BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF034C07

Length=758
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHN43447.1|  DEAD-box ATP-dependent RNA helicase 24                  233   1e-67   Glycine soja [wild soybean]
ref|XP_003554554.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    232   5e-67   Glycine max [soybeans]
ref|XP_009610165.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    232   7e-67   Nicotiana tomentosiformis
ref|XP_003521597.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    231   2e-66   Glycine max [soybeans]
gb|KHN19202.1|  DEAD-box ATP-dependent RNA helicase 24                  230   3e-66   Glycine soja [wild soybean]
ref|XP_011079538.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    225   2e-64   Sesamum indicum [beniseed]
ref|XP_009758471.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    224   3e-64   Nicotiana sylvestris
ref|XP_006349177.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    223   1e-63   Solanum tuberosum [potatoes]
ref|XP_004494431.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    220   1e-62   Cicer arietinum [garbanzo]
ref|XP_004494432.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    220   1e-62   Cicer arietinum [garbanzo]
ref|XP_002277419.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    220   2e-62   Vitis vinifera
emb|CAN74586.1|  hypothetical protein VITISV_041989                     220   2e-62   Vitis vinifera
ref|XP_004229381.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    217   2e-61   Solanum lycopersicum
ref|XP_007163191.1|  hypothetical protein PHAVU_001G214100g             215   9e-61   Phaseolus vulgaris [French bean]
gb|AGV54423.1|  DEAD-box ATP-dependent RNA helicase 24-like protein     214   1e-60   Phaseolus vulgaris [French bean]
gb|KDO86968.1|  hypothetical protein CISIN_1g003881mg                   214   3e-60   Citrus sinensis [apfelsine]
ref|XP_006444514.1|  hypothetical protein CICLE_v10018925mg             214   3e-60   Citrus clementina [clementine]
ref|XP_010069832.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    211   3e-59   Eucalyptus grandis [rose gum]
ref|XP_003625986.1|  DEAD-box ATP-dependent RNA helicase                210   5e-59   Medicago truncatula
gb|EYU46816.1|  hypothetical protein MIMGU_mgv1a001735mg                209   7e-59   Erythranthe guttata [common monkey flower]
gb|KJB22489.1|  hypothetical protein B456_004G050200                    205   4e-57   Gossypium raimondii
ref|XP_011042271.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    204   7e-57   Populus euphratica
gb|KJB22487.1|  hypothetical protein B456_004G050200                    204   9e-57   Gossypium raimondii
gb|KJB22491.1|  hypothetical protein B456_004G050200                    204   1e-56   Gossypium raimondii
gb|KHG13095.1|  DEAD-box ATP-dependent RNA helicase 24 -like protein    201   1e-55   Gossypium arboreum [tree cotton]
ref|XP_010267974.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    201   1e-55   Nelumbo nucifera [Indian lotus]
gb|KHG13094.1|  DEAD-box ATP-dependent RNA helicase 24 -like protein    200   2e-55   Gossypium arboreum [tree cotton]
gb|KHG18820.1|  DEAD-box ATP-dependent RNA helicase 24 -like protein    200   2e-55   Gossypium arboreum [tree cotton]
gb|KHG30147.1|  DEAD-box ATP-dependent RNA helicase 24 -like protein    199   2e-55   Gossypium arboreum [tree cotton]
ref|XP_002301515.2|  DEAD/DEAH box helicase family protein              200   2e-55   
gb|KJB22485.1|  hypothetical protein B456_004G050000                    198   9e-55   Gossypium raimondii
ref|XP_004156816.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    198   1e-54   
emb|CDP17060.1|  unnamed protein product                                197   2e-54   Coffea canephora [robusta coffee]
ref|XP_010087224.1|  DEAD-box ATP-dependent RNA helicase 24             194   1e-53   
ref|XP_002515267.1|  hypothetical protein RCOM_1346600                  195   1e-53   Ricinus communis
ref|XP_008454276.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    194   3e-53   Cucumis melo [Oriental melon]
ref|XP_010938236.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    194   4e-53   Elaeis guineensis
ref|XP_004152219.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    193   4e-53   Cucumis sativus [cucumbers]
ref|XP_010679397.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    193   6e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009416320.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    192   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007051129.1|  P-loop containing nucleoside triphosphate hy...    192   2e-52   
ref|XP_011468779.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    191   2e-52   Fragaria vesca subsp. vesca
ref|XP_006840470.1|  hypothetical protein AMTR_s00045p00182070          191   3e-52   
ref|XP_009403707.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    191   3e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004288535.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    191   3e-52   Fragaria vesca subsp. vesca
gb|KFK37476.1|  hypothetical protein AALP_AA4G262200                    191   3e-52   Arabis alpina [alpine rockcress]
ref|XP_007051128.1|  P-loop containing nucleoside triphosphate hy...    191   5e-52   
ref|XP_009370603.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    189   1e-51   Pyrus x bretschneideri [bai li]
ref|XP_009142546.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    189   2e-51   Brassica rapa
ref|XP_006293732.1|  hypothetical protein CARUB_v10022694mg             189   2e-51   Capsella rubella
emb|CDX80096.1|  BnaA05g00600D                                          188   2e-51   
ref|XP_010921475.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    188   3e-51   Elaeis guineensis
ref|XP_009349922.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    187   8e-51   Pyrus x bretschneideri [bai li]
ref|XP_007221465.1|  hypothetical protein PRUPE_ppa001666mg             186   1e-50   Prunus persica
gb|EPS66709.1|  hypothetical protein M569_08067                         185   3e-50   Genlisea aurea
emb|CDY37796.1|  BnaC04g00290D                                          185   3e-50   Brassica napus [oilseed rape]
ref|XP_008781128.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    185   5e-50   Phoenix dactylifera
emb|CDX95719.1|  BnaC03g26000D                                          184   7e-50   
ref|XP_008227876.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    184   9e-50   Prunus mume [ume]
ref|XP_008808687.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    184   1e-49   Phoenix dactylifera
ref|XP_008381412.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    183   2e-49   
gb|KDP28272.1|  hypothetical protein JCGZ_14043                         183   2e-49   Jatropha curcas
ref|XP_006397925.1|  hypothetical protein EUTSA_v10001321mg             183   2e-49   Eutrema salsugineum [saltwater cress]
ref|XP_010506768.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    183   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010506769.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    182   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_008343158.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    182   4e-49   
ref|XP_010518432.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    179   5e-48   Camelina sativa [gold-of-pleasure]
ref|XP_006649971.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    178   1e-47   
ref|NP_566099.1|  DEAD-box ATP-dependent RNA helicase 24                176   8e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002467976.1|  hypothetical protein SORBIDRAFT_01g037410          171   3e-45   Sorghum bicolor [broomcorn]
ref|XP_010544963.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    171   3e-45   Tarenaya hassleriana [spider flower]
ref|XP_004984607.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    166   2e-43   Setaria italica
ref|XP_008654950.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    163   2e-42   Zea mays [maize]
ref|XP_008654947.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    163   2e-42   Zea mays [maize]
