   3e-48   
gb|KCW76300.1|  hypothetical protein EUGRSUZ_D00674                     170   4e-48   
ref|NP_001150705.1|  LOC100284338 precursor                             176   4e-48   
ref|XP_002452974.1|  hypothetical protein SORBIDRAFT_04g035810          176   4e-48   
ref|XP_004158226.1|  PREDICTED: serine carboxypeptidase-like 34-like    174   4e-48   
ref|XP_001772135.1|  predicted protein                                  175   5e-48   
ref|XP_010670278.1|  PREDICTED: serine carboxypeptidase-like 25         176   5e-48   
ref|XP_006648863.1|  PREDICTED: serine carboxypeptidase-like 34-like    175   6e-48   
ref|XP_010067797.1|  PREDICTED: serine carboxypeptidase-like 40 i...    173   6e-48   
ref|XP_006648043.1|  PREDICTED: serine carboxypeptidase 24-like         174   6e-48   
gb|EYU39589.1|  hypothetical protein MIMGU_mgv1a0101822mg               166   6e-48   
ref|XP_007223035.1|  hypothetical protein PRUPE_ppa005368mg             175   7e-48   
ref|XP_008461360.1|  PREDICTED: serine carboxypeptidase-like 34         175   1e-47   
dbj|BAJ85578.1|  predicted protein                                      175   1e-47   
gb|AFW85537.1|  hypothetical protein ZEAMMB73_208131                    174   1e-47   
ref|XP_010031922.1|  PREDICTED: serine carboxypeptidase-like 34         175   1e-47   
gb|ACU21427.1|  unknown                                                 169   1e-47   
ref|XP_001755195.1|  predicted protein                                  174   1e-47   
ref|XP_004135953.1|  PREDICTED: serine carboxypeptidase-like 34-like    174   2e-47   
gb|EMT14017.1|  Serine carboxypeptidase-like 34                         172   2e-47   
dbj|BAJ92218.1|  predicted protein                                      175   2e-47   
ref|XP_010054359.1|  PREDICTED: serine carboxypeptidase-like 31         171   2e-47   
ref|XP_002307165.1|  hypothetical protein POPTR_0005s09440g             174   2e-47   
ref|XP_006484531.1|  PREDICTED: serine carboxypeptidase-like 34-like    174   3e-47   
ref|XP_006437593.1|  hypothetical protein CICLE_v10031313mg             174   3e-47   
gb|EYU27945.1|  hypothetical protein MIMGU_mgv1a005674mg                174   4e-47   
gb|ABR16596.1|  unknown                                                 174   4e-47   
emb|CDO99728.1|  unnamed protein product                                173   4e-47   
ref|XP_009591368.1|  PREDICTED: serine carboxypeptidase-like 31 i...    173   5e-47   
ref|XP_004297735.1|  PREDICTED: serine carboxypeptidase-like 34         173   5e-47   
pdb|1GXS|B  Chain B, Crystal Structure Of Hydroxynitrile Lyase Fr...    164   6e-47   
ref|XP_009591367.1|  PREDICTED: serine carboxypeptidase-like 31 i...    173   6e-47   
ref|XP_010067796.1|  PREDICTED: serine carboxypeptidase-like 40 i...    173   8e-47   
ref|XP_011075284.1|  PREDICTED: serine carboxypeptidase-like 34         173   8e-47   
gb|KFK27639.1|  hypothetical protein AALP_AA8G409500                    173   9e-47   
ref|XP_006847851.1|  hypothetical protein AMTR_s00029p00066410          169   1e-46   
ref|XP_008803196.1|  PREDICTED: serine carboxypeptidase-like 34         171   1e-46   
gb|EMS66545.1|  Serine carboxypeptidase-like 34                         171   1e-46   
ref|XP_010278297.1|  PREDICTED: serine carboxypeptidase-like 31         172   1e-46   
ref|XP_010112534.1|  Serine carboxypeptidase-like 34                    172   1e-46   
ref|XP_010052354.1|  PREDICTED: serine carboxypeptidase-like 31         172   1e-46   
ref|XP_009800560.1|  PREDICTED: serine carboxypeptidase-like 31 i...    172   1e-46   
ref|XP_009800559.1|  PREDICTED: serine carboxypeptidase-like 31 i...    172   2e-46   
ref|XP_002521402.1|  serine carboxypeptidase, putative                  172   2e-46   
ref|XP_004954211.1|  PREDICTED: serine carboxypeptidase 24-like         172   2e-46   
ref|XP_002312023.1|  hypothetical protein POPTR_0008s04130g             171   2e-46   
ref|XP_008224993.1|  PREDICTED: serine carboxypeptidase-like 31         172   2e-46   
ref|XP_010918383.1|  PREDICTED: serine carboxypeptidase-like 34 i...    169   2e-46   
gb|AFK45951.1|  unknown                                                 166   3e-46   
ref|XP_006583804.1|  PREDICTED: serine carboxypeptidase-like 31-l...    171   3e-46   
ref|XP_001765233.1|  predicted protein                                  171   3e-46   
gb|KJB79850.1|  hypothetical protein B456_013G069700                    171   3e-46   
ref|XP_010533893.1|  PREDICTED: serine carboxypeptidase-like 31 i...    171   3e-46   
ref|XP_006590795.1|  PREDICTED: serine carboxypeptidase-like 34-like    171   3e-46   
gb|ABR16997.1|  unknown                                                 172   4e-46   
ref|XP_003529304.1|  PREDICTED: serine carboxypeptidase-like 31-l...    171   4e-46   
ref|XP_007131611.1|  hypothetical protein PHAVU_011G027900g             168   4e-46   
ref|XP_010533892.1|  PREDICTED: serine carboxypeptidase-like 31 i...    171   5e-46   
ref|XP_010533891.1|  PREDICTED: serine carboxypeptidase-like 31 i...    171   5e-46   
ref|XP_010274881.1|  PREDICTED: serine carboxypeptidase-like 34         171   5e-46   
ref|XP_011096266.1|  PREDICTED: serine carboxypeptidase-like 31         171   5e-46   
ref|XP_011031766.1|  PREDICTED: serine carboxypeptidase-like 27         170   6e-46   
ref|NP_197712.2|  serine carboxypeptidase-like 34                       169   7e-46   
ref|XP_010112533.1|  Serine carboxypeptidase-like 34                    170   7e-46   
gb|EYU33331.1|  hypothetical protein MIMGU_mgv1a025174mg                170   8e-46   
ref|XP_007148207.1|  hypothetical protein PHAVU_006G189100g             170   9e-46   
gb|KEH30582.1|  serine carboxypeptidase-like protein                    169   1e-45   
ref|XP_002465006.1|  hypothetical protein SORBIDRAFT_01g030370          169   1e-45   
ref|XP_003607259.1|  Serine carboxypeptidase-like protein               169   1e-45   
ref|XP_009379538.1|  PREDICTED: serine carboxypeptidase-like 31         169   1e-45   
ref|XP_002274699.1|  PREDICTED: serine carboxypeptidase-like 28         169   1e-45   
ref|XP_003537768.1|  PREDICTED: serine carboxypeptidase-like 34-like    169   1e-45   
emb|CBI31484.3|  unnamed protein product                                169   1e-45   
ref|XP_007043281.1|  Serine carboxypeptidase-like 34 isoform 1          169   2e-45   
ref|XP_010918382.1|  PREDICTED: serine carboxypeptidase-like 34 i...    169   2e-45   
ref|XP_003542771.1|  PREDICTED: serine carboxypeptidase-like 31-like    169   2e-45   
ref|XP_009130122.1|  PREDICTED: serine carboxypeptidase-like 34         169   2e-45   
emb|CDY46950.1|  BnaA02g32960D                                          169   2e-45   
ref|XP_010316720.1|  PREDICTED: serine carboxypeptidase-like 31         169   2e-45   
emb|CAN75418.1|  hypothetical protein VITISV_014880                     168   2e-45   
emb|CDY40802.1|  BnaC02g41710D                                          169   2e-45   
ref|XP_004505704.1|  PREDICTED: serine carboxypeptidase-like 34-like    169   2e-45   



>ref|XP_009789305.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana sylvestris]
Length=470

 Score =   306 bits (785),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 162/184 (88%), Gaps = 1/184 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTCT  FS+++ +LKR +R VG LRR YDPCTE+HS IYFNLPEVQ+ALHVH  NSSF+W
Sbjct  288  PTCTAKFSMLNHLLKRSNR-VGHLRRSYDPCTEQHSVIYFNLPEVQEALHVHKRNSSFKW  346

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
            V CS+EV   WKD P TVLDVY+ELI +GLRIWVFSGDTDAVIPVTSTRYSIDALKLPT+
Sbjct  347  VACSEEVSSGWKDSPKTVLDVYRELIQSGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTI  406

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
            SPWR WYD+GQVGGWTQEY+GLTFV VRGAGH+VALHRPK ALTLV+SFLAG SMP LQ+
Sbjct  407  SPWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVALHRPKQALTLVKSFLAGASMPSLQQ  466

Query  127  ISDS  116
            ISDS
Sbjct  467  ISDS  470



>ref|XP_009630744.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana tomentosiformis]
Length=470

 Score =   303 bits (777),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 161/183 (88%), Gaps = 1/183 (1%)
 Frame = -3

Query  664  TCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWV  485
            TCT  FSI++ +LKR +R VG LRR YDPCTE+HS IYFNLPEVQ+ALHVH  NSSF+WV
Sbjct  289  TCTAKFSILNHLLKRSNR-VGHLRRSYDPCTEQHSVIYFNLPEVQEALHVHKRNSSFKWV  347

Query  484  TCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVS  305
             CSDEV   WKD P TVLDVY+ELI +GLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV+
Sbjct  348  ACSDEVSSGWKDSPKTVLDVYRELIRSGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVA  407

Query  304  PWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQRI  125
            PWR WYD+GQVGGWTQEY+GLTFV VRGAGH+VALHRPK ALTLV+SFLAG+SMP L+ I
Sbjct  408  PWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVALHRPKQALTLVKSFLAGSSMPSLELI  467

Query  124  SDS  116
            SDS
Sbjct  468  SDS  470



>ref|XP_004242620.1| PREDICTED: serine carboxypeptidase II-2 [Solanum lycopersicum]
Length=465

 Score =   301 bits (770),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 159/184 (86%), Gaps = 1/184 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P CT  FSI++ +L R+   VG LRR YDPCTE+HS IYFNLPEVQ ALHVH  NSSF+W
Sbjct  283  PACTAKFSILNHLL-RKSNSVGHLRRSYDPCTEQHSKIYFNLPEVQSALHVHMRNSSFKW  341

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
            VTCS+EV   WKD P TVLDVY+ELI +GLRIWVFSGDTDAVIPVTSTRYSI+ALKLPTV
Sbjct  342  VTCSEEVSSGWKDSPNTVLDVYRELIKSGLRIWVFSGDTDAVIPVTSTRYSINALKLPTV  401

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
            +PWR WYD+GQVGGWTQEY+GLTFV VRGAGH+VALHRPK ALTLV+SFLAGTSMP L+ 
Sbjct  402  APWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVALHRPKQALTLVKSFLAGTSMPSLEL  461

Query  127  ISDS  116
            ISDS
Sbjct  462  ISDS  465



>ref|XP_006343604.1| PREDICTED: serine carboxypeptidase II-2-like [Solanum tuberosum]
Length=465

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 159/184 (86%), Gaps = 1/184 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P CT  FSI++ +L R+   +G LRR YDPCTE+HS IYFNLPEVQ ALHVH  NSSF+W
Sbjct  283  PACTAKFSILNHLL-RKSNSIGHLRRSYDPCTEQHSKIYFNLPEVQNALHVHKRNSSFKW  341

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
            VTCS+EV   WKD P +VLDVY+ELI +GLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV
Sbjct  342  VTCSEEVSSGWKDSPMSVLDVYRELIKSGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  401

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
            +PWR WYD+GQVGGWTQEY+GLTFV VRGAGH+VALHRPK ALTLV+SFLAGTSMP L+ 
Sbjct  402  APWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVALHRPKQALTLVKSFLAGTSMPSLEL  461

Query  127  ISDS  116
            ISDS
Sbjct  462  ISDS  465



>emb|CDP02851.1| unnamed protein product [Coffea canephora]
Length=472

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 160/184 (87%), Gaps = 1/184 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P CT +FS+M++ LKRR+ KVG LRR YDPCTE+HST+YFNLP+VQ ALHV+  ++SF+W
Sbjct  290  PACTANFSVMNQFLKRRN-KVGHLRRAYDPCTEQHSTVYFNLPKVQHALHVYNRSNSFKW  348

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD+VY+ WKD P +VL++Y EL+ AG+RIWVFSGDTDAV+PVTSTRYS+DALKL TV
Sbjct  349  ATCSDDVYNNWKDSPRSVLNIYHELLNAGIRIWVFSGDTDAVLPVTSTRYSLDALKLRTV  408

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
             PWRPWYD+GQVGGWTQ+YEGL FV VRGAGH+V LHRPK ALTL +SF++G S+P L++
Sbjct  409  GPWRPWYDDGQVGGWTQQYEGLNFVTVRGAGHEVPLHRPKQALTLFKSFISGNSLPQLEQ  468

Query  127  ISDS  116
            ISDS
Sbjct  469  ISDS  472



>gb|EYU34325.1| hypothetical protein MIMGU_mgv1a005646mg [Erythranthe guttata]
Length=476

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 158/184 (86%), Gaps = 1/184 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P CT + + +SR L R+  KVGLLRR YDPCTE HST+YFNLPEVQKALHVHT NSS +W
Sbjct  294  PACTANSTSLSR-LSRKKSKVGLLRRAYDPCTEEHSTVYFNLPEVQKALHVHTRNSSLKW  352

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCS+ V + W+D P +VL+VY+ELI +GLR+W+FSGDTDAVIPVTSTRY+IDALKLPTV
Sbjct  353  ETCSNTVNENWQDSPKSVLNVYRELIHSGLRVWIFSGDTDAVIPVTSTRYNIDALKLPTV  412

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
            SPWR WYD+GQVGGWTQEY+GLTFV VRGAGH+V LHRPK ALTLV+SFL+G SMP L+ 
Sbjct  413  SPWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVPLHRPKQALTLVKSFLSGISMPKLEL  472

Query  127  ISDS  116
            +SDS
Sbjct  473  VSDS  476



>ref|XP_011079368.1| PREDICTED: serine carboxypeptidase II-2 [Sesamum indicum]
Length=474

 Score =   282 bits (721),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 157/184 (85%), Gaps = 2/184 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P CT +FS +S   KR +RKVGLLRR YDPCTERHST+YFNLPEVQ A+HVH+ NS  +W
Sbjct  291  PPCTANFSRLSHPWKR-NRKVGLLRRAYDPCTERHSTVYFNLPEVQNAIHVHSKNSPLKW  349

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD V + WKD P +VL+VY+EL+ +G+RIW+FSGDTDAVIPVTSTRYSIDALKLPTV
Sbjct  350  ETCSDAVNENWKDSPRSVLNVYRELLHSGIRIWIFSGDTDAVIPVTSTRYSIDALKLPTV  409

Query  307  SPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQ  131
            SPWR WY D+GQVGGWTQEYEGLTFV VRGAGH+V LH+PK ALTL++S+L+G SMP L+
Sbjct  410  SPWRAWYDDDGQVGGWTQEYEGLTFVTVRGAGHEVPLHKPKQALTLIKSYLSGNSMPKLE  469

Query  130  RISD  119
             +SD
Sbjct  470  LVSD  473



>ref|XP_002275081.1| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
 emb|CBI36573.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 150/184 (82%), Gaps = 1/184 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C+      ++++KR  R VG +   YDPCTE+HS +Y+NLPEVQ+ALHV+T N+  +W
Sbjct  287  PPCSVKVGFSNQLMKRLIR-VGRISERYDPCTEQHSVVYYNLPEVQQALHVYTDNAPSKW  345

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSDEV   WKD P TVLDVY+ELI AGLRIW+FSGDTDA+IPVTSTRYS+DALKLPTV
Sbjct  346  ATCSDEVSATWKDSPKTVLDVYRELIHAGLRIWIFSGDTDAIIPVTSTRYSVDALKLPTV  405

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
             PWR WYD+GQVGGW+QEY GLTFV VRGAGH+V LH+PK ALTL+ +FL GTSMP L++
Sbjct  406  GPWRAWYDDGQVGGWSQEYAGLTFVTVRGAGHEVPLHKPKQALTLINAFLKGTSMPSLEQ  465

Query  127  ISDS  116
            ++DS
Sbjct  466  LADS  469



>ref|XP_007202013.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
 gb|EMJ03212.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
Length=473

 Score =   268 bits (685),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 150/183 (82%), Gaps = 1/183 (1%)
 Frame = -3

Query  664  TCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWV  485
             C  + S  +R+LKR   KVG +   YDPCTE HS +YFNLPEVQKALHV+  ++  +W 
Sbjct  292  ACPANVSQSNRLLKRM-HKVGRISEKYDPCTEAHSVVYFNLPEVQKALHVNPNHAPSKWA  350

Query  484  TCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVS  305
            TCSD VY  W+D P TVLDVY+ELI +GLRIW+FSGDTD+VIPVTSTRYSIDALKLPTV 
Sbjct  351  TCSDVVYTTWQDSPRTVLDVYKELIHSGLRIWMFSGDTDSVIPVTSTRYSIDALKLPTVK  410

Query  304  PWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQRI  125
            PWRPWYD+GQVGGWTQEY GLTFV+VRGAGH+V LH+PK ALTL+++FL+G+SMP  + +
Sbjct  411  PWRPWYDDGQVGGWTQEYAGLTFVSVRGAGHEVPLHKPKQALTLIKAFLSGSSMPSSELV  470

Query  124  SDS  116
            SDS
Sbjct  471  SDS  473



>emb|CAN75200.1| hypothetical protein VITISV_014887 [Vitis vinifera]
Length=524

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 152/190 (80%), Gaps = 1/190 (1%)
 Frame = -3

Query  685  PTASSPPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  506
            P +   P C+      ++++KR  R VG +   YDPCTE+HS +Y+NLPEVQ+ALHV+T 
Sbjct  336  PYSIFTPPCSVKVGFSNQLMKRLIR-VGRISERYDPCTEQHSVVYYNLPEVQQALHVYTD  394

Query  505  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  326
            N+  +W TCSDEV   WKD P TVLDVY+ELI AGLRIW+FSGDTDA+IPVTSTRYS+DA
Sbjct  395  NAPSKWATCSDEVSATWKDSPKTVLDVYRELIHAGLRIWIFSGDTDAIIPVTSTRYSVDA  454

Query  325  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  146
            LKLPTV PWR WYD+GQVGGW+QEY GLTFV VRGAGH+V LH+PK ALTL+ +FL GTS
Sbjct  455  LKLPTVGPWRAWYDDGQVGGWSQEYAGLTFVTVRGAGHEVPLHKPKQALTLINAFLKGTS  514

Query  145  MPGLQRISDS  116
            MP L++++DS
Sbjct  515  MPSLEQLADS  524



>ref|XP_004287151.1| PREDICTED: serine carboxypeptidase II-2 [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 151/190 (79%), Gaps = 1/190 (1%)
 Frame = -3

Query  685  PTASSPPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  506
            P +   P+C  + S  +R+LKR     G +   YDPCTE+H+ +YFNLPEVQKALHV   
Sbjct  282  PYSIYTPSCPANVSQSNRLLKRM-HVAGRINEKYDPCTEKHTVVYFNLPEVQKALHVDRH  340

Query  505  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  326
            ++  +W TCSD VY  WKD P TVLDVY+ELI +GLRIW+FSGDTDAVIPVTSTRYSID+
Sbjct  341  HAPSKWETCSDVVYTTWKDSPRTVLDVYRELIHSGLRIWMFSGDTDAVIPVTSTRYSIDS  400

Query  325  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  146
            LKLPTV PWR WYD GQVGGWTQEY GLTFV+VRGAGH+V LH+PKLAL L+++FL+G+S
Sbjct  401  LKLPTVKPWRAWYDEGQVGGWTQEYAGLTFVSVRGAGHEVPLHKPKLALALIKNFLSGSS  460

Query  145  MPGLQRISDS  116
            MP LQ +SDS
Sbjct  461  MPSLQLVSDS  470



>ref|XP_010273729.1| PREDICTED: serine carboxypeptidase II-2 [Nelumbo nucifera]
Length=485

 Score =   266 bits (679),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 147/184 (80%), Gaps = 2/184 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTCT + S+  R++KR   + G +   YDPCTE+HST+YFNLPEVQKALHVH   +  +W
Sbjct  304  PTCTSNSSLSHRLMKRL--RAGRISEKYDPCTEKHSTVYFNLPEVQKALHVHPEVAPTKW  361

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD V + WKD P TVLD+Y ELI AGLRIW+FSGDTDAVIPVTSTRYSIDALKLPT+
Sbjct  362  ETCSDVVNENWKDSPKTVLDIYHELIGAGLRIWIFSGDTDAVIPVTSTRYSIDALKLPTI  421

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
             PWR WYD GQVGGWTQ+Y GL FV+VRGAGH+V LH+PKLAL+L+++FL+G  MP L  
Sbjct  422  GPWRAWYDEGQVGGWTQQYVGLNFVSVRGAGHEVPLHKPKLALSLIKAFLSGRQMPTLTE  481

Query  127  ISDS  116
             SDS
Sbjct  482  YSDS  485



>ref|XP_007013884.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
 gb|EOY31503.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
Length=476

 Score =   265 bits (678),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 149/184 (81%), Gaps = 1/184 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C+ + S    +LKRR R VG +   YDPCTE+HS +YFNLPEVQKALHV    +  +W
Sbjct  294  PPCSANVSQSKWLLKRRLR-VGQVSDKYDPCTEKHSEVYFNLPEVQKALHVLPEVAPSKW  352

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD V   WKD P T+LDVY+ELI  GLRIW+FSGD DAVIPVTSTRYSIDALKLPTV
Sbjct  353  ETCSDIVSTNWKDSPRTMLDVYRELIHVGLRIWIFSGDADAVIPVTSTRYSIDALKLPTV  412

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
             PWR WYD+GQVGGWTQEY GL FV+VRGAGH+V LHRPKLALTLV++FL+GTSMPGL++
Sbjct  413  KPWRAWYDDGQVGGWTQEYAGLNFVSVRGAGHEVPLHRPKLALTLVKAFLSGTSMPGLEQ  472

Query  127  ISDS  116
            +SDS
Sbjct  473  VSDS  476



>ref|XP_008243035.1| PREDICTED: serine carboxypeptidase II-2 [Prunus mume]
Length=473

 Score =   265 bits (678),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 153/190 (81%), Gaps = 1/190 (1%)
 Frame = -3

Query  685  PTASSPPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  506
            P +   P C  + S  +R L+++  KVG +   YDPCTE HS +YFNLPEVQKALHV+  
Sbjct  285  PYSIYTPACPANVSQSNR-LQKQMHKVGRISEKYDPCTEAHSVVYFNLPEVQKALHVNPN  343

Query  505  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  326
            ++  +W TCSD VY  W+D P TVLDVY+ELI +GLRIW+FSGDTD+VIPVTSTRYSIDA
Sbjct  344  HAPSKWATCSDVVYTTWQDSPRTVLDVYKELIHSGLRIWMFSGDTDSVIPVTSTRYSIDA  403

Query  325  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  146
            LKLPTV PWRPWY++GQVGGWTQEY GLTFV+VRGAGH+V LH+PK ALTL+++FL+G+S
Sbjct  404  LKLPTVKPWRPWYEDGQVGGWTQEYAGLTFVSVRGAGHEVPLHKPKQALTLIKAFLSGSS  463

Query  145  MPGLQRISDS  116
            MP  + +SDS
Sbjct  464  MPSSELVSDS  473



>ref|XP_010111113.1| Serine carboxypeptidase-like 29 [Morus notabilis]
 gb|EXC30159.1| Serine carboxypeptidase-like 29 [Morus notabilis]
Length=495

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 150/190 (79%), Gaps = 1/190 (1%)
 Frame = -3

Query  685  PTASSPPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  506
            P +   P C  + S  +++LKR    VG + + YDPCTE+HST+YFN PEVQ+ALHV   
Sbjct  307  PYSIYTPPCHANDSQSNQLLKRM-HMVGRISQKYDPCTEKHSTVYFNQPEVQRALHVDPD  365

Query  505  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  326
            ++  +W TCSD VY  WKD PTTVLD+Y ELI + LRIWVFSGDTDAVIP+TSTRYSIDA
Sbjct  366  HAPSKWDTCSDLVYSTWKDSPTTVLDIYHELIHSSLRIWVFSGDTDAVIPITSTRYSIDA  425

Query  325  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  146
            LKLPTV PWR WYD+G+VGGWTQEYEGLTFV+VRGAGH+V LH+PK ALTL++SFL+G  
Sbjct  426  LKLPTVCPWRAWYDDGEVGGWTQEYEGLTFVSVRGAGHEVPLHKPKQALTLIKSFLSGLP  485

Query  145  MPGLQRISDS  116
            MP L  +SDS
Sbjct  486  MPNLNLVSDS  495



>ref|XP_011018073.1| PREDICTED: serine carboxypeptidase II-2-like [Populus euphratica]
Length=371

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 145/184 (79%), Gaps = 1/184 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P+C+ + S  S +L +R  +VG +   YDPCTE HST+YFNLPEVQKALHV    +   W
Sbjct  189  PSCSANVS-QSNLLPKRKHRVGRVSEKYDPCTETHSTVYFNLPEVQKALHVSPEFAPARW  247

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCS+ V   WKD P TVLD+Y+ELI +GL +WVFSGDTDAVIPVTSTRYSIDALKLPTV
Sbjct  248  ETCSEVVNINWKDSPRTVLDIYKELIRSGLHLWVFSGDTDAVIPVTSTRYSIDALKLPTV  307

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
             PW  WYD+GQVGGWTQEY GLTFV VRGAGH+V LH+PK ALTLV++FL+GT MP LQ 
Sbjct  308  KPWGAWYDDGQVGGWTQEYAGLTFVVVRGAGHEVPLHKPKQALTLVKAFLSGTPMPTLQL  367

Query  127  ISDS  116
            +SDS
Sbjct  368  VSDS  371



>ref|XP_011018071.1| PREDICTED: serine carboxypeptidase II-2-like isoform X1 [Populus 
euphratica]
Length=478

 Score =   257 bits (657),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 145/184 (79%), Gaps = 1/184 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P+C+ + S  S +L +R  +VG +   YDPCTE HST+YFNLPEVQKALHV    +   W
Sbjct  296  PSCSANVS-QSNLLPKRKHRVGRVSEKYDPCTETHSTVYFNLPEVQKALHVSPEFAPARW  354

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCS+ V   WKD P TVLD+Y+ELI +GL +WVFSGDTDAVIPVTSTRYSIDALKLPTV
Sbjct  355  ETCSEVVNINWKDSPRTVLDIYKELIRSGLHLWVFSGDTDAVIPVTSTRYSIDALKLPTV  414

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
             PW  WYD+GQVGGWTQEY GLTFV VRGAGH+V LH+PK ALTLV++FL+GT MP LQ 
Sbjct  415  KPWGAWYDDGQVGGWTQEYAGLTFVVVRGAGHEVPLHKPKQALTLVKAFLSGTPMPTLQL  474

Query  127  ISDS  116
            +SDS
Sbjct  475  VSDS  478



>emb|CBI36578.3| unnamed protein product [Vitis vinifera]
Length=470

 Score =   257 bits (656),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 148/184 (80%), Gaps = 1/184 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C+      ++++K+     G+ R+ YDPCTE+HS +Y+NLPEVQ+ALHV+  N++F+W
Sbjct  288  PPCSVKIGFSNQLMKKLIMASGISRK-YDPCTEQHSAVYYNLPEVQQALHVYVDNATFKW  346

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSDEV   WKD P +VL++Y+ELI A LRIW+FSGDTDAVIPVTSTRYSIDALKLPTV
Sbjct  347  ATCSDEVSTTWKDSPRSVLNIYRELIHARLRIWIFSGDTDAVIPVTSTRYSIDALKLPTV  406

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
            SPWR WYD+GQVGGWTQ+Y GLTFV VRGAGH+V LH+PK A TL ++FL+G  MP +++
Sbjct  407  SPWRAWYDDGQVGGWTQDYAGLTFVTVRGAGHEVPLHKPKQAFTLFKAFLSGAPMPYMEQ  466

Query  127  ISDS  116
            +S S
Sbjct  467  VSYS  470



>ref|XP_002273324.2| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
Length=510

 Score =   257 bits (656),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 148/184 (80%), Gaps = 1/184 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C+      ++++K+     G+ R+ YDPCTE+HS +Y+NLPEVQ+ALHV+  N++F+W
Sbjct  328  PPCSVKIGFSNQLMKKLIMASGISRK-YDPCTEQHSAVYYNLPEVQQALHVYVDNATFKW  386

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSDEV   WKD P +VL++Y+ELI A LRIW+FSGDTDAVIPVTSTRYSIDALKLPTV
Sbjct  387  ATCSDEVSTTWKDSPRSVLNIYRELIHARLRIWIFSGDTDAVIPVTSTRYSIDALKLPTV  446

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
            SPWR WYD+GQVGGWTQ+Y GLTFV VRGAGH+V LH+PK A TL ++FL+G  MP +++
Sbjct  447  SPWRAWYDDGQVGGWTQDYAGLTFVTVRGAGHEVPLHKPKQAFTLFKAFLSGAPMPYMEQ  506

Query  127  ISDS  116
            +S S
Sbjct  507  VSYS  510



>ref|XP_009358402.1| PREDICTED: serine carboxypeptidase II-2 [Pyrus x bretschneideri]
Length=482

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 145/181 (80%), Gaps = 1/181 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P+C  + S  S  L++R   VG + + YDPCTE HS +YFNLPEVQKALHV   ++  +W
Sbjct  291  PSCPANVS-QSNGLRKRRNTVGHISQKYDPCTEAHSVVYFNLPEVQKALHVDPDHAPSKW  349

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD V   WKD P TVLDVY+ELI +GLRIW+FSGD DAVIP+TSTRYSIDALKLPTV
Sbjct  350  ATCSDVVSMTWKDSPRTVLDVYKELIHSGLRIWMFSGDNDAVIPITSTRYSIDALKLPTV  409

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
             PWR WYD+GQVGGWTQEY GLTFV+VRGAGH+V LH+PK ALTL++SFL+G+SMP  ++
Sbjct  410  KPWRAWYDDGQVGGWTQEYAGLTFVSVRGAGHEVPLHKPKQALTLIKSFLSGSSMPASEQ  469

Query  127  I  125
            +
Sbjct  470  L  470



>ref|XP_006453577.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66817.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=474

 Score =   255 bits (652),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 144/184 (78%), Gaps = 1/184 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P+CT S S  +R+LKR    VG     YDPCTE+HS +YFN PEVQKALHV    +  +W
Sbjct  290  PSCTASVSQSNRLLKRM-HVVGHASEKYDPCTEKHSVVYFNQPEVQKALHVIPAVAPAKW  348

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCS  V + W D P TVLD+Y+ELI +GLRIW+FSGDTDAVIPVTSTRYSIDAL LPTV
Sbjct  349  ETCSGVVNNNWLDSPRTVLDIYRELIHSGLRIWMFSGDTDAVIPVTSTRYSIDALNLPTV  408

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
             PWR WYD+GQVGGWTQEY GLTFV VRGAGH+V LHRPK ALTL++SFL+G SMP L+R
Sbjct  409  KPWRAWYDDGQVGGWTQEYAGLTFVTVRGAGHEVPLHRPKPALTLIKSFLSGRSMPCLER  468

Query  127  ISDS  116
            +S S
Sbjct  469  VSHS  472



>gb|EPS71160.1| hypothetical protein M569_03591, partial [Genlisea aurea]
Length=441

 Score =   254 bits (649),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 146/180 (81%), Gaps = 2/180 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C  +FS  +R+ +++  + G+LRR YDPCTE HST YFNLPEVQ ALH+ + NS  +W
Sbjct  264  PPCRTNFSRPNRLDRKKVCRFGILRRQYDPCTEEHSTAYFNLPEVQDALHIRSKNS--QW  321