ref|XP_003558073.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    163   3e-42   Brachypodium distachyon [annual false brome]
gb|AFW88580.1|  putative DEAD-box ATP-dependent RNA helicase fami...    162   5e-42   
ref|NP_001147596.1|  pre-mRNA-processing ATP-dependent RNA helica...    162   5e-42   Zea mays [maize]
ref|XP_001779387.1|  predicted protein                                  158   2e-40   
gb|EEE58924.1|  hypothetical protein OsJ_10575                          157   3e-40   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049904.1|  Os03g0308500                                       157   6e-40   
dbj|BAJ97115.1|  predicted protein                                      156   9e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC75096.1|  hypothetical protein OsI_11255                          157   9e-40   Oryza sativa Indica Group [Indian rice]
gb|EMS61774.1|  DEAD-box ATP-dependent RNA helicase 24                  149   3e-37   Triticum urartu
gb|EMT30425.1|  DEAD-box ATP-dependent RNA helicase 24                  146   3e-36   
ref|XP_009135930.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    132   2e-31   
emb|CDX83333.1|  BnaA03g21730D                                          132   2e-31   
ref|XP_002980961.1|  hypothetical protein SELMODRAFT_51367              126   2e-29   
ref|XP_006388445.1|  hypothetical protein POPTR_0184s002103g            118   3e-29   
ref|XP_002989340.1|  hypothetical protein SELMODRAFT_41331              124   1e-28   
gb|KJB22488.1|  hypothetical protein B456_004G050200                    111   7e-27   Gossypium raimondii
gb|KJB22484.1|  hypothetical protein B456_004G050000                    111   8e-27   Gossypium raimondii
ref|XP_010507898.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    118   2e-26   Camelina sativa [gold-of-pleasure]
gb|KJB22490.1|  hypothetical protein B456_004G050200                    118   2e-26   Gossypium raimondii
ref|XP_002882116.1|  hypothetical protein ARALYDRAFT_483908             115   2e-25   
ref|XP_010518433.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    113   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_006444513.1|  hypothetical protein CICLE_v10018925mg             112   1e-24   
ref|XP_011079539.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    111   3e-24   Sesamum indicum [beniseed]
ref|XP_007051130.1|  P-loop containing nucleoside triphosphate hy...    111   3e-24   
gb|KDO86973.1|  hypothetical protein CISIN_1g003881mg                   110   1e-23   Citrus sinensis [apfelsine]
ref|XP_008353905.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    105   1e-22   
ref|XP_009758479.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    105   4e-22   Nicotiana sylvestris
ref|XP_009610166.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    105   4e-22   Nicotiana tomentosiformis
ref|XP_010679398.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    103   2e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_005643999.1|  DEAD-domain-containing protein                   98.2    1e-19   Coccomyxa subellipsoidea C-169
dbj|BAK04860.1|  predicted protein                                    94.7    5e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CEG84746.1|  Putative Adenosinetriphosphatase                     89.7    5e-17   Rhizopus microsporus
emb|CEI91338.1|  hypothetical protein RMCBS344292_05633               90.5    6e-17   Rhizopus microsporus
emb|CEI97815.1|  Putative Adenosinetriphosphatase                     89.7    6e-17   Rhizopus microsporus
emb|CEG65407.1|  hypothetical protein RMATCC62417_02199               90.5    7e-17   Rhizopus microsporus
gb|ESA03679.1|  hypothetical protein GLOINDRAFT_5342                  88.2    4e-16   
dbj|GAN07211.1|  ATP-dependent RNA helicase DDX42-like                87.8    5e-16   Mucor ambiguus
emb|CEP11906.1|  hypothetical protein                                 88.2    5e-16   Parasitella parasitica
ref|XP_006388446.1|  hypothetical protein POPTR_0184s002101g          82.0    8e-16   
ref|XP_005849956.1|  hypothetical protein CHLNCDRAFT_6836             85.1    2e-15   Chlorella variabilis
emb|CDS07964.1|  hypothetical protein LRAMOSA01913                    85.9    2e-15   Lichtheimia ramosa
gb|EPB84356.1|  adenosinetriphosphatase                               85.1    3e-15   Mucor circinelloides f. circinelloides 1006PhL
gb|EIE89314.1|  hypothetical protein RO3G_14025                       84.7    4e-15   Rhizopus delemar RA 99-880
emb|CDH49031.1|  atp-dependent rna helicase ddx42-like                81.6    4e-14   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_002732809.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  79.7    2e-13   Saccoglossus kowalevskii
ref|XP_005189100.1|  PREDICTED: ATP-dependent RNA helicase DDX42      79.7    2e-13   Musca domestica
gb|KFD64928.1|  hypothetical protein M514_06320                       78.6    4e-13   Trichuris suis
emb|CDW58801.1|  ATP dependent RNA helicase DDX42                     78.6    5e-13   Trichuris trichiura
ref|XP_008111755.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  78.2    6e-13   Anolis carolinensis [Carolina anole]
gb|KFD52829.1|  hypothetical protein M513_06320                       78.2    8e-13   Trichuris suis
emb|CAG07234.1|  unnamed protein product                              77.8    8e-13   Tetraodon nigroviridis
ref|XP_003222696.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  77.8    8e-13   Anolis carolinensis [Carolina anole]
ref|XP_011412959.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  77.8    8e-13   Crassostrea gigas
gb|EKC34097.1|  ATP-dependent RNA helicase DDX42                      77.8    8e-13   Crassostrea gigas
ref|XP_003965007.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  77.0    1e-12   
ref|XP_007434065.1|  PREDICTED: ATP-dependent RNA helicase DDX42      77.0    2e-12   Python bivittatus
gb|KFH71949.1|  adenosinetriphosphatase                               77.0    2e-12   Mortierella verticillata NRRL 6337
ref|XP_003704217.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  77.0    2e-12   Megachile rotundata
ref|XP_003494399.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  77.0    2e-12   Bombus impatiens
ref|XP_003695134.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...  77.0    2e-12   Apis florea [dwarf honeybee]
ref|XP_003400196.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  76.6    2e-12   Bombus terrestris [large earth bumblebee]
ref|XP_624210.1|  PREDICTED: ATP-dependent RNA helicase DDX42-lik...  76.6    2e-12   Apis mellifera [bee]
gb|ETE73951.1|  ATP-dependent RNA helicase DDX42                      76.6    2e-12   Ophiophagus hannah
dbj|BAB25270.3|  unnamed protein product                              75.5    3e-12   Mus musculus [mouse]
ref|XP_010153672.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  75.1    3e-12   Eurypyga helias
ref|XP_011183991.1|  PREDICTED: ATP-dependent RNA helicase DDX42      75.9    3e-12   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011212733.1|  PREDICTED: ATP-dependent RNA helicase DDX42      75.9    3e-12   Bactrocera dorsalis [papaya fruit fly]
ref|XP_005439531.1|  PREDICTED: ATP-dependent RNA helicase DDX42      75.9    4e-12   
ref|XP_004526774.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  75.9    4e-12   Ceratitis capitata [medfly]
ref|XP_004526775.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  75.9    4e-12   
ref|XP_011141579.1|  PREDICTED: ATP-dependent RNA helicase DDX42      75.5    4e-12   Harpegnathos saltator
ref|XP_011155541.1|  PREDICTED: ATP-dependent RNA helicase DDX42      75.5    5e-12   Solenopsis invicta [imported red fire ant]
ref|XP_011333820.1|  PREDICTED: ATP-dependent RNA helicase DDX42      75.5    5e-12   Ooceraea biroi
ref|XP_001603249.2|  PREDICTED: ATP-dependent RNA helicase DDX42      75.5    5e-12   Nasonia vitripennis
gb|EFZ20748.1|  hypothetical protein SINV_08125                       75.5    5e-12   
ref|XP_011406654.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  75.1    5e-12   
ref|XP_007562270.1|  PREDICTED: ATP-dependent RNA helicase DDX42      75.5    5e-12   