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD V + WKD P++VL+VY++L  AGLRIW FSGDTD+VIPV STRYSI+AL+LPTV
Sbjct  322  ETCSDLVNENWKDSPSSVLNVYRKLFPAGLRIWFFSGDTDSVIPVASTRYSINALRLPTV  381

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
            SPWR WY++GQVGGWT+EYEGLT V VRGAGH+VALH+PKL+LTLV+SFL G  MP L+ 
Sbjct  382  SPWRAWYNDGQVGGWTEEYEGLTLVTVRGAGHEVALHKPKLSLTLVDSFLRGNPMPKLEE  441



>gb|KDP38717.1| hypothetical protein JCGZ_04070 [Jatropha curcas]
Length=478

 Score =   255 bits (651),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 144/184 (78%), Gaps = 1/184 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P CT + S  +R+LK+R R VG + + YDPCTE HST+YFNLPEVQKALHV       +W
Sbjct  296  PPCTTNSSGSNRLLKKRHR-VGHVSKKYDPCTEAHSTVYFNLPEVQKALHVSPEFLPSKW  354

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD V + WKD P TVL++Y ELI +GLRIW+FSGDTDAVIPVTSTRYSIDALKLPT 
Sbjct  355  ETCSDLVNENWKDSPRTVLNIYHELIHSGLRIWMFSGDTDAVIPVTSTRYSIDALKLPTT  414

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
             PW  WYD+GQVGGWTQEY GL FV VRGAGH+V LHRPKLAL L+++FL+G SMP  + 
Sbjct  415  KPWHAWYDDGQVGGWTQEYAGLNFVVVRGAGHEVPLHRPKLALALIKTFLSGVSMPTHEL  474

Query  127  ISDS  116
            +S S
Sbjct  475  VSAS  478



>gb|AFK34001.1| unknown [Medicago truncatula]
Length=239

 Score =   246 bits (629),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 136/166 (82%), Gaps = 0/166 (0%)
 Frame = -3

Query  628  LKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKD  449
            L +R    G LR +YDPCTE+HS IYFN PEVQ+ALHV   +   +W TCSD V   WKD
Sbjct  66   LDKRKHSFGRLRSVYDPCTEKHSIIYFNRPEVQRALHVDPDHKPDKWQTCSDVVGTNWKD  125

Query  448  CPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVG  269
             PT+VL++Y+ELI  GLRIW+FSG+TDAVIPV STRYSI+ALKLPT+SPWR WYD+G+VG
Sbjct  126  SPTSVLNIYRELIPTGLRIWIFSGNTDAVIPVASTRYSINALKLPTLSPWRAWYDDGEVG  185

Query  268  GWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQ  131
            GWTQEY GLTFV VRGAGH+V LHRPKLALTL+++FL GTSMP L+
Sbjct  186  GWTQEYAGLTFVNVRGAGHEVPLHRPKLALTLIKAFLEGTSMPTLE  231



>ref|XP_008394291.1| PREDICTED: serine carboxypeptidase II-2 [Malus domestica]
Length=482

 Score =   254 bits (649),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 144/181 (80%), Gaps = 1/181 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P+C  + S  S  L++R   VG + + YDPCTE HS +YFNLPEVQKALH    ++  +W
Sbjct  291  PSCPANVS-QSNGLRKRRNTVGHISQKYDPCTEAHSVVYFNLPEVQKALHXDPGHAPSKW  349

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD V   WKD P TVLDVY+ELI +GLRIW+FSGD DAVIP+TSTRYSIDALKLPTV
Sbjct  350  ATCSDVVSMTWKDSPRTVLDVYKELIHSGLRIWMFSGDNDAVIPITSTRYSIDALKLPTV  409

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
             PWR WYD+GQVGGWTQEY GLTFV+VRGAGH+V LH+PK ALTL++SFL+G+SMP  ++
Sbjct  410  KPWRAWYDDGQVGGWTQEYAGLTFVSVRGAGHEVPLHKPKQALTLIKSFLSGSSMPASEQ  469

Query  127  I  125
            +
Sbjct  470  L  470



>ref|XP_007138291.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
 gb|ESW10285.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
Length=472

 Score =   254 bits (648),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 146/186 (78%), Gaps = 3/186 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDR--KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSF  494
            P C  + S +SR+++R++R  ++GL    YDPCTERHS +YFN PEVQ ALHV   +   
Sbjct  288  PPCHANVSQLSRLVRRKNRIGRLGLSTE-YDPCTERHSIVYFNRPEVQTALHVDLDHKPA  346

Query  493  EWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLP  314
             W TCSD VY  WKD P +VLD+Y ELI  GL+IWVFSG+TD VIPVTSTRYSI ALKLP
Sbjct  347  TWETCSDVVYTNWKDSPRSVLDIYHELIGMGLKIWVFSGNTDVVIPVTSTRYSISALKLP  406

Query  313  TVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGL  134
            T+SPWR WYD+G+VGGWTQEY GLTFV VRGAGH+V LH+PKLALTLV++FLAGTSMP L
Sbjct  407  TLSPWRAWYDDGEVGGWTQEYAGLTFVIVRGAGHEVPLHKPKLALTLVQTFLAGTSMPNL  466

Query  133  QRISDS  116
              +S S
Sbjct  467  DLLSTS  472



>ref|XP_006474032.1| PREDICTED: serine carboxypeptidase-like 29-like [Citrus sinensis]
Length=474

 Score =   254 bits (648),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 143/184 (78%), Gaps = 1/184 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P+CT S S  +R+LKR    VG     YDPCTE+HS +YFN PEVQKALHV    +  +W
Sbjct  290  PSCTASVSQSNRLLKRM-HVVGHPSEKYDPCTEKHSVVYFNQPEVQKALHVIPAVAPAKW  348

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCS  V + W D P TVLD+Y+ELI +GLRIW+FSGDTDAVIPVTSTRYSIDAL LPTV
Sbjct  349  ETCSGVVNNNWLDSPRTVLDIYRELIHSGLRIWMFSGDTDAVIPVTSTRYSIDALNLPTV  408

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
             PWR WYD GQVGGWTQEY GLTFV VRGAGH+V LHRPK ALTL++SFL+G SMP L+R
Sbjct  409  KPWRAWYDEGQVGGWTQEYSGLTFVTVRGAGHEVPLHRPKPALTLIKSFLSGRSMPCLKR  468

Query  127  ISDS  116
            +S S
Sbjct  469  VSHS  472



>ref|XP_002528403.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF33996.1| serine carboxypeptidase, putative [Ricinus communis]
Length=480

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 145/190 (76%), Gaps = 1/190 (1%)
 Frame = -3

Query  685  PTASSPPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  506
            P +   P CT + S  +R+LK    KVG +   YDPCTE HST+YFNLPEVQKALHV   
Sbjct  292  PYSIYTPPCTANVSGSNRLLKTM-HKVGRVYEKYDPCTEAHSTVYFNLPEVQKALHVSKE  350

Query  505  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  326
             +  +W TCSD V + WKD P TVLD+Y ELI +G+RIWVFSGDTDAVIPVTSTRYSIDA
Sbjct  351  FAPSKWETCSDLVNNNWKDSPRTVLDIYHELIHSGIRIWVFSGDTDAVIPVTSTRYSIDA  410

Query  325  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  146
            LKL T  PW  WYD+ QVGGWTQEY GL FV VRGAGH+V LHRPKLALTL+++FL+GTS
Sbjct  411  LKLRTTKPWHAWYDDRQVGGWTQEYAGLAFVVVRGAGHEVPLHRPKLALTLIKAFLSGTS  470

Query  145  MPGLQRISDS  116
            MP L+ +S S
Sbjct  471  MPTLEPVSSS  480



>ref|XP_010687643.1| PREDICTED: serine carboxypeptidase II-2 [Beta vulgaris subsp. 
vulgaris]
Length=475

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 149/190 (78%), Gaps = 3/190 (2%)
 Frame = -3

Query  685  PTASSPPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  506
            P +   P+CT + S+ +++LKR    +G L   YDPC+E+HS +YFN PEVQ+ALHV+  
Sbjct  289  PYSIYTPSCTTNSSLPNKLLKRL---IGHLNEAYDPCSEKHSVVYFNQPEVQQALHVNPQ  345

Query  505  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  326
             +  +W TCS  V   W+D   +VLD+Y EL+ AGLRIW+FSGDTDAVIPVTSTRY+IDA
Sbjct  346  FAPVKWETCSGLVNSNWQDSSRSVLDIYHELMDAGLRIWMFSGDTDAVIPVTSTRYNIDA  405

Query  325  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  146
            LKLPT+ PW  WYD+GQVGGWTQEY+GLTFV VRGAGH+V LHR KL+LTLV+SFLAG S
Sbjct  406  LKLPTIKPWHAWYDDGQVGGWTQEYKGLTFVVVRGAGHEVPLHRAKLSLTLVKSFLAGES  465

Query  145  MPGLQRISDS  116
            MP L+++SDS
Sbjct  466  MPTLEQVSDS  475



>gb|KEH38195.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=441

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = -3

Query  622  RRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCP  443
            +R   VG LR +YDPCTE+HSTIYFN PEVQ+ LHV       +W TCS  V   WKD P
Sbjct  272  KRKNSVGRLRGVYDPCTEKHSTIYFNRPEVQRILHVDPDYKPAKWETCSTVVNTNWKDSP  331

Query  442  TTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGW  263
             TVLD+Y+ELI  GLRIW+FSG+TDAVIPVTSTRY+I+ALKLPTVSPWR WYD+G+VGGW
Sbjct  332  RTVLDIYRELIPTGLRIWIFSGNTDAVIPVTSTRYTINALKLPTVSPWRAWYDDGEVGGW  391

Query  262  TQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQRIS  122
            TQEY GLTFV VRGAGH+V LHRPKLALTL+++FLAGTSMP L+ ++
Sbjct  392  TQEYAGLTFVNVRGAGHEVPLHRPKLALTLIKAFLAGTSMPTLEPLT  438



>ref|XP_003595892.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|AES66143.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=472

 Score =   249 bits (637),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = -3

Query  622  RRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCP  443
            +R   VG LR +YDPCTE+HSTIYFN PEVQ+ LHV       +W TCS  V   WKD P
Sbjct  303  KRKNSVGRLRGVYDPCTEKHSTIYFNRPEVQRILHVDPDYKPAKWETCSTVVNTNWKDSP  362

Query  442  TTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGW  263
             TVLD+Y+ELI  GLRIW+FSG+TDAVIPVTSTRY+I+ALKLPTVSPWR WYD+G+VGGW
Sbjct  363  RTVLDIYRELIPTGLRIWIFSGNTDAVIPVTSTRYTINALKLPTVSPWRAWYDDGEVGGW  422

Query  262  TQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQRIS  122
            TQEY GLTFV VRGAGH+V LHRPKLALTL+++FLAGTSMP L+ ++
Sbjct  423  TQEYAGLTFVNVRGAGHEVPLHRPKLALTLIKAFLAGTSMPTLEPLT  469



>gb|KHN02055.1| Serine carboxypeptidase II-2 [Glycine soja]
Length=469

 Score =   249 bits (635),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 142/186 (76%), Gaps = 1/186 (1%)
 Frame = -3

Query  673  SPPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSF  494
            +PP    + S +SR+++R+ R +G L   YDPCTE+HS +YFN P+VQ  LHV   +   
Sbjct  285  TPPCQHANVSQLSRLVRRKHR-IGRLSAEYDPCTEKHSIVYFNRPDVQTVLHVDPDHKPA  343

Query  493  EWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLP  314
             W TCSDEV+  WKD P TVL++Y ELI  GLRIWVFSG+TD VIPVTSTRYSI AL LP
Sbjct  344  TWETCSDEVFTNWKDSPRTVLNIYHELIQMGLRIWVFSGNTDVVIPVTSTRYSIKALDLP  403

Query  313  TVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGL  134
            TVSPWR WYD+G+VGGWTQEY GLTFV VRGAGH+V LH PKLALTL ++FLAGTSMP L
Sbjct  404  TVSPWRAWYDDGEVGGWTQEYAGLTFVVVRGAGHEVPLHSPKLALTLFKAFLAGTSMPNL  463

Query  133  QRISDS  116
            + +  S
Sbjct  464  ELVGAS  469



>ref|XP_009410194.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=473

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 143/190 (75%), Gaps = 0/190 (0%)
 Frame = -3

Query  685  PTASSPPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  506
            P +   P+C  S +     L +R   VG +   YDPCTE+HST+YFNLPEVQKALH++  
Sbjct  284  PYSIFTPSCPGSVTFSKNKLLKRRHSVGSIGEKYDPCTEQHSTVYFNLPEVQKALHINPA  343

Query  505  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  326
             +  +W TCSD V + WKD   +VL +Y ELI  GLRIW+FSGDTDAVIPVTSTRY+ID+
Sbjct  344  FAPSKWETCSDVVNENWKDSARSVLHIYHELIGYGLRIWMFSGDTDAVIPVTSTRYNIDS  403

Query  325  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  146
            LKLPTV+PW PWYD+GQVGGWTQ Y+GLTFV VRGAGH+V LH+PKLAL L +SFL+G+S
Sbjct  404  LKLPTVTPWHPWYDDGQVGGWTQVYKGLTFVTVRGAGHEVPLHQPKLALVLFKSFLSGSS  463

Query  145  MPGLQRISDS  116
            MP    + DS
Sbjct  464  MPTFTGLDDS  473



>ref|XP_003595890.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|ACJ85268.1| unknown [Medicago truncatula]
 gb|AES66141.1| serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AFK36219.1| unknown [Medicago truncatula]
Length=473

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 136/166 (82%), Gaps = 0/166 (0%)
 Frame = -3

Query  628  LKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKD  449
            L +R    G LR +YDPCTE+HS IYFN PEVQ+ALHV   +   +W TCSD V   WKD
Sbjct  300  LDKRKHSFGRLRSVYDPCTEKHSIIYFNRPEVQRALHVDPDHKPDKWQTCSDVVGTNWKD  359

Query  448  CPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVG  269
             PT+VL++Y+ELI  GLRIW+FSG+TDAVIPV STRYSI+ALKLPT+SPWR WYD+G+VG
Sbjct  360  SPTSVLNIYRELIPTGLRIWIFSGNTDAVIPVASTRYSINALKLPTLSPWRAWYDDGEVG  419

Query  268  GWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQ  131
            GWTQEY GLTFV VRGAGH+V LHRPKLALTL+++FL GTSMP L+
Sbjct  420  GWTQEYAGLTFVNVRGAGHEVPLHRPKLALTLIKAFLEGTSMPTLE  465



>ref|XP_003522937.2| PREDICTED: serine carboxypeptidase II-2-like [Glycine max]
Length=483

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 142/186 (76%), Gaps = 1/186 (1%)
 Frame = -3

Query  673  SPPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSF  494
            +PP    + S +SR+++R+ R +G L   YDPCTE+HS +YFN P+VQ  LHV   +   
Sbjct  299  TPPCQHANVSQLSRLVRRKHR-IGRLSAEYDPCTEKHSIVYFNRPDVQTVLHVDPDHKPA  357

Query  493  EWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLP  314
             W TCSDEV+  WKD P TVL++Y ELI  GLRIWVFSG+TD VIPVTSTRYSI AL LP
Sbjct  358  TWETCSDEVFTNWKDSPRTVLNIYHELIQMGLRIWVFSGNTDVVIPVTSTRYSIKALDLP  417

Query  313  TVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGL  134
            TVSPWR WYD+G+VGGWTQEY GLTFV VRGAGH+V LH PKLALTL ++FLAGTSMP L
Sbjct  418  TVSPWRAWYDDGEVGGWTQEYAGLTFVVVRGAGHEVPLHSPKLALTLFKAFLAGTSMPNL  477

Query  133  QRISDS  116
            + +  S
Sbjct  478  ELVGAS  483



>ref|XP_003595891.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES66142.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=473

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 139/179 (78%), Gaps = 4/179 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C E+         RR    G LR +YDPCTE HS IYFN PEVQ+ALHV+  +   +W
Sbjct  291  PPCHEN----DNQPDRRKHSFGRLRGVYDPCTENHSNIYFNRPEVQRALHVNPDHKPDKW  346

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD V   WKD P +VL++Y+ELI  GLRIW+FSG+TDA+IPVTSTRYSI+ALKLPTV
Sbjct  347  QTCSDVVGTNWKDSPRSVLNIYRELIPTGLRIWIFSGNTDAIIPVTSTRYSINALKLPTV  406

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQ  131
            SPWR WYD+G+VGGWTQEY GLTFV VRGAGH+V LHRPKLALTL+++FL GTSMP L+
Sbjct  407  SPWRAWYDDGEVGGWTQEYAGLTFVNVRGAGHEVPLHRPKLALTLIKAFLEGTSMPTLE  465



>ref|XP_008790132.1| PREDICTED: serine carboxypeptidase II-2 isoform X1 [Phoenix dactylifera]
Length=473

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 145/203 (71%), Gaps = 2/203 (1%)
 Frame = -3

Query  718  ILLVTS*EISI--PTASSPPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  545
            IL V S E+    P +   P+C  S +     L +R    G     YDPCTE+HST+YFN
Sbjct  271  ILDVASNELGNIDPYSIFTPSCPGSVTFSKNKLLKRLHSFGRAGEKYDPCTEKHSTVYFN  330

Query  544  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  365
            LPEVQKALHV+   +  +W TCSD V + WKDCP +VL +Y ELI  GLRIW+FSGDTDA
Sbjct  331  LPEVQKALHVNPAVAPSKWETCSDIVNENWKDCPRSVLHIYHELIQYGLRIWMFSGDTDA  390

Query  364  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKL  185
            VIPV STRYS+D+LKLPTV+PW  WYD+GQVGGWTQ Y+GLTFV VRGAGH+V LHRPK 
Sbjct  391  VIPVASTRYSVDSLKLPTVTPWHAWYDDGQVGGWTQVYKGLTFVTVRGAGHEVPLHRPKQ  450

Query  184  ALTLVESFLAGTSMPGLQRISDS  116
            AL L +SFL+G+ MP L    DS
Sbjct  451  ALVLFKSFLSGSPMPTLSEFDDS  473



>gb|KHG11306.1| Serine carboxypeptidase-like 29 [Gossypium arboreum]
Length=487

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 139/177 (79%), Gaps = 1/177 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P+C+ + S    +LKRR   V  L   YDPCTE+HS +YFNLPEVQK+LHV    +  +W
Sbjct  294  PSCSANASQTKWLLKRR-LMVSQLSEKYDPCTEKHSEVYFNLPEVQKSLHVLPEAAPSKW  352

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD V   WKD P T+LDVY+ELI  GLRIW+FSGDTDAVIP+TSTRYSIDALKL T+
Sbjct  353  ETCSDIVNTNWKDSPITMLDVYRELIHEGLRIWIFSGDTDAVIPITSTRYSIDALKLATM  412

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPG  137
             PWR WYD+GQVGGWTQEYEGL FV+VRGAGH+V LHRPK ALTL ++FL+GTSMP 
Sbjct  413  KPWRAWYDDGQVGGWTQEYEGLKFVSVRGAGHEVPLHRPKQALTLFKAFLSGTSMPA  469



>ref|XP_010040844.1| PREDICTED: serine carboxypeptidase II-2-like [Eucalyptus grandis]
 gb|KCW44872.1| hypothetical protein EUGRSUZ_L01547 [Eucalyptus grandis]
Length=473

 Score =   247 bits (631),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 146/190 (77%), Gaps = 1/190 (1%)
 Frame = -3

Query  685  PTASSPPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  506
            P +   P C  + S  +R L++R + +G +   YDPCTE HS  YFN  EVQ ALHV+  
Sbjct  285  PYSIYTPLCPVNGSQSNR-LRKRMKVIGHVNEKYDPCTEEHSVKYFNRAEVQTALHVNKA  343

Query  505  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  326
             +  +W TCSD V + WKD P TVLD+Y+EL+  GLRIW+FSGDTDAVIPVTSTRY+ID+
Sbjct  344  FAPAKWDTCSDLVNENWKDAPRTVLDIYRELMREGLRIWMFSGDTDAVIPVTSTRYTIDS  403

Query  325  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  146
            LKLPTV P+R WYD+G VGGWTQEY GLTFV+VRGAGH+V LHRPKLAL L+++FLAGTS
Sbjct  404  LKLPTVKPFRAWYDDGTVGGWTQEYAGLTFVSVRGAGHEVPLHRPKLALALIKAFLAGTS  463

Query  145  MPGLQRISDS  116
            MP LQ +SDS
Sbjct  464  MPSLQLVSDS  473



>ref|XP_010048771.1| PREDICTED: serine carboxypeptidase II-2 [Eucalyptus grandis]
 gb|KCW81143.1| hypothetical protein EUGRSUZ_C02514 [Eucalyptus grandis]
Length=473

 Score =   247 bits (631),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 146/190 (77%), Gaps = 1/190 (1%)
 Frame = -3

Query  685  PTASSPPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  506
            P +   P C  + S  +R L++R + +G +   YDPCTE HS  YFN  EVQ ALHV+  
Sbjct  285  PYSIYTPLCPVNGSQSNR-LRKRMKVIGHVNEKYDPCTEEHSVKYFNRAEVQTALHVNKA  343

Query  505  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  326
             +  +W TCSD V + WKD P TVLD+Y+EL+  GLRIW+FSGDTDAVIPVTSTRY+ID+
Sbjct  344  FAPAKWDTCSDLVSENWKDAPRTVLDIYRELMREGLRIWMFSGDTDAVIPVTSTRYTIDS  403

Query  325  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  146
            LKLPTV P+R WYD+G VGGWTQEY GLTFV+VRGAGH+V LHRPKLAL L+++FLAGTS
Sbjct  404  LKLPTVKPFRAWYDDGTVGGWTQEYAGLTFVSVRGAGHEVPLHRPKLALALIKAFLAGTS  463

Query  145  MPGLQRISDS  116
            MP LQ +SDS
Sbjct  464  MPSLQLVSDS  473



>ref|XP_010905043.1| PREDICTED: serine carboxypeptidase II-2 [Elaeis guineensis]
Length=471

 Score =   247 bits (630),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 146/203 (72%), Gaps = 2/203 (1%)
 Frame = -3

Query  718  ILLVTS*EISI--PTASSPPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  545
            IL V S E+    P +   P+C  + +     L +R    G +   YDPCTE+HSTIYFN
Sbjct  269  ILDVASNELGTIDPYSILTPSCPGTVTFSKNKLLKRLHSFGRVGEKYDPCTEKHSTIYFN  328

Query  544  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  365
            LPEVQKALHV+   +  EW TCSD V + WKD P +VL +Y ELI  GLRIW+FSGDTDA
Sbjct  329  LPEVQKALHVNPVVAPSEWETCSDVVNENWKDSPRSVLHIYHELIHYGLRIWMFSGDTDA  388

Query  364  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKL  185
            VIPVTSTRY++D+LKLPTV+PW  WYD+GQVGGWTQ Y+GLTFV VRGAGH+V LHRPK 
Sbjct  389  VIPVTSTRYNVDSLKLPTVTPWHAWYDDGQVGGWTQVYKGLTFVTVRGAGHEVPLHRPKQ  448

Query  184  ALTLVESFLAGTSMPGLQRISDS  116
            AL L +SFL+G+ MP L    DS
Sbjct  449  ALVLFKSFLSGSPMPTLSEFVDS  471



>ref|XP_002324616.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
 gb|EEF03181.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
Length=466

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = -3

Query  613  RKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTV  434
             +VG +   YDPCTE H+T+YFNLPEVQKALHV    +   W TCS+ V   WKD P TV
Sbjct  301  NRVGRVSEKYDPCTETHTTVYFNLPEVQKALHVSPEFAPARWETCSEVVNINWKDSPRTV  360

Query  433  LDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQE  254
            LD+Y+ELI +GL +WVFSGDTDAVIPVTSTRYSIDALKLPTV PW  WYD+GQVGGWTQE
Sbjct  361  LDIYKELIHSGLHVWVFSGDTDAVIPVTSTRYSIDALKLPTVKPWGAWYDDGQVGGWTQE  420

Query  253  YEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQRISDS  116
            Y GLTFV VRGAGH+V LH+PK ALTLV++FL+GT MP LQ +SDS
Sbjct  421  YAGLTFVVVRGAGHEVPLHKPKQALTLVKAFLSGTPMPTLQLVSDS  466



>ref|XP_004964646.1| PREDICTED: serine carboxypeptidase II-2-like [Setaria italica]
Length=474

 Score =   246 bits (628),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 136/177 (77%), Gaps = 1/177 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC  +F+     + +R R VG +   YDPCTE+HST+YFNL EVQKALHV+      +W
Sbjct  289  PTCHATFASSKNKVMKRLRSVGKMGEQYDPCTEKHSTVYFNLAEVQKALHVNPVIGKSKW  348

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCS  V + W DC  +VL +Y ELI  GLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV
Sbjct  349  ETCSGVVNNHWGDCERSVLHIYHELIQYGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  408

Query  307  SPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            +PW  WY DNG+VGGW+Q YEGLTFV VRGAGH+V LHRPK ALTL++SFLAGT MP
Sbjct  409  TPWHAWYDDNGEVGGWSQGYEGLTFVTVRGAGHEVPLHRPKQALTLIKSFLAGTPMP  465



>gb|ACF84647.1| unknown [Zea mays]
Length=257

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 132/177 (75%), Gaps = 1/177 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC  SF+     + +R    G +   YDPCTE+HST+YFNL EVQKALHV+T     +W
Sbjct  72   PTCHASFASSKNKVMKRLHSAGKMGEQYDPCTEKHSTVYFNLAEVQKALHVNTVIGKSKW  131

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCS+ V   W DC  +VL +Y ELI  GLRIWVFSGDTDAVIPVTSTRYSIDALKLPT+
Sbjct  132  ETCSEAVNTHWGDCERSVLHIYHELIQYGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTI  191

Query  307  SPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            +PW  WY D+G+VGGWTQ Y GL FV VRGAGH+V LHRPK ALTL++SFL G+ MP
Sbjct  192  TPWHAWYDDDGEVGGWTQGYRGLNFVTVRGAGHEVPLHRPKQALTLIKSFLTGSPMP  248



>ref|XP_006453578.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66818.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=491

 Score =   244 bits (623),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 144/201 (72%), Gaps = 18/201 (9%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P+CT S S  +R+LKR    VG     YDPCTE+HS +YFN PEVQKALHV    +  +W
Sbjct  290  PSCTASVSQSNRLLKRM-HVVGHASEKYDPCTEKHSVVYFNQPEVQKALHVIPAVAPAKW  348

Query  487  VTC-----------------SDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  359
             TC                 S  V + W D P TVLD+Y+ELI +GLRIW+FSGDTDAVI
Sbjct  349  ETCRWHQQYTLVISLFLLLCSGVVNNNWLDSPRTVLDIYRELIHSGLRIWMFSGDTDAVI  408

Query  358  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLAL  179
            PVTSTRYSIDAL LPTV PWR WYD+GQVGGWTQEY GLTFV VRGAGH+V LHRPK AL
Sbjct  409  PVTSTRYSIDALNLPTVKPWRAWYDDGQVGGWTQEYAGLTFVTVRGAGHEVPLHRPKPAL  468

Query  178  TLVESFLAGTSMPGLQRISDS  116
            TL++SFL+G SMP L+R+S S
Sbjct  469  TLIKSFLSGRSMPCLERVSHS  489



>ref|XP_003596536.1| Serine carboxypeptidase [Medicago truncatula]
Length=562

 Score =   244 bits (623),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = -3

Query  628  LKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKD  449
            L +R  +VG LR +YDPCT +HST YFNLPEVQ+ LHVH  +   +W TCS  V   WKD
Sbjct  389  LVKRKHRVGNLRTVYDPCTSKHSTTYFNLPEVQRILHVHPDHRPAKWQTCSVVVAINWKD  448

Query  448  CPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVG  269
             P TVL++Y+ELI  GLRIW+FSG+TDAV+PVTSTRYSIDALKLPTVSPWR WYD+G+V 
Sbjct  449  SPRTVLNIYRELIPTGLRIWMFSGNTDAVLPVTSTRYSIDALKLPTVSPWRAWYDDGEVA  508

Query  268  GWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQ  131
            GWTQEY GLTFV VRGAGH+V LHRPKLAL L +SFLAGTSM  L+
Sbjct  509  GWTQEYAGLTFVNVRGAGHEVPLHRPKLALALFKSFLAGTSMQTLE  554



>gb|AIN39846.1| hypothetical protein [Zoysia matrella]
Length=172

 Score =   232 bits (591),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 128/162 (79%), Gaps = 1/162 (1%)
 Frame = -3

Query  622  RRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCP  443
            +R   VG +   YDPCTE+HS +YFNLPEVQKALHV    S  +W TCS+ V   W DC 
Sbjct  2    KRLHSVGKMGEQYDPCTEKHSIVYFNLPEVQKALHVSPVISKSKWETCSEVVNTHWGDCE  61

Query  442  TTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYD-NGQVGG  266
             +VL +Y ELI  GLRIWVFSGDTDAVIPVTSTRYS+DALKLPTV+PW  WYD +G+VGG
Sbjct  62   RSVLHIYHELIQYGLRIWVFSGDTDAVIPVTSTRYSVDALKLPTVTPWHAWYDEDGEVGG  121

Query  265  WTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            WT+ YEGLTFV VRGAGH+V LHRPK ALTL++SFLAG+ MP
Sbjct  122  WTEGYEGLTFVTVRGAGHEVPLHRPKQALTLIKSFLAGSPMP  163



>gb|AES66787.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=474

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 137/169 (81%), Gaps = 1/169 (1%)
 Frame = -3

Query  637  SRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDF  458
            ++++K + R VG LR +YDPCT +HST YFNLPEVQ+ LHVH  +   +W TCS  V   
Sbjct  299  NQMVKGKHR-VGNLRTVYDPCTSKHSTTYFNLPEVQRILHVHPDHRPAKWQTCSVVVAIN  357

Query  457  WKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNG  278
            WKD P TVL++Y+ELI  GLRIW+FSG+TDAV+PVTSTRYSIDALKLPTVSPWR WYD+G
Sbjct  358  WKDSPRTVLNIYRELIPTGLRIWMFSGNTDAVLPVTSTRYSIDALKLPTVSPWRAWYDDG  417

Query  277  QVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQ  131
            +V GWTQEY GLTFV VRGAGH+V LHRPKLAL L +SFLAGTSM  L+
Sbjct  418  EVAGWTQEYAGLTFVNVRGAGHEVPLHRPKLALALFKSFLAGTSMQTLE  466



>ref|XP_004488608.1| PREDICTED: serine carboxypeptidase II-2-like [Cicer arietinum]
Length=485

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = -3

Query  622  RRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCP  443
            +R   +G LR  YDPCTE+HS  YFN PEVQ+ LHV   +   +W TCSD V   WKD P
Sbjct  315  KRKHSIGRLRATYDPCTEKHSIKYFNQPEVQRILHVDPHHKPEKWETCSDLVNINWKDSP  374

Query  442  TTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGW  263
             TVLD+Y+ELI  GLRIW+FSG+TD+VIPVTSTRY+IDALKLPTVSPWR WYD+G+VGGW
Sbjct  375  RTVLDIYRELIPTGLRIWMFSGNTDSVIPVTSTRYTIDALKLPTVSPWRAWYDDGEVGGW  434

Query  262  TQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQRI  125
             QEY GLTFV +RGAGH+V LH+PKLALTL ++FLAGTSMP L+ +
Sbjct  435  IQEYAGLTFVTIRGAGHEVPLHKPKLALTLFKAFLAGTSMPTLEPL  480



>gb|EMT26558.1| putative Serine carboxypeptidase II-2 [Aegilops tauschii]
Length=389

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 136/182 (75%), Gaps = 1/182 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC  SF+     + +R R  G +   YDPCTE+HS +YFNL EVQKALHV+      +W
Sbjct  204  PTCHSSFASSRNKVVKRLRSAGKMGEQYDPCTEQHSIVYFNLHEVQKALHVNPVIGKSKW  263