ref|XP_008414524.1|  PREDICTED: ATP-dependent RNA helicase DDX42      75.5    5e-12   
gb|KDR08431.1|  hypothetical protein L798_01778                       75.1    6e-12   Zootermopsis nevadensis
ref|XP_009462900.1|  PREDICTED: ATP-dependent RNA helicase DDX42      75.5    6e-12   Nipponia nippon
ref|XP_005796709.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  75.1    6e-12   Xiphophorus maculatus
ref|XP_011053634.1|  PREDICTED: ATP-dependent RNA helicase DDX42      75.1    6e-12   Acromyrmex echinatior
ref|XP_006616469.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  75.1    6e-12   Apis dorsata [rock honeybee]
ref|XP_010131293.1|  PREDICTED: ATP-dependent RNA helicase DDX42      75.1    6e-12   Buceros rhinoceros silvestris
ref|XP_010220070.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...  75.1    7e-12   Tinamus guttatus
gb|EGT53299.1|  hypothetical protein CAEBREN_28318                    75.1    7e-12   Caenorhabditis brenneri
ref|XP_009094836.1|  PREDICTED: ATP-dependent RNA helicase DDX42      75.1    7e-12   
gb|KFM68309.1|  ATP-dependent RNA helicase DDX42                      73.9    8e-12   Stegodyphus mimosarum
ref|XP_011309575.1|  PREDICTED: ATP-dependent RNA helicase DDX42      74.7    8e-12   Fopius arisanus
ref|XP_010118012.1|  PREDICTED: ATP-dependent RNA helicase DDX42      74.7    8e-12   Chlamydotis macqueenii
ref|XP_009484257.1|  PREDICTED: ATP-dependent RNA helicase DDX42      74.7    8e-12   Pelecanus crispus
ref|XP_009700459.1|  PREDICTED: ATP-dependent RNA helicase DDX42      74.7    8e-12   Cariama cristata
ref|XP_005513666.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...  74.7    9e-12   
ref|XP_010291871.1|  PREDICTED: ATP-dependent RNA helicase DDX42      74.7    9e-12   Phaethon lepturus
ref|XP_009815142.1|  PREDICTED: ATP-dependent RNA helicase DDX42      74.7    9e-12   Gavia stellata
ref|XP_009500504.1|  PREDICTED: ATP-dependent RNA helicase DDX42      74.3    9e-12   Phalacrocorax carbo [common cormorant]
ref|XP_009318712.1|  PREDICTED: ATP-dependent RNA helicase DDX42      74.7    9e-12   Pygoscelis adeliae
ref|XP_008557882.1|  PREDICTED: ATP-dependent RNA helicase DDX42      74.7    9e-12   
ref|XP_009929118.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  74.7    9e-12   Haliaeetus albicilla
ref|XP_009943052.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...  74.7    9e-12   Opisthocomus hoazin [hoatzin]
ref|XP_009286175.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...  74.7    9e-12   Aptenodytes forsteri
ref|XP_005070291.1|  PREDICTED: ATP-dependent RNA helicase DDX42      74.7    9e-12   
ref|XP_009974055.1|  PREDICTED: ATP-dependent RNA helicase DDX42      74.7    9e-12   Tyto alba [Schleiereule]
ref|XP_009576804.1|  PREDICTED: ATP-dependent RNA helicase DDX42      74.7    9e-12   Fulmarus glacialis
ref|NP_001026097.1|  ATP-dependent RNA helicase DDX42                 74.7    9e-12   Gallus gallus [bantam]
ref|XP_009882142.1|  PREDICTED: ATP-dependent RNA helicase DDX42      74.7    1e-11   Charadrius vociferus
ref|XP_003213086.1|  PREDICTED: ATP-dependent RNA helicase DDX42      74.7    1e-11   Meleagris gallopavo [common turkey]
ref|XP_010307118.1|  PREDICTED: ATP-dependent RNA helicase DDX42      74.7    1e-11   Balearica regulorum gibbericeps
ref|XP_009929120.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  74.3    1e-11   Haliaeetus albicilla
ref|XP_005235891.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...  74.7    1e-11   
gb|AAH43036.4|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 42             74.3    1e-11   Mus musculus [mouse]
emb|CAB43268.1|  hypothetical protein                                 73.6    1e-11   Homo sapiens [man]
dbj|BAC33675.1|  unnamed protein product                              74.3    1e-11   Mus musculus [mouse]
ref|NP_497743.1|  Protein C46F11.4                                    74.3    1e-11   Caenorhabditis elegans [roundworm]
gb|ERE69243.1|  ATP-dependent RNA helicase DDX42                      74.3    1e-11   Cricetulus griseus [Chinese hamsters]
ref|XP_009908841.1|  PREDICTED: ATP-dependent RNA helicase DDX42      74.3    1e-11   Picoides pubescens
ref|NP_082350.3|  ATP-dependent RNA helicase DDX42                    74.3    1e-11   Mus musculus [mouse]
gb|EDL34279.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 42, isofor...  74.3    1e-11   Mus musculus [mouse]
ref|XP_006125806.1|  PREDICTED: ATP-dependent RNA helicase DDX42      74.3    1e-11   
ref|XP_001943796.1|  PREDICTED: ATP-dependent RNA helicase DDX42      74.3    1e-11   Acyrthosiphon pisum
ref|XP_003501916.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  74.3    1e-11   Cricetulus griseus [Chinese hamsters]
ref|XP_010208580.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  71.2    1e-11   Colius striatus
ref|XP_010178876.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  74.3    1e-11   Mesitornis unicolor
ref|XP_008636714.1|  PREDICTED: ATP-dependent RNA helicase DDX42      74.3    1e-11   
ref|XP_009068482.1|  PREDICTED: ATP-dependent RNA helicase DDX42      74.3    1e-11   Acanthisitta chloris
dbj|BAE42635.1|  unnamed protein product                              74.3    1e-11   Mus musculus [mouse]
ref|XP_010178875.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  74.3    1e-11   Mesitornis unicolor
ref|XP_009944313.1|  PREDICTED: ATP-dependent RNA helicase DDX42      73.9    1e-11   Leptosomus discolor
ref|XP_005059918.1|  PREDICTED: ATP-dependent RNA helicase DDX42      74.3    1e-11   Ficedula albicollis
ref|XP_010082319.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...  73.9    1e-11   Pterocles gutturalis
gb|EDL34280.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 42, isofor...  73.9    1e-11   Mus musculus [mouse]
ref|XP_009553734.1|  PREDICTED: ATP-dependent RNA helicase DDX42      73.9    1e-11   Cuculus canorus
dbj|BAG50996.1|  unnamed protein product                              73.2    2e-11   Homo sapiens [man]
dbj|BAG53696.1|  unnamed protein product                              73.6    2e-11   Homo sapiens [man]
ref|XP_010412362.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...  73.9    2e-11   
ref|XP_003381401.1|  ATP-dependent RNA helicase DDX42                 73.6    2e-11   Trichinella spiralis
ref|XP_005141681.1|  PREDICTED: ATP-dependent RNA helicase DDX42      73.9    2e-11   Melopsittacus undulatus
ref|NP_001100529.1|  ATP-dependent RNA helicase DDX42                 73.6    2e-11   Rattus norvegicus [brown rat]
ref|XP_306246.4|  Anopheles gambiae str. PEST AGAP012523-PA           73.6    2e-11   Anopheles gambiae str. PEST
ref|XP_006017900.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...  73.9    2e-11   
ref|XP_010006331.1|  PREDICTED: ATP-dependent RNA helicase DDX42      73.6    2e-11   Chaetura pelagica
ref|XP_005994677.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  73.6    2e-11   Latimeria chalumnae
ref|XP_002193200.1|  PREDICTED: ATP-dependent RNA helicase DDX42      73.6    2e-11   
ref|XP_005994674.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  73.6    2e-11   
ref|XP_009637948.1|  PREDICTED: ATP-dependent RNA helicase DDX42      73.6    2e-11   Egretta garzetta
ref|XP_009674257.1|  PREDICTED: ATP-dependent RNA helicase DDX42      73.6    2e-11   Struthio camelus australis
ref|XP_002008043.1|  GI12051                                          73.6    2e-11   Drosophila mojavensis
ref|XP_005994676.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  73.6    2e-11   Latimeria chalumnae
ref|XP_001985416.1|  GH17046                                          73.6    2e-11   Drosophila grimshawi
ref|XP_004597309.1|  PREDICTED: ATP-dependent RNA helicase DDX42      73.6    2e-11   Ochotona princeps [southern American pika]
ref|XP_001696911.1|  hypothetical protein CHLREDRAFT_176229           72.8    2e-11   Chlamydomonas reinhardtii
ref|XP_010167373.1|  PREDICTED: ATP-dependent RNA helicase DDX42      73.6    2e-11   Antrostomus carolinensis
ref|XP_010775224.1|  PREDICTED: ATP-dependent RNA helicase DDX42      73.6    2e-11   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_005029343.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  73.6    2e-11   