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCS+ +   WKDC  +VL +Y ELI  GLRIW+FSGDTDAVIPVTSTRYSIDALKLPTV
Sbjct  264  ETCSEVINTNWKDCDRSVLHIYHELIQYGLRIWMFSGDTDAVIPVTSTRYSIDALKLPTV  323

Query  307  SPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQ  131
            +PW  WY D+G+VGGWTQ Y+GL FV VRGAGH+V LHRPK ALTL++SFLAG+ MP L 
Sbjct  324  TPWHAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPLHRPKQALTLIKSFLAGSPMPVLS  383

Query  130  RI  125
             +
Sbjct  384  DL  385



>ref|NP_001057009.1| Os06g0186400 [Oryza sativa Japonica Group]
 dbj|BAD72445.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAD72446.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAF18923.1| Os06g0186400 [Oryza sativa Japonica Group]
 gb|EAZ36073.1| hypothetical protein OsJ_20382 [Oryza sativa Japonica Group]
 dbj|BAG90330.1| unnamed protein product [Oryza sativa Japonica Group]
Length=484

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 136/180 (76%), Gaps = 1/180 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC  SF+     + +R   VG +   YDPCTE+HST+YFNL EVQKALHV    +  +W
Sbjct  299  PTCHASFASSRNKVMKRLHSVGKMGERYDPCTEKHSTVYFNLAEVQKALHVSPIINKSKW  358

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD V   WKDC  +VL +Y ELI  GLRIWVFSGDTDAV+PVTSTRYSI+ALKLPTV
Sbjct  359  ETCSDVVNTNWKDCERSVLHIYHELIQYGLRIWVFSGDTDAVLPVTSTRYSINALKLPTV  418

Query  307  SPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQ  131
            +PW  WY D+G+VGGWTQ Y+GL FV VRGAGH+V LHRPK AL L++SFLAG+ MP +Q
Sbjct  419  TPWNAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPLHRPKQALILIKSFLAGSPMPSVQ  478



>ref|XP_004144720.1| PREDICTED: serine carboxypeptidase-like 29-like [Cucumis sativus]
Length=468

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 139/184 (76%), Gaps = 3/184 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C+E+    S  L++R   +G +   YDPCTE+HS  YFNLPEVQ+ALHV    +  +W
Sbjct  288  PPCSEA---SSNRLRKRMHMIGRVGERYDPCTEKHSVAYFNLPEVQQALHVDPKFAPSKW  344

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCS  +   WKD   +VLD+Y+ELI AGLRIWVFSGDTDAV+P+TSTRYS+DALKLP +
Sbjct  345  ETCSYLINGNWKDSAGSVLDIYRELIQAGLRIWVFSGDTDAVLPITSTRYSVDALKLPVI  404

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
              WRPWYD GQVGGW QEYEG+T V+VRGAGH+V LH+PKLAL L++SFLAG S+  LQ 
Sbjct  405  GSWRPWYDGGQVGGWIQEYEGVTLVSVRGAGHEVPLHQPKLALQLIKSFLAGNSLSPLQL  464

Query  127  ISDS  116
             SD+
Sbjct  465  HSDT  468



>sp|P55748.1|CBP22_HORVU RecName: Full=Serine carboxypeptidase II-2; AltName: Full=CP-MII.2; 
Contains: RecName: Full=Serine carboxypeptidase II-2 
chain A; Contains: RecName: Full=Serine carboxypeptidase II-2 
chain B; Flags: Precursor, partial [Hordeum vulgare]
 gb|AAB31590.1| CP-MII.2=serine carboxypeptidase [Hordeum vulgare=barley, cv. 
Alexis, aleurone, Peptide, 436 aa]
 emb|CAB59202.1| serine carboxylase II-2 [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   238 bits (607),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 136/182 (75%), Gaps = 1/182 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC  SF+     + +R R VG +   YDPCTE+HS +YFNL EVQKALHV+      +W
Sbjct  251  PTCHSSFASSRNKVVKRLRSVGKMGEQYDPCTEKHSIVYFNLHEVQKALHVNPVIGKSKW  310

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCS+ +   WKDC  +VL +Y ELI  GLRIW+FSGDTDAVIPVTSTRYSIDALKLPTV
Sbjct  311  ETCSEVINTNWKDCERSVLHIYHELIQYGLRIWMFSGDTDAVIPVTSTRYSIDALKLPTV  370

Query  307  SPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQ  131
            +PW  WY D+G+VGGWTQ Y+GL FV VRGAGH+V LHRPK ALTL++SFLAG  MP L 
Sbjct  371  TPWHAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPLHRPKQALTLIKSFLAGRPMPVLS  430

Query  130  RI  125
             +
Sbjct  431  DL  432



>gb|ABK24285.1| unknown [Picea sitchensis]
Length=450

 Score =   238 bits (607),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 136/187 (73%), Gaps = 7/187 (4%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRI---YDPCTERHSTIYFNLPEVQKALHVHTTNSS  497
            P C  S    +   +++ RK    R +   YDPCTE+HS IYFNLPEVQKALH + T   
Sbjct  267  PPCLNS----TGTYRKQHRKRYPWRHLFGEYDPCTEKHSEIYFNLPEVQKALHANVTGIP  322

Query  496  FEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKL  317
            + W TCSD V D W D P ++L +YQELI AGLRIW+FSGDTDAVIPVTSTRYSI+ALKL
Sbjct  323  YRWTTCSDAVADHWGDSPRSMLPIYQELIKAGLRIWMFSGDTDAVIPVTSTRYSINALKL  382

Query  316  PTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPG  137
            PTV+ W PWYDNGQVGGWTQ YEGLTFV VRGAGH+V LH P+ A T+ ESFL G  MP 
Sbjct  383  PTVTQWHPWYDNGQVGGWTQVYEGLTFVTVRGAGHEVPLHEPRKAFTVFESFLEGKPMPV  442

Query  136  LQRISDS  116
              ++ D+
Sbjct  443  SPKLVDT  449



>ref|NP_001146398.1| Serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG39493.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACL53886.1| unknown [Zea mays]
 gb|AFW85536.1| Serine carboxypeptidase K10B2.2 [Zea mays]
Length=474

 Score =   239 bits (609),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 132/177 (75%), Gaps = 1/177 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC  SF+     + +R    G +   YDPCTE+HST+YFNL EVQKALHV+T     +W
Sbjct  289  PTCHASFASSKNKVMKRLHSAGKMGEQYDPCTEKHSTVYFNLAEVQKALHVNTVIGKSKW  348

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCS+ V   W DC  +VL +Y ELI  GLRIWVFSGDTDAVIPVTSTRYSIDALKLPT+
Sbjct  349  ETCSEAVNTHWGDCERSVLHIYHELIQYGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTI  408

Query  307  SPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            +PW  WY D+G+VGGWTQ Y GL FV VRGAGH+V LHRPK ALTL++SFL G+ MP
Sbjct  409  TPWHAWYDDDGEVGGWTQGYRGLNFVTVRGAGHEVPLHRPKQALTLIKSFLTGSPMP  465



>dbj|BAJ99024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   238 bits (608),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 137/182 (75%), Gaps = 1/182 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC  SF+     + +R R VG +   YDPCTE+HS +YFNL EVQKALHV+      +W
Sbjct  284  PTCHSSFASSRNKVVKRLRSVGKMGEQYDPCTEQHSIVYFNLHEVQKALHVNPVIGKSKW  343

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCS+ +   WKDC  +VL +Y ELI  GLRIW+FSGDTDAVIPVTSTRYSIDALKLPTV
Sbjct  344  ETCSEVINTNWKDCERSVLHIYHELIQYGLRIWMFSGDTDAVIPVTSTRYSIDALKLPTV  403

Query  307  SPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQ  131
            +PW  WY D+G+VGGWTQ Y+GL FV VRGAGH+V LHRPK ALTL++SFLAG+ MP L 
Sbjct  404  TPWHAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPLHRPKQALTLIKSFLAGSPMPVLS  463

Query  130  RI  125
             +
Sbjct  464  DL  465



>ref|XP_008452541.1| PREDICTED: serine carboxypeptidase II-2 [Cucumis melo]
Length=468

 Score =   238 bits (608),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 138/184 (75%), Gaps = 3/184 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C+E   + S  L++R   VG +   YDPCTE+HS  YFNLPEVQ+ALHV    +  +W
Sbjct  288  PPCSE---VSSNRLRKRMHMVGRIGERYDPCTEQHSVAYFNLPEVQQALHVDPKFAPSKW  344

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCS  +   WKD   +VLD+Y+ELI AGLRIWVFSGDTDAV+P+TSTRYS+DALKLP +
Sbjct  345  ETCSYVINGNWKDSAGSVLDIYRELIQAGLRIWVFSGDTDAVLPITSTRYSVDALKLPVI  404

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
             PWR WYD GQVGGW QEYEG+T V+VRGAGH+V LH+PKLAL L ++FLAG S+  LQ 
Sbjct  405  GPWRAWYDEGQVGGWIQEYEGVTLVSVRGAGHEVPLHQPKLALQLFKAFLAGNSLSPLQL  464

Query  127  ISDS  116
             SD+
Sbjct  465  HSDT  468



>gb|KGN61064.1| hypothetical protein Csa_2G036620 [Cucumis sativus]
Length=542

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 139/184 (76%), Gaps = 3/184 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C+E+    S  L++R   +G +   YDPCTE+HS  YFNLPEVQ+ALHV    +  +W
Sbjct  362  PPCSEA---SSNRLRKRMHMIGRVGERYDPCTEKHSVAYFNLPEVQQALHVDPKFAPSKW  418

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCS  +   WKD   +VLD+Y+ELI AGLRIWVFSGDTDAV+P+TSTRYS+DALKLP +
Sbjct  419  ETCSYLINGNWKDSAGSVLDIYRELIQAGLRIWVFSGDTDAVLPITSTRYSVDALKLPVI  478

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
              WRPWYD GQVGGW QEYEG+T V+VRGAGH+V LH+PKLAL L++SFLAG S+  LQ 
Sbjct  479  GSWRPWYDGGQVGGWIQEYEGVTLVSVRGAGHEVPLHQPKLALQLIKSFLAGNSLSPLQL  538

Query  127  ISDS  116
             SD+
Sbjct  539  HSDT  542



>ref|XP_009395827.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=476

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P+CT SF++    L +R    G + + YDPCTE+HS +YFNLPEVQK LHV+   +  +W
Sbjct  292  PSCTGSFTLSKNKLLKRLHSAGRIGKKYDPCTEKHSMVYFNLPEVQKVLHVNPAFAPSKW  351

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
            VTCSD V   +KD   +VL +Y+ELI+ GLRIW+FSGDTDAVIPV STRY+IDALKLPTV
Sbjct  352  VTCSDFVDKNYKDSSRSVLPIYRELISHGLRIWMFSGDTDAVIPVASTRYNIDALKLPTV  411

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            +PW  WYD+GQVGGWTQ Y+GLTFV VRGAGH+++L RPK AL L+++FL+G  MP
Sbjct  412  TPWHAWYDDGQVGGWTQVYKGLTFVTVRGAGHEISLLRPKSALVLIKAFLSGNPMP  467



>dbj|BAK02147.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 136/182 (75%), Gaps = 1/182 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC  SF+     + +R R VG +   YDPCTE+HS +YFNL EVQKALHV+      +W
Sbjct  284  PTCHSSFASSRNKVVKRLRSVGKMGEQYDPCTEQHSIVYFNLHEVQKALHVNPVIGKSKW  343

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCS+ +   WKDC  +VL +Y ELI  GL IW+FSGDTDAVIPVTSTRYSIDALKLPTV
Sbjct  344  ETCSEVINTNWKDCERSVLHIYHELIQYGLHIWMFSGDTDAVIPVTSTRYSIDALKLPTV  403

Query  307  SPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQ  131
            +PW  WY D+G+VGGWTQ Y+GL FV VRGAGH+V LHRPK ALTL++SFLAG+ MP L 
Sbjct  404  TPWHAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPLHRPKQALTLIKSFLAGSPMPVLS  463

Query  130  RI  125
             +
Sbjct  464  DL  465



>gb|KJB76659.1| hypothetical protein B456_012G098600 [Gossypium raimondii]
Length=487

 Score =   236 bits (603),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 136/181 (75%), Gaps = 1/181 (1%)
 Frame = -3

Query  685  PTASSPPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  506
            P +   P+C+ + S    +LKRR   V  L   YDPCTE+HS +YFNLPEVQK+LHV   
Sbjct  288  PYSIFTPSCSANASQTKWLLKRR-HMVSQLSEKYDPCTEKHSEVYFNLPEVQKSLHVLPE  346

Query  505  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  326
             +  +W TCSD V   WKD P T+LDVY+EL   GLRI +FSGDTDAVIP+TSTRYSIDA
Sbjct  347  AAPSKWETCSDIVNTNWKDSPITMLDVYRELTREGLRICIFSGDTDAVIPITSTRYSIDA  406

Query  325  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  146
            LKL TV PW  WYD+GQVGGWTQEYEGL FV+VRGAGH+V LHRPK AL L ++FL+GTS
Sbjct  407  LKLATVKPWHAWYDDGQVGGWTQEYEGLKFVSVRGAGHEVPLHRPKQALALFKAFLSGTS  466

Query  145  M  143
            M
Sbjct  467  M  467



>ref|XP_003564183.1| PREDICTED: serine carboxypeptidase II-2 [Brachypodium distachyon]
Length=474

 Score =   236 bits (601),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 136/182 (75%), Gaps = 1/182 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC  SF+     + +R R VG +   YDPCTE+HS +YFNL EVQKALHV+      +W
Sbjct  289  PTCHSSFASSRNKVMKRLRSVGKMGEQYDPCTEKHSIVYFNLAEVQKALHVNPVIGKSKW  348

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCS  + + W D   +VL +Y ELI  GLRIW+FSGDTDAVIPVTSTRYSI+ALKLPTV
Sbjct  349  ETCSGVINNNWGDSERSVLHIYHELIQYGLRIWMFSGDTDAVIPVTSTRYSINALKLPTV  408

Query  307  SPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQ  131
            +PW  WY D+G+VGGWTQ Y+GLTFV VRGAGH+V LHRPK ALTL++SFLAG+ MP L 
Sbjct  409  APWHAWYDDDGEVGGWTQGYQGLTFVTVRGAGHEVPLHRPKQALTLIKSFLAGSPMPVLS  468

Query  130  RI  125
             +
Sbjct  469  DL  470



>ref|XP_004162685.1| PREDICTED: serine carboxypeptidase-like 29-like [Cucumis sativus]
Length=468

 Score =   236 bits (601),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 138/184 (75%), Gaps = 3/184 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C+E+    S  L++R   +G +   YD CTE+HS  YFNLPEVQ+ALHV    +  +W
Sbjct  288  PPCSEA---SSNRLRKRMHMIGRVGERYDLCTEKHSVAYFNLPEVQQALHVDPKFAPSKW  344

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCS  +   WKD   +VLD+Y+ELI AGLRIWVFSGDTDAV+P+TSTRYS+DALKLP +
Sbjct  345  ETCSYLINGNWKDSAGSVLDIYRELIQAGLRIWVFSGDTDAVLPITSTRYSVDALKLPVI  404

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
              WRPWYD GQVGGW QEYEG+T V+VRGAGH+V LH+PKLAL L++SFLAG S+  LQ 
Sbjct  405  GSWRPWYDGGQVGGWIQEYEGVTLVSVRGAGHEVPLHQPKLALQLIKSFLAGNSLSPLQL  464

Query  127  ISDS  116
             SD+
Sbjct  465  HSDT  468



>ref|XP_006655861.1| PREDICTED: serine carboxypeptidase II-2-like [Oryza brachyantha]
Length=484

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 133/177 (75%), Gaps = 1/177 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC  SF+     + +R   VG +   YDPCTE+HST+YFNL EVQKALH     +  +W
Sbjct  299  PTCHSSFAASRNKVMKRLHSVGKMGERYDPCTEKHSTVYFNLAEVQKALHASPIINKSKW  358

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD V   WKDC  +VL +Y ELI  GLRIWVFSGDTDAV+PVTSTRYSIDALKL TV
Sbjct  359  ETCSDIVNTNWKDCERSVLHIYHELIQYGLRIWVFSGDTDAVLPVTSTRYSIDALKLLTV  418

Query  307  SPWRPWYD-NGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            +PW  WYD +G+VGGWTQ Y+GL FV+VRGAGH+V LHRPK AL L++SFLAG +MP
Sbjct  419  TPWSAWYDEDGEVGGWTQGYKGLNFVSVRGAGHEVPLHRPKQALILIKSFLAGRAMP  475



>ref|XP_006845388.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
 gb|ERN07063.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
Length=473

 Score =   234 bits (596),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 137/180 (76%), Gaps = 1/180 (1%)
 Frame = -3

Query  664  TCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWV  485
            TC +  S +S  L+ +    G +   YDPCTE+HST+YFN PEVQKALHV+   +  +W 
Sbjct  290  TC-QGNSTLSNKLRSKSNSFGRIGEQYDPCTEKHSTVYFNQPEVQKALHVNPAFAPSKWK  348

Query  484  TCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVS  305
            TCSD V   W+D   ++L +Y ELI  GLRIW+FSGDTDA+IPVTSTRY+IDAL+LPTV+
Sbjct  349  TCSDVVGVNWRDSVKSILPIYHELIHEGLRIWMFSGDTDAIIPVTSTRYNIDALRLPTVT  408

Query  304  PWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQRI  125
            PW  WYDNGQVGGWTQ Y+GLTFV VRGAGH+VALH+P+LAL L+++FL G+ MP L  +
Sbjct  409  PWHAWYDNGQVGGWTQVYKGLTFVTVRGAGHEVALHKPRLALRLIKAFLVGSPMPTLASL  468



>ref|XP_002324520.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF03085.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=470

 Score =   231 bits (589),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 129/170 (76%), Gaps = 4/170 (2%)
 Frame = -3

Query  613  RKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEV----YDFWKDC  446
             +VG +   YDPCTE H+T+YFNLPEVQKALHV    +   W TC             D 
Sbjct  301  NRVGRVSEKYDPCTETHTTVYFNLPEVQKALHVSPEFAPARWETCRGATCPHHLTLIFDS  360

Query  445  PTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGG  266
            P TVLD+Y+ELI +GL +WVFSGDTDAVIPVTSTRYSIDALKLPTV PW  WYD+GQVGG
Sbjct  361  PRTVLDIYKELIHSGLHVWVFSGDTDAVIPVTSTRYSIDALKLPTVKPWGAWYDDGQVGG  420

Query  265  WTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQRISDS  116
            WTQEY GLTFV VRGAGH+V LH+PK ALTLV++FL+GT MP LQ +SDS
Sbjct  421  WTQEYAGLTFVVVRGAGHEVPLHKPKQALTLVKAFLSGTPMPTLQLVSDS  470



>ref|XP_009137969.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=476

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 133/175 (76%), Gaps = 1/175 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C  + S    +LK+R R  G +   YDPCT +HS +YFNLPEVQ+ALHV    +  +W
Sbjct  285  PACVANASQAKMLLKKR-RVGGRVSEQYDPCTMKHSKVYFNLPEVQEALHVPPGLAPSKW  343

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
              CSD+V   WKD P++VL++Y ELI AGLRIWVFSGD DAV+PVTSTRYSIDALKL  V
Sbjct  344  DVCSDDVSRNWKDSPSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDALKLHPV  403

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            SP+ PWY +GQVGGWTQEY+GL FV VRGAGH+V LHRPK AL L ++F++GTS+
Sbjct  404  SPYGPWYIDGQVGGWTQEYDGLNFVTVRGAGHEVPLHRPKEALALFQAFISGTSL  458



>emb|CDY13387.1| BnaA03g51050D [Brassica napus]
Length=476

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 132/175 (75%), Gaps = 1/175 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C  + S    +LK+R R  G +   YDPCT +HS +YFNLPEVQ+ALHV    +  +W
Sbjct  285  PACVANASQAKMLLKKR-RVGGRVSEQYDPCTMKHSKVYFNLPEVQEALHVPPGLAPSKW  343

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
              CSD+V   WKD P++VL++Y ELI AGLRIWVFSGD DAV+PVTSTRYSIDALKL  V
Sbjct  344  DVCSDDVSRNWKDSPSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDALKLHPV  403

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            SP+ PWY +GQVGGWTQEY+GL FV VRGAGH+V LHRPK AL L ++F+ GTS+
Sbjct  404  SPYGPWYIDGQVGGWTQEYDGLNFVTVRGAGHEVPLHRPKEALALFQAFITGTSL  458



>ref|XP_009127491.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=480

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C  + S  S +L ++   V  L R+YDPCT++HS +YFNLP+VQKALHV    +  +W
Sbjct  301  PACVTNSSQSSMLLNKKRPFVSDLSRVYDPCTKKHSKVYFNLPKVQKALHVPPKVAPSKW  360

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCS  V + WKD P++VLD+Y ELI AGLRIWVFSGD DA++PVTSTRYSI+AL L T+
Sbjct  361  DTCSKVVGEHWKDSPSSVLDIYHELIAAGLRIWVFSGDADAIVPVTSTRYSINALNLSTI  420

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            SP+ PWY +GQVGGW+Q+Y GL FV VRG+GH+VALHRPK AL L ++F++GT +
Sbjct  421  SPYGPWYIDGQVGGWSQQYAGLNFVIVRGSGHEVALHRPKEALALFKAFISGTPL  475



>emb|CDX68696.1| BnaC01g07570D [Brassica napus]
Length=504

 Score =   229 bits (583),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C  + S  S +L ++   V  L R+YDPCT++HS +YFNLP+VQKALHV    +  +W
Sbjct  325  PACVTNSSQSSMLLNKKGPFVSDLSRVYDPCTKKHSKVYFNLPKVQKALHVPPQVAPSKW  384

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCS  V + WKD P++VLD+Y ELI AGLRIWVFSGD DA++PVTSTRYSI+AL L T+
Sbjct  385  DTCSKVVGEHWKDSPSSVLDIYHELIAAGLRIWVFSGDADAIVPVTSTRYSINALNLSTL  444

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            SP+ PWY +GQVGGW+Q+Y GL FV VRG+GH+VALHRPK AL L ++F++GT +
Sbjct  445  SPYGPWYIDGQVGGWSQQYAGLNFVIVRGSGHEVALHRPKEALALFKAFISGTPL  499



>emb|CDX72270.1| BnaC07g42920D [Brassica napus]
Length=667

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 134/176 (76%), Gaps = 1/176 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC  + S    +LK+R    G +   YDPCT +HS +YFNLPEVQ+ALHV    +  +W
Sbjct  285  PTCVANASQAKMLLKKRAVG-GRVSEQYDPCTMKHSKVYFNLPEVQEALHVPPGLAPSKW  343

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
              CSD V + WKD P++VL++Y ELI AGLRIWVFSGD DAV+PVTSTRYSIDALKL  V
Sbjct  344  DVCSDVVSENWKDSPSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDALKLHPV  403

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            SP+ PWY +GQVGGWTQEY+GL FV VRGAGH+V LHRPK AL L ++F++GTS+P
Sbjct  404  SPYGPWYIDGQVGGWTQEYDGLNFVTVRGAGHEVPLHRPKEALALFQAFISGTSLP  459



>ref|XP_010526302.1| PREDICTED: serine carboxypeptidase-like 29 [Tarenaya hassleriana]
Length=489

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 132/176 (75%), Gaps = 1/176 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC  + +    +LK+R   +G +   YDPCTE+HS +YFNLPEVQ ALHV    +  +W
Sbjct  292  PTCPGNVTQTKFLLKKRP-ILGRVSENYDPCTEKHSIMYFNLPEVQTALHVPPELAPSKW  350

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD V + WKD P +VL++Y ELI AGL IWVFSGD DAV+PVTSTRYSIDAL L  +
Sbjct  351  ETCSDTVGNHWKDSPRSVLNIYHELIAAGLHIWVFSGDADAVVPVTSTRYSIDALNLRPL  410

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            +PWRPWY +GQVGGWTQ+Y GL FV VRGAGH+V LHRPK AL L ++F++G S+P
Sbjct  411  NPWRPWYIDGQVGGWTQQYVGLNFVTVRGAGHEVPLHRPKQALALFKAFVSGNSLP  466



>ref|XP_010253608.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 122/153 (80%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+ST+YFN PEVQK+LH + T  S+ W TCSD V D+W D P ++L +YQ
Sbjct  305  MTRAYDPCTERYSTMYFNQPEVQKSLHANVTGISYPWKTCSDIVGDYWADSPLSMLPIYQ  364

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGLRIWVFSGDTDAV+PVT+TRYSIDALKLPTV  W PWYDNG+VGGW+Q Y+GLT
Sbjct  365  ELIAAGLRIWVFSGDTDAVVPVTATRYSIDALKLPTVINWYPWYDNGKVGGWSQVYKGLT  424

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            FV V GAGH+V LHRP+ A  L +SFL    MP
Sbjct  425  FVTVTGAGHEVPLHRPREAFILFKSFLENKPMP  457



>emb|CDY28217.1| BnaA01g06320D [Brassica napus]
Length=468

 Score =   225 bits (574),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 133/176 (76%), Gaps = 1/176 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRK-VGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFE  491
            P C  + S  S +L  + R  V  L R+YDPCT++HS +YFNLP+VQKALHV    +  +
Sbjct  288  PACVVTNSSQSSMLLNKKRPFVSDLSRVYDPCTKKHSKVYFNLPKVQKALHVPPKVAPSK  347

Query  490  WVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPT  311
            W TCS  V + WKD P++VLD+Y ELI AGLRIWVFSGD DA++PVTSTRYSI+AL L T
Sbjct  348  WDTCSKVVGEHWKDSPSSVLDIYHELIAAGLRIWVFSGDADAIVPVTSTRYSINALNLST  407

Query  310  VSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
             SP+ PWY +GQVGGW+Q+Y GL FV VRG+GH+VALHRPK AL L ++F++GT +
Sbjct  408  TSPYGPWYIDGQVGGWSQQYAGLNFVIVRGSGHEVALHRPKEALALFKAFISGTPL  463



>gb|ACG38162.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG38177.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
Length=463

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 131/176 (74%), Gaps = 3/176 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC ++     R+++ R      L R YDPCTE++ST Y+NLPEVQ+ALH + T   + W
Sbjct  282  PTCKKTSLHKRRLIRGR---TPWLPRGYDPCTEKYSTKYYNLPEVQRALHANVTGIPYPW  338

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
            VTCSD VYDFWKD P ++L +Y+ELI AG+RIWVFSGD D+V+P+T+TRYSIDAL LPT+
Sbjct  339  VTCSDPVYDFWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVVPLTATRYSIDALFLPTI  398

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            + W PWYD+ +VGGW Q YEGLT V VRGAGH+V LHRP+  L L E FL G  MP
Sbjct  399  TNWYPWYDDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPRQGLKLFEHFLRGEPMP  454



>ref|XP_008654560.1| PREDICTED: uncharacterized protein LOC100273202 isoform X1 [Zea 
mays]
 gb|ACF86547.1| unknown [Zea mays]
 gb|AFW80078.1| serine carboxypeptidase K10B2.2 [Zea mays]
Length=463

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 131/176 (74%), Gaps = 3/176 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC ++     R+++ R      L R YDPCTE++ST Y+NLPEVQ+ALH + T   + W
Sbjct  282  PTCKKTSLHKRRLIRGR---TPWLPRGYDPCTEKYSTKYYNLPEVQRALHANVTGIPYPW  338

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
            VTCSD VYDFWKD P ++L +Y+ELI AG+RIWVFSGD D+V+P+T+TRYSIDAL LPT+
Sbjct  339  VTCSDPVYDFWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVVPLTATRYSIDALFLPTI  398

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            + W PWYD+ +VGGW Q YEGLT V VRGAGH+V LHRP+  L L E FL G  MP
Sbjct  399  TNWYPWYDDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPRQGLKLFEHFLRGEPMP  454



>gb|ACF79757.1| unknown [Zea mays]
Length=463

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 131/176 (74%), Gaps = 3/176 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC ++     R+++ R      L R YDPCTE++ST Y+NLPEVQ+ALH + T   + W
Sbjct  282  PTCKKTSLHKRRLIRGR---TPWLPRGYDPCTEKYSTKYYNLPEVQRALHANVTGIPYPW  338

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
            VTCSD VYDFWKD P ++L +Y+ELI AG+RIWVFSGD D+V+P+T+TRYSIDAL LPT+
Sbjct  339  VTCSDPVYDFWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVVPLTATRYSIDALFLPTI  398

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            + W PWYD+ +VGGW Q YEGLT V VRGAGH+V LHRP+  L L E FL G  MP
Sbjct  399  TNWYPWYDDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPRQGLKLFEHFLRGEPMP  454



>emb|CDY55623.1| BnaC03g77560D [Brassica napus]
Length=477

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 131/175 (75%), Gaps = 1/175 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C  + S    +LK+R R    +   YDPCTE+HS +YFNLPEVQ+ALHV    +  +W
Sbjct  286  PACIANASQSKMLLKKRPR-TSRVSEQYDPCTEKHSKVYFNLPEVQEALHVPPGLAPSKW  344

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD V + WKDC ++VL++Y ELI AGLRIWVFSGD DAV+PVT+TRYSIDAL L  +
Sbjct  345  DTCSDVVNEHWKDCSSSVLNIYHELIAAGLRIWVFSGDADAVVPVTATRYSIDALNLRPL  404

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            SP+ PWY +GQVGGWTQ+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  405  SPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEALALFKAFISGTPL  459



>ref|XP_010669644.1| PREDICTED: serine carboxypeptidase-like 27 [Beta vulgaris subsp. 
vulgaris]
Length=456

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 129/172 (75%), Gaps = 3/172 (2%)
 Frame = -3

Query  655  ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCS  476
            +S + M R L  R      + R YDPCTER+ST YFN P+VQ ALH ++T  S+ W TCS
Sbjct  284  KSTASMKRSLNGR---YPWMSRAYDPCTERYSTEYFNRPDVQLALHANSTKISYPWSTCS  340

Query  475  DEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWR  296
            D V ++W + P T+L +YQELI AGLRIWV+SGDTDAV+P+T+TRYSIDALKLPTV+ W 
Sbjct  341  DIVGNYWSESPLTMLPIYQELIAAGLRIWVYSGDTDAVVPITATRYSIDALKLPTVTNWY  400

Query  295  PWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            PWYDNG+VGGW+Q YEGLTFV ++GAGH+V LHRP+ A  L   FL   SMP
Sbjct  401  PWYDNGRVGGWSQVYEGLTFVTIKGAGHEVPLHRPRQAFILFNHFLKNKSMP  452



>ref|XP_006470942.1| PREDICTED: serine carboxypeptidase II-2-like [Citrus sinensis]
Length=315

 Score =   219 bits (558),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 136/212 (64%), Gaps = 29/212 (14%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P+CT S S  +R+LKR    VG     YDPCTE+HS +YFN PEVQKALHV    +  +W
Sbjct  103  PSCTASVSQSNRLLKRM-HVVGHASEKYDPCTEKHSVVYFNQPEVQKALHVIPAVALAKW  161

Query  487  VTCS------------------DEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  362
             TC                     V + W D P  VLD+Y ELI +GLRIW+FSGDTDAV
Sbjct  162  ETCRWHQQHALMIFFIFTALQWGVVNNNWLDSPRIVLDIYHELIHSGLRIWMFSGDTDAV  221

Query  361  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGG----------WTQEYEGLTFVAVRGAGH  212
            IPVTSTRYSIDAL LPTV PWR WYD GQV            WTQEY GLT V VRGA H
Sbjct  222  IPVTSTRYSIDALNLPTVKPWRAWYDEGQVNYTTKPFITYILWTQEYAGLTLVTVRGADH  281

Query  211  KVALHRPKLALTLVESFLAGTSMPGLQRISDS  116
            +V LHRPK ALTL++SFL+G SMP L+R+S S
Sbjct  282  EVPLHRPKPALTLIKSFLSGRSMPCLERVSLS  313



>ref|XP_002312024.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE89391.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   223 bits (568),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 121/154 (79%), Gaps = 0/154 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN PEVQKALH + T   + W TCSD V D+W D P ++L +Y+
Sbjct  304  MSRAYDPCTERYSKVYFNHPEVQKALHANVTGIPYPWKTCSDIVGDYWADSPLSMLPIYK  363

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPT+  W PWYDNG+VGGW+Q Y+GL+
Sbjct  364  ELIAAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLS  423

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMPG  137
            FV V GAGH+V LHRP+ A  L  SFL   SMPG
Sbjct  424  FVTVTGAGHEVPLHRPRQAFILFRSFLKNKSMPG  457



>dbj|BAH20278.1| AT4G30810 [Arabidopsis thaliana]
Length=373

 Score =   220 bits (560),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 130/175 (74%), Gaps = 1/175 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C  + S  + +LK+R      +   YDPCTE+H+T+YFNLPEVQKALHV    +  +W
Sbjct  182  PACVANASQSNMLLKKRPM-TSRVSEQYDPCTEKHTTVYFNLPEVQKALHVPPGLAPSKW  240

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD V + W D P++VL++Y ELI AGLRIWVFSGD DAV+PVTSTRYSIDAL L  +
Sbjct  241  DTCSDVVSEHWNDSPSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDALNLRPL  300

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            S + PWY +GQVGGW+Q+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  301  SAYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQALALFKAFISGTPL  355



>ref|XP_002457307.1| hypothetical protein SORBIDRAFT_03g005360 [Sorghum bicolor]
 gb|EES02427.1| hypothetical protein SORBIDRAFT_03g005360 [Sorghum bicolor]
Length=463

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 130/176 (74%), Gaps = 3/176 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC ++     R+++ R      L R YDPCTE++ST Y+NLPEVQKALH + T   + W
Sbjct  282  PTCKKTSLHKRRLIRGR---TPWLPRGYDPCTEKYSTKYYNLPEVQKALHANVTGIPYPW  338

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
            VTCSD VYDFWKD P ++L +Y+ELI AGLRIWVFSGD D+V+P+T+TRYSIDAL LPTV
Sbjct  339  VTCSDPVYDFWKDSPRSMLPIYRELIAAGLRIWVFSGDADSVVPLTATRYSIDALFLPTV  398

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            + W PWYD+ +VGGW Q Y+GLT V +RGAGH+V LHRP+  L L E FL    MP
Sbjct  399  TNWYPWYDDEEVGGWCQVYKGLTLVTIRGAGHEVPLHRPRQGLKLFEHFLRDEPMP  454



>gb|KDP25725.1| hypothetical protein JCGZ_23946 [Jatropha curcas]
Length=456

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 122/153 (80%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN PEVQKALH + T  S+ W TCSD V ++W D P ++L +Y+
Sbjct  303  MSRAYDPCTERYSKLYFNRPEVQKALHANATGISYPWKTCSDIVGNYWADAPLSMLPIYK  362

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGL+IWV+SGDTDAV+PVT+TRYSIDALKLPT++ W PWYDNG+VGGW+Q Y+GLT
Sbjct  363  ELIAAGLKIWVYSGDTDAVVPVTATRYSIDALKLPTITNWSPWYDNGKVGGWSQVYKGLT  422

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            FV V GAGH+V LHRP+ A  L +SFL    MP
Sbjct  423  FVTVTGAGHEVPLHRPRQAFILFKSFLENKPMP  455



>ref|XP_010527107.1| PREDICTED: serine carboxypeptidase-like 29, partial [Tarenaya 
hassleriana]
Length=207

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC  + S    +LK+R    G +   YDPCTE+HS +YFN PEVQKALHV    +  +W
Sbjct  10   PTCPANVSQSKLLLKKRP-IFGRVSEEYDPCTEKHSRVYFNPPEVQKALHVPPEFAPSKW  68

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
              CSD V + W D P +VL++Y ELI AGLRIWVFSGD DAV+PVT+TRYSI+AL L  +
Sbjct  69   DICSDTVSEHWIDSPPSVLNIYHELIAAGLRIWVFSGDADAVVPVTATRYSIEALNLRPL  128

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
            SPW  WY +GQV GWTQ+Y GL FV VRGAGH+V LHRPK +L L ++F++G  +P  ++
Sbjct  129  SPWYSWYMDGQVAGWTQQYAGLNFVTVRGAGHEVPLHRPKQSLELFKAFVSGNPLPTSEK  188

Query  127  IS  122
             S
Sbjct  189  NS  190



>ref|XP_011031767.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 122/154 (79%), Gaps = 0/154 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCT+R+S +YFN PEVQKALH + T   ++W TCSD V D+W D P ++L +Y+
Sbjct  304  MSRAYDPCTDRYSKVYFNHPEVQKALHANVTGIPYQWKTCSDIVGDYWADSPLSMLPIYK  363

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            EL+ AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPT+  W PWYDNG+VGGW+Q Y+GL+
Sbjct  364  ELMAAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLS  423

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMPG  137
            FV V GAGH+V LHRP+ A  L  SFL   SMPG
Sbjct  424  FVTVTGAGHEVPLHRPRQAFILFRSFLENKSMPG  457



>emb|CDY28216.1| BnaA01g06330D [Brassica napus]
Length=481

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 129/175 (74%), Gaps = 1/175 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C  S S    +LKRR     +  + YDPCTE+HS +YFNLPEVQ+ALHV    +  +W
Sbjct  289  PACVASASQSRMLLKRRPVNSRVSEQ-YDPCTEKHSKVYFNLPEVQRALHVPPEVAPSKW  347

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TC+  V + W DC ++VLD+Y ELI AG+RIWVFSGD DAV+PVTSTRYSIDAL L T 
Sbjct  348  DTCNYVVNENWNDCASSVLDIYHELIAAGIRIWVFSGDADAVVPVTSTRYSIDALNLSTT  407

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            SP+ PWY +GQVGGWTQ+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  408  SPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEALALFKAFISGTPL  462



>ref|XP_003556225.1| PREDICTED: serine carboxypeptidase-like 27-like isoform 1 [Glycine 
max]
 gb|KHN00830.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=460

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 120/153 (78%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN PEVQKALH + T   + W  CSD V ++W D P ++L +YQ
Sbjct  305  MSRAYDPCTERYSDLYFNRPEVQKALHANVTGIPYAWKACSDIVGNYWTDSPLSMLPIYQ  364

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI+AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPT+  W PWYDNG+VGGW+Q Y+GLT
Sbjct  365  ELISAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLT  424

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V VRGAGH+V LHRP+ A  L  SFL   SMP
Sbjct  425  LVTVRGAGHEVPLHRPRQAFILFRSFLENKSMP  457



>ref|XP_011076996.1| PREDICTED: serine carboxypeptidase-like 27 [Sesamum indicum]
Length=461

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 124/164 (76%), Gaps = 1/164 (1%)
 Frame = -3

Query  628  LKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWK  452
            L+RR R     + R YDPCTER+S IYFNLPEVQ ALH + T  S+ W +CSD V ++W 
Sbjct  297  LRRRLRGHYPWMSRAYDPCTERYSEIYFNLPEVQNALHANVTRISYPWQSCSDIVGNYWA  356

Query  451  DCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQV  272
            D P +VL +YQELI AG RIWVFSGDTDAV+PVT+TRYSIDALKLPT++ W PWYDNG+V
Sbjct  357  DTPLSVLPIYQELIAAGHRIWVFSGDTDAVVPVTATRYSIDALKLPTITKWYPWYDNGKV  416

Query  271  GGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            GGW+Q Y+GLT V V GAGH+V LHRP+ A  L  SFL    MP
Sbjct  417  GGWSQVYKGLTLVTVTGAGHEVPLHRPRQAFILFRSFLENKPMP  460



>ref|XP_010525795.1| PREDICTED: serine carboxypeptidase-like 29, partial [Tarenaya 
hassleriana]
Length=277

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC  + S    +LK+R    G +   YDPCTE+HS +YFNLPEVQKALHV    +  +W
Sbjct  80   PTCPANVSQSKLLLKKRP-IFGRVSEEYDPCTEKHSRVYFNLPEVQKALHVPPEFAPSKW  138

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
              CSD V + W D P +VL++Y ELI AGLRIWVFSGD DAV+PVT+TRYSI+AL L  +
Sbjct  139  DICSDTVSEHWIDSPPSVLNIYHELIAAGLRIWVFSGDADAVVPVTATRYSIEALNLRPL  198

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
            SPW  WY +GQV GWTQ+Y GL FV VRGAGH+V LHRPK +L L ++F++G  +P  ++
Sbjct  199  SPWYSWYMDGQVAGWTQQYAGLNFVTVRGAGHEVPLHRPKQSLELFKAFVSGNPLPTSEK  258

Query  127  IS  122
             S
Sbjct  259  NS  260



>emb|CDY23258.1| BnaA08g12880D [Brassica napus]
Length=478

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 131/175 (75%), Gaps = 1/175 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C  + S  + +LK+R R    +   YDPCTE+HS +YFNLPEVQ+ALHV    +  +W
Sbjct  287  PACIANASQSNMLLKKRPR-TSRVSEQYDPCTEKHSKVYFNLPEVQEALHVPPGLAPSKW  345

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD V + WKD  ++VL++Y ELI AGLRIWVFSGD DAV+PVT+TRYSIDAL L  +
Sbjct  346  DTCSDVVNEHWKDSSSSVLNIYHELIAAGLRIWVFSGDADAVVPVTATRYSIDALNLRPL  405

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            SP+ PWY +GQVGGWTQ+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  406  SPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEALALFKAFISGTQL  460



>ref|XP_009127511.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=481

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 129/175 (74%), Gaps = 1/175 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C  S S    +LKRR     +  + YDPCTE+HS +YFNLPEVQ+ALHV    +  +W
Sbjct  289  PACVASASQSRMLLKRRPVNSRVSEQ-YDPCTEKHSKVYFNLPEVQRALHVPPEVAPSKW  347

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TC+  V + W DC ++VLD+Y ELI AG+RIWVFSGD DAV+PVTSTRYSIDAL L + 
Sbjct  348  DTCNYVVNENWNDCASSVLDIYHELIAAGIRIWVFSGDADAVVPVTSTRYSIDALNLSST  407

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            SP+ PWY +GQVGGWTQ+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  408  SPYGPWYTDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEALALFKAFISGTPL  462



>gb|KFK29659.1| hypothetical protein AALP_AA7G162000 [Arabis alpina]
Length=478

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 130/175 (74%), Gaps = 1/175 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C  + S    +LK+R      +   YDPCTE+HS +YFNLPEV+ ALHV +  +S +W
Sbjct  285  PACLANASQTKMLLKKRPM-TSRVSEQYDPCTEKHSKVYFNLPEVKTALHVPSRLASAKW  343

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD V + WKDC ++VL++Y ELI AGLRIWVFSGD DAV+PVTSTRYSIDAL L  +
Sbjct  344  DTCSDVVNEHWKDCSSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDALNLRPL  403

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            S + PWY +GQVGGWTQ+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  404  STYGPWYMDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEALALFKAFISGTQL  458



>ref|XP_009378094.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 124/153 (81%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN P+VQKALH + T  S+ W TCSD V ++W D P ++L +Y+
Sbjct  302  MSRAYDPCTERYSEVYFNRPDVQKALHANVTRVSYPWKTCSDIVGNYWADSPLSILPIYR  361

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGLRIWVFSGDTD+V+PVT+TRYSIDALKLPT++ W PW +NG+VGGW+Q Y+GLT
Sbjct  362  ELIAAGLRIWVFSGDTDSVVPVTATRYSIDALKLPTITNWYPWNNNGKVGGWSQVYKGLT  421

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            FV V GAGH+V LHRP+LA+ L  SFLA  +MP
Sbjct  422  FVTVTGAGHEVPLHRPRLAVILFRSFLASKAMP  454



>ref|XP_010264739.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 121/153 (79%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S IYFN PEVQKALH + T  S+ W TCSD V D+W D P ++L +Y+
Sbjct  305  MPRAYDPCTERYSIIYFNRPEVQKALHANLTAISYPWKTCSDIVGDYWADSPLSMLPIYE  364

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGLRIWVFSGDTDAV+P+T+TRYSIDALKLPTV  W PWYD+G+VGGW+Q Y+GLT
Sbjct  365  ELIAAGLRIWVFSGDTDAVVPLTATRYSIDALKLPTVMNWYPWYDHGKVGGWSQVYKGLT  424

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            FV VRGAGH+V LHRP+  L L + FL    MP
Sbjct  425  FVTVRGAGHEVPLHRPRQVLILFKYFLENKPMP  457



>ref|XP_008368824.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 122/153 (80%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN P+VQKALH + T  S+ W TCSD V ++W D P ++L +Y+
Sbjct  302  MSRAYDPCTERYSEVYFNRPDVQKALHANVTRVSYPWKTCSDIVGNYWADSPLSMLPIYK  361

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGLRIWVFSGDTD+V+PVT+TRYSIDALKLPT++ W PW DNG+VGGW+Q Y+GLT
Sbjct  362  ELIAAGLRIWVFSGDTDSVVPVTATRYSIDALKLPTITNWYPWNDNGKVGGWSQVYKGLT  421

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            FV V GAGH+V LHRP+LA  L  SFL   +MP
Sbjct  422  FVTVTGAGHEVPLHRPRLAFILFRSFLGSKAMP  454



>ref|XP_009592854.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana tomentosiformis]
Length=456

 Score =   220 bits (561),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 120/153 (78%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S IYFNLPEVQKA H + T  ++ W TCSD V ++W D P ++L +YQ
Sbjct  303  MSRAYDPCTERYSEIYFNLPEVQKAFHANVTKVAYPWKTCSDIVGNYWADSPLSMLPIYQ  362

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGLRIWVFSGDTD+V+PVT+TRYSIDALKLPT++ W PWYDN +VGGW+Q Y+GLT
Sbjct  363  ELIAAGLRIWVFSGDTDSVVPVTATRYSIDALKLPTITNWYPWYDNKKVGGWSQVYKGLT  422

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V V GAGH+V LHRP+ A  L+ SFL    MP
Sbjct  423  LVTVTGAGHEVPLHRPRQAFILLRSFLENKPMP  455



>ref|XP_004968265.1| PREDICTED: serine carboxypeptidase 2-like [Setaria italica]
Length=523

 Score =   222 bits (565),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 128/175 (73%), Gaps = 3/175 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC ++     R ++ R      L R YDPCTE++S  Y+NLPEVQKALH + T   + W
Sbjct  342  PTCKKTSLHKRRQIRGR---TPWLPRGYDPCTEKYSEKYYNLPEVQKALHANVTGIPYAW  398

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
            V CSD +YD+WKD P ++L +Y+ELI AG+RIWVFSGD D+V+P+T+TRYSIDAL LPTV
Sbjct  399  VACSDPIYDYWKDSPKSMLPIYRELIAAGIRIWVFSGDADSVVPLTATRYSIDALSLPTV  458

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            + W PWYDNG+VGGW Q Y+GLT V VRGAGH+VALHRP+  L L E FL    M
Sbjct  459  TNWYPWYDNGEVGGWCQVYKGLTLVTVRGAGHEVALHRPRQGLKLFEHFLRDEPM  513



>ref|XP_009802382.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana sylvestris]
Length=456

 Score =   220 bits (561),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 121/153 (79%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFNLPEVQKA H + T  ++ W TCSD V ++W D P ++L +YQ
Sbjct  303  MSRAYDPCTERYSEVYFNLPEVQKAFHANVTKVAYPWKTCSDIVGNYWADSPLSMLPIYQ  362

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI+AGLRIWVFSGDTD+V+PVT+TRYSIDALKLPT++ W PWYDN +VGGW+Q Y+GLT
Sbjct  363  ELISAGLRIWVFSGDTDSVVPVTATRYSIDALKLPTITNWYPWYDNKKVGGWSQVYKGLT  422

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V V GAGH+V LHRP+ A  L+ SFL    MP
Sbjct  423  LVTVTGAGHEVPLHRPRQAFILLRSFLENKPMP  455



>dbj|BAK06862.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=228

 Score =   213 bits (542),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 117/153 (76%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            L R YDPCTER+S IY+NLPEVQ ALH +TT   + W TCSD V  +W D P ++L +Y 
Sbjct  74   LSRAYDPCTERYSNIYYNLPEVQTALHANTTGIKYPWKTCSDIVGSYWADSPRSMLPIYH  133

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AG+RIWVFSGDTDAV+P+T+TRYSI ALKLPT+  W PWYD+G+VGGW+Q Y+GLT
Sbjct  134  ELIAAGIRIWVFSGDTDAVVPITATRYSISALKLPTLMNWYPWYDHGKVGGWSQVYKGLT  193

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V V GAGH+V LHRP+ AL L   FL  T MP
Sbjct  194  LVTVAGAGHEVPLHRPRQALILFRHFLKDTPMP  226



>emb|CDX68695.1| BnaC01g07580D [Brassica napus]
Length=481

 Score =   221 bits (562),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 128/175 (73%), Gaps = 1/175 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C  S S  SR+L  R      +   YDPCTE+HS +YFNLPEVQ+ALHV    +  +W
Sbjct  289  PACVASAS-QSRMLLNRRPVNSRVSEQYDPCTEQHSKVYFNLPEVQRALHVPPEVAPSKW  347

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TC+  V + W DC ++VLD+Y ELI AG+RIWVFSGD DAV+PVTSTRYSIDAL L T 
Sbjct  348  DTCNYVVNENWNDCASSVLDIYHELIAAGIRIWVFSGDADAVVPVTSTRYSIDALNLSTT  407

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            SP+ PWY +GQVGGWTQ+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  408  SPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEALALFKAFISGTPL  462



>emb|CDO99730.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   220 bits (560),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 128/177 (72%), Gaps = 6/177 (3%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFE  491
            P C  S S     L+RR R     + R YDPCTERHST+YFNLPEVQ+A H +TT   + 
Sbjct  288  PPCNASSS-----LRRRFRVHFPWMPRAYDPCTERHSTVYFNLPEVQEAFHANTTGIPYP  342

Query  490  WVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPT  311
            W TCSD V  +W D P +VL +YQ L+ AGL+IWVFSGDTD+V+P+T+TRYSIDALKLPT
Sbjct  343  WKTCSDTVGIYWTDAPLSVLPIYQGLMAAGLKIWVFSGDTDSVVPITATRYSIDALKLPT  402

Query  310  VSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            ++ W PWYDN +VGGW+Q Y+GL FV V GAGH+V LHRP+LA  L  SFL    MP
Sbjct  403  ITNWYPWYDNKRVGGWSQVYKGLIFVTVTGAGHEVPLHRPRLAYILFRSFLENEPMP  459



>gb|KJB78938.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=470

 Score =   220 bits (561),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 120/153 (78%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R +DPCTER+S  YFN PEVQKALH + T   ++W TCSD V   W D P ++L +YQ
Sbjct  303  MSRAFDPCTERYSKEYFNRPEVQKALHANVTGIPYQWETCSDVVGYNWTDSPLSMLPIYQ  362

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AG+RIWV+SGDTDAV+PVT+TRYSIDALKLPT++ W PWYDNG+VGGW+QEY+GLT
Sbjct  363  ELIAAGIRIWVYSGDTDAVVPVTATRYSIDALKLPTINKWHPWYDNGKVGGWSQEYKGLT  422

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            FV V GAGH+V LHRP+ A  L  SFL   SMP
Sbjct  423  FVTVTGAGHEVPLHRPRQAFILFRSFLENKSMP  455



>ref|NP_567854.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
 sp|Q949Q7.1|SCP29_ARATH RecName: Full=Serine carboxypeptidase-like 29; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK93635.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM91708.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEE85811.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
Length=479

 Score =   220 bits (561),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 130/175 (74%), Gaps = 1/175 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C  + S  + +LK+R      +   YDPCTE+H+T+YFNLPEVQKALHV    +  +W
Sbjct  288  PACVANASQSNMLLKKRPM-TSRVSEQYDPCTEKHTTVYFNLPEVQKALHVPPGLAPSKW  346

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD V + W D P++VL++Y ELI AGLRIWVFSGD DAV+PVTSTRYSIDAL L  +
Sbjct  347  DTCSDVVSEHWNDSPSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDALNLRPL  406

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            S + PWY +GQVGGW+Q+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  407  SAYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQALALFKAFISGTPL  461



>ref|XP_006850617.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
 gb|ERN12198.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
Length=461

 Score =   220 bits (560),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 126/167 (75%), Gaps = 3/167 (2%)
 Frame = -3

Query  637  SRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYD  461
            S  LK + R     + R YDPCTERHS +YFNLPEVQKALH + T   + W TCSD V +
Sbjct  293  SATLKNKPRGHYPWMSRAYDPCTERHSKVYFNLPEVQKALHANVTGIPYPWATCSDVVGN  352

Query  460  FWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDN  281
             W+D P ++L +YQELI AG RIWVFSGDTD+V+PVT+TRYS+DALKLPT++ W PWYDN
Sbjct  353  NWQDSPKSMLPIYQELIAAGFRIWVFSGDTDSVVPVTATRYSLDALKLPTLTNWYPWYDN  412

Query  280  GQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            G+VGGW+Q Y GLTFV + GAGH+V LHRP+ A  L +SFL   +MP
Sbjct  413  GKVGGWSQVYRGLTFVTITGAGHEVPLHRPRQAFILFKSFL--QNMP  457



>ref|XP_011040963.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN PEVQKALH + T   + W TCS+ V D+W D P ++L +Y+
Sbjct  304  MSRAYDPCTERYSKVYFNRPEVQKALHANVTGIPYPWETCSNIVGDYWADSPLSMLPIYK  363

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y GLT
Sbjct  364  ELIAAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTIINWYPWYDSGKVGGWSQVYTGLT  423

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMPG  137
            FV V GAGH+V LHRP+ A  L  SFL   SMPG
Sbjct  424  FVTVTGAGHEVPLHRPRQAFILFMSFLGNKSMPG  457



>ref|XP_009108967.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=477

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 130/175 (74%), Gaps = 1/175 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C  + S  + +LK+R R    +   YDPCTE+HS +YFNLPEVQ+ALHV    +  +W
Sbjct  286  PACIANASQSNMLLKKRPR-TSRVSEQYDPCTEKHSKVYFNLPEVQEALHVPPGLAPSKW  344

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD V + WKD  ++VL++Y ELI AGLRIWVFSGD DAV+PVT+TRYSIDAL L  +
Sbjct  345  DTCSDVVNENWKDSSSSVLNIYHELIAAGLRIWVFSGDADAVVPVTATRYSIDALNLRPL  404

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            SP+ PWY +GQVGGWTQ+Y GL FV VRGAGH+V LHRPK  L L ++F++GT +
Sbjct  405  SPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEGLALFKAFISGTPL  459



>gb|KJB76568.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=304

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN  EVQKALH + T  S+ W TCSD V ++W D P ++L +Y+
Sbjct  151  MSRAYDPCTERYSKVYFNRLEVQKALHANVTALSYPWQTCSDIVGNYWTDAPLSMLPIYK  210

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPTV  W PWYDNG+VGGW+Q Y+GLT
Sbjct  211  ELIAAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTVINWYPWYDNGKVGGWSQAYKGLT  270

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V V GAGH+V LHRP+ A  L  SFL    MP
Sbjct  271  LVTVTGAGHEVPLHRPRQAFILFRSFLENKLMP  303



>ref|XP_006350225.1| PREDICTED: serine carboxypeptidase-like 27-like [Solanum tuberosum]
Length=456

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFNLPEVQKA H + T  ++ W TCSD V D+W D P ++L +YQ
Sbjct  303  MSRAYDPCTERYSDVYFNLPEVQKAFHANVTKIAYPWKTCSDIVGDYWDDSPLSMLPIYQ  362

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGLRIWVFSGDTD+V+P+T+TRYSIDALKLPT++ W PWYDN +VGGW+Q Y+GLT
Sbjct  363  ELIAAGLRIWVFSGDTDSVVPLTATRYSIDALKLPTITNWYPWYDNKKVGGWSQLYKGLT  422

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V + GAGH+V LHRP+ A  L  SFL    MP
Sbjct  423  LVTITGAGHEVPLHRPRQAFILFRSFLENKPMP  455



>ref|XP_002869361.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45620.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 129/175 (74%), Gaps = 1/175 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C  + S  + +LK+R      +   YDPCTE+H+T+YFNLPEVQKALHV    +  +W
Sbjct  288  PACVANASQSNMLLKKRPM-TSRVSEQYDPCTEKHTTVYFNLPEVQKALHVPAGLAPSKW  346

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD V + W D P++VL++Y ELI AGLRIWVFSGD DAV+PVTSTRYSIDAL L  +
Sbjct  347  DTCSDVVNEHWNDSPSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDALNLRPL  406

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            S + PWY +GQVGGW+Q+Y GL FV VRGAGH+V LHRPK A  L ++F++GT +
Sbjct  407  SVYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQAFALFKAFISGTPL  461



>ref|XP_007219592.1| hypothetical protein PRUPE_ppa023509mg, partial [Prunus persica]
 gb|EMJ20791.1| hypothetical protein PRUPE_ppa023509mg, partial [Prunus persica]
Length=397

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN PEVQ+A H + T  S+ W TCSD V  +W D P ++L +Y+
Sbjct  244  MSRAYDPCTERYSEVYFNHPEVQRAFHANVTGISYPWQTCSDIVGTYWADSPLSMLPIYR  303

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPT++ W PWYDNG+VGGW Q Y+GLT
Sbjct  304  ELIAAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTITNWSPWYDNGKVGGWNQIYKGLT  363

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            FV V GAGH+V LHRP+ A  + +SFL G  M
Sbjct  364  FVTVTGAGHEVPLHRPRQAFIVFKSFLEGKPM  395



>gb|KHG25905.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=470

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 120/153 (78%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R +DPCTER+S  YFN PEVQKALH + T   ++W TCSD +   W D P ++L +YQ
Sbjct  303  MSRAFDPCTERYSKEYFNRPEVQKALHANVTGIPYQWETCSDVIGYNWTDSPLSMLPIYQ  362

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AG+RIWV+SGDTDAV+PVT+TRYSIDALKLPT++ W PWY+NG+VGGW+QEY+GLT
Sbjct  363  ELIAAGIRIWVYSGDTDAVVPVTATRYSIDALKLPTINKWHPWYENGKVGGWSQEYKGLT  422

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            FV V GAGH+V LHRP+ A  L  SFL   SMP
Sbjct  423  FVTVTGAGHEVPLHRPRQAFILFRSFLENKSMP  455



>ref|XP_006645520.1| PREDICTED: serine carboxypeptidase II-1-like [Oryza brachyantha]
Length=412

 Score =   216 bits (551),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 129/176 (73%), Gaps = 3/176 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC ++  +  R++K     +  L R YDPCTE++ST Y+NLPEVQKA H + T   + W
Sbjct  231  PTCKKTSFLKRRLIKG---NMPWLPRGYDPCTEKYSTKYYNLPEVQKAFHANVTGIPYAW  287

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD+++ +WKD P ++L +Y+ELI AGLRIWVFSGD D+V+P+T+TRYSIDAL LPTV
Sbjct  288  TTCSDDLFYYWKDSPRSMLPIYRELIAAGLRIWVFSGDADSVVPLTATRYSIDALHLPTV  347

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            + W PWYD+ +V GW Q Y+GLT V +RGAGH+V LHRP+ AL L E FL    MP
Sbjct  348  TNWYPWYDDDEVAGWCQVYQGLTLVTIRGAGHEVPLHRPRQALKLFEHFLQDNPMP  403



>ref|XP_006589433.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=460

 Score =   218 bits (554),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN PEVQKA H + T   + W  CSD V ++W D P ++L +Y+
Sbjct  305  MSRAYDPCTERYSDLYFNRPEVQKAFHANVTGIPYAWKACSDIVGNYWTDSPLSMLPIYR  364

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI+AGLRIWV+SGDTDAV+P+T+TRYSIDALKLPT+  W PWYDNG+VGGW+Q Y+GLT
Sbjct  365  ELISAGLRIWVYSGDTDAVVPMTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLT  424

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V VRGAGH+V LHRP+ A  L  SFL   SMP
Sbjct  425  LVTVRGAGHEVPLHRPRQAFILFRSFLENKSMP  457



>gb|KHN17121.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=459

 Score =   218 bits (554),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN PEVQKA H + T   + W  CSD V ++W D P ++L +Y+
Sbjct  304  MSRAYDPCTERYSDLYFNRPEVQKAFHANVTGIPYAWKACSDIVGNYWTDSPLSMLPIYR  363

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI+AGLRIWV+SGDTDAV+P+T+TRYSIDALKLPT+  W PWYDNG+VGGW+Q Y+GLT
Sbjct  364  ELISAGLRIWVYSGDTDAVVPMTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLT  423

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V VRGAGH+V LHRP+ A  L  SFL   SMP
Sbjct  424  LVTVRGAGHEVPLHRPRQAFILFRSFLENKSMP  456



>gb|AFK43035.1| unknown [Medicago truncatula]
Length=459

 Score =   217 bits (553),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 128/182 (70%), Gaps = 4/182 (2%)
 Frame = -3

Query  685  PTASSPPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  506
            P +   P C  + S+ S +  R       + R YDPCTERHS +YFN PEVQKALH + T
Sbjct  279  PYSIYTPPCNNTASLRSGLNGRYP----WMSRAYDPCTERHSDVYFNCPEVQKALHANVT  334

Query  505  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  326
               + W TCSD V ++W D P ++L +Y ELI AGLRIWVFSGDTD+V+P+T+TRYSIDA
Sbjct  335  GIPYIWKTCSDIVGNYWTDSPLSMLPIYHELINAGLRIWVFSGDTDSVVPLTATRYSIDA  394

Query  325  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  146
            LKLPT+  W PWYD+G+VGGW+Q Y+GLT V +RGAGH+V LH+P+ A  L  SFL    
Sbjct  395  LKLPTIINWYPWYDSGKVGGWSQVYKGLTLVTIRGAGHEVPLHKPREAFILFRSFLENKD  454

Query  145  MP  140
            MP
Sbjct  455  MP  456



>dbj|BAO04184.1| hypothetical protein [Delphinium grandiflorum]
Length=456

 Score =   217 bits (553),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 129/176 (73%), Gaps = 4/176 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC+ + S    + K R R    +   YDPCTE+HST+YFNLPEVQKALH + T   + W
Sbjct  284  PTCSATISQRRNLRKIRPR----ISVPYDPCTEKHSTVYFNLPEVQKALHANVTGIPYPW  339

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TC+D + D WKD P ++L +Y+ELI AG+RIWVFSGDTD+V+PVT+TRYS+D L+LPT+
Sbjct  340  ATCNDIIGDNWKDSPRSMLPIYRELIAAGIRIWVFSGDTDSVVPVTATRYSLDTLELPTL  399

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
              W PWYDNGQ+GGW++ Y+GL+ + VRGAGH+V LH P+ A  + +SFL    MP
Sbjct  400  VKWHPWYDNGQMGGWSEVYDGLSLIVVRGAGHEVPLHAPRKAYIMFKSFLENKPMP  455



>ref|XP_006412667.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
 gb|ESQ54120.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
Length=480

 Score =   218 bits (554),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 130/175 (74%), Gaps = 1/175 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C  + S  S++L  + R    +   YDPCTE+HS +YFNLPEV++ALHV    +S +W
Sbjct  289  PACVANAS-QSKMLLNKRRMTSRVSEQYDPCTEKHSKVYFNLPEVKEALHVPPGLASSKW  347

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCS+ V + W D P++VL++Y ELI AGLRIWVFSGD DAV+PVT+TRYSIDAL L  +
Sbjct  348  DTCSNVVNEHWNDSPSSVLNIYHELIAAGLRIWVFSGDADAVVPVTATRYSIDALNLRPL  407

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            S + PWY +GQVGGWTQ+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  408  STYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEALALFKAFISGTPL  462



>ref|XP_003591950.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62201.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=459

 Score =   217 bits (552),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 128/182 (70%), Gaps = 4/182 (2%)
 Frame = -3

Query  685  PTASSPPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  506
            P +   P C  + S+ S +  R       + R YDPCTERHS +YFN PEVQKALH + T
Sbjct  279  PYSIYTPPCNNTASLRSGLNGRYP----WMSRAYDPCTERHSDVYFNRPEVQKALHANVT  334