ref|XP_005029345.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  73.6    2e-11   
gb|ETN66901.1|  DEAD box ATP-dependent RNA helicase                   73.6    2e-11   Anopheles darlingi [American malaria mosquito]
gb|EOA94497.1|  ATP-dependent RNA helicase DDX42                      73.6    2e-11   Anas platyrhynchos [duck]
ref|NP_001080569.1|  ATP-dependent RNA helicase DDX42                 73.6    2e-11   Xenopus laevis [clawed frog]
ref|XP_005002031.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...  73.2    2e-11   
ref|XP_002047225.1|  GJ13322                                          73.2    3e-11   Drosophila virilis
ref|XP_008504049.1|  PREDICTED: ATP-dependent RNA helicase DDX42      73.2    3e-11   Calypte anna
ref|XP_002410726.1|  ATP-dependent RNA helicase, putative             72.8    3e-11   Ixodes scapularis [blacklegged tick]
ref|XP_005029344.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  73.2    3e-11   
ref|XP_003113047.1|  hypothetical protein CRE_25460                   73.2    3e-11   Caenorhabditis remanei
ref|XP_001653010.1|  AAEL001317-PA                                    72.8    3e-11   Aedes aegypti
ref|XP_004630218.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.8    3e-11   Octodon degus
ref|XP_009987983.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...  72.8    3e-11   Tauraco erythrolophus
ref|XP_004868683.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.8    3e-11   Heterocephalus glaber [naked mole rat]
ref|XP_002121386.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  72.8    3e-11   Ciona intestinalis [sea vase]
ref|XP_005402246.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.8    4e-11   Chinchilla lanigera
ref|XP_004891560.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.8    4e-11   
gb|EHB07352.1|  ATP-dependent RNA helicase DDX42                      72.8    4e-11   Heterocephalus glaber [naked mole rat]
gb|KFB45936.1|  AGAP012523-PA-like protein                            72.8    4e-11   Anopheles sinensis
gb|AGV54888.1|  MAP3K3/DDX42 fusion protein 1                         72.4    4e-11   Homo sapiens [man]
ref|XP_001957842.1|  GF23818                                          72.8    4e-11   Drosophila ananassae
ref|XP_010854727.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.8    4e-11   Bison bison bison
ref|XP_006041686.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.8    4e-11   
dbj|BAG54335.1|  unnamed protein product                              72.4    4e-11   Homo sapiens [man]
ref|XP_008269922.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.8    4e-11   Oryctolagus cuniculus [domestic rabbit]
ref|XP_005694049.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.8    4e-11   Capra hircus [domestic goat]
ref|XP_006886354.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.8    4e-11   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_010615035.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.8    4e-11   Fukomys damarensis [Damara mole rat]
ref|XP_008147656.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.8    4e-11   Eptesicus fuscus
ref|XP_004013070.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.8    4e-11   
ref|XP_003131337.3|  PREDICTED: ATP-dependent RNA helicase DDX42      72.8    4e-11   
ref|XP_003748366.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  72.4    4e-11   Galendromus occidentalis
ref|XP_004655133.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.8    4e-11   Jaculus jaculus
ref|XP_006092216.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.8    4e-11   
ref|XP_003414374.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.8    4e-11   Loxodonta africana [African bush elephant]
ref|XP_006199368.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...  72.8    4e-11   Vicugna pacos
ref|XP_008691827.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.8    4e-11   Ursus maritimus [white bear]
ref|XP_003942489.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.8    4e-11   Saimiri boliviensis boliviensis
gb|AAH78667.1|  DDX42 protein                                         72.8    4e-11   Homo sapiens [man]
ref|XP_009431321.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.4    4e-11   Pan troglodytes
ref|XP_002748184.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.8    4e-11   Callithrix jacchus [common marmoset]
ref|XP_007088325.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.8    4e-11   Panthera tigris altaica
ref|XP_010954290.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.8    4e-11   Camelus bactrianus [camel]
ref|XP_006177459.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.8    4e-11   Camelus ferus
ref|XP_008577303.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.4    4e-11   Galeopterus variegatus [Malayan flying lemur]
ref|XP_005858704.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.8    4e-11   Myotis brandtii
ref|XP_005976265.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...  72.8    4e-11   Pantholops hodgsonii [Tibetan antelope]
gb|KFO18063.1|  ATP-dependent RNA helicase DDX42                      72.8    4e-11   Fukomys damarensis [Damara mole rat]
ref|XP_002924562.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.8    4e-11   Ailuropoda melanoleuca
ref|NP_031398.2|  ATP-dependent RNA helicase DDX42                    72.8    4e-11   Homo sapiens [man]
ref|XP_004618051.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.8    4e-11   Sorex araneus [Eurasian shrew]
ref|XP_006776778.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.8    4e-11   
ref|XP_003270725.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.8    4e-11   
gb|AAC32396.1|  RNA helicase-related protein                          72.4    4e-11   
gb|EAW94278.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 42, isofor...  72.8    4e-11   
ref|XP_004041217.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.8    4e-11   
ref|XP_001147818.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.8    4e-11   
ref|XP_010854726.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.8    4e-11   
ref|XP_001501051.2|  PREDICTED: ATP-dependent RNA helicase DDX42      72.4    4e-11   
ref|XP_011366836.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.4    4e-11   
gb|EFB27245.1|  hypothetical protein PANDA_013938                     72.4    4e-11   
gb|ELK12473.1|  ATP-dependent RNA helicase DDX42                      72.4    4e-11   
ref|XP_005469003.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  72.4    4e-11   
ref|XP_006940548.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.4    4e-11   
ref|XP_003913323.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.4    4e-11   
ref|XP_005911167.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...  72.4    4e-11   
ref|XP_004749233.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.4    4e-11   
ref|XP_004432706.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.4    4e-11   
ref|NP_001126368.1|  ATP-dependent RNA helicase DDX42                 72.4    4e-11   
ref|XP_008844809.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.4    4e-11   
ref|XP_003786247.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.4    4e-11   
ref|XP_005328259.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.4    4e-11   
ref|XP_006041685.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.4    4e-11   
ref|XP_011366837.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.4    4e-11   
ref|XP_006912374.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  72.4    4e-11   
ref|XP_004749232.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.4    4e-11   
ref|XP_006638164.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  72.4    4e-11   
ref|XP_008516525.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.4    4e-11   
ref|XP_537598.3|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependent R...  72.4    4e-11   
ref|NP_001248484.1|  ATP-dependent RNA helicase DDX42                 72.4    4e-11   
ref|XP_007104587.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.4    4e-11   
ref|XP_010822544.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...  72.4    4e-11   
ref|XP_003442169.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  72.4    5e-11   