Query  505  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  326
               + W TCSD V ++W D P ++L +Y ELI AGLRIWVFSGDTD+V+P+T+TRYSIDA
Sbjct  335  GIPYIWKTCSDIVGNYWTDSPLSMLPIYHELINAGLRIWVFSGDTDSVVPLTATRYSIDA  394

Query  325  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  146
            LKLPT+  W PWYD+G+VGGW+Q Y+GLT V +RGAGH+V LH+P+ A  L  SFL    
Sbjct  395  LKLPTIINWYPWYDSGKVGGWSQVYKGLTLVTIRGAGHEVPLHKPREAFILFRSFLENKD  454

Query  145  MP  140
            MP
Sbjct  455  MP  456



>ref|XP_003560871.1| PREDICTED: serine carboxypeptidase 2-like [Brachypodium distachyon]
Length=482

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 130/185 (70%), Gaps = 8/185 (4%)
 Frame = -3

Query  667  PTCTESFSIM---SRVLKRRDRKVG----LLRRIYDPCTERHSTIYFNLPEVQKALHVHT  509
            PTC  + S +   S V+ RR    G    +    YDPCTER+ST Y+N PEVQKALH + 
Sbjct  290  PTCNTNASALPTPSSVVSRRQHPKGRYPWMTGGSYDPCTERYSTAYYNRPEVQKALHANV  349

Query  508  TNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSID  329
            T  ++ W  CSD +   W D P ++L +Y+E+I AGLRIWVFSGDTD+V+P T+TRYSID
Sbjct  350  TGINYAWAACSDTINGNWSDSPRSMLSIYKEIIQAGLRIWVFSGDTDSVVPSTATRYSID  409

Query  328  ALKLPTVSPWRPWYDNGQ-VGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAG  152
            AL LPT + W PWYD+ Q VGGW+Q YEGLT V VRGAGH+VALHRP+ AL L ++FL G
Sbjct  410  ALVLPTTTDWYPWYDDNQEVGGWSQVYEGLTLVTVRGAGHEVALHRPRQALILFQNFLQG  469

Query  151  TSMPG  137
              MPG
Sbjct  470  KPMPG  474



>ref|NP_001044713.1| Os01g0833500 [Oryza sativa Japonica Group]
 dbj|BAD73778.1| putative serine carboxypeptidase II [Oryza sativa Japonica Group]
 dbj|BAF06627.1| Os01g0833500 [Oryza sativa Japonica Group]
 gb|EAZ14049.1| hypothetical protein OsJ_03974 [Oryza sativa Japonica Group]
 dbj|BAG93392.1| unnamed protein product [Oryza sativa Japonica Group]
Length=454

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            L R YDPCTER+S+IY+N PEVQ A+H +TT   + W TCSD V  +W D P ++L +YQ
Sbjct  300  LSRAYDPCTERYSSIYYNRPEVQIAMHANTTGIQYSWKTCSDIVGSYWADSPKSMLPIYQ  359

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AG+RIWVFSGDTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT
Sbjct  360  ELIAAGIRIWVFSGDTDAVVPVTATRYSIDALKLPTMVNWYPWYDHGKVGGWSQVYKGLT  419

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V + GAGH+V LHRP+ AL L   FL  T MP
Sbjct  420  LVTIAGAGHEVPLHRPREALILFRHFLQNTPMP  452



>ref|XP_002315292.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF01463.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN PEVQKALH + T   + W TCS+ V D+W D P ++L +Y+
Sbjct  304  MSRAYDPCTERYSKVYFNRPEVQKALHANVTGIPYPWETCSNIVGDYWADSPLSMLPIYK  363

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y GLT
Sbjct  364  ELIAAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTIINWYPWYDSGKVGGWSQVYTGLT  423

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMPG  137
            FV V GAGH+V L RP+ A  L  SFL   SMPG
Sbjct  424  FVTVTGAGHEVPLRRPRQAFILFMSFLGNKSMPG  457



>gb|EAY76388.1| hypothetical protein OsI_04319 [Oryza sativa Indica Group]
Length=454

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            L R YDPCTER+S+IY+N PEVQ A+H +TT   + W TCSD V  +W D P ++L +YQ
Sbjct  300  LSRAYDPCTERYSSIYYNRPEVQIAMHANTTGIQYSWKTCSDIVGSYWADSPKSMLPIYQ  359

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AG+RIWVFSGDTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT
Sbjct  360  ELIAAGIRIWVFSGDTDAVVPVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLT  419

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V + GAGH+V LHRP+ AL L   FL  T MP
Sbjct  420  LVTIAGAGHEVPLHRPREALILFRHFLQNTPMP  452



>ref|XP_004236634.1| PREDICTED: serine carboxypeptidase-like 27 [Solanum lycopersicum]
Length=456

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFNLPEVQKA H + T  ++ W TCSD V D+W D P ++L +Y 
Sbjct  303  MSRAYDPCTERYSDVYFNLPEVQKAFHANVTKIAYPWKTCSDIVGDYWDDSPLSMLPIYH  362

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGLRIWVFSGDTD+V+P+T+TRYSIDALKLPT++ W PWYDN +VGGW+Q Y+GLT
Sbjct  363  ELIAAGLRIWVFSGDTDSVVPLTATRYSIDALKLPTITNWYPWYDNKKVGGWSQIYKGLT  422

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V + GAGH+V LHRP+ A  L  SFL    MP
Sbjct  423  LVTITGAGHEVPLHRPRQAFILFRSFLENKPMP  455



>ref|XP_008233341.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
 ref|XP_008233342.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
Length=455

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN PEVQ+A H + T  S+ W TCSD V  +W D P ++L +Y+
Sbjct  302  MSRAYDPCTERYSEVYFNHPEVQRAFHANVTGISYPWQTCSDIVGTYWADSPLSMLPIYR  361

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPT++ W PWYDNG+VGGW Q Y+GLT
Sbjct  362  ELIAAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTITNWSPWYDNGKVGGWNQIYKGLT  421

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            FV V GAGH+V LHRP+ A  +  SFL G  M
Sbjct  422  FVTVTGAGHEVPLHRPRQAFIVFRSFLEGKPM  453



>ref|XP_010541227.1| PREDICTED: serine carboxypeptidase-like 29 [Tarenaya hassleriana]
Length=346

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 128/182 (70%), Gaps = 1/182 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC  + S    +LK+R    G +   YDPCTE+HS +YFN PEVQKALHV    +  +W
Sbjct  149  PTCPANVSQSKLLLKKRP-IFGRVSEEYDPCTEKHSRVYFNPPEVQKALHVPPEFAPSKW  207

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
              CSD V + W D P +VL++Y ELI  GLRIWVFSGD DAV+PVT+TRYSI+AL L  +
Sbjct  208  DICSDTVSEHWNDSPPSVLNIYHELIAVGLRIWVFSGDADAVVPVTATRYSIEALNLRPL  267

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
            SPW  WY +GQV GWTQ+Y GL FV VRGAGH+V LHRPK +L L ++F++G  +P  ++
Sbjct  268  SPWYSWYMDGQVAGWTQQYAGLNFVTVRGAGHEVPLHRPKQSLELFKAFVSGNPLPTSEK  327

Query  127  IS  122
             S
Sbjct  328  NS  329



>ref|XP_007143689.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
 gb|ESW15683.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
Length=459

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 117/153 (76%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S  YFN PEVQKA H + T   +EW  CSD V ++W D P ++L +YQ
Sbjct  305  MSRAYDPCTERYSDSYFNRPEVQKAFHANVTGIPYEWKACSDIVGNYWTDSPLSMLPIYQ  364

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AG RIWV+SGDTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT
Sbjct  365  ELIRAGYRIWVYSGDTDAVVPVTATRYSIDALKLPTIINWYPWYDSGKVGGWSQVYKGLT  424

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V VRGAGH+V LHRP+ A  L  SFL   SMP
Sbjct  425  MVTVRGAGHEVPLHRPREAFILFSSFLQNKSMP  457



>ref|XP_010447670.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=479

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 129/175 (74%), Gaps = 1/175 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C  + S  + +LK+R    G +   YDPCTE+H+ +YFNLPEVQKALHV    +  +W
Sbjct  288  PACVANASQSNMLLKKRPM-TGRVSEQYDPCTEKHTKVYFNLPEVQKALHVPPGLAPSKW  346

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCS+ V   WKD  ++VL++Y ELI AGLRIWVFSGD DAV+PVTSTRYSIDAL L  +
Sbjct  347  DTCSNVVNGHWKDSSSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDALNLRPL  406

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            S + PWY +GQVGGW+Q+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  407  SAYGPWYLDGQVGGWSQQYAGLKFVTVRGAGHEVPLHRPKQALALFKAFISGTPL  461



>ref|XP_006410747.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
 gb|ESQ52200.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
Length=449

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 129/175 (74%), Gaps = 4/175 (2%)
 Frame = -3

Query  664  TCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            TC  E+ ++ SR L+ R      + R YDPCTER+S+ YFN PEVQKA+H +TT  +++W
Sbjct  278  TCKKEAAALRSRFLRVRHP---WMWRAYDPCTERYSSTYFNSPEVQKAMHANTTGLAYQW  334

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD V + W D P ++L +Y+ELI AG+RIWVFSGDTD+V+PVT TRYSI ALKLP V
Sbjct  335  KTCSDIVGEKWSDSPLSMLPIYKELIAAGIRIWVFSGDTDSVVPVTGTRYSIRALKLPPV  394

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            S W PWYDNGQVGGW+Q Y+GLT V + GAGH+V LHRP+    L +SFLA   M
Sbjct  395  SKWYPWYDNGQVGGWSQVYKGLTLVTIHGAGHEVPLHRPRRGFLLFKSFLANKPM  449



>ref|XP_003564543.1| PREDICTED: serine carboxypeptidase-like 27 [Brachypodium distachyon]
Length=451

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            L R YDPCTER++ +Y+NLPEVQ ALH +TT   + W TCSD V  +W D P ++L +YQ
Sbjct  297  LSRAYDPCTERYANVYYNLPEVQMALHANTTGIQYPWKTCSDIVGSYWADSPKSMLPIYQ  356

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AG+RIWVFSGDTDAV+PVT+TRYSI ALKLPT+  W PWYD+G+VGGW+Q Y+GLT
Sbjct  357  ELIAAGIRIWVFSGDTDAVVPVTATRYSIKALKLPTLMNWYPWYDHGKVGGWSQVYKGLT  416

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V V GAGH+V LHRP+ AL L   FL  T MP
Sbjct  417  LVTVTGAGHEVPLHRPRQALILFRHFLKDTPMP  449



>ref|XP_006286217.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
 gb|EOA19115.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
Length=479

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 130/181 (72%), Gaps = 1/181 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C  + S  + +LK+R      +R  YDPCTE+H+ +YFNLPEVQ+ALHV    +  +W
Sbjct  288  PACLSNASQSNMLLKKRTM-TSRVREQYDPCTEKHTKVYFNLPEVQRALHVPPGLAPSKW  346

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD V + W D  ++VL++Y ELI AGLRIWVFSGD DAV+PVTSTRYSIDAL L  +
Sbjct  347  DTCSDVVNEHWNDSSSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDALNLRPL  406

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
            S + PWY +GQVGGW+Q+Y GL FV VRGAGH+V LHRPK AL L ++F++G  +   + 
Sbjct  407  SAYGPWYSDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQALELFKAFISGAPLSTHEN  466

Query  127  I  125
            I
Sbjct  467  I  467



>ref|XP_004496292.1| PREDICTED: serine carboxypeptidase-like 27-like isoform X1 [Cicer 
arietinum]
Length=462

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 131/182 (72%), Gaps = 4/182 (2%)
 Frame = -3

Query  685  PTASSPPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  506
            P +   P C ++ S + R L  R      + R YDPCTER+S +YFN PEVQKALH + T
Sbjct  281  PYSIYTPPCNDTAS-LRRGLNGR---YPWMSRAYDPCTERYSDLYFNRPEVQKALHANVT  336

Query  505  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  326
              S+ W TCSD V ++W D P ++L +YQELI A LRIWV+SGDTDAV+P+T+TR+SIDA
Sbjct  337  GISYPWKTCSDIVGNYWTDSPLSMLPIYQELINASLRIWVYSGDTDAVVPLTATRHSIDA  396

Query  325  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  146
            LKLPT+  W PWYD+G+VGGW+Q Y+GLTFV VRGAGH+V LHRP+ +  L  SFL    
Sbjct  397  LKLPTIINWYPWYDSGKVGGWSQVYKGLTFVTVRGAGHEVPLHRPRESFILFRSFLENKY  456

Query  145  MP  140
            MP
Sbjct  457  MP  458



>ref|XP_002457308.1| hypothetical protein SORBIDRAFT_03g005370 [Sorghum bicolor]
 gb|EES02428.1| hypothetical protein SORBIDRAFT_03g005370 [Sorghum bicolor]
Length=467

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 130/176 (74%), Gaps = 3/176 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC ++  +  R ++ R   +  L R YDPCTE + T Y+NLPEVQ+A H + T   + W
Sbjct  286  PTCKKTSLLKRRQIRGR---MPWLPRGYDPCTELYFTKYYNLPEVQEAFHANVTGIPYAW  342

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
            + CSD VY++W+D P ++L +Y+ELI+AGLRIWVFSGDTD+V+P+T+TRYSIDAL LPT+
Sbjct  343  IGCSDPVYEYWQDSPRSMLPIYRELISAGLRIWVFSGDTDSVVPLTATRYSIDALSLPTI  402

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            + W PWY + +VGGW Q YEGLT V VRGAGH+V LHRP+  L L+E FL G  MP
Sbjct  403  TKWYPWYYDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPRQGLKLLEHFLQGEPMP  458



>ref|XP_010438130.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=498

 Score =   216 bits (550),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 129/175 (74%), Gaps = 1/175 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C  + S  + +LK+R    G +   YDPCTE+H+ +YFNLPEVQKALHV    +  +W
Sbjct  307  PACVANASQSNMLLKKRPI-TGRVSEQYDPCTEKHTKVYFNLPEVQKALHVPPGLAPSKW  365

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCS+ V   WKD  ++VL++Y ELI AGLRIWVFSGD DAV+PVTSTRYSIDAL L  +
Sbjct  366  DTCSNVVNGHWKDSSSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDALNLRPL  425

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            S + PWY +GQVGGW+Q+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  426  SAYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQALALFKAFISGTPL  480



>ref|NP_001042076.1| Os01g0158200 [Oryza sativa Japonica Group]
 dbj|BAD61439.1| putative carboxypeptidase D [Oryza sativa Japonica Group]
 dbj|BAF03990.1| Os01g0158200 [Oryza sativa Japonica Group]
 gb|EAZ10621.1| hypothetical protein OsJ_00453 [Oryza sativa Japonica Group]
 dbj|BAG92359.1| unnamed protein product [Oryza sativa Japonica Group]
Length=471

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 129/176 (73%), Gaps = 3/176 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC ++ S + R L R +     L R YDPCTE++ST Y+NLPEVQKA H + T   + W
Sbjct  290  PTCKKT-SFLKRRLIRGNSP--WLPRGYDPCTEKYSTKYYNLPEVQKAFHANVTGIPYAW  346

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD+++ +WKD P ++L +Y+ELI AGLRIWVFSGD D+V+P+T+TRYSIDAL LPTV
Sbjct  347  TTCSDDLFYYWKDSPRSMLPIYRELIAAGLRIWVFSGDADSVVPLTATRYSIDALYLPTV  406

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            + W PWYD+ +V GW Q Y+GLT V +RGAGH+V LHRP+ AL L E FL    MP
Sbjct  407  TNWYPWYDDEEVAGWCQVYQGLTLVTIRGAGHEVPLHRPRQALKLFEHFLQDKPMP  462



>gb|KDO48447.1| hypothetical protein CISIN_1g012819mg [Citrus sinensis]
Length=456

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN PEVQKALH + T  S+ W TCS+ V D W D P ++L +Y+
Sbjct  303  MSRAYDPCTERYSEVYFNHPEVQKALHANVTGISYPWRTCSEIVGDNWTDSPLSMLPIYK  362

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGL+IWVFSGDTDAV+PVT+TRYSIDALKLPTV  W PWYDN +VGGW+Q Y+GLT
Sbjct  363  ELIAAGLKIWVFSGDTDAVVPVTATRYSIDALKLPTVINWYPWYDNRKVGGWSQVYKGLT  422

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            FV V GAGH+V LHRP+ A  L  SFL    MP
Sbjct  423  FVTVTGAGHEVPLHRPRQAFILFRSFLENKPMP  455



>emb|CAN74854.1| hypothetical protein VITISV_028701 [Vitis vinifera]
Length=452

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFNLPEVQ ALH + T  S+ W TCS+ V  +W D P ++L +YQ
Sbjct  299  MSRAYDPCTERYSEVYFNLPEVQTALHANVTQVSYPWRTCSNIVGIYWADSPLSMLPIYQ  358

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGLRIWVFSGDTDAV+PVT+TRYSIDALKLPT++ W  WYDN +VGGW+Q Y+GLT
Sbjct  359  ELIAAGLRIWVFSGDTDAVVPVTATRYSIDALKLPTITNWYXWYDNHKVGGWSQVYKGLT  418

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            FV V GAGH+V LHRP+ A  L  SFL    MP
Sbjct  419  FVTVTGAGHEVPLHRPRQAYILFRSFLENKPMP  451



>gb|KJB76563.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=452

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN  EVQKALH + T  S+ W TCSD V ++W D P ++L +Y+
Sbjct  299  MSRAYDPCTERYSKVYFNRLEVQKALHANVTALSYPWQTCSDIVGNYWTDAPLSMLPIYK  358

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPTV  W PWYDNG+VGGW+Q Y+GLT
Sbjct  359  ELIAAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTVINWYPWYDNGKVGGWSQAYKGLT  418

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V V GAGH+V LHRP+ A  L  SFL    MP
Sbjct  419  LVTVTGAGHEVPLHRPRQAFILFRSFLENKLMP  451



>ref|XP_002274723.1| PREDICTED: serine carboxypeptidase-like 27 [Vitis vinifera]
 emb|CBI31485.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   214 bits (546),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFNLPEVQ ALH + T  S+ W TCS+ V  +W D P ++L +YQ
Sbjct  303  MSRAYDPCTERYSEVYFNLPEVQTALHANVTQVSYPWRTCSNIVGIYWADSPLSMLPIYQ  362

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGLRIWVFSGDTDAV+PVT+TRYSIDALKLPT++ W  WYDN +VGGW+Q Y+GLT
Sbjct  363  ELIAAGLRIWVFSGDTDAVVPVTATRYSIDALKLPTITNWYAWYDNHKVGGWSQVYKGLT  422

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            FV V GAGH+V LHRP+ A  L  SFL    MP
Sbjct  423  FVTVTGAGHEVPLHRPRQAYILFRSFLENKPMP  455



>gb|KJB76569.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=451

 Score =   214 bits (546),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN  EVQKALH + T  S+ W TCSD V ++W D P ++L +Y+
Sbjct  298  MSRAYDPCTERYSKVYFNRLEVQKALHANVTALSYPWQTCSDIVGNYWTDAPLSMLPIYK  357

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPTV  W PWYDNG+VGGW+Q Y+GLT
Sbjct  358  ELIAAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTVINWYPWYDNGKVGGWSQAYKGLT  417

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V V GAGH+V LHRP+ A  L  SFL    MP
Sbjct  418  LVTVTGAGHEVPLHRPRQAFILFRSFLENKLMP  450



>dbj|BAJ99174.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   214 bits (545),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 117/153 (76%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            L R YDPCTER+S IY+NLPEVQ ALH +TT   + W TCSD V  +W D P ++L +Y 
Sbjct  290  LSRAYDPCTERYSNIYYNLPEVQTALHANTTGIKYPWKTCSDIVGSYWADSPRSMLPIYH  349

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AG+RIWVFSGDTDAV+P+T+TRYSI ALKLPT+  W PWYD+G+VGGW+Q Y+GLT
Sbjct  350  ELIAAGIRIWVFSGDTDAVVPITATRYSISALKLPTLMNWYPWYDHGKVGGWSQVYKGLT  409

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V V GAGH+V LHRP+ AL L   FL  T MP
Sbjct  410  LVTVAGAGHEVPLHRPRQALILFRHFLKDTPMP  442



>dbj|BAB08188.1| unnamed protein product [Oryza sativa Japonica Group]
Length=490

 Score =   215 bits (548),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 141/220 (64%), Gaps = 19/220 (9%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC ++ S + R L R +     L R YDPCTE++ST Y+NLPEVQKA H + T   + W
Sbjct  290  PTCKKT-SFLKRRLIRGNSP--WLPRGYDPCTEKYSTKYYNLPEVQKAFHANVTGIPYAW  346

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD+++ +WKD P ++L +Y+ELI AGLRIWVFSGD D+V+P+T+TRYSIDAL LPTV
Sbjct  347  TTCSDDLFYYWKDSPRSMLPIYRELIAAGLRIWVFSGDADSVVPLTATRYSIDALYLPTV  406

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
            + W PWYD+ +V GW Q Y+GLT V +RGAGH+V LHRP+ AL L E FL    MP  + 
Sbjct  407  TNWYPWYDDEEVAGWCQVYQGLTLVTIRGAGHEVPLHRPRQALKLFEHFLQDKPMPQPEY  466

Query  127  ISDS*LFSPHGEERE*NG*QLLCYDV*CSCRKLVLDCCRH  8
             ++             N     CY   C C  L LD   H
Sbjct  467  TAE-------------NLTNESCY---CYCLVLALDQPEH  490



>gb|KHG08205.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=452

 Score =   214 bits (545),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN  EVQKALH + T  S+ W TCSD V ++W D P ++L +Y+
Sbjct  299  MSRAYDPCTERYSKVYFNRLEVQKALHANVTALSYPWQTCSDIVGNYWTDAPLSMLPIYK  358

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPT+  W PWYDNG+VGGW+Q Y+GLT
Sbjct  359  ELIAAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTIINWYPWYDNGKVGGWSQAYKGLT  418

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V V GAGH+V LHRP+ A  L  SFL    MP
Sbjct  419  LVTVTGAGHEVPLHRPRQAFILFRSFLENKLMP  451



>ref|XP_003591947.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62198.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=458

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 124/176 (70%), Gaps = 4/176 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C  + S+ S +  R       + R YDPC ER+S +YFN PEVQKALH + T  S+ W
Sbjct  285  PPCNNTASLRSGLHDRYP----WMYRAYDPCAERYSDVYFNRPEVQKALHANVTGISYAW  340

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
              CS  V+D+W D P ++L +YQELI A LRIWV+SGDTDAVIP+T+TRYSI ALKLPT+
Sbjct  341  KACSGTVWDYWTDSPLSMLPIYQELINADLRIWVYSGDTDAVIPLTATRYSIGALKLPTI  400

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
              W PWYDNG+V GW+Q Y+GLT V VRGAGH+V LHRP+ A  L  SFL   +MP
Sbjct  401  MNWYPWYDNGKVCGWSQVYKGLTLVTVRGAGHEVPLHRPREAFILFRSFLENKNMP  456



>tpg|DAA53383.1| TPA: hypothetical protein ZEAMMB73_784297 [Zea mays]
Length=340

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 127/176 (72%), Gaps = 3/176 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC ++ S+  R L R   ++  L R YDPCTE + T Y NLPEVQ A H + T   + W
Sbjct  159  PTCKKT-SLQKRRLIRG--RMPWLPRGYDPCTELYITKYCNLPEVQDAFHANVTGIPYAW  215

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
            V CSD +Y++WKD P ++L +Y+ELI+AGLRIWVFSGDTD+V+P+T+TRYSIDAL LPT+
Sbjct  216  VGCSDPIYEYWKDSPRSMLPIYRELISAGLRIWVFSGDTDSVVPLTATRYSIDALSLPTI  275

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            + W PWY + +VGGW Q YEGLT V VRGAGH+V LHRP   L L E FL G  MP
Sbjct  276  TKWYPWYYDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPPQGLKLFEHFLRGEPMP  331



>ref|XP_008381976.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 120/153 (78%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN P+VQKALH + T  S+ W TCSD V ++W D P ++L +Y+
Sbjct  302  MSRAYDPCTERYSEVYFNRPDVQKALHANVTKVSYPWQTCSDXVGNYWADSPLSMLPIYK  361

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGL+IWVFSGDTD+V+PVT+TRYSIDALKLPT++ W PW DNG+VGG +Q Y+GLT
Sbjct  362  ELIAAGLKIWVFSGDTDSVVPVTATRYSIDALKLPTITNWFPWNDNGKVGGRSQIYKGLT  421

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            FV V GAGH+V LHRP+LA  L  SFL    MP
Sbjct  422  FVTVTGAGHEVPLHRPRLAFILFRSFLESKPMP  454



>ref|XP_004307401.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
 ref|XP_011469671.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
Length=458

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 133/191 (70%), Gaps = 7/191 (4%)
 Frame = -3

Query  691  SIPTASSPPTCTESFSIMSR------VLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEV  533
            ++  A S     + +SI +R       LKR  R     + R YDPCTER+S  YFN PEV
Sbjct  267  ALKLADSEQGNIDPYSIFTRPCSSAAALKRNLRGHYPWMSRAYDPCTERYSEKYFNHPEV  326

Query  532  QKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPV  353
            QKALH + T  S+ W TCSD V ++W D P ++L +YQELI AGL+IWV+SGDTDAV+PV
Sbjct  327  QKALHANVTGLSYPWKTCSDFVGNYWSDSPRSMLPIYQELIAAGLKIWVYSGDTDAVVPV  386

Query  352  TSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTL  173
            T+TRYSIDALKLPT++ W PW D+G+VGGW+Q Y+GLT V + GAGH+V LHRP+ A  L
Sbjct  387  TATRYSIDALKLPTINNWSPWSDSGKVGGWSQIYKGLTLVTITGAGHEVPLHRPREAFIL  446

Query  172  VESFLAGTSMP  140
             +SFL    MP
Sbjct  447  FKSFLENKPMP  457



>ref|XP_006644961.1| PREDICTED: serine carboxypeptidase-like 27-like [Oryza brachyantha]
Length=455

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 117/153 (76%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            L R YDPCTER+S IY+N PEVQ A+H +TT   + W TCSD V  +W D P ++L +YQ
Sbjct  301  LSRAYDPCTERYSNIYYNRPEVQIAMHANTTGIQYPWKTCSDIVGSYWADSPKSMLPIYQ  360

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AG+RIWVFSGDTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT
Sbjct  361  ELIAAGIRIWVFSGDTDAVVPVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLT  420

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V V GAGH+V LHRP+ AL L   FL    MP
Sbjct  421  LVTVTGAGHEVPLHRPREALILFRHFLQNIPMP  453



>ref|XP_010908844.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=462

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 128/174 (74%), Gaps = 4/174 (2%)
 Frame = -3

Query  661  CTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVT  482
            C +S S + R LK R      + R YDPCT+R++ +Y+N PEVQ+ALH + T   + W T
Sbjct  292  CNDS-SALKRNLKGR---YPWMSRAYDPCTDRYAKVYYNRPEVQRALHANVTGIRYAWDT  347

Query  481  CSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSP  302
            CSD V ++W D P ++L +YQELI AG+RIWVFSGDTDAV+PVT+TRYSIDAL+LPT+  
Sbjct  348  CSDIVGNYWADSPRSMLPIYQELIAAGVRIWVFSGDTDAVVPVTATRYSIDALELPTLRR  407

Query  301  WRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            W PWYD+G+VGGW+Q Y+GLTFV + GAGH+V LHRP+ AL L   FL    MP
Sbjct  408  WYPWYDHGKVGGWSQVYKGLTFVTITGAGHEVPLHRPRQALILFRHFLQNKPMP  461



>gb|EMS47606.1| Serine carboxypeptidase-like 27 [Triticum urartu]
Length=470

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 117/153 (76%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            L R YDPCTER+S IY+NLPEVQ ALH +TT   + W TCSD V  +W D P ++L +Y 
Sbjct  316  LSRAYDPCTERYSNIYYNLPEVQAALHANTTGIKYPWKTCSDIVGSYWADSPRSMLPIYH  375

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AG++IWVFSGDTDAV+PVT+TRYSI ALKLPT+  W PWYD+G+VGGW+Q Y+GLT
Sbjct  376  ELIAAGIKIWVFSGDTDAVVPVTATRYSISALKLPTLMNWYPWYDHGKVGGWSQVYKGLT  435

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V V GAGH+V LHRP+ AL L   FL  T MP
Sbjct  436  LVTVAGAGHEVPLHRPRQALILFRHFLKDTPMP  468



>ref|XP_008805039.1| PREDICTED: serine carboxypeptidase-like 27 [Phoenix dactylifera]
Length=461

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = -3

Query  637  SRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYD  461
            S  LKR  R +   + R YDPCT+R++ +Y+N PEVQ+ALH + T   + W TCSD V +
Sbjct  294  SSALKRNLRGRYPWMSRAYDPCTDRYAKVYYNRPEVQRALHANVTGIHYAWDTCSDIVGN  353

Query  460  FWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDN  281
            +W D P ++L +YQELI AG+RIWVFSGDTDAV+PVT+TRYSIDALKLPT+  W PWYD+
Sbjct  354  YWADSPRSMLPIYQELIAAGVRIWVFSGDTDAVVPVTATRYSIDALKLPTLLRWYPWYDH  413

Query  280  GQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            G+VGGW+Q Y+GLTFV + GAGH+V LHRP+ AL L   FL    MP
Sbjct  414  GKVGGWSQVYKGLTFVTITGAGHEVPLHRPRQALILFRHFLQNKPMP  460



>ref|XP_002459313.1| hypothetical protein SORBIDRAFT_02g002260 [Sorghum bicolor]
 gb|EER95834.1| hypothetical protein SORBIDRAFT_02g002260 [Sorghum bicolor]
Length=478

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -3

Query  586  YDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELIT  407
            YDPCTE HST+Y+N PEVQ+ALH + T  ++ W TCSD +   W D P ++L +Y+ELI 
Sbjct  324  YDPCTESHSTVYYNRPEVQRALHANLTGINYPWATCSDLINTNWGDSPKSMLPIYKELIA  383

Query  406  AGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAV  227
            AGLRIWVFSGDTDAVIP+TSTRYS+DAL LPT + W PWYD  QVGGW+Q YEGLT V V
Sbjct  384  AGLRIWVFSGDTDAVIPLTSTRYSVDALGLPTTTSWYPWYDKKQVGGWSQVYEGLTLVTV  443

Query  226  RGAGHKVALHRPKLALTLVESFLAGTSMP  140
            RGAGH+V LHRP+ AL L + FL G  MP
Sbjct  444  RGAGHEVPLHRPRQALILFQQFLKGEPMP  472



>ref|XP_008446902.1| PREDICTED: serine carboxypeptidase-like 27 [Cucumis melo]
Length=457

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S  YFN P+VQKA H + T  ++ W TCSD V ++W D P ++L +YQ
Sbjct  304  MSRAYDPCTERYSVAYFNHPDVQKAFHANVTGITYPWSTCSDLVGNYWADSPLSMLPIYQ  363

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI +G+RIWVFSGDTD+V+PVT+TRYSIDALKLPT+S W PWYD+G+VGGW+Q Y+GLT
Sbjct  364  ELIVSGIRIWVFSGDTDSVVPVTATRYSIDALKLPTISNWYPWYDHGKVGGWSQIYKGLT  423

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            FV V GAGH+V LHRP+ A  L  SFL    +P
Sbjct  424  FVTVAGAGHEVPLHRPREAFILFRSFLEDKPLP  456



>gb|AAV43957.1| putative serine carboxypeptidase II [Oryza sativa Japonica Group]
Length=483

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 128/179 (72%), Gaps = 4/179 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVG---LLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSS  497
            PTC E+ S  S   ++R  K G    +   YDPCTER+ST Y+N PEVQ+ALH + T  +
Sbjct  296  PTCNET-STSSAAARQRRLKQGHYPWMTGSYDPCTERYSTEYYNRPEVQRALHANVTGIN  354

Query  496  FEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKL  317
            + W TCSD + D W+D P +VL +Y ELI AGLRIWVFSGDTDAV+P+T+TRYSIDAL L
Sbjct  355  YTWATCSDILNDNWRDSPRSVLPIYHELIAAGLRIWVFSGDTDAVVPLTATRYSIDALGL  414