ref|XP_008048858.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.4    5e-11   
ref|XP_006737712.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.4    5e-11   
ref|XP_004707328.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.4    5e-11   
ref|XP_004405925.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.4    5e-11   
ref|XP_010378341.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.4    5e-11   
ref|XP_004275691.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.4    5e-11   
ref|XP_007456819.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...  72.4    5e-11   
sp|Q5R7D1.1|DDX42_PONAB  RecName: Full=ATP-dependent RNA helicase...  72.4    5e-11   
ref|XP_008011624.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.4    5e-11   
ref|XP_005584722.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.4    5e-11   
gb|EAW94276.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 42, isofor...  72.4    5e-11   
ref|XP_008577302.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.4    5e-11   
gb|AAH15505.1|  DDX42 protein                                         72.4    5e-11   
ref|XP_005369492.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.4    5e-11   
gb|EPQ02964.1|  ATP-dependent RNA helicase DDX42                      72.4    5e-11   
ref|XP_004374278.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.4    5e-11   
ref|XP_006912375.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  72.4    5e-11   
ref|XP_009431320.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.4    5e-11   
ref|XP_006970570.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.4    5e-11   
ref|XP_010378342.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.4    5e-11   
ref|XP_004321221.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.4    5e-11   
ref|XP_007527727.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.4    5e-11   
ref|XP_010980004.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.4    5e-11   
ref|XP_007175821.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.4    5e-11   
gb|KIY92875.1|  ATP-dependent RNA helicase DDX42                      71.6    5e-11   
ref|XP_006833637.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.4    5e-11   
ref|XP_008048862.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.4    5e-11   
ref|XP_007527726.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.4    5e-11   
ref|XP_004693490.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.4    5e-11   
ref|XP_010020094.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.4    5e-11   
ref|XP_008048861.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.4    5e-11   
emb|CDQ80425.1|  unnamed protein product                              72.4    5e-11   
ref|XP_007957926.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.4    5e-11   
ref|XP_005532499.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.4    5e-11   
ref|XP_008048860.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.4    5e-11   
ref|XP_003728430.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  72.4    5e-11   
ref|XP_005496258.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.4    5e-11   
ref|XP_008048859.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.0    5e-11   
ref|XP_004456873.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.0    6e-11   
ref|XP_004621812.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  72.0    6e-11   
emb|CAP29330.2|  Protein CBG09775                                     72.0    6e-11   
ref|XP_008280144.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.0    7e-11   
ref|XP_005429966.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.0    7e-11   
ref|XP_008280143.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  72.0    7e-11   
ref|XP_010743245.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.0    7e-11   
ref|XP_007061954.1|  PREDICTED: ATP-dependent RNA helicase DDX42      72.0    7e-11   
gb|EMP33727.1|  ATP-dependent RNA helicase DDX42                      72.0    7e-11   
ref|XP_010872478.1|  PREDICTED: ATP-dependent RNA helicase DDX42      71.6    8e-11   
ref|XP_004552488.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  71.6    8e-11   
ref|XP_006803079.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  71.6    9e-11   
ref|XP_004552486.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  71.6    9e-11   
ref|XP_006271624.1|  PREDICTED: ATP-dependent RNA helicase DDX42      71.6    9e-11   
ref|XP_002026545.1|  GL21821                                          71.6    9e-11   
ref|XP_005726276.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  71.6    9e-11   
ref|XP_005921894.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  71.6    9e-11   
ref|XP_001353646.1|  GA19578                                          71.6    9e-11   
ref|XP_005921896.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  71.6    9e-11   
ref|XP_011500852.1|  PREDICTED: ATP-dependent RNA helicase DDX42      71.6    9e-11   
ref|XP_008935895.1|  PREDICTED: ATP-dependent RNA helicase DDX42      71.2    1e-10   
ref|XP_011254081.1|  PREDICTED: ATP-dependent RNA helicase DDX42      71.2    1e-10   
ref|XP_009864663.1|  PREDICTED: ATP-dependent RNA helicase DDX42      71.2    1e-10   
ref|XP_005313033.1|  PREDICTED: ATP-dependent RNA helicase DDX42      71.2    1e-10   
ref|XP_004071236.1|  PREDICTED: ATP-dependent RNA helicase DDX42      71.2    1e-10   
ref|XP_003768499.1|  PREDICTED: ATP-dependent RNA helicase DDX42      71.2    1e-10   
ref|XP_002068383.1|  GK13754                                          71.2    1e-10   
ref|XP_008327544.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  70.9    1e-10   
ref|XP_008327545.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  71.2    1e-10   
ref|NP_648413.1|  CG6418                                              70.9    1e-10   
ref|XP_007662329.1|  PREDICTED: ATP-dependent RNA helicase DDX42      70.9    1e-10   
ref|XP_008484723.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  70.9    1e-10   
ref|XP_008196207.1|  PREDICTED: ATP-dependent RNA helicase DDX42      70.9    1e-10   
gb|ETL77834.1|  hypothetical protein, variant                         70.5    2e-10   
gb|ETK85711.1|  hypothetical protein, variant                         70.5    2e-10   
gb|ETI45762.1|  hypothetical protein, variant                         70.5    2e-10   
gb|ETM45576.1|  hypothetical protein, variant                         70.5    2e-10   
ref|XP_008892762.1|  hypothetical protein, variant                    70.5    2e-10   
ref|XP_002899634.1|  DEAD/DEAH box RNA helicase, putative             70.1    2e-10   
ref|XP_002094331.1|  GE20258                                          70.5    2e-10   
ref|XP_002163251.2|  PREDICTED: ATP-dependent RNA helicase DDX42-...  70.5    2e-10   
ref|XP_001972305.1|  GG13958                                          70.5    2e-10   
ref|XP_008892761.1|  hypothetical protein PPTG_01275                  70.1    3e-10   
gb|ETL77833.1|  hypothetical protein L917_21256                       70.1    3e-10   
gb|ETP43648.1|  hypothetical protein F442_09647                       70.1    3e-10   
gb|ETK85710.1|  hypothetical protein L915_09551                       70.1    3e-10   
gb|ETI45761.1|  hypothetical protein F443_09746                       70.1    3e-10   
gb|ETM45575.1|  hypothetical protein L914_09420                       70.1    3e-10   
gb|AAH98590.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 42             69.3    3e-10   
emb|CCI42202.1|  unnamed protein product                              69.7    3e-10   
ref|XP_008921732.1|  PREDICTED: ATP-dependent RNA helicase DDX42      69.7    3e-10   
gb|ERL84716.1|  hypothetical protein D910_02141                       69.7    3e-10   
ref|XP_001635620.1|  predicted protein                                68.9    4e-10   
ref|XP_002030023.1|  GM24798                                          69.3    5e-10   
gb|ENN71264.1|  hypothetical protein YQE_12190                        69.3    5e-10   
gb|ENN71263.1|  hypothetical protein YQE_12190                        69.3    5e-10   
ref|XP_002076525.1|  GD17585                                          68.9    5e-10   