Query  316  PTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            PT   W PWYD  +VGGW+Q Y+GL+ V VRGAGH+V LHRP+ AL L + FL G  MP
Sbjct  415  PTTVSWYPWYDAMKVGGWSQVYKGLSLVTVRGAGHEVPLHRPRQALILFKHFLQGKPMP  473



>gb|EEC69980.1| hypothetical protein OsI_00486 [Oryza sativa Indica Group]
Length=474

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 129/176 (73%), Gaps = 3/176 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC ++ S + R L R +  +  L R YDPCTE++S  Y+NLPEVQKA H + T   + W
Sbjct  293  PTCKKT-SFLKRRLIRGN--LPWLPRGYDPCTEKYSMKYYNLPEVQKAFHANVTGIPYAW  349

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD+++ +WKD P ++L +Y+ELI AGLRIWVFSGD D+V+P+T+TRYSIDAL LPTV
Sbjct  350  TTCSDDLFYYWKDSPRSMLPIYRELIAAGLRIWVFSGDADSVVPLTATRYSIDALYLPTV  409

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            + W PWYD+ +V GW Q Y+GLT V +RGAGH+V LHRP+ AL L E FL    MP
Sbjct  410  TNWYPWYDDEEVAGWCQVYQGLTLVTIRGAGHEVPLHRPRQALKLFEHFLQDKPMP  465



>ref|XP_006436271.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
 ref|XP_006485878.1| PREDICTED: serine carboxypeptidase-like 27-like [Citrus sinensis]
 gb|ESR49511.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
Length=456

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN PEVQKALH + T  S+ W TCS+ V D W D P ++L +Y+
Sbjct  303  MSRAYDPCTERYSEVYFNHPEVQKALHANVTWISYPWRTCSEIVGDNWTDSPLSMLPIYK  362

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGL+IWVFSGDTDAV+PVT+TRYSIDALKLPTV  W PWYDN +VGGW+Q Y+GLT
Sbjct  363  ELIAAGLKIWVFSGDTDAVVPVTATRYSIDALKLPTVINWYPWYDNRKVGGWSQVYKGLT  422

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            FV V GAGH+V LHRP+ A  L  SFL    MP
Sbjct  423  FVTVTGAGHEVPLHRPRQAFILFRSFLENKPMP  455



>ref|XP_004968264.1| PREDICTED: serine carboxypeptidase-like 27-like [Setaria italica]
Length=463

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 124/176 (70%), Gaps = 3/176 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC ++     R+++ R      L R YDPCT ++ST Y+NLPEVQKALH + T   + W
Sbjct  282  PTCKKTSLHRHRLIRGR---TPWLPRGYDPCTTQYSTKYYNLPEVQKALHANVTGIPYAW  338

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
            V CSD +Y +WKD P ++L +Y+ELI AG RIWVFSGD DAV+P+  TRYSIDAL LPT+
Sbjct  339  VACSDPIYKYWKDSPRSMLPIYRELIAAGKRIWVFSGDADAVVPLPGTRYSIDALFLPTI  398

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            S W  WYD G+VGGW Q Y+GLT V +RGAGH+V LHRP+L L L E FL    MP
Sbjct  399  SNWYAWYDQGEVGGWCQVYKGLTLVTIRGAGHEVPLHRPRLGLKLFEHFLRDEPMP  454



>ref|XP_006655142.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase 2-like 
[Oryza brachyantha]
Length=469

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 126/187 (67%), Gaps = 3/187 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVG---LLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSS  497
            PTC E+ S  +R  ++R  K G    +   YDPCTE +ST Y+N PEVQ ALH + T  +
Sbjct  278  PTCNETSSPAARARQQRRLKRGHYPWMTGSYDPCTEIYSTAYYNRPEVQTALHANVTGIN  337

Query  496  FEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKL  317
            + W TCSD + + W+D P TVL +Y ELI AGLRIWVFSGDTDAV+P+T TRYSIDAL L
Sbjct  338  YTWATCSDILNNNWRDSPRTVLPIYHELIAAGLRIWVFSGDTDAVVPLTGTRYSIDALGL  397

Query  316  PTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPG  137
            PT   W PWYD  +VGGW+Q Y+GLT V VRGAGH+V LHRP+ A  L   FL G  MP 
Sbjct  398  PTTINWYPWYDAIKVGGWSQVYKGLTLVTVRGAGHEVPLHRPRQAFILFNHFLKGKPMPN  457

Query  136  LQRISDS  116
               I  +
Sbjct  458  APTIKSA  464



>gb|ABK21145.1| unknown [Picea sitchensis]
Length=343

 Score =   209 bits (533),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = -3

Query  586  YDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELIT  407
            YDPCTE +S +YFN PEVQKA H + T+ S+ W TCSD +  +W+D P ++L +YQEL+ 
Sbjct  186  YDPCTESYSALYFNRPEVQKAFHANVTSISYSWTTCSDILEKYWQDSPRSMLPIYQELLR  245

Query  406  AGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAV  227
            AG+RIWVFSGDTDAV+PVT+TRYSIDAL+L T+  W PWYDN +VGGWTQ Y+GLT V +
Sbjct  246  AGIRIWVFSGDTDAVVPVTATRYSIDALRLRTIVNWYPWYDNQEVGGWTQIYKGLTLVTI  305

Query  226  RGAGHKVALHRPKLALTLVESFLAGTSMP  140
            RGAGH+V LH+P+ A  L ++FL G  MP
Sbjct  306  RGAGHEVPLHQPRKAFILFKAFLKGKPMP  334



>ref|XP_009333715.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   212 bits (540),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN P+VQKALH + T  S+ W TCSD V ++W D P ++L +Y+
Sbjct  302  MSRAYDPCTERYSEVYFNRPDVQKALHANVTKVSYPWQTCSDIVGNYWADSPLSMLPIYK  361

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGL+IWVFSGDTD+V+PVT+TRYSIDALKLPT++ W PW DNG+VGG  Q Y+GLT
Sbjct  362  ELIAAGLKIWVFSGDTDSVVPVTATRYSIDALKLPTITNWFPWNDNGKVGGRCQIYKGLT  421

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            FV V GAGH+V LHRP+LA  L  SFL    MP
Sbjct  422  FVTVTGAGHEVPLHRPRLAFILFRSFLESKPMP  454



>ref|XP_002458719.1| hypothetical protein SORBIDRAFT_03g038940 [Sorghum bicolor]
 gb|EES03839.1| hypothetical protein SORBIDRAFT_03g038940 [Sorghum bicolor]
Length=467

 Score =   212 bits (540),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            L R YDPCTER+++IY+N PEVQ A+H +TT   + W TCSD V  +W D P ++L +YQ
Sbjct  313  LSRAYDPCTERYASIYYNRPEVQMAMHANTTGLHYPWQTCSDIVGSYWADSPRSMLPIYQ  372

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AG++IWVFSGDTDAV+PVT+TRYSIDALKLPTV  W PWYD+G+VGGW+Q Y+GLT
Sbjct  373  ELIAAGIKIWVFSGDTDAVVPVTATRYSIDALKLPTVVNWYPWYDHGKVGGWSQVYKGLT  432

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V + GAGH+V LHRP+ AL +   FL    MP
Sbjct  433  LVTIAGAGHEVPLHRPRQALIMFRHFLQNKPMP  465



>ref|XP_003591949.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 ref|XP_003638560.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=461

 Score =   212 bits (540),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 128/184 (70%), Gaps = 6/184 (3%)
 Frame = -3

Query  685  PTASSPPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  506
            P +   P C  + S+ S +  R       + R YDPCTERHS +YFN PEVQKALH + T
Sbjct  279  PYSIYTPPCNNTASLRSGLNGRYP----WMSRAYDPCTERHSDVYFNRPEVQKALHANVT  334

Query  505  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  326
               + W TCSD V ++W D P ++L +Y ELI AGLRIWVFSGDTD+V+P+T+TRYSIDA
Sbjct  335  GIPYIWKTCSDIVGNYWTDSPLSMLPIYHELINAGLRIWVFSGDTDSVVPLTATRYSIDA  394

Query  325  LKLPTVSPWRPWYDNGQ--VGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAG  152
            LKLPT+  W PWYD+G+  VGGW+Q Y+GLT V +RGAGH+V LH+P+ A  L  SFL  
Sbjct  395  LKLPTIINWYPWYDSGKVGVGGWSQVYKGLTLVTIRGAGHEVPLHKPREAFILFRSFLEN  454

Query  151  TSMP  140
              MP
Sbjct  455  KDMP  458



>ref|XP_004970465.1| PREDICTED: serine carboxypeptidase-like 27-like [Setaria italica]
Length=457

 Score =   212 bits (539),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            L R YDPCTER+++IY+N PEVQ ALH +TT   + W TCSD V  +W D P ++L +YQ
Sbjct  303  LSRAYDPCTERYASIYYNRPEVQMALHANTTGIHYPWQTCSDIVGTYWADSPRSMLPIYQ  362

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AG++IWVFSGDTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT
Sbjct  363  ELIAAGMKIWVFSGDTDAVVPVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLT  422

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V + GAGH+V LHRP+ AL +   FL    MP
Sbjct  423  LVTIAGAGHEVPLHRPRQALIMFRHFLKNKPMP  455



>ref|XP_008673013.1| PREDICTED: LOC100285510 isoform X1 [Zea mays]
 gb|ACR34277.1| unknown [Zea mays]
 tpg|DAA56985.1| TPA: virulence protein Nf314 [Zea mays]
Length=467

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            L R YDPCTER+++IY+N PEVQ ALH +TT   + W TCSD V  +W D P ++L +YQ
Sbjct  313  LSRAYDPCTERYASIYYNRPEVQMALHANTTGIHYPWQTCSDIVGSYWADSPRSMLPIYQ  372

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AG++IWVFSGDTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT
Sbjct  373  ELIAAGIKIWVFSGDTDAVVPVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLT  432

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             + + GAGH+V LHRP+ AL +   FL    MP
Sbjct  433  LITIAGAGHEVPLHRPRQALIMFRHFLQNKPMP  465



>ref|NP_001151874.1| LOC100285510 precursor [Zea mays]
 gb|ACG44727.1| virulence-related protein Nf314 [Zea mays]
Length=467

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            L R YDPCTER+++IY+N PEVQ ALH +TT   + W TCSD V  +W D P ++L +YQ
Sbjct  313  LSRAYDPCTERYASIYYNRPEVQMALHANTTGIHYPWQTCSDIVGSYWADSPRSMLPIYQ  372

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AG++IWVFSGDTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT
Sbjct  373  ELIAAGIKIWVFSGDTDAVVPVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLT  432

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             + + GAGH+V LHRP+ AL +   FL    MP
Sbjct  433  LITIAGAGHEVPLHRPRQALIMFRHFLQNKPMP  465



>ref|XP_004142401.1| PREDICTED: serine carboxypeptidase-like 27-like [Cucumis sativus]
 ref|XP_004157517.1| PREDICTED: serine carboxypeptidase-like 27-like [Cucumis sativus]
 gb|KGN52285.1| hypothetical protein Csa_5G623490 [Cucumis sativus]
Length=455

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S  YFN P+VQ+A H + T  ++ W TCSD V ++W D P ++L +YQ
Sbjct  302  MSRAYDPCTERYSVAYFNHPDVQEAFHANVTGITYPWSTCSDLVGNYWADSPLSMLPIYQ  361

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI +G+RIWVFSGDTD+V+PVT+TRYSIDALKLPT+S W PWYD+G+VGGW+Q Y+GLT
Sbjct  362  ELIGSGIRIWVFSGDTDSVVPVTATRYSIDALKLPTLSNWYPWYDHGKVGGWSQIYKGLT  421

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            FV V GAGH+V LHRP+ A  L  SFL    +P
Sbjct  422  FVTVAGAGHEVPLHRPREAFILFRSFLENKPLP  454



>tpg|DAA53384.1| TPA: serine carboxypeptidase K10B2.2 [Zea mays]
Length=474

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 127/176 (72%), Gaps = 3/176 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC ++ S+  R L R   ++  L R YDPCTE + T Y NLPEVQ A H + T   + W
Sbjct  293  PTCKKT-SLQKRRLIRG--RMPWLPRGYDPCTELYITKYCNLPEVQDAFHANVTGIPYAW  349

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
            V CSD +Y++WKD P ++L +Y+ELI+AGLRIWVFSGDTD+V+P+T+TRYSIDAL LPT+
Sbjct  350  VGCSDPIYEYWKDSPRSMLPIYRELISAGLRIWVFSGDTDSVVPLTATRYSIDALSLPTI  409

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            + W PWY + +VGGW Q YEGLT V VRGAGH+V LHRP   L L E FL G  MP
Sbjct  410  TKWYPWYYDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPPQGLKLFEHFLRGEPMP  465



>ref|NP_001150676.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG39970.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
Length=484

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 127/176 (72%), Gaps = 3/176 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC ++ S+  R L R   ++  L R YDPCTE + T Y NLPEVQ A H + T   + W
Sbjct  303  PTCKKT-SLQKRRLIRG--RMPWLPRGYDPCTELYITKYCNLPEVQDAFHANVTGIPYAW  359

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
            V CSD +Y++WKD P ++L +Y+ELI+AGLRIWVFSGDTD+V+P+T+TRYSIDAL LPT+
Sbjct  360  VGCSDPIYEYWKDSPRSMLPIYRELISAGLRIWVFSGDTDSVVPLTATRYSIDALSLPTI  419

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            + W PWY + +VGGW Q YEGLT V VRGAGH+V LHRP   L L E FL G  MP
Sbjct  420  TKWYPWYYDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPPQGLKLFEHFLRGEPMP  475



>ref|XP_009141519.1| PREDICTED: serine carboxypeptidase-like 26 [Brassica rapa]
Length=447

 Score =   210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 126/175 (72%), Gaps = 4/175 (2%)
 Frame = -3

Query  664  TCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            TC  E+ ++ SR L+ R      + R YDPCTER+S +YFN PEVQKA+H +TT  ++ W
Sbjct  276  TCKKEAAALRSRFLRVRHP---WMWRAYDPCTERYSGMYFNSPEVQKAMHANTTGLAYPW  332

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD V + W D P ++L +Y+ELI AGLRIWVFSGDTD+V+PVT TRYSI ALKL  V
Sbjct  333  KTCSDIVGEKWADSPLSMLPIYKELIGAGLRIWVFSGDTDSVVPVTGTRYSIRALKLQPV  392

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            S W PWYDNGQVGGW+Q Y+GLT V + GAGH+V LHRP+    L +SFL    M
Sbjct  393  SKWYPWYDNGQVGGWSQVYKGLTLVTIHGAGHEVPLHRPRRGFLLFQSFLNNKPM  447



>pdb|1BCR|B Chain B, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-ii, 
With The Microbial Peptide Aldehyde Inhibitor, Antipain, 
And Arginine At Room Temperature
 pdb|1BCS|B Chain B, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, 
With The Microbial Peptide Aldehyde Inhibitor, Chymostatin, 
And Arginine At 100 Degrees Kelvin
 prf||1408164B CPase II B
Length=160

 Score =   201 bits (510),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -3

Query  586  YDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELI  410
            YDPCTER+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI
Sbjct  4    YDPCTERYSTAYYNRRDVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELI  63

Query  409  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  230
             AGLRIWVFSGDTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+
Sbjct  64   AAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVS  123

Query  229  VRGAGHKVALHRPKLALTLVESFLAGTSMPG  137
            VRGAGH+V LHRP+ AL L + FL G  MPG
Sbjct  124  VRGAGHEVPLHRPRQALVLFQYFLQGKPMPG  154



>ref|XP_010547376.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547377.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547378.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
Length=457

 Score =   210 bits (534),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 116/153 (76%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S  YFN P VQKALH + T   + W  CSD V  +W D P ++L +Y+
Sbjct  303  MSRAYDPCTERYSNSYFNRPNVQKALHANVTRLPYPWKACSDIVGSYWTDSPVSMLPIYK  362

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AG++IWVFSGDTDAV+PVT+TRYSI+ALKLPT++ W PWYD G+VGGW+Q Y+GLT
Sbjct  363  ELIAAGVKIWVFSGDTDAVVPVTATRYSINALKLPTITNWYPWYDQGKVGGWSQVYKGLT  422

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            FV+V GAGH+V LHRP+ A  L  SFL    MP
Sbjct  423  FVSVAGAGHEVPLHRPRQAFILFRSFLEDKPMP  455



>ref|XP_006407773.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
 gb|ESQ49226.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
Length=456

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN  EVQKALH + T   + W +CSD V  +W+D P ++L +Y+
Sbjct  302  MSRAYDPCTERYSNVYFNRVEVQKALHANVTRLPYPWKSCSDIVGSYWRDSPVSMLPIYR  361

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELITAGL+IWVFSGDTDAV+PVT+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT
Sbjct  362  ELITAGLKIWVFSGDTDAVVPVTATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLT  421

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V V GAGH+V LHRP+ A  L  SFL    MP
Sbjct  422  LVTVAGAGHEVPLHRPRQAFILFRSFLESKPMP  454



>pdb|1WHT|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat 
Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution
Length=153

 Score =   200 bits (509),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -3

Query  586  YDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELI  410
            YDPCTER+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI
Sbjct  2    YDPCTERYSTAYYNRRDVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELI  61

Query  409  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  230
             AGLRIWVFSGDTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+
Sbjct  62   AAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVS  121

Query  229  VRGAGHKVALHRPKLALTLVESFLAGTSMPG  137
            VRGAGH+V LHRP+ AL L + FL G  MPG
Sbjct  122  VRGAGHEVPLHRPRQALVLFQYFLQGKPMPG  152



>pdb|3SC2|B Chain B, Refined Atomic Model Of Wheat Serine Carboxypeptidase 
Ii At 2.2- Angstroms Resolution
Length=152

 Score =   200 bits (509),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -3

Query  586  YDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELI  410
            YDPCTER+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI
Sbjct  2    YDPCTERYSTAYYNRRDVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELI  61

Query  409  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  230
             AGLRIWVFSGDTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+
Sbjct  62   AAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVS  121

Query  229  VRGAGHKVALHRPKLALTLVESFLAGTSMPG  137
            VRGAGH+V LHRP+ AL L + FL G  MPG
Sbjct  122  VRGAGHEVPLHRPRQALVLFQYFLQGKPMPG  152



>emb|CDY32091.1| BnaC04g44750D [Brassica napus]
Length=447

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 126/175 (72%), Gaps = 4/175 (2%)
 Frame = -3

Query  664  TCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            TC  E+ ++ SR L+ R      + R YDPCTER+S +YFN PEVQKA+H +TT  ++ W
Sbjct  276  TCKKEAAALRSRFLRVRHP---WMWRAYDPCTERYSGMYFNSPEVQKAMHANTTGLAYPW  332

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD V + W D P ++L +Y+ELI AGLRIWVFSGDTD+V+P+T TRYSI ALKL  V
Sbjct  333  KTCSDIVGEKWADSPLSMLPIYKELIGAGLRIWVFSGDTDSVVPITGTRYSIRALKLQPV  392

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            S W PWYDNGQVGGW+Q Y+GLT V + GAGH+V LHRP+    L +SFL    M
Sbjct  393  SKWYPWYDNGQVGGWSQVYKGLTLVTIHGAGHEVPLHRPRRGFLLFQSFLNNKPM  447



>emb|CDY40438.1| BnaA04g20790D [Brassica napus]
Length=447

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 125/175 (71%), Gaps = 4/175 (2%)
 Frame = -3

Query  664  TCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            TC  E+ ++ SR L+ R      + R YDPCTER+S +YFN PEVQKA+H +TT  ++ W
Sbjct  276  TCKREAAALRSRFLRVRHP---WMWRAYDPCTERYSGMYFNSPEVQKAMHANTTGLAYPW  332

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD V + W D P ++L +Y+ELI AGLRIWVFSGDTD+V+PVT TRYSI ALKL  V
Sbjct  333  KTCSDIVGEKWADSPLSMLPIYKELIGAGLRIWVFSGDTDSVVPVTGTRYSIRALKLQPV  392

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            S W PWYDNGQVGGW+Q Y GLT V + GAGH+V LHRP+    L +SFL    M
Sbjct  393  SKWYPWYDNGQVGGWSQVYNGLTLVTIHGAGHEVPLHRPRRGFLLFQSFLNNKPM  447



>pdb|1WHS|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat 
Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution
Length=153

 Score =   200 bits (509),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -3

Query  586  YDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELI  410
            YDPCTER+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI
Sbjct  2    YDPCTERYSTAYYNRRDVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELI  61

Query  409  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  230
             AGLRIWVFSGDTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+
Sbjct  62   AAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVS  121

Query  229  VRGAGHKVALHRPKLALTLVESFLAGTSMPG  137
            VRGAGH+V LHRP+ AL L + FL G  MPG
Sbjct  122  VRGAGHEVPLHRPRQALVLFQYFLQGKPMPG  152



>ref|XP_010432944.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=480

 Score =   210 bits (534),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 127/175 (73%), Gaps = 1/175 (1%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C    S  + +LK+R    G +   YDPCTE+H+ +YFNLPEVQKALHV    +  +W
Sbjct  289  PACVAKASQSNMLLKKRPI-TGRVSEQYDPCTEKHTKVYFNLPEVQKALHVPPGLAPSKW  347

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCS+ V   WKD  ++VL++Y ELI AGLRIWVFSGD DAV+PVTSTR+SIDAL L  +
Sbjct  348  DTCSNVVNGHWKDSSSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRHSIDALNLHPL  407

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            S + PWY + QVGGW+Q+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  408  SVYGPWYLDEQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQALALFKAFISGTPL  462



>emb|CDY35977.1| BnaA05g29730D [Brassica napus]
Length=459

 Score =   209 bits (532),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN  EVQKALH + T  S+ W +CSD V ++W D P ++L +Y+
Sbjct  305  MSRAYDPCTERYSNVYFNRVEVQKALHANVTRLSYSWKSCSDIVGNYWTDSPVSMLPIYR  364

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGL+IWVFSGDTDAV+P+T+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT
Sbjct  365  ELIAAGLKIWVFSGDTDAVVPITATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLT  424

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V V GAGH+V LHRP+ A  +  SFL    MP
Sbjct  425  LVTVTGAGHEVPLHRPRQAFIIFRSFLENKPMP  457



>sp|P55747.1|CBP21_HORVU RecName: Full=Serine carboxypeptidase II-1; AltName: Full=CP-MII.1; 
Contains: RecName: Full=Serine carboxypeptidase II-1 
chain A; Contains: RecName: Full=Serine carboxypeptidase II-1 
chain B; Flags: Precursor, partial [Hordeum vulgare]
 gb|AAB31591.1| CP-MII.1=serine carboxypeptidase [Hordeum vulgare=barley, cv. 
Alexis, aleurone, Peptide, 324 aa]
 emb|CAB58992.1| serine carboxypeptidase II-1 [Hordeum vulgare subsp. vulgare]
Length=324

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 123/176 (70%), Gaps = 3/176 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC ++     R++K R      L R YDPCTE++ST Y+NLPEVQKA   + T   + W
Sbjct  143  PTCKKTSLHRRRLIKGRR---PWLPRGYDPCTEQYSTKYYNLPEVQKAFRANVTGIPYSW  199

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
              CSD + D WKD P ++L +Y+ELI AG+RIWVFSGD D+V+P+T+TRYSIDAL LPTV
Sbjct  200  TACSDVLSDHWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVVPLTATRYSIDALYLPTV  259

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            + W PWYD  +V GW Q Y+GLT V +RGAGH+V LHRP+ AL L E FL    MP
Sbjct  260  TNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPQQALKLFEHFLQDKPMP  315



>ref|XP_008649461.1| PREDICTED: serine carboxypeptidase 2-like isoform X2 [Zea mays]
 gb|AFW77518.1| hypothetical protein ZEAMMB73_509500 [Zea mays]
Length=491

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 128/191 (67%), Gaps = 15/191 (8%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVG----LLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNS  500
            PTC ++ +  S    RR R  G    +    YDPCTERHST+Y+N PEVQ+ALH + T  
Sbjct  294  PTCNQTSTSSSSSTPRRMRLKGRYPWMRGSSYDPCTERHSTVYYNRPEVQRALHANVTAG  353

Query  499  S-----FEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYS  335
            +     + W TCSD + + W D P +VL +Y+ELI AGLRIWVFSGDTDAV+P+T+TRYS
Sbjct  354  AGGAMNYTWATCSDTINNNWGDSPKSVLHIYKELIAAGLRIWVFSGDTDAVVPLTATRYS  413

Query  334  IDALKLPTVSPWRPWYD------NGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTL  173
            IDAL LPTV  W PWYD        +VGGW+Q YEGLT V VRGAGH+V LHRP+ AL L
Sbjct  414  IDALNLPTVVSWYPWYDAKEQKQQQEVGGWSQVYEGLTLVTVRGAGHEVPLHRPRQALIL  473

Query  172  VESFLAGTSMP  140
               FL G  MP
Sbjct  474  FRHFLRGKPMP  484



>ref|XP_004962519.1| PREDICTED: serine carboxypeptidase 2-like [Setaria italica]
Length=490

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 124/177 (70%), Gaps = 1/177 (1%)
 Frame = -3

Query  667  PTCTE-SFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFE  491
            PTC + S S  +R   R       +R  YDPCTE HST+Y+N PEVQ+ALH + T  ++ 
Sbjct  308  PTCNQTSSSTTARKNWRLKGHYPWMRGSYDPCTEMHSTVYYNRPEVQRALHANVTGINYT  367

Query  490  WVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPT  311
            W TCS  +   W D P ++L +Y+ELI AGLRIWV+SGDTD+V+P+T+TRYSIDAL LPT
Sbjct  368  WTTCSGIINTNWGDSPRSMLPIYKELIAAGLRIWVYSGDTDSVVPLTATRYSIDALGLPT  427

Query  310  VSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            V  W PWYD  +VGGW+Q Y+GLT V +RGAGH+V LHRPK AL L   FL G  MP
Sbjct  428  VVSWYPWYDKKEVGGWSQVYKGLTLVTIRGAGHEVPLHRPKQALILFRHFLHGKPMP  484



>ref|XP_009147010.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Brassica 
rapa]
Length=450

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN  EVQKALH + T  S+ W +CSD V ++W D P ++L +Y+
Sbjct  296  MSRAYDPCTERYSNVYFNRVEVQKALHANVTRLSYPWKSCSDIVGNYWTDSPVSMLPIYR  355

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGL+IWVFSGDTDAV+P+T+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT
Sbjct  356  ELIAAGLKIWVFSGDTDAVVPITATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLT  415

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V V GAGH+V LHRP+ A  +  SFL    MP
Sbjct  416  LVTVTGAGHEVPLHRPRQAFIIFRSFLENKPMP  448



>gb|KFK38250.1| hypothetical protein AALP_AA3G088900 [Arabis alpina]
Length=461

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 122/167 (73%), Gaps = 3/167 (2%)
 Frame = -3

Query  640  MSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYD  461
            + R LK R      + R YDPCTER+S +YFN  EVQKALH + T   + W +CSD V  
Sbjct  296  LKRFLKGR---YPWMSRAYDPCTERYSNVYFNRVEVQKALHANVTRLPYPWKSCSDIVGS  352

Query  460  FWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDN  281
            +W D P ++L +Y+ELITAGL+IWVFSGDTDAV+PVT+TRYSIDALKL T++ W PWYD+
Sbjct  353  YWTDSPVSMLPIYRELITAGLKIWVFSGDTDAVVPVTATRYSIDALKLETITNWYPWYDH  412

Query  280  GQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            G+VGGW+Q Y+GLT V V GAGH+V LHRP+ A  L  SFL    MP
Sbjct  413  GKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAFILFRSFLENKPMP  459



>gb|ACU19747.1| unknown [Glycine max]
Length=282

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 123/182 (68%), Gaps = 4/182 (2%)
 Frame = -3

Query  685  PTASSPPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  506
            P +   P C +  +I  R+  R       L R YDPCTER+ST+YFN PEVQKALH + T
Sbjct  66   PYSIYTPVCNDIAAIKRRLGGRYP----WLSRAYDPCTERYSTLYFNRPEVQKALHANVT  121

Query  505  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  326
               + W  C+D + + W D P ++L +YQELI  G+RIWVFSGDTD+V+PVT++RYSI A
Sbjct  122  GIPYSWAGCNDVIVENWGDSPLSMLSIYQELIEGGIRIWVFSGDTDSVVPVTASRYSIRA  181

Query  325  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  146
            L L T+  W  WYDN +VGGW+Q YEGLT V VRGAGH+V LH+P+    L ++FL   +
Sbjct  182  LNLSTIINWYAWYDNDEVGGWSQVYEGLTLVTVRGAGHEVPLHKPRQGFILFKTFLEDKN  241

Query  145  MP  140
            MP
Sbjct  242  MP  243



>ref|XP_009147009.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Brassica 
rapa]
Length=459

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN  EVQKALH + T  S+ W +CSD V ++W D P ++L +Y+
Sbjct  305  MSRAYDPCTERYSNVYFNRVEVQKALHANVTRLSYPWKSCSDIVGNYWTDSPVSMLPIYR  364

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGL+IWVFSGDTDAV+P+T+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT
Sbjct  365  ELIAAGLKIWVFSGDTDAVVPITATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLT  424

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V V GAGH+V LHRP+ A  +  SFL    MP
Sbjct  425  LVTVTGAGHEVPLHRPRQAFIIFRSFLENKPMP  457



>emb|CDY28004.1| BnaC05g44060D [Brassica napus]
Length=459

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN  EVQKALH + T  S+ W +CSD V ++W D P ++L +Y+
Sbjct  305  MSRAYDPCTERYSNVYFNRVEVQKALHANVTRLSYPWKSCSDIVGNYWTDSPVSMLPIYR  364

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGL+IWVFSGDTDAV+P+T+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT
Sbjct  365  ELIAAGLKIWVFSGDTDAVVPITATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLT  424

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V V GAGH+V LHRP+ A  +  SFL    MP
Sbjct  425  LVTVTGAGHEVPLHRPRQAFIIFRSFLENKPMP  457



>ref|XP_009414289.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 116/153 (76%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +Y+N PEVQKALH + T   + W TCSD + D W D P +VL +Y 
Sbjct  319  MSRAYDPCTERYSMVYYNRPEVQKALHANVTGIPYSWETCSDTIGDNWGDSPKSVLPIYH  378

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGLRIWVFSGDTD+V+P+T+TRYSIDALKL T+  W PWY +G+VGGW+Q YEGLT
Sbjct  379  ELIAAGLRIWVFSGDTDSVVPLTATRYSIDALKLKTLKNWYPWYYDGKVGGWSQIYEGLT  438

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            FV V GAGH+V LHRP+ AL L + FL    MP
Sbjct  439  FVTVTGAGHEVPLHRPRQALILFKRFLKNKPMP  471



>ref|XP_003566409.1| PREDICTED: serine carboxypeptidase II-1 [Brachypodium distachyon]
 ref|XP_003568700.1| PREDICTED: serine carboxypeptidase II-1 [Brachypodium distachyon]
Length=469

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 125/176 (71%), Gaps = 3/176 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC ++     R++K R      L R YDPCTE++ST Y+NLPEVQKA H + T   + W
Sbjct  288  PTCKKASLRKRRLIKGRRP---WLPRGYDPCTEKYSTKYYNLPEVQKAFHANVTGMPYAW  344

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
              CSD++++ WKD P ++L +Y ELI AG+RIWVFSGD D+V+P+T+TRYSIDAL LPTV
Sbjct  345  NPCSDDLFEHWKDSPRSMLPIYHELIAAGIRIWVFSGDADSVVPLTATRYSIDALYLPTV  404

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            + W PWY+  +V GW Q Y+GLT V +RGAGH+V LHRP+ AL L E FL    MP
Sbjct  405  TNWYPWYEEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPQQALKLFEHFLQDKPMP  460



>ref|XP_006297635.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
 gb|EOA30533.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
Length=460

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 117/153 (76%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN  EVQKALH + T   + W  CSD V  +W D P ++L +Y+
Sbjct  306  MSRAYDPCTERYSNVYFNRVEVQKALHANVTRLRYPWKACSDIVGSYWTDSPMSMLPIYR  365

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELITAGL+IWVFSGDTDAV+PVT+TRYS+DALKL T++ W PWYD+G+VGGW+Q Y+GLT
Sbjct  366  ELITAGLKIWVFSGDTDAVVPVTATRYSVDALKLATITNWYPWYDHGKVGGWSQVYKGLT  425

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V V GAGH+V LHRP+ A  L +SFL    MP
Sbjct  426  LVTVAGAGHEVPLHRPRQAFILFKSFLENKPMP  458



>ref|XP_010486379.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 123/167 (74%), Gaps = 3/167 (2%)
 Frame = -3

Query  640  MSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYD  461
            + R LK R      + R YDPC+ER+S +YFN  EVQKALH + T   + W  CSD V +
Sbjct  294  LKRFLKGR---YPWMSRAYDPCSERYSNVYFNRVEVQKALHANVTRLPYPWKACSDIVGN  350

Query  460  FWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDN  281
            +W+D P ++L +Y+ELITAGL+IWVFSGDTDAV+P+T+TRYSIDALKL T++ W PWYD+
Sbjct  351  YWEDSPLSMLPIYRELITAGLKIWVFSGDTDAVVPITATRYSIDALKLATITNWYPWYDH  410

Query  280  GQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            G+VGGW+Q Y+GLT V V GAGH+V LHRP+ A  L  SFL    MP
Sbjct  411  GKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAFILFRSFLENKPMP  457



>ref|NP_187456.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
 sp|Q9SFB5.1|SCP27_ARATH RecName: Full=Serine carboxypeptidase-like 27; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF21209.1|AC013483_33 putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAT71955.1| At3g07990 [Arabidopsis thaliana]
 gb|AAU95440.1| At3g07990 [Arabidopsis thaliana]
 gb|AEE74628.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
Length=459

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 122/167 (73%), Gaps = 3/167 (2%)
 Frame = -3

Query  640  MSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYD  461
            + R LK R      + R YDPCTER+S +YFN  +VQKALH + T  S+ W  CSD V  
Sbjct  294  LKRFLKGR---YPWMSRAYDPCTERYSNVYFNRLDVQKALHANVTRLSYPWKACSDIVGS  350

Query  460  FWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDN  281
            +W D P ++L +Y+ELITAGL+IWVFSGDTDAV+P+T+TRYS+DALKL T++ W PWYD+
Sbjct  351  YWDDSPLSMLPIYKELITAGLKIWVFSGDTDAVVPITATRYSVDALKLATITNWYPWYDH  410

Query  280  GQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            G+VGGW+Q Y+GLT V V GAGH+V LHRP+ A  L  SFL    MP
Sbjct  411  GKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAFILFRSFLESKPMP  457



>gb|EMS66624.1| Serine carboxypeptidase II-1 [Triticum urartu]
Length=357

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 123/176 (70%), Gaps = 3/176 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC ++     R +K R      L R YDPCTE++ST Y+NLPEVQKA   + T   + W
Sbjct  176  PTCKKTSLHRRRQIKGRRP---WLPRGYDPCTEQYSTKYYNLPEVQKAFRANVTGIPYAW  232

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
              CSD ++++WKD P ++L +Y+ELI AG+RIWVFSGD D+V+P+T TRYSIDAL LPTV
Sbjct  233  TGCSDVLFEYWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVVPLTGTRYSIDALYLPTV  292

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            + W PWYD  +V GW Q Y+GLT V +RGAGH+V LHRP+ AL L E FL    MP
Sbjct  293  TNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPRQALKLFEHFLQDKPMP  348



>ref|XP_010464446.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   207 bits (528),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPC+ER+S +YFN  EVQKALH + T   + W  CSD V ++W+D P ++L +Y+
Sbjct  305  MSRAYDPCSERYSNVYFNRVEVQKALHANVTRLPYPWKACSDIVGNYWEDSPLSMLPIYR  364

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELITAGL+IWVFSGDTDAV+P+T+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT
Sbjct  365  ELITAGLKIWVFSGDTDAVVPITATRYSIDALKLTTITNWYPWYDHGKVGGWSQVYKGLT  424

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V V GAGH+V LHRP+ A  L  SFL    MP
Sbjct  425  LVTVAGAGHEVPLHRPRQAFILFRSFLENKPMP  457



>gb|EMT21139.1| putative Serine carboxypeptidase II-1 [Aegilops tauschii]
Length=419

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 123/176 (70%), Gaps = 3/176 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC ++     R +K R      L R YDPCTE++ST Y+NLPEVQKA   + T   + W
Sbjct  238  PTCKKTSLHRRRQIKGRRP---WLPRGYDPCTEQYSTKYYNLPEVQKAFRANVTGIPYAW  294

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             +CSD ++++WKD P ++L +Y ELI AG+RIWVFSGD D+V+P+T TRYSIDAL LPTV
Sbjct  295  TSCSDVLFEYWKDSPRSMLPIYHELIAAGIRIWVFSGDADSVVPLTGTRYSIDALYLPTV  354

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            + W PWYD  +V GW Q Y+GLT V +RGAGH+V LHRP+ AL L E FL    MP
Sbjct  355  TNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPRQALKLFEHFLQDKPMP  410



>ref|XP_008789080.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
27 [Phoenix dactylifera]
Length=473

 Score =   207 bits (528),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 126/179 (70%), Gaps = 7/179 (4%)
 Frame = -3

Query  655  ESFSIMSRV------LKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSS  497
            + +SI +R       LKR+ R     + R YDPCTE ++ +Y+N PEVQ ALH + T   
Sbjct  292  DPYSIYTRACNETTTLKRKLRGHYPWMSRAYDPCTENYAEVYYNRPEVQMALHANVTGIP  351

Query  496  FEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKL  317
            + W TCS+ V + W D P ++L +Y+ELI AGLRIWVFSGDTD+V+PVT+TRYSIDAL L
Sbjct  352  YPWNTCSNIVGNHWADSPRSMLPIYRELIAAGLRIWVFSGDTDSVVPVTATRYSIDALNL  411

Query  316  PTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             TV  W PWYDNG+VGGWTQ YEGLTFV V GAGH+V LHRP+ AL L + FL    MP
Sbjct  412  STVISWYPWYDNGKVGGWTQVYEGLTFVTVXGAGHEVPLHRPRQALVLFKHFLQNRPMP  470



>ref|XP_010920885.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=506

 Score =   208 bits (529),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 126/175 (72%), Gaps = 6/175 (3%)
 Frame = -3

Query  661  CTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWV  485
            CT++ S     LKR+ R     + R YDPCTE ++ +Y+N PEVQKALH + T   + W 
Sbjct  307  CTDATS-----LKRKIRGHYPWMSRAYDPCTENYARVYYNHPEVQKALHANVTGIPYPWD  361

Query  484  TCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVS  305
            TCS+ V  +W D P ++L +Y+ELI AGLRIWVFSGDTD+V+P+T+TRYSIDAL L TV 
Sbjct  362  TCSNIVGIYWADSPRSMLPIYRELIAAGLRIWVFSGDTDSVVPLTATRYSIDALNLSTVI  421

Query  304  PWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             W PWYD+G+VGGWTQ YEGLTFV VRGAGH+V LHRP+ AL L   FL    MP
Sbjct  422  SWYPWYDHGKVGGWTQVYEGLTFVTVRGAGHEVPLHRPRQALILFRHFLQDKLMP  476



>ref|XP_008649460.1| PREDICTED: serine carboxypeptidase 2-like isoform X1 [Zea mays]
Length=492

 Score =   207 bits (528),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 130/198 (66%), Gaps = 16/198 (8%)
 Frame = -3

Query  685  PTASSPPTCTESFSIMSRVLKRRDRKVG----LLRRIYDPCTERHSTIYFNLPEVQKALH  518
            P +   PTC ++ +  S    RR R  G    +    YDPCTERHST+Y+N PEVQ+ALH
Sbjct  288  PYSIYTPTCNQTSTSSSSSTPRRMRLKGRYPWMRGSSYDPCTERHSTVYYNRPEVQRALH  347

Query  517  VHTTNSS-----FEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPV  353
             + T  +     + W TCSD + + W D P +VL +Y+ELI AGLRIWVFSGDTDAV+P+
Sbjct  348  ANVTAGAGGAMNYTWATCSDTINNNWGDSPKSVLHIYKELIAAGLRIWVFSGDTDAVVPL  407

Query  352  TSTRYSIDALKLPTVSPWRPWYD-------NGQVGGWTQEYEGLTFVAVRGAGHKVALHR  194
            T+TRYSIDAL LPTV  W PWYD         +VGGW+Q YEGLT V VRGAGH+V LHR
Sbjct  408  TATRYSIDALNLPTVVSWYPWYDAKEQQKQQQEVGGWSQVYEGLTLVTVRGAGHEVPLHR  467

Query  193  PKLALTLVESFLAGTSMP  140
            P+ AL L   FL G  MP
Sbjct  468  PRQALILFRHFLRGKPMP  485



>gb|KCW65386.1| hypothetical protein EUGRSUZ_G02816 [Eucalyptus grandis]
Length=467

 Score =   207 bits (526),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 115/152 (76%), Gaps = 0/152 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN PEVQKALH + T   + W TCSD V ++W D P ++L +YQ
Sbjct  314  MSRAYDPCTERYSEVYFNKPEVQKALHANVTGLPYAWKTCSDIVGNYWADSPLSMLPIYQ  373

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGLRIWV+SGDTDAV+PVT++RYSIDALKL TV  W PW DNG+VGGW+Q Y+GLT
Sbjct  374  ELIAAGLRIWVYSGDTDAVVPVTASRYSIDALKLATVINWYPWTDNGKVGGWSQVYKGLT  433

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            FV V GAGH+V L RP+ A  L  SFL    M
Sbjct  434  FVTVTGAGHEVPLLRPRQAFILFRSFLENKPM  465



>ref|XP_007009787.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
 gb|EOY18597.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
Length=552

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 120/186 (65%), Gaps = 33/186 (18%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFNLPEVQKALH + T  S+ W TCSD V ++W D P ++L +Y+
Sbjct  366  MSRAYDPCTERYSKVYFNLPEVQKALHANVTGISYPWQTCSDLVGNYWADAPLSMLPIYK  425

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNG-------------  278
            ELI AG RIWV+SGDTDAV+PVT+TRYSIDALKLPTV+ W PWYDNG             
Sbjct  426  ELIAAGFRIWVYSGDTDAVVPVTATRYSIDALKLPTVTNWYPWYDNGKVSTDNVIQFLEL  485

Query  277  --------------------QVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFL  158
                                QVGGW+Q Y GLTFV V GAGH+V LHRP+ A  L  SFL
Sbjct  486  VSVEIGLHRCLSHQISHFLIQVGGWSQAYRGLTFVTVTGAGHEVPLHRPRQAFILFRSFL  545

Query  157  AGTSMP  140
                MP
Sbjct  546  ENKPMP  551



>ref|XP_002882565.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58824.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 117/153 (76%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN  +VQKALH + T   + W  CSD V  +W+D P ++L +Y+
Sbjct  302  MSRAYDPCTERYSNVYFNRADVQKALHANVTRLPYPWKACSDIVGSYWEDSPLSMLPIYR  361

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELITAGL+IW+FSGDTDAV+PVT+TRYS+DALKL T++ W PWYD+G+VGGW+Q Y+GLT
Sbjct  362  ELITAGLKIWIFSGDTDAVVPVTATRYSVDALKLATITNWYPWYDHGKVGGWSQVYKGLT  421

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V V GAGH+V LHRP+ A  L  SFL    MP
Sbjct  422  LVTVAGAGHEVPLHRPRQAFILFRSFLDSKPMP  454



>ref|XP_010460785.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=457

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 117/153 (76%), Gaps = 0/153 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPC+ER+S +YFN  EVQKALH + T   + W  CSD V ++W+D P ++L +Y+
Sbjct  303  MSRAYDPCSERYSNVYFNRVEVQKALHANVTRLPYPWKACSDIVGNYWEDSPLSMLPIYR  362

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELITAGL+IWVFSGDTDAV+P+T+TRYSIDALKL T++ W PWYD+G+V GW+Q Y+GLT
Sbjct  363  ELITAGLKIWVFSGDTDAVVPITATRYSIDALKLATITNWYPWYDHGKVAGWSQVYKGLT  422

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             V V GAGH+V LHRP+ A  L  SFL    MP
Sbjct  423  LVTVAGAGHEVPLHRPRQAFILFRSFLENKPMP  455



>ref|XP_003566533.2| PREDICTED: serine carboxypeptidase 2-like [Brachypodium distachyon]
Length=466

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 127/176 (72%), Gaps = 3/176 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P C ++ S+ SR   R   +   +   YDPCTER+ST+Y+N PEVQ+ALH + T  ++ W
Sbjct  285  PVCNQTASV-SR--PRPRGRYPWMSGSYDPCTERYSTVYYNRPEVQRALHANVTGINYTW  341

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TCSD +   W D P ++L +Y+ELI AGLRIWVFSGDTDAV+P+T+TRYSIDAL LPT 
Sbjct  342  ATCSDTINKNWGDAPRSMLPIYKELIQAGLRIWVFSGDTDAVVPLTATRYSIDALDLPTT  401

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
              W PW D+ +VGGW+Q Y+GLT V +RGAGH+V LHRP+ AL + ++FL G  +P
Sbjct  402  IGWYPWSDSKEVGGWSQVYKGLTLVTIRGAGHEVPLHRPRQALIMFQNFLRGMPLP  457



>ref|XP_009410600.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 124/177 (70%), Gaps = 4/177 (2%)
 Frame = -3

Query  661  CTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVT  482
            C  S S+ S +    + +   + R YDPCT+R++ +Y+N PEVQ+ALH + T   + W T
Sbjct  287  CNSSRSLKSSL----NGRYPWMSRAYDPCTDRYAKVYYNRPEVQRALHANVTGIQYPWDT  342

Query  481  CSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSP  302
            CSD V ++W D P ++L +YQELI AGLRIW+FSGDTDAV+PVT+TRYSIDAL L T+  
Sbjct  343  CSDIVGNYWADSPRSMLPIYQELIAAGLRIWMFSGDTDAVVPVTATRYSIDALNLQTLIS  402

Query  301  WRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQ  131
            W PWYD G+VGGW+Q Y+GLTFV + GAGH+V LH P+ A+ L   FL    MP  Q
Sbjct  403  WYPWYDKGKVGGWSQVYKGLTFVTIMGAGHEVPLHHPRQAMILFRQFLKNRPMPRCQ  459



>emb|CAA18212.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
 emb|CAB79799.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
Length=425

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 117/148 (79%), Gaps = 9/148 (6%)
 Frame = -3

Query  586  YDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELIT  407
            YDPCTE+H+T+YFNLPEVQKALH+        W+ CSD V + W D P++VL++Y ELI 
Sbjct  269  YDPCTEKHTTVYFNLPEVQKALHL--------WL-CSDVVSEHWNDSPSSVLNIYHELIA  319

Query  406  AGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAV  227
            AGLRIWVFSGD DAV+PVTSTRYSIDAL L  +S + PWY +GQVGGW+Q+Y GL FV V
Sbjct  320  AGLRIWVFSGDADAVVPVTSTRYSIDALNLRPLSAYGPWYLDGQVGGWSQQYAGLNFVTV  379

Query  226  RGAGHKVALHRPKLALTLVESFLAGTSM  143
            RGAGH+V LHRPK AL L ++F++GT +
Sbjct  380  RGAGHEVPLHRPKQALALFKAFISGTPL  407



>dbj|BAK02399.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92622.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 123/176 (70%), Gaps = 3/176 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC ++     R++K R      L R YDPCTE++ST Y+NLPEVQKA   + T   + W
Sbjct  282  PTCKKTSLHRRRLIKGRRP---WLPRGYDPCTEQYSTKYYNLPEVQKAFRANVTGIPYSW  338

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
              CSD + D WKD P ++L +Y+ELI AG+RIWVFSGD D+V+P+T+TRYSIDAL LPTV
Sbjct  339  TACSDVLSDHWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVVPLTATRYSIDALYLPTV  398

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            + W PWYD  +V GW Q Y+GLT V +RGAGH+V LHRP+ AL L E FL    MP
Sbjct  399  TNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPQQALKLFEHFLQDKPMP  454



>emb|CDM82001.1| unnamed protein product [Triticum aestivum]
Length=463

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 123/176 (70%), Gaps = 3/176 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTC ++     R +K R      L R YDPCTE++ST Y+NLPEVQKA   + T   + W
Sbjct  282  PTCKKTSLHRRRQIKGRRP---WLPRGYDPCTEQYSTKYYNLPEVQKAFRANVTGIPYAW  338

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
              CSD ++++WKD P ++L +Y+ELI AG+RIWVFSGD D+V+P+T TRYSIDAL LPTV
Sbjct  339  TGCSDVLFEYWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVVPLTGTRYSIDALYLPTV  398

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            + W PWYD  +V GW Q Y+GLT V +RGAGH+V LHRP+ AL L E FL    MP
Sbjct  399  TNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPRQALKLFEHFLQDKPMP  454



>emb|CDP11023.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 134/183 (73%), Gaps = 3/183 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            P CT S S  S +L +R   + L  + YDPCTE HS IYFNLPEVQ+ALHV    S  +W
Sbjct  307  PKCTSSSSTTSNLLSKRWPTL-LRSQGYDPCTEAHSIIYFNLPEVQQALHVR--GSPVKW  363

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             TC   V+  WKD   ++L+  +EL T+G+RIW++SG+TDAVIP+TSTRYS+ AL LPTV
Sbjct  364  ETCGLTVHYAWKDSARSLLNTIKELTTSGIRIWIYSGNTDAVIPITSTRYSLRALNLPTV  423

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQR  128
              + PWY++GQVGGWTQ+YEGLTFVAV  AGH+V LH+PK ALT+ ++FLAGT +   ++
Sbjct  424  GSYLPWYEDGQVGGWTQQYEGLTFVAVNAAGHEVPLHKPKQALTIFKAFLAGTPLATSKQ  483

Query  127  ISD  119
             SD
Sbjct  484  FSD  486



>ref|XP_010067290.1| PREDICTED: serine carboxypeptidase-like 27 [Eucalyptus grandis]
Length=528

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 115/152 (76%), Gaps = 0/152 (0%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  419
            + R YDPCTER+S +YFN PEVQKALH + T   + W TCSD V ++W D P ++L +YQ
Sbjct  375  MSRAYDPCTERYSEVYFNKPEVQKALHANVTGLPYAWKTCSDIVGNYWADSPLSMLPIYQ  434

Query  418  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  239
            ELI AGLRIWV+SGDTDAV+PVT++RYSIDALKL TV  W PW DNG+VGGW+Q Y+GLT
Sbjct  435  ELIAAGLRIWVYSGDTDAVVPVTASRYSIDALKLATVINWYPWTDNGKVGGWSQVYKGLT  494

Query  238  FVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            FV V GAGH+V L RP+ A  L  SFL    M
Sbjct  495  FVTVTGAGHEVPLLRPRQAFILFRSFLENKPM  526



>ref|XP_009410601.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=457

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 122/174 (70%), Gaps = 4/174 (2%)
 Frame = -3

Query  661  CTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVT  482
            C  S S+ S +  R       + R YDPCT+R++ +Y+N PEVQ+ALH + T   + W T
Sbjct  287  CNSSRSLKSSLNGRYP----WMSRAYDPCTDRYAKVYYNRPEVQRALHANVTGIQYPWDT  342

Query  481  CSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSP  302
            CSD V ++W D P ++L +YQELI AGLRIW+FSGDTDAV+PVT+TRYSIDAL L T+  
Sbjct  343  CSDIVGNYWADSPRSMLPIYQELIAAGLRIWMFSGDTDAVVPVTATRYSIDALNLQTLIS  402

Query  301  WRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            W PWYD G+VGGW+Q Y+GLTFV + GAGH+V LH P+ A+ L   FL    MP
Sbjct  403  WYPWYDKGKVGGWSQVYKGLTFVTIMGAGHEVPLHHPRQAMILFRQFLKNRPMP  456



>ref|XP_010937832.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=470

 Score =   205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 129/190 (68%), Gaps = 7/190 (4%)
 Frame = -3

Query  688  IPTASSPPTCTESFSIMSR------VLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQ  530
            +  AS+     + +SI +R       LKR+ R     + R YDPCTE ++ +Y+N PEVQ
Sbjct  278  LEAASNEMGNIDPYSIYTRPCNDATTLKRKLRGHYPWMSRAYDPCTENYANVYYNRPEVQ  337

Query  529  KALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVT  350
            KALH + T   + W TCS+ V  +W D P ++L +Y+ELI AGLRIWVFSGDTD+V+P+T
Sbjct  338  KALHANVTGIPYPWDTCSNIVGKYWTDSPRSMLPIYRELIAAGLRIWVFSGDTDSVVPLT  397

Query  349  STRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLV  170
            +TRYSIDAL L TV  W  WYD G VGGWTQ Y+GLTFV VRGAGH+V LHRP+ AL L 
Sbjct  398  ATRYSIDALNLSTVISWYAWYDQGMVGGWTQVYKGLTFVTVRGAGHEVPLHRPRQALVLF  457

Query  169  ESFLAGTSMP  140
            + FL    MP
Sbjct  458  KHFLQNRPMP  467



>emb|CAI64396.1| serine carboxypeptidase II [Triticum aestivum]
Length=260

 Score =   199 bits (506),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -3

Query  586  YDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELI  410
            YDPCTER+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI
Sbjct  102  YDPCTERYSTAYYNRRDVQTALHANVTGAMNYTWSTCSDTINTHWHDAPRSMLPIYRELI  161

Query  409  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  230
             AGLRIWVFSGDTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+
Sbjct  162  AAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVS  221

Query  229  VRGAGHKVALHRPKLALTLVESFLAGTSMPG  137
            VRGAGH+V LHRP+ AL L + FL G  MPG
Sbjct  222  VRGAGHEVPLHRPRQALVLFQYFLQGKPMPG  252



>ref|XP_006294202.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
 gb|EOA27100.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
Length=451

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 124/176 (70%), Gaps = 4/176 (2%)
 Frame = -3

Query  664  TCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            TCT E+ ++ SR  + R      + R YDPCTER+S +YFN PEVQKA+H + T  ++ W
Sbjct  278  TCTKEAAALRSRFSRVRHP---WMWRAYDPCTERYSGMYFNSPEVQKAMHANITGLAYSW  334

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
              CSD V + W D P ++L +Y+ELI AGLRIWVFSGDTD+V+PVT TRYSI ALKL  V
Sbjct  335  KGCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFSGDTDSVVPVTGTRYSIRALKLQPV  394

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            S W PW DNGQVGGW+Q Y+GLT V + GAGH+V LHRP+    L +SFL    +P
Sbjct  395  SKWYPWNDNGQVGGWSQVYQGLTLVTIHGAGHEVPLHRPRRGFLLFQSFLDNKPLP  450



>ref|XP_009386999.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=474

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 122/167 (73%), Gaps = 1/167 (1%)
 Frame = -3

Query  634  RVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDF  458
            R LKR  R     + R YDPCTER+S IY+N  +VQ+A+H + T   + W TCSD + + 
Sbjct  306  RSLKRNLRGHYPWMSRAYDPCTERYSRIYYNRADVQRAMHANVTGIPYGWDTCSDTISEN  365

Query  457  WKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNG  278
            W D P ++L +Y+ELI AGLRIWVFSGDTDAV+P+T+TRYSIDAL+L T+  W PWYD+G
Sbjct  366  WGDSPKSMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIDALRLRTLEKWYPWYDHG  425

Query  277  QVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPG  137
            +VGGW+Q Y+GLT+V V GAGH+V LHRP+ AL L E FL    MP 
Sbjct  426  KVGGWSQIYKGLTYVTVTGAGHEVPLHRPRQALMLFEHFLKNKPMPA  472



>gb|EMT12249.1| Serine carboxypeptidase 2 [Aegilops tauschii]
Length=468

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 128/179 (72%), Gaps = 4/179 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNS-SF  494
            P C  + S  S + +RR R +   L   YDPCTER+ST Y+N  +VQ ALH + T + ++
Sbjct  284  PVCNITSS--SSLSQRRPRGRYPWLTGSYDPCTERYSTAYYNRRDVQMALHANVTGAMNY  341

Query  493  EWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLP  314
             W TCSD +   W D P ++L +Y+ELI AGLRIWVFSGDTDAV+P+T+TRYSI AL LP
Sbjct  342  TWTTCSDTINTHWHDAPRSMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLP  401

Query  313  TVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPG  137
            T + W PWYD+ +VGGW+Q Y+GLT V+VRGAGH+V LHRP+ AL L + FL G  MPG
Sbjct  402  TTTSWHPWYDDQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQALVLFQYFLQGKPMPG  460



>gb|ACA61621.1| hypothetical protein AP7_B10.1 [Arabidopsis lyrata subsp. petraea]
Length=450

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = -3

Query  592  RIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQEL  413
            R YDPCT+R+S +YFN PEVQKA+H + T  S+ W TCSD V + W D P ++L +Y+EL
Sbjct  299  RAYDPCTDRYSGMYFNSPEVQKAMHANITGLSYPWKTCSDIVGEKWADSPLSMLPIYKEL  358

Query  412  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFV  233
            I AGLRIWVFSGDTD+V+P+T TRYSI ALKLP +S W PW D+GQVGGW+Q Y+GLT V
Sbjct  359  IAAGLRIWVFSGDTDSVVPITGTRYSIRALKLPPLSKWYPWNDDGQVGGWSQVYKGLTLV  418

Query  232  AVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             + GAGH+V LHRP+ A  L +SFL    +P
Sbjct  419  TIHGAGHEVPLHRPRRAYLLFQSFLDNKPLP  449



>gb|KHN13367.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=493

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 124/182 (68%), Gaps = 4/182 (2%)
 Frame = -3

Query  685  PTASSPPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  506
            P +   P C +    ++ + +R   +   L R YDPCTER+ST+YFN PEVQKALH + T
Sbjct  277  PYSIYTPVCND----IAAIKRRLGGRYPWLSRAYDPCTERYSTLYFNRPEVQKALHANVT  332

Query  505  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  326
               + W  C+D + + W D P ++L +YQELI  G+RIWVFSGDTD+V+PVT++RYSI A
Sbjct  333  GIPYSWAGCNDVIVENWGDSPLSMLPIYQELIEGGIRIWVFSGDTDSVVPVTASRYSIRA  392

Query  325  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  146
            L L T+  W  WYDN +VGGW+Q YEGLT V VRGAGH+V LH+P+    L ++FL   +
Sbjct  393  LNLSTIINWYAWYDNDEVGGWSQVYEGLTLVTVRGAGHEVPLHKPRQGFILFKTFLEDKN  452

Query  145  MP  140
            MP
Sbjct  453  MP  454



>ref|XP_003548016.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=493

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 124/182 (68%), Gaps = 4/182 (2%)
 Frame = -3

Query  685  PTASSPPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  506
            P +   P C +    ++ + +R   +   L R YDPCTER+ST+YFN PEVQKALH + T
Sbjct  277  PYSIYTPVCND----IAAIKRRLGGRYPWLSRAYDPCTERYSTLYFNRPEVQKALHANVT  332

Query  505  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  326
               + W  C+D + + W D P ++L +YQELI  G+RIWVFSGDTD+V+PVT++RYSI A
Sbjct  333  GIPYSWAGCNDVIVENWGDSPLSMLPIYQELIEGGIRIWVFSGDTDSVVPVTASRYSIRA  392

Query  325  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  146
            L L T+  W  WYDN +VGGW+Q YEGLT V VRGAGH+V LH+P+    L ++FL   +
Sbjct  393  LNLSTIINWYAWYDNDEVGGWSQVYEGLTLVTVRGAGHEVPLHKPRQGFILFKTFLEDKN  452

Query  145  MP  140
            MP
Sbjct  453  MP  454



>ref|XP_011469672.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=455

 Score =   202 bits (513),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 115/155 (74%), Gaps = 0/155 (0%)
 Frame = -3

Query  604  GLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDV  425
            G   R YDPC ER+S  YFN PEVQKALH + T  S+ W TCSD + + W D P ++L +
Sbjct  300  GHYSRAYDPCAERYSEKYFNHPEVQKALHANVTGLSYPWKTCSDIIGNNWSDSPRSMLPI  359

Query  424  YQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEG  245
            YQELI AGL+IWV+SGDTDAV+PVT+TRYSIDALKLPT++ W PWYD+G+VGG +Q Y+G
Sbjct  360  YQELIAAGLKIWVYSGDTDAVVPVTATRYSIDALKLPTIANWSPWYDSGKVGGRSQIYKG  419

Query  244  LTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            LT V + GAGH V L RP+ A  L +SFL    MP
Sbjct  420  LTLVTITGAGHLVPLLRPREAFILFKSFLENKPMP  454



>ref|XP_002881414.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57673.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
Length=450

 Score =   201 bits (512),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 114/151 (75%), Gaps = 0/151 (0%)
 Frame = -3

Query  592  RIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQEL  413
            R YDPCT+R+S +YFN PEVQKA+H + T  S+ W  CSD V + W D P ++L +Y+EL
Sbjct  299  RAYDPCTDRYSGMYFNSPEVQKAMHANITGLSYPWKGCSDIVGEKWADSPLSMLPIYKEL  358

Query  412  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFV  233
            I AGLRIWVFSGDTD+V+P+T TRYSI ALKLP +S W PW D+GQVGGW+Q Y+GLT V
Sbjct  359  IAAGLRIWVFSGDTDSVVPITGTRYSIRALKLPPLSKWYPWNDDGQVGGWSQVYKGLTLV  418

Query  232  AVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             + GAGH+V LHRP+ A  L +SFL    +P
Sbjct  419  TIHGAGHEVPLHRPRRAFLLFQSFLDNKPLP  449



>ref|XP_004307399.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=458

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 114/151 (75%), Gaps = 0/151 (0%)
 Frame = -3

Query  592  RIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQEL  413
            R YDPC ER+S  YFN PEVQKALH + T  S+ W TCSD + + W D P ++L +YQEL
Sbjct  307  RAYDPCAERYSEKYFNHPEVQKALHANVTGLSYPWKTCSDIIGNNWSDSPRSMLPIYQEL  366

Query  412  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFV  233
            I AGL+IWV+SGDTDAV+PVT+TRYSIDALKLPT++ W PWYD+G+VGG +Q Y+GLT V
Sbjct  367  IAAGLKIWVYSGDTDAVVPVTATRYSIDALKLPTIANWSPWYDSGKVGGRSQIYKGLTLV  426

Query  232  AVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             + GAGH V L RP+ A  L +SFL    MP
Sbjct  427  TITGAGHLVPLLRPREAFILFKSFLENKPMP  457



>sp|P08819.2|CBP2_WHEAT RecName: Full=Serine carboxypeptidase 2; AltName: Full=CPDW-II; 
Short=CP-WII; AltName: Full=Carboxypeptidase D; AltName: 
Full=Serine carboxypeptidase II; Contains: RecName: Full=Serine 
carboxypeptidase 2 chain A; AltName: Full=Serine carboxypeptidase 
II chain A; Contains: RecName: Full=Serine carboxypeptidase 
2 chain B; AltName: Full=Serine carboxypeptidase II 
chain B; Flags: Precursor [Triticum aestivum]
Length=444

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -3

Query  586  YDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELI  410
            YDPCTER+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI
Sbjct  288  YDPCTERYSTAYYNRRDVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELI  347

Query  409  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  230
             AGLRIWVFSGDTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+
Sbjct  348  AAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVS  407

Query  229  VRGAGHKVALHRPKLALTLVESFLAGTSMPG  137
            VRGAGH+V LHRP+ AL L + FL G  MPG
Sbjct  408  VRGAGHEVPLHRPRQALVLFQYFLQGKPMPG  438



>prf||1408163B CPase II B
Length=159

 Score =   192 bits (487),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -3

Query  586  YDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELI  410
            YDPCTER+ST Y+N  +VQ ALH + T + ++ W  CSD +   W D P ++L +Y+ELI
Sbjct  4    YDPCTERYSTAYYNRRDVQTALHANVTGAMNYTWXZCSDTINTHWHDAPRSMLPIYRELI  63