ref|NP_001032894.2|  ATP-dependent RNA helicase DDX42                 68.9    6e-10   
ref|XP_004918655.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  68.9    6e-10   
ref|XP_002935570.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  68.9    7e-10   
gb|AAI57684.1|  LOC100135374 protein                                  68.9    7e-10   
gb|EFX87493.1|  hypothetical protein DAPPUDRAFT_306483                68.9    7e-10   
emb|CDJ96065.1|  DNA RNA helicase domain containing protein           68.9    7e-10   
ref|XP_001013142.1|  CLN3 protein                                     68.6    8e-10   
ref|XP_009526657.1|  hypothetical protein PHYSODRAFT_300617           68.6    9e-10   
emb|CDJ87791.1|  DNA RNA helicase domain containing protein           68.6    9e-10   
ref|XP_007908375.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  68.2    1e-09   
gb|EAR92897.2|  DEAD/DEAH-box helicase                                68.2    1e-09   
emb|CCA19605.1|  DEAD/DEAH box RNA helicase putative                  68.2    1e-09   
ref|XP_007908376.1|  PREDICTED: ATP-dependent RNA helicase DDX42 ...  68.2    1e-09   
ref|XP_002641484.1|  Hypothetical protein CBG09775                    67.8    1e-09   
ref|XP_001423947.1|  hypothetical protein                             67.4    2e-09   
gb|EYB91634.1|  hypothetical protein Y032_0203g1805                   67.4    2e-09   
ref|XP_002430222.1|  DEAD box ATP-dependent RNA helicase, putative    67.0    2e-09   
gb|KHJ90802.1|  DEAD/DEAH box helicase                                67.0    3e-09   
gb|EFA86632.1|  putative RNA helicase                                 66.6    3e-09   
ref|XP_005089057.1|  PREDICTED: ATP-dependent RNA helicase DDX42-...  66.6    3e-09   
gb|KHN87845.1|  ATP-dependent RNA helicase DDX42                      66.6    4e-09   
ref|XP_004362177.1|  putative RNA helicase                            66.2    5e-09   
ref|XP_636700.1|  hypothetical protein DDB_G0288501                   65.9    7e-09   
gb|ELU02447.1|  hypothetical protein CAPTEDRAFT_155002                65.5    7e-09   
ref|XP_009018679.1|  hypothetical protein HELRODRAFT_132273           64.3    8e-09   
gb|EJY69232.1|  hypothetical protein OXYTRI_10149                     65.5    9e-09   
gb|ERG83651.1|  atp-dependent rna helicase ddx42                      65.1    1e-08   
gb|EJW77757.1|  hypothetical protein WUBG_11335                       64.3    1e-08   
gb|ETN68203.1|  DEAD/DEAH box helicase                                64.7    2e-08   
gb|EJD75019.1|  DEAD-box ATP-dependent RNA helicase 24                63.9    2e-08   
ref|XP_003148859.1|  DEAD/DEAH box helicase                           63.5    3e-08   
emb|CDP93632.1|  Protein Bm2795, isoform c                            63.5    3e-08   
ref|XP_001902572.1|  DEAD/DEAH box helicase family protein            63.5    4e-08   
gb|EPZ32154.1|  DNA/RNA helicase, DEAD/DEAH box type domain-conta...  63.2    4e-08   
gb|KJE90517.1|  DEAD/DEAH box helicase                                63.2    5e-08   
ref|XP_004364695.1|  DEAD/DEAH box helicase                           63.2    5e-08   
ref|XP_006677717.1|  hypothetical protein BATDEDRAFT_10391            62.4    9e-08   
ref|XP_004342199.1|  DEAD/DEAH box helicase domain containing pro...  62.0    1e-07   
ref|XP_004365647.1|  DEAD box ATP-dependent RNA helicase              62.0    1e-07   
emb|CBY08790.1|  unnamed protein product                              61.6    2e-07   
ref|XP_010027294.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  61.6    2e-07   
dbj|GAA57786.1|  ATP-dependent RNA helicase DDX42                     61.2    2e-07   
dbj|GAM28709.1|  hypothetical protein SAMD00019534_118850             60.8    3e-07   
ref|XP_009175231.1|  LOW QUALITY PROTEIN: hypothetical protein T2...  60.8    3e-07   
emb|CDW84857.1|  dead-box atp-dependent rna helicase 24-like          60.8    3e-07   
ref|XP_010518933.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.5    3e-07   
dbj|GAA35819.2|  probable ATP-dependent RNA helicase DDX17            60.8    3e-07   
ref|XP_004998139.1|  vasa                                             60.5    4e-07   
ref|XP_009176831.1|  hypothetical protein T265_11802                  60.5    4e-07   
ref|XP_011128708.1|  putative DEAD box ATP-dependent RNA helicase     60.5    4e-07   
ref|XP_003986376.1|  PREDICTED: probable ATP-dependent RNA helica...  60.5    4e-07   
gb|EHH60763.1|  Putative ATP-dependent RNA helicase DDX53             60.1    4e-07   
ref|XP_005593226.1|  PREDICTED: probable ATP-dependent RNA helica...  60.1    4e-07   
ref|XP_007090172.1|  PREDICTED: probable ATP-dependent RNA helica...  60.1    4e-07   
ref|XP_003917545.1|  PREDICTED: DEAD box protein 53                   60.1    4e-07   
ref|XP_001087519.1|  PREDICTED: probable ATP-dependent RNA helica...  60.1    5e-07   
gb|EHH19845.1|  Putative ATP-dependent RNA helicase DDX53             60.1    5e-07   
ref|XP_010356995.1|  PREDICTED: DEAD box protein 53                   60.1    5e-07   
gb|KFK38698.1|  hypothetical protein AALP_AA3G148400                  60.1    5e-07   
ref|XP_001645593.1|  hypothetical protein Kpol_1033p40                59.7    5e-07   
gb|AAG51573.1|AC027034_19  RNA helicase, 5' partial; 101954-101280    57.4    6e-07   
gb|KGN57060.1|  hypothetical protein Csa_3G151370                     60.1    6e-07   
ref|XP_006415274.1|  hypothetical protein EUTSA_v10007300mg           59.7    6e-07   
ref|XP_004134467.1|  PREDICTED: uncharacterized protein LOC101206109  60.1    6e-07   
ref|XP_004356048.1|  putative RNA helicase                            59.7    7e-07   
ref|XP_004159856.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...  59.7    7e-07   
ref|XP_003566767.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  59.7    7e-07   
gb|AGE46032.1|  dead-box ATP-dependent RNA helicase                   59.3    7e-07   
ref|XP_004580611.1|  PREDICTED: probable ATP-dependent RNA helica...  59.3    8e-07   
ref|XP_004968529.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  59.3    9e-07   
gb|KFQ18838.1|  putative ATP-dependent RNA helicase DDX46             55.8    9e-07   
gb|KFK44954.1|  hypothetical protein AALP_AA1G325100                  59.3    9e-07   
gb|EPS60527.1|  hypothetical protein M569_14276                       57.8    9e-07   
emb|CAA09209.1|  RNA helicase                                         57.0    1e-06   
ref|XP_009336746.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  56.2    1e-06   
emb|CDH54279.1|  p-loop containing nucleoside triphosphatehydrola...  59.3    1e-06   
ref|XP_004968530.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  58.9    1e-06   
ref|XP_005407885.1|  PREDICTED: probable ATP-dependent RNA helica...  59.3    1e-06   
ref|XP_006306418.1|  hypothetical protein CARUB_v10012355mg           58.9    1e-06   
ref|NP_001142117.1|  uncharacterized protein LOC100274281             58.9    1e-06   
ref|XP_002503377.1|  predicted protein                                58.9    1e-06   
ref|XP_010501121.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  58.9    1e-06   
ref|XP_010940175.1|  PREDICTED: ATP-dependent RNA helicase-like p...  58.9    1e-06   
dbj|GAM26008.1|  hypothetical protein SAMD00019534_091830             58.9    1e-06   
ref|XP_010940176.1|  PREDICTED: ATP-dependent RNA helicase-like p...  58.9    1e-06   
ref|XP_010480028.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  58.9    1e-06   
ref|XP_010480030.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  58.9    1e-06   
gb|KIJ12013.1|  hypothetical protein PAXINDRAFT_83682                 55.5    1e-06   
gb|KIH67945.1|  DEAD/DEAH box helicase                                58.9    1e-06   
gb|KIO15031.1|  hypothetical protein M404DRAFT_120005                 55.5    1e-06   
ref|XP_008862132.1|  hypothetical protein H310_00937                  58.9    1e-06   
ref|XP_009822138.1|  hypothetical protein H257_00904                  58.5    2e-06   
ref|XP_001419069.1|  predicted protein                                58.5    2e-06   
ref|XP_003293247.1|  hypothetical protein DICPUDRAFT_41749            58.5    2e-06   



>gb|KHN43447.1| DEAD-box ATP-dependent RNA helicase 24 [Glycine soja]
Length=686

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTLIT KEARFAGELVNSL+ AGQNV  ELMDLAMKDGRF
Sbjct  471  DMHVHRIGRTGRAGDKDGVAYTLITLKEARFAGELVNSLVAAGQNVSVELMDLAMKDGRF  530

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTG  399
            RSKRDARKGGGK+ KGRGG GRGVRGVD+GLGIGY++ES+NAP+TT PSRSAAVNSLRTG
Sbjct  531  RSKRDARKGGGKKGKGRGGGGRGVRGVDFGLGIGYNSESNNAPSTTAPSRSAAVNSLRTG  590

Query  398  MMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAA  219
            MM+QFKSNFVAASSN QNQ  G+++ M  NK+ ALPGFVSGG+IGGD N  + ++  N A
Sbjct  591  MMSQFKSNFVAASSNSQNQGFGSNTSMAANKRPALPGFVSGGSIGGDINTYQNTASPNPA  650

Query  218  TS  213
            TS
Sbjct  651  TS  652



>ref|XP_003554554.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Glycine 
max]
Length=768

 Score =   232 bits (592),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTLIT KEARFAGELVNSL+ AGQNV  ELMDLAMKDGRF
Sbjct  553  DMHVHRIGRTGRAGDKDGVAYTLITLKEARFAGELVNSLVAAGQNVSVELMDLAMKDGRF  612

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTG  399
            RSKRDARKGGGK+ KGRGG GRGVRGVD+GLGIGY++ES+NAP+TT PSRSAAVNSLRTG
Sbjct  613  RSKRDARKGGGKKGKGRGGGGRGVRGVDFGLGIGYNSESNNAPSTTAPSRSAAVNSLRTG  672

Query  398  MMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAA  219
            MM+QFKSNFVAASSN QNQ  G+++ M  NK+ ALPGFVSGG+IGGD N  + ++  N A
Sbjct  673  MMSQFKSNFVAASSNSQNQGFGSNTSMAANKRPALPGFVSGGSIGGDINTYQNTASPNPA  732

Query  218  TS  213
            TS
Sbjct  733  TS  734



>ref|XP_009610165.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Nicotiana tomentosiformis]
Length=777

 Score =   232 bits (591),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 154/219 (70%), Positives = 171/219 (78%), Gaps = 6/219 (3%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDGTAYTLITQKEARFAGEL NSL+ AGQ V  ELMDLAMKDGRF
Sbjct  559  DMHVHRIGRTGRAGDKDGTAYTLITQKEARFAGELANSLVAAGQTVSIELMDLAMKDGRF  618

Query  578  rsk-rdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRT  402
            RSK    + GG +     GG+ RGVRGVD+GLGIGY+AES+N P    PSRSAAVNSLRT
Sbjct  619  RSKRDARKGGGKRAKGRGGGNNRGVRGVDFGLGIGYNAESNNPPQNAAPSRSAAVNSLRT  678

Query  401  GMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNA  222
            GMMAQFKSNFVAASSN QNQ + N++G  PNK M L GFVSGGTIGG++NASR SS   A
Sbjct  679  GMMAQFKSNFVAASSNSQNQGMNNTAGAYPNKGMVLQGFVSGGTIGGESNASRISSTFAA  738

Query  221  AT-----SVQKPREDASHLssgssrdrqrerrrpSGWDR  120
            AT     S Q  R+ A+  SS SS+++ RERRRPSGWDR
Sbjct  739  ATPGAYSSSQPARDGANQKSSESSKEKSRERRRPSGWDR  777



>ref|XP_003521597.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Glycine 
max]
Length=782

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 156/185 (84%), Gaps = 3/185 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTLIT KEARFAGELVNSL+ AGQNV  ELMDLAMKDGRF
Sbjct  564  DMHVHRIGRTGRAGDKDGVAYTLITLKEARFAGELVNSLVAAGQNVSVELMDLAMKDGRF  623

Query  578  rskrdarkgggkrakgrggsgrgvrgvD---YGLGIGYSAESSNAPTTTVPSRSAAVNSL  408
            RSKRDARKGGGK+ KGRGG G G RGV    +GLGIGY+ ES+NAP+TT PSRSAAVNSL
Sbjct  624  RSKRDARKGGGKKGKGRGGGGGGGRGVRGVDFGLGIGYNPESNNAPSTTAPSRSAAVNSL  683

Query  407  RTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSIS  228
            RTGMM+QFKSNFVAASSN QNQ  GN++ M  NK+ ALPGFVSGG+IGGD N  ++++  
Sbjct  684  RTGMMSQFKSNFVAASSNSQNQGFGNNTSMTANKRTALPGFVSGGSIGGDINTYQSTASP  743

Query  227  NAATS  213
            N ATS
Sbjct  744  NPATS  748



>gb|KHN19202.1| DEAD-box ATP-dependent RNA helicase 24 [Glycine soja]
Length=784

 Score =   230 bits (587),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 156/185 (84%), Gaps = 3/185 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTLIT KEARFAGELVNSL+ AGQNV  ELMDLAMKDGRF
Sbjct  566  DMHVHRIGRTGRAGDKDGVAYTLITLKEARFAGELVNSLVAAGQNVSVELMDLAMKDGRF  625

Query  578  rskrdarkgggkrakgrggsgrgvrgvD---YGLGIGYSAESSNAPTTTVPSRSAAVNSL  408
            RSKRDARKGGGK+ KGRGG G G RGV    +GLGIGY+ ES+NAP+TT PSRSAAVNSL
Sbjct  626  RSKRDARKGGGKKGKGRGGGGGGGRGVRGVDFGLGIGYNPESNNAPSTTAPSRSAAVNSL  685

Query  407  RTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSIS  228
            RTGMM+QFKSNFVAASSN QNQ  GN++ M  NK+ ALPGFVSGG+IGGD N  ++++  
Sbjct  686  RTGMMSQFKSNFVAASSNSQNQGFGNNTSMTANKRTALPGFVSGGSIGGDINTYQSTASP  745

Query  227  NAATS  213
            N ATS
Sbjct  746  NPATS  750



>ref|XP_011079538.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Sesamum indicum]
Length=770

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 179/216 (83%), Gaps = 6/216 (3%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDGTAYTLITQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  558  DMHVHRIGRTGRAGDKDGTAYTLITQKEARFAGELVNSLIAAGQNVSTELMDLAMKDGRF  617

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTG  399
            RSKRD+RKGGGKRAKGRGG GRGVRGVDYGLGIGYS + SNA ++  P+RS AVNSLRTG
Sbjct  618  RSKRDSRKGGGKRAKGRGGGGRGVRGVDYGLGIGYSPD-SNAASSVTPTRSVAVNSLRTG  676

Query  398  MMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAA  219
            MMAQF++NFV ASSN QN  + NS+G+  NK+M LPGFVSGGTIGGD +A + +S ++AA
Sbjct  677  MMAQFRNNFVPASSNSQNHFVQNSTGVQTNKRMVLPGFVSGGTIGGDMHAVQINSTTSAA  736

Query  218  T---SVQKPREDASHLssgssrdrqrerrrpSGWDR  120
            +   ++   RE A    + S RD+ RERRRPSGWDR
Sbjct  737  SASNTILNSREIAKQ--TPSERDKARERRRPSGWDR  770