Query  409  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQ-VGGWTQEYEGLTFV  233
             AGLRIWVFSGDTDAV+P+T+TRYSI AL L T + W PWYD+ Q VGGW+Q Y+GLT V
Sbjct  64   AAGLRIWVFSGDTDAVVPLTATRYSIGALGLATTTSWYPWYDDLQEVGGWSQVYKGLTLV  123

Query  232  AVRGAGHKVALHRPKLALTLVESFLAGTSMPG  137
            +VRGAGH+V LHRP+ AL L + FL G  MPG
Sbjct  124  SVRGAGHEVPLHRPRQALILFQQFLQGKPMPG  155



>ref|XP_010505098.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=453

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = -3

Query  592  RIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQEL  413
            R YDPCTER+S +YFN PEVQKA+H + T  ++ W TCSD V + W D P ++L +Y+EL
Sbjct  302  RAYDPCTERYSGMYFNSPEVQKAMHANITGLAYPWKTCSDIVGEKWADSPLSMLPIYKEL  361

Query  412  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFV  233
            I AGLRIWVFSGDTD+V+P+T TRYSI ALKL  +S W PW DNGQVGGW Q Y+GLT V
Sbjct  362  IAAGLRIWVFSGDTDSVVPITGTRYSIRALKLQPLSKWYPWNDNGQVGGWIQVYKGLTLV  421

Query  232  AVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             + GAGH+V LHRP+    L +SFL    +P
Sbjct  422  TIHGAGHEVPLHRPRRGFLLFQSFLDNKPLP  452



>gb|AES62200.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=491

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 128/214 (60%), Gaps = 36/214 (17%)
 Frame = -3

Query  685  PTASSPPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  506
            P +   P C  + S+ S +  R       + R YDPCTERHS +YFN PEVQKALH + T
Sbjct  279  PYSIYTPPCNNTASLRSGLNGRYP----WMSRAYDPCTERHSDVYFNRPEVQKALHANVT  334

Query  505  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  326
               + W TCSD V ++W D P ++L +Y ELI AGLRIWVFSGDTD+V+P+T+TRYSIDA
Sbjct  335  GIPYIWKTCSDIVGNYWTDSPLSMLPIYHELINAGLRIWVFSGDTDSVVPLTATRYSIDA  394

Query  325  LKLPTVSPWRPWYDNG--------------------------------QVGGWTQEYEGL  242
            LKLPT+  W PWYD+G                                +VGGW+Q Y+GL
Sbjct  395  LKLPTIINWYPWYDSGKVGANFCKEKLFKFILIGMNSGKFDTKIYSSVKVGGWSQVYKGL  454

Query  241  TFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            T V +RGAGH+V LH+P+ A  L  SFL    MP
Sbjct  455  TLVTIRGAGHEVPLHKPREAFILFRSFLENKDMP  488



>ref|XP_007154876.1| hypothetical protein PHAVU_003G155400g, partial [Phaseolus vulgaris]
 gb|ESW26870.1| hypothetical protein PHAVU_003G155400g, partial [Phaseolus vulgaris]
Length=371

 Score =   197 bits (501),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 120/176 (68%), Gaps = 5/176 (3%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTCT S ++     K      G     YDPCTE ++  Y+NLPEVQKA+H + TN  ++W
Sbjct  199  PTCTTSQTVRHIRFKNLHMISG-----YDPCTENYAEKYYNLPEVQKAMHANLTNIPYKW  253

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
              CS+ +   WKD   +VL +Y+ELI AGL+IWVFSGDTD+V+PVT+TR+S++ L L   
Sbjct  254  TACSEVLLKNWKDSEISVLPIYKELIAAGLKIWVFSGDTDSVVPVTATRFSLNHLNLSIK  313

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            + W PWY  GQVGGWT+ Y GLTF  VRGAGH+V L +PK A TL +SFLAG  +P
Sbjct  314  TRWYPWYSGGQVGGWTEVYNGLTFATVRGAGHEVPLFQPKRAYTLFKSFLAGKELP  369



>ref|XP_010509560.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=451

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = -3

Query  592  RIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQEL  413
            R YDPCTER+S +YFN PEVQKA+H + T  ++ W  CSD V + W D P ++L +Y+EL
Sbjct  300  RAYDPCTERYSGMYFNSPEVQKAMHANITGLAYSWKGCSDIVGEKWADSPLSMLPIYKEL  359

Query  412  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFV  233
            I AGLRIWVFSGDTD+V+P+T TRYSI ALKL  +S W PW DNGQVGGW+Q Y+GLT V
Sbjct  360  IAAGLRIWVFSGDTDSVVPITGTRYSIRALKLQPLSKWYPWNDNGQVGGWSQVYKGLTLV  419

Query  232  AVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             + GAGH+V LHRP+    L +SFL    +P
Sbjct  420  TIHGAGHEVPLHRPRRGFLLFQSFLDNKPLP  450



>ref|XP_003519151.1| PREDICTED: serine carboxypeptidase 24-like isoform 1 [Glycine 
max]
Length=461

 Score =   199 bits (506),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 123/176 (70%), Gaps = 3/176 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTCT S +   R ++ ++     L   YDPCTE ++  Y+NLPEVQ A+H + TN  ++W
Sbjct  287  PTCTTSQNNTVRHMRFKNLH---LISGYDPCTENYAEKYYNLPEVQIAMHANVTNIPYKW  343

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
              CSD +   WKD   +VL +Y+ELI AGLRIWVFSGDTD+V+PVT+TR+S++ L L T 
Sbjct  344  TACSDVLLKNWKDSEISVLPIYKELIAAGLRIWVFSGDTDSVVPVTATRFSLNHLNLRTR  403

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            + W PWY  GQVGGWT+ Y+GLTF  VRGAGH+V L +PK A  L +SFLAG  +P
Sbjct  404  TRWYPWYSGGQVGGWTEVYDGLTFATVRGAGHEVPLFQPKRAYILFKSFLAGNELP  459



>gb|KHN42831.1| Serine carboxypeptidase 24 [Glycine soja]
Length=460

 Score =   199 bits (505),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 123/176 (70%), Gaps = 3/176 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTCT S +   R ++ ++     L   YDPCTE ++  Y+NLPEVQ A+H + TN  ++W
Sbjct  286  PTCTTSQNNTVRHMRFKNLH---LISGYDPCTENYAEKYYNLPEVQIAMHANVTNIPYKW  342

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
              CSD +   WKD   +VL +Y+ELI AGLRIWVFSGDTD+V+PVT+TR+S++ L L T 
Sbjct  343  TACSDVLLKNWKDSEISVLPIYKELIAAGLRIWVFSGDTDSVVPVTATRFSLNHLNLRTR  402

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            + W PWY  GQVGGWT+ Y+GLTF  VRGAGH+V L +PK A  L +SFLAG  +P
Sbjct  403  TRWYPWYSGGQVGGWTEVYDGLTFATVRGAGHEVPLFQPKRAYILFKSFLAGNELP  458



>ref|XP_010516783.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=454

 Score =   199 bits (505),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = -3

Query  592  RIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQEL  413
            R YDPCTER+S +YFN PEVQKA+H + T  ++ W TCSD V + W D P ++L +Y+EL
Sbjct  303  RAYDPCTERYSGMYFNSPEVQKAMHANITGLAYPWKTCSDIVGEKWADSPLSMLPIYKEL  362

Query  412  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFV  233
            I AGLRIWVFSGDTD+V+P+T TRYSI ALKL  +S W PW D+GQVGGW+Q Y+GLT V
Sbjct  363  IAAGLRIWVFSGDTDSVVPITGTRYSIRALKLQPLSKWYPWNDSGQVGGWSQVYKGLTLV  422

Query  232  AVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             + GAGH+V LHRP+    L +SFL    +P
Sbjct  423  TIHGAGHEVPLHRPRRGFLLFQSFLDNKPLP  453



>gb|KJB76567.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=482

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 118/183 (64%), Gaps = 30/183 (16%)
 Frame = -3

Query  598  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTC--------------------  479
            + R YDPCTER+S +YFN  EVQKALH + T  S+ W TC                    
Sbjct  299  MSRAYDPCTERYSKVYFNRLEVQKALHANVTALSYPWQTCRYDHFLNTSRIFKIFVSNIY  358

Query  478  ----------SDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSID  329
                      SD V ++W D P ++L +Y+ELI AGLRIWV+SGDTDAV+PVT+TRYSID
Sbjct  359  FIRICKSLFYSDIVGNYWTDAPLSMLPIYKELIAAGLRIWVYSGDTDAVVPVTATRYSID  418

Query  328  ALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGT  149
            ALKLPTV  W PWYDNG+VGGW+Q Y+GLT V V GAGH+V LHRP+ A  L  SFL   
Sbjct  419  ALKLPTVINWYPWYDNGKVGGWSQAYKGLTLVTVTGAGHEVPLHRPRQAFILFRSFLENK  478

Query  148  SMP  140
             MP
Sbjct  479  LMP  481



>ref|XP_003549539.1| PREDICTED: serine carboxypeptidase 24-like [Glycine max]
 gb|KHN17498.1| Serine carboxypeptidase 24 [Glycine soja]
Length=460

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 122/176 (69%), Gaps = 3/176 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            PTCT S +   R ++ ++     L   YDPCTE ++  Y+NLPEVQKA+H + TN  ++W
Sbjct  286  PTCTASQNNTVRHMRFKNLH---LISGYDPCTENYAEKYYNLPEVQKAMHANVTNIPYKW  342

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
              CSD +   WKD   +VL +Y+ELI AGL+IWVFSGDTD+V+PVT+TR+S++ L L   
Sbjct  343  TACSDVLLKNWKDSAISVLPIYKELIAAGLKIWVFSGDTDSVVPVTATRFSLNHLNLSIR  402

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            + W PWY  GQVGGWT+ Y+GLTF  VRGAGH+V L +PK A  L +SFLA   +P
Sbjct  403  TRWYPWYSGGQVGGWTEVYDGLTFATVRGAGHEVPLFQPKRAYILFKSFLAAKELP  458



>gb|KDO59486.1| hypothetical protein CISIN_1g0120681mg, partial [Citrus sinensis]
Length=381

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 119/174 (68%), Gaps = 2/174 (1%)
 Frame = -3

Query  637  SRVLKRRDRKVGLLRRI--YDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVY  464
            S V   R +   L RR+  YDPCTE ++  Y+N  EVQKALH + T   ++W  CSD + 
Sbjct  206  STVRPMRLKNTLLRRRVSGYDPCTENYAEKYYNRQEVQKALHANVTGIPYKWTACSDVLI  265

Query  463  DFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYD  284
            + WKD   +VL  Y++LI AGL+IWVFSGDTD+V+PVT+TR+S+  L LP  +PW PWY 
Sbjct  266  NNWKDSEDSVLPTYKQLIAAGLKIWVFSGDTDSVVPVTATRFSLSHLNLPIKTPWYPWYS  325

Query  283  NGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQRIS  122
              QVGGWT+ Y+GLTF  VRGAGH+V L +P+ AL L  SFLAG  +P  + IS
Sbjct  326  GNQVGGWTEVYKGLTFATVRGAGHEVPLFQPRRALILFRSFLAGKQLPKSRHIS  379



>ref|XP_008352213.1| PREDICTED: serine carboxypeptidase 24-like, partial [Malus domestica]
Length=332

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 124/185 (67%), Gaps = 6/185 (3%)
 Frame = -3

Query  685  PTASSPPTCTESFSIMSRVLKRRDRKVGLLRRI---YDPCTERHSTIYFNLPEVQKALHV  515
            P +   P C    +   R L+ ++    LLRR    YDPCTE ++  Y+N P+VQKA+H 
Sbjct  148  PYSIYTPFCVTMLNNTKRHLRLKN---SLLRRRASGYDPCTENYAEKYYNRPDVQKAMHA  204

Query  514  HTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYS  335
            + T   ++W  CSD +Y++W D   +VL  Y+ELI AGLRIWVFSGDTD+V+PVT+TR+S
Sbjct  205  NVTRIPYKWTACSDVLYEYWXDSEYSVLPTYKELIAAGLRIWVFSGDTDSVVPVTATRFS  264

Query  334  IDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLA  155
            ++ L L   +PW PWY   QVGGWT+ Y+GLTF  VRGAGH+V L + +  LTL +SFLA
Sbjct  265  LNHLNLTIKTPWYPWYSGRQVGGWTEVYDGLTFATVRGAGHEVPLIQAERGLTLFKSFLA  324

Query  154  GTSMP  140
            G  +P
Sbjct  325  GKKLP  329



>gb|KFK36474.1| hypothetical protein AALP_AA4G129400 [Arabis alpina]
Length=449

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 121/175 (69%), Gaps = 4/175 (2%)
 Frame = -3

Query  664  TCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEW  488
            TC  E+ ++ SR L+ R      + R YDPCTER+S +YFN  EVQKA+H + T  S+ W
Sbjct  278  TCKKEAEALRSRFLRVRHP---WMWRAYDPCTERYSGMYFNSLEVQKAMHANRTGISYPW  334

Query  487  VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV  308
             +CSD V   W D P ++L +Y+ELI AGLRIWVFSGDTD+V+PVT TRYSI +LKL  +
Sbjct  335  TSCSDIVGAKWADSPLSMLPIYKELIAAGLRIWVFSGDTDSVVPVTGTRYSIRSLKLQPI  394

Query  307  SPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            S W PWYDN QVGGW Q Y+GLT V + GAGH+V L RP+ A  L +SFL    M
Sbjct  395  SKWYPWYDNEQVGGWCQVYKGLTLVTIHGAGHEVPLFRPRRAFLLFKSFLENKPM  449



>ref|NP_181121.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
 sp|Q9ZQQ0.1|SCP26_ARATH RecName: Full=Serine carboxypeptidase-like 26; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD21479.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM15111.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM65590.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|ABJ17113.1| At2g35780 [Arabidopsis thaliana]
 gb|AEC09160.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
Length=452

 Score =   194 bits (493),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = -3

Query  592  RIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQEL  413
            R YDPCTE++S +YFN PEVQKA+H + T  ++ W  CSD V + W D P ++L +Y+EL
Sbjct  301  RAYDPCTEKYSGMYFNSPEVQKAMHANITGLAYPWKGCSDIVGEKWADSPLSMLPIYKEL  360

Query  412  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFV  233
            I AGLRIWVFSGDTD+V+P+T TRYSI ALKL  +S W PW D+GQVGGW+Q Y+GLT V
Sbjct  361  IAAGLRIWVFSGDTDSVVPITGTRYSIRALKLQPLSKWYPWNDDGQVGGWSQVYKGLTLV  420

Query  232  AVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
             + GAGH+V L RP+ A  L +SFL    +P
Sbjct  421  TIHGAGHEVPLFRPRRAFLLFQSFLDNKPLP  451



>ref|XP_007011905.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY29524.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=465

 Score =   194 bits (493),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 122/178 (69%), Gaps = 4/178 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRI--YDPCTERHSTIYFNLPEVQKALHVHTTNSSF  494
            P+C    +  +R +  R +   L RR+  YDPCTE ++  Y+N P+VQKA+H +TT   +
Sbjct  288  PSCLALTNNSARHI--RLKNTLLHRRVSGYDPCTENYAEKYYNRPDVQKAMHANTTGIPY  345

Query  493  EWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLP  314
            +W  CSD +   WKD   +VL +Y+ELI AGLRIWVFSGDTD+V+PVT+TR+S+  L L 
Sbjct  346  KWTACSDVLIKNWKDSENSVLPIYKELIAAGLRIWVFSGDTDSVVPVTATRFSLSHLNLH  405

Query  313  TVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
              +PW PWY   QVGGWT+ Y+GLTF  VRGAGH+V L +PK A  L +SFLAG  +P
Sbjct  406  IKTPWYPWYSGNQVGGWTEVYQGLTFATVRGAGHEVPLFQPKRAFILYKSFLAGKELP  463



>emb|CAA70815.1| serine carboxypeptidase II, CP-MII [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86051.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=476

 Score =   194 bits (493),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = -3

Query  586  YDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELI  410
            YDPCTER+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI
Sbjct  317  YDPCTERYSTAYYNRRDVQTALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELI  376

Query  409  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQ-VGGWTQEYEGLTFV  233
             AGLRIWVFSGDTDAV+P+T+TRYSI AL L T + W PWYD+ Q VGGW+Q Y+GLT V
Sbjct  377  AAGLRIWVFSGDTDAVVPLTATRYSIGALGLATTTSWYPWYDDLQEVGGWSQVYKGLTLV  436

Query  232  AVRGAGHKVALHRPKLALTLVESFLAGTSMPG  137
            +VRGAGH+V LHRP+ AL L + FL G  MPG
Sbjct  437  SVRGAGHEVPLHRPRQALILFQQFLQGKPMPG  468



>ref|XP_006453596.1| hypothetical protein CICLE_v10008182mg [Citrus clementina]
 gb|ESR66836.1| hypothetical protein CICLE_v10008182mg [Citrus clementina]
Length=471

 Score =   194 bits (493),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 119/175 (68%), Gaps = 2/175 (1%)
 Frame = -3

Query  637  SRVLKRRDRKVGLLRRI--YDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVY  464
            S V   R +   L RR+  YDPCTE ++  Y+N  EVQKALH + T   ++W  CSD + 
Sbjct  296  STVRPMRLKNTLLRRRVSGYDPCTENYAEKYYNRQEVQKALHANVTGIPYKWTACSDVLI  355

Query  463  DFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYD  284
            + WKD   +VL  Y++LI AGL+IWVFSGDTD+V+PVT+TR+S+  L LP  +PW PWY 
Sbjct  356  NNWKDSEDSVLPTYKQLIAAGLKIWVFSGDTDSVVPVTATRFSVSHLNLPIKTPWYPWYS  415

Query  283  NGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQRISD  119
              QVGGWT+ Y+GLTF  VRGAGH+V L +P+ AL L  SFLAG  +P  + IS 
Sbjct  416  GNQVGGWTEVYKGLTFATVRGAGHEVPLFQPRRALILFRSFLAGKQLPKSRHISQ  470



>ref|XP_006474013.1| PREDICTED: serine carboxypeptidase 24-like [Citrus sinensis]
Length=471

 Score =   194 bits (492),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 119/175 (68%), Gaps = 2/175 (1%)
 Frame = -3

Query  637  SRVLKRRDRKVGLLRRI--YDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVY  464
            S V   R +   L RR+  YDPCTE ++  Y+N  EVQKALH + T   ++W  CSD + 
Sbjct  296  STVRPMRLKNTLLRRRVSGYDPCTENYAEKYYNRQEVQKALHANVTGIPYKWTACSDVLI  355

Query  463  DFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYD  284
            + WKD   +VL  Y++LI AGL+IWVFSGDTD+V+PVT+TR+S+  L LP  +PW PWY 
Sbjct  356  NNWKDSEDSVLPTYKQLIAAGLKIWVFSGDTDSVVPVTATRFSLSHLNLPIKTPWYPWYS  415

Query  283  NGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMPGLQRISD  119
              QVGGWT+ Y+GLTF  VRGAGH+V L +P+ AL L  SFLAG  +P  + IS 
Sbjct  416  GNQVGGWTEVYKGLTFATVRGAGHEVPLFQPRRALILFRSFLAGKQLPKSRHISQ  470



>emb|CDP02317.1| unnamed protein product [Coffea canephora]
Length=471

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 116/152 (76%), Gaps = 0/152 (0%)
 Frame = -3

Query  586  YDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELIT  407
            YDPCTE+++ +Y+N P+VQKALH +TT   ++W  CS+ +   W D  ++VL +Y++LI 
Sbjct  320  YDPCTEKYAEVYYNRPDVQKALHANTTRIPYKWTACSETLNRNWNDTDSSVLPIYRKLIA  379

Query  406  AGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAV  227
            AGLRIWVFSGD D+V+PVT+TRY++  LKL T +PW PWY   QVGGWT+ Y+GLTF  V
Sbjct  380  AGLRIWVFSGDVDSVVPVTATRYALAQLKLDTDAPWYPWYVKKQVGGWTEVYKGLTFATV  439

Query  226  RGAGHKVALHRPKLALTLVESFLAGTSMPGLQ  131
            RGAGH+V L +P+ AL L++SFLAG  +P L+
Sbjct  440  RGAGHEVPLLKPRAALQLLKSFLAGQPLPSLK  471



>ref|XP_008230880.1| PREDICTED: serine carboxypeptidase-like 25 [Prunus mume]
Length=253

 Score =   187 bits (475),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 120/180 (67%), Gaps = 2/180 (1%)
 Frame = -3

Query  673  SPPTCTESFSIMSRVLKRRDRKVGLLRRI--YDPCTERHSTIYFNLPEVQKALHVHTTNS  500
            +PP      S  +R    R     + R++  YDPCTE+++ +Y+N P+VQKALH + T  
Sbjct  71   APPCNNSDGSTSTRQSSMRLPHRPMFRQLSGYDPCTEKYAEVYYNRPDVQKALHANITGI  130

Query  499  SFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALK  320
             ++W  CS+ +   W D   +VL +Y+++I AGLRIWVFSGD D+V+PVT+TRYS+  LK
Sbjct  131  PYKWTACSEVLNRNWNDTDVSVLPIYRDMIIAGLRIWVFSGDVDSVVPVTATRYSLAQLK  190

Query  319  LPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            L T  PW PWY   QVGGWT+ YEGLTF  VRGAGH+V L +P+ AL L +SF+ G  +P
Sbjct  191  LETKIPWYPWYTKKQVGGWTEVYEGLTFATVRGAGHEVPLFKPREALHLFKSFIQGKPLP  250



>gb|KDP38690.1| hypothetical protein JCGZ_04043 [Jatropha curcas]
Length=254

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 120/179 (67%), Gaps = 3/179 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLR-RI--YDPCTERHSTIYFNLPEVQKALHVHTTNSS  497
            P+C +  +  S +   R  K  LLR RI  YDPCTE ++  Y+N P+VQKA+H + T   
Sbjct  74   PSCIQLQNNKSNLRPLRLFKNTLLRGRISGYDPCTENYAEKYYNRPDVQKAMHANVTGIP  133

Query  496  FEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKL  317
            ++W  CSD +   W+D  ++VL +Y+ELI AGLRIWVFSGDTD+V+PVT+TR+S+  L L
Sbjct  134  YKWTACSDVLIKNWRDSESSVLPIYKELIAAGLRIWVFSGDTDSVVPVTATRFSLSHLNL  193

Query  316  PTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
               + W PWY   QVGGWT+ Y GLTF  VRGAGH+V L +P+ A  L  SF+AG  +P
Sbjct  194  TVKTRWYPWYSGNQVGGWTEAYNGLTFATVRGAGHEVPLFQPRRAFILFRSFVAGKELP  252



>ref|XP_006297594.1| hypothetical protein CARUB_v10013616mg [Capsella rubella]
 gb|EOA30492.1| hypothetical protein CARUB_v10013616mg [Capsella rubella]
Length=472

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 124/183 (68%), Gaps = 7/183 (4%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLL-----RRI--YDPCTERHSTIYFNLPEVQKALHVHT  509
            P C +S         RR  ++  L     R+I  YDPCTER++ IY+N P+VQKALH +T
Sbjct  288  PPCNKSSDGGVGSSGRRSMRLPHLPHSVWRKISGYDPCTERYAEIYYNRPDVQKALHANT  347

Query  508  TNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSID  329
            TN  ++W  CS+ +   W D  ++VL +Y+E+I  G+R+WVFSGD D+V+PVT+TRYS+ 
Sbjct  348  TNIPYKWTACSEVLNRNWNDTDSSVLPIYREMIAGGIRVWVFSGDVDSVVPVTATRYSLA  407

Query  328  ALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGT  149
             L L T  PW PWY   QVGGWT+ YEGLTFV VRGAGH+V L +P++AL L + FL+G 
Sbjct  408  RLSLSTKVPWYPWYVKKQVGGWTEVYEGLTFVTVRGAGHEVPLFKPRVALELFKYFLSGK  467

Query  148  SMP  140
             +P
Sbjct  468  PLP  470



>sp|P08818.2|CBP2_HORVU RecName: Full=Serine carboxypeptidase 2; AltName: Full=CP-MII; 
AltName: Full=Carboxypeptidase D; AltName: Full=Serine carboxypeptidase 
II; Contains: RecName: Full=Serine carboxypeptidase 
2 chain A; AltName: Full=Serine carboxypeptidase II chain 
A; Contains: RecName: Full=Serine carboxypeptidase 2 chain 
B; AltName: Full=Serine carboxypeptidase II chain B; Flags: 
Precursor [Hordeum vulgare]
Length=476

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -3

Query  586  YDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELI  410
            YDPCTER+ST Y+N  +VQ ALH + T + ++ W  CSD +   W D P ++L +Y+ELI
Sbjct  317  YDPCTERYSTAYYNRRDVQTALHANVTGAMNYTWTNCSDTINTHWHDAPRSMLPIYRELI  376

Query  409  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQ-VGGWTQEYEGLTFV  233
             AGLRIWVFSGDTDAV+P+T+TRYSI AL L T + W PWYD+ Q VGGW+Q Y+GLT V
Sbjct  377  AAGLRIWVFSGDTDAVVPLTATRYSIGALGLATTTSWYPWYDDLQEVGGWSQVYKGLTLV  436

Query  232  AVRGAGHKVALHRPKLALTLVESFLAGTSMPG  137
            +VRGAGH+V LHRP+ AL L + FL G  MPG
Sbjct  437  SVRGAGHEVPLHRPRQALILFQQFLQGKPMPG  468



>ref|XP_007032750.1| Serine carboxypeptidase-like 25 isoform 3 [Theobroma cacao]
 gb|EOY03676.1| Serine carboxypeptidase-like 25 isoform 3 [Theobroma cacao]
Length=395

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 121/181 (67%), Gaps = 3/181 (2%)
 Frame = -3

Query  673  SPPTCTESFSIMSR-VLKRRDRKVGLLRRI--YDPCTERHSTIYFNLPEVQKALHVHTTN  503
            +PP      S+ +R  ++   R   + R I  YDPCTE+++ IY+N P+VQKALH +TT 
Sbjct  213  APPCNNSDGSLFTRQTMRMPHRPYRIFRAISGYDPCTEKYAEIYYNRPDVQKALHANTTG  272

Query  502  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  323
              ++W  CS+ +   W D   +VL +Y+E+I  GLR+WVFSGD D+V+PVT+TRYS+  L
Sbjct  273  IHYKWTACSEVLNRNWNDTDASVLPIYREMIAGGLRVWVFSGDVDSVVPVTATRYSLAQL  332

Query  322  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  143
            KL T  PW PWY   QVGGWT+ Y GLTF  VRGAGH+V L +P+ AL L +SFL G  +
Sbjct  333  KLTTKIPWYPWYVKKQVGGWTEVYHGLTFATVRGAGHEVPLFKPRAALQLFKSFLRGEPL  392

Query  142  P  140
            P
Sbjct  393  P  393



>ref|XP_008394313.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase 24-like 
[Malus domestica]
Length=472

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 124/185 (67%), Gaps = 6/185 (3%)
 Frame = -3

Query  685  PTASSPPTCTESFSIMSRVLKRRDRKVGLLRRI---YDPCTERHSTIYFNLPEVQKALHV  515
            P +   P C    +   R L+ ++    LLRR    YDPCTE ++  Y+N P+VQKA+H 
Sbjct  288  PYSIYTPFCVTMLNNTKRHLRLKN---SLLRRRASGYDPCTENYAEKYYNRPDVQKAMHA  344

Query  514  HTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYS  335
            + T   ++W  CSD +Y++W D   +VL  Y+ELI AGLRIWVFSGDTD+V+PVT+TR+S
Sbjct  345  NVTRIPYKWTACSDVLYEYWXDSEYSVLPTYKELIAAGLRIWVFSGDTDSVVPVTATRFS  404

Query  334  IDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLA  155
            ++ L L   +PW PWY   QVGGWT+ Y+GLTF  VRGAGH+V L + +  LTL +SFLA
Sbjct  405  LNHLNLTIKTPWYPWYSGRQVGGWTEVYDGLTFATVRGAGHEVPLIQAERGLTLFKSFLA  464

Query  154  GTSMP  140
            G  +P
Sbjct  465  GKKLP  469



>ref|XP_009358427.1| PREDICTED: serine carboxypeptidase 24 [Pyrus x bretschneideri]
Length=472

 Score =   192 bits (487),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 124/188 (66%), Gaps = 6/188 (3%)
 Frame = -3

Query  685  PTASSPPTCTESFSIMSRVLKRRDRKVGLLRRI---YDPCTERHSTIYFNLPEVQKALHV  515
            P +   P C    +   R L+ ++    LLRR    YDPCTE ++  Y+N P+VQKA+H 
Sbjct  288  PYSIYTPFCLTMLNNRKRHLRLKNT---LLRRRASGYDPCTENYAEKYYNRPDVQKAMHA  344

Query  514  HTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYS  335
            + T   ++W  CSD ++ +WKD   +VL  Y+ELI AGLRIWVFSGDTD+V+PVT+TR S
Sbjct  345  NVTRIPYKWTACSDVLFKYWKDSEYSVLPTYKELIAAGLRIWVFSGDTDSVVPVTATRLS  404

Query  334  IDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLA  155
            ++ L L   +PW PWY   QVGGWT+ Y+GLTF  VRGAGH+V L + +  LTL +SFLA
Sbjct  405  LNHLNLTIKTPWYPWYSGSQVGGWTEVYDGLTFATVRGAGHEVPLIQAERGLTLFKSFLA  464

Query  154  GTSMPGLQ  131
            G  +P L 
Sbjct  465  GKKLPKLN  472



>gb|KJB75608.1| hypothetical protein B456_012G048700 [Gossypium raimondii]
Length=481

 Score =   192 bits (488),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  667  PTCTES----FSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNS  500
            P C  S    F+  S  L  R   +      YDPCTE+++ IY+N P+VQKALH +TT  
Sbjct  300  PPCNNSDGNRFTRHSMRLPHRPHSIFRQLSGYDPCTEKYAEIYYNRPDVQKALHANTTGI  359

Query  499  SFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALK  320
             ++W  CS+ +   W D   +VL +Y+E+I  GLR+WVFSGD D+V+PVT+TRYS+  LK
Sbjct  360  RYKWTACSEVLNRNWNDTDGSVLPIYKEIIAGGLRVWVFSGDVDSVVPVTATRYSLAQLK  419

Query  319  LPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
            L T  PW PWY   QVGGWT+ YEGLTF  VRGAGH+V L +P+ AL L +SFL+G  +P
Sbjct  420  LSTKIPWYPWYVKKQVGGWTEVYEGLTFATVRGAGHEVPLFKPRAALQLFKSFLSGEPLP  479



>ref|XP_010656616.1| PREDICTED: serine carboxypeptidase 24 isoform X2 [Vitis vinifera]
Length=381

 Score =   189 bits (481),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 119/178 (67%), Gaps = 3/178 (2%)
 Frame = -3

Query  667  PTCTESFSIMSRVLKRRDRKVGLLRRI--YDPCTERHSTIYFNLPEVQKALHVHTTNSSF  494
            P+C  +    S +   R +   + RR+  YDPCTE ++  Y+N P+VQKA+H ++T   +
Sbjct  200  PSCM-ALPNSSTIRSPRFKNSLVRRRVSGYDPCTENYAEKYYNRPDVQKAMHANSTGIPY  258

Query  493  EWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLP  314
            +W  CS  +  +W D   ++L +Y+ELI AGLRIWVFSGDTDAV+PVT+TR+S++ L L 
Sbjct  259  KWTACSGVLIKYWNDSEASMLPIYKELIEAGLRIWVFSGDTDAVVPVTATRFSLNHLNLT  318

Query  313  TVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  140
              +PW PWY  GQVGGWT+ YEGLTF  VRGAGH+V L +P  A  L  SFL G  +P
Sbjct  319  VKTPWYPWYSGGQVGGWTEVYEGLTFATVRGAGHEVPLFQPMRAFLLFRSFLGGKQLP  376



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1340626501500