>ref|XP_009758471.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Nicotiana sylvestris]
 ref|XP_009758473.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Nicotiana sylvestris]
Length=762

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 149/176 (85%), Gaps = 1/176 (1%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDGTAYTLITQKEARFAGEL NSL+ AGQ V  ELMDLAMKDGRF
Sbjct  559  DMHVHRIGRTGRAGDKDGTAYTLITQKEARFAGELANSLVAAGQTVSIELMDLAMKDGRF  618

Query  578  rskrdarkgggkrakgrggsgrgvrg-vDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRT  402
            RSKRDARKGGGKRAKGRGG        VD+GLGIGY++ES+N P  T PSRSAAVNSLRT
Sbjct  619  RSKRDARKGGGKRAKGRGGGSNRGVRGVDFGLGIGYNSESNNPPQNTAPSRSAAVNSLRT  678

Query  401  GMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSS  234
            GMMAQFKS+FVAASSN QNQ + N++G  PNK M L GFVSGGTIGG++NASR SS
Sbjct  679  GMMAQFKSSFVAASSNSQNQGMNNTAGAYPNKGMVLQGFVSGGTIGGESNASRISS  734



>ref|XP_006349177.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Solanum 
tuberosum]
Length=774

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 156/219 (71%), Positives = 171/219 (78%), Gaps = 6/219 (3%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDGTAYTLIT KEARFAGEL NSL+ AGQ V  ELMDLAMKDGRF
Sbjct  556  DMHVHRIGRTGRAGDKDGTAYTLITHKEARFAGELANSLVAAGQTVSVELMDLAMKDGRF  615

Query  578  rskrdarkgggkrakgrggsgrgvrg-vDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRT  402
            RSKRDARKGGGKRAKGRGG        VD+GLGIGY+ ES+N P +  PSRSAAVNSLRT
Sbjct  616  RSKRDARKGGGKRAKGRGGGNNKGVRGVDFGLGIGYNPESNNPPQSAAPSRSAAVNSLRT  675

Query  401  GMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNA  222
            GMMAQFKS+FVAASS  QNQ + N+ G  PNKKM L GFVSGGTIGG++N S  SS   A
Sbjct  676  GMMAQFKSSFVAASSKSQNQGMNNTEGTFPNKKMVLQGFVSGGTIGGNSNTSHNSSTFTA  735

Query  221  A-----TSVQKPREDASHLssgssrdrqrerrrpSGWDR  120
            A     TS Q  R+ A+  SS SS+++ RERRRPSGWDR
Sbjct  736  ATSGAYTSSQPARDGANQKSSESSKEKSRERRRPSGWDR  774



>ref|XP_004494431.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X1 [Cicer arietinum]
Length=776

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 147/185 (79%), Gaps = 3/185 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDK+G AYTLITQKEARFAGELVNSL+ AGQNV  ELMDLAMKDGRF
Sbjct  557  DMHVHRIGRTGRAGDKEGVAYTLITQKEARFAGELVNSLVAAGQNVSTELMDLAMKDGRF  616

Query  578  rsk---rdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSL  408
            RSK   R      GK   G G  G+GVRGVD+GLGIGY+AE +NAP+ TVPSRSAAVNSL
Sbjct  617  RSKRDARKGGGRKGKGRGGGGAGGKGVRGVDFGLGIGYTAEPNNAPSNTVPSRSAAVNSL  676

Query  407  RTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSIS  228
            RTGMM+QF+SNFVAASSN QN+   N++ +  NK+ AL GFVSGG+IGGD N  + ++  
Sbjct  677  RTGMMSQFRSNFVAASSNSQNEGFSNNTSITVNKRPALAGFVSGGSIGGDINTHQHTASY  736

Query  227  NAATS  213
            N ATS
Sbjct  737  NPATS  741



>ref|XP_004494432.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X2 [Cicer arietinum]
Length=775

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 147/185 (79%), Gaps = 3/185 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDK+G AYTLITQKEARFAGELVNSL+ AGQNV  ELMDLAMKDGRF
Sbjct  557  DMHVHRIGRTGRAGDKEGVAYTLITQKEARFAGELVNSLVAAGQNVSTELMDLAMKDGRF  616

Query  578  rsk---rdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSL  408
            RSK   R      GK   G G  G+GVRGVD+GLGIGY+AE +NAP+ TVPSRSAAVNSL
Sbjct  617  RSKRDARKGGGRKGKGRGGGGAGGKGVRGVDFGLGIGYTAEPNNAPSNTVPSRSAAVNSL  676

Query  407  RTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSIS  228
            RTGMM+QF+SNFVAASSN QN+   N++ +  NK+ AL GFVSGG+IGGD N  + ++  
Sbjct  677  RTGMMSQFRSNFVAASSNSQNEGFSNNTSITVNKRPALAGFVSGGSIGGDINTHQHTASY  736

Query  227  NAATS  213
            N ATS
Sbjct  737  NPATS  741



>ref|XP_002277419.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Vitis vinifera]
 emb|CBI36962.3| unnamed protein product [Vitis vinifera]
Length=771

 Score =   220 bits (560),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 177/219 (81%), Gaps = 6/219 (3%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D HVHRIGR GRAGDKDGTAYTLIT KEARFAGELV SLI AGQNVP ELMDLAMKDGRF
Sbjct  553  DAHVHRIGRTGRAGDKDGTAYTLITHKEARFAGELVGSLIAAGQNVPMELMDLAMKDGRF  612

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTG  399
            RSKRDARKGGGK++KG+GG+GRGVRGVD+GLGIGY+ ES+N  + TVPSR+AAVNSLRTG
Sbjct  613  RSKRDARKGGGKKSKGKGGNGRGVRGVDFGLGIGYNPESNNPSSQTVPSRAAAVNSLRTG  672

Query  398  MMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTN-ASRTSSISNA  222
            MMAQFKSNFVAA+S  QNQ   NS     NK+  L GFVSGG+IGGD N A  TSS S A
Sbjct  673  MMAQFKSNFVAATSGSQNQGSNNSPSTYANKRPVLQGFVSGGSIGGDMNRAQTTSSFSPA  732

Query  221  ATSV-----QKPREDASHLssgssrdrqrerrrpSGWDR  120
             TS      Q   E+ASH +S +SRDR RERRRPSGWDR
Sbjct  733  PTSAGKTSGQNSGENASHRNSENSRDRSRERRRPSGWDR  771



>emb|CAN74586.1| hypothetical protein VITISV_041989 [Vitis vinifera]
Length=771

 Score =   220 bits (560),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 177/219 (81%), Gaps = 6/219 (3%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D HVHRIGR GRAGDKDGTAYTLIT KEARFAGELV SLI AGQNVP ELMDLAMKDGRF
Sbjct  553  DAHVHRIGRTGRAGDKDGTAYTLITHKEARFAGELVGSLIAAGQNVPMELMDLAMKDGRF  612

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTG  399
            RSKRDARKGGGK++KG+GG+GRGVRGVD+GLGIGY+ ES+N  + TVPSR+AAVNSLRTG
Sbjct  613  RSKRDARKGGGKKSKGKGGNGRGVRGVDFGLGIGYNPESNNPSSQTVPSRAAAVNSLRTG  672

Query  398  MMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTN-ASRTSSISNA  222
            MMAQFKSNFVAA+S  QNQ   NS     NK+  L GFVSGG+IGGD N A  TSS S A
Sbjct  673  MMAQFKSNFVAATSGSQNQGSNNSPSTYANKRPVLQGFVSGGSIGGDMNRAQTTSSFSPA  732

Query  221  ATSV-----QKPREDASHLssgssrdrqrerrrpSGWDR  120
             TS      Q   E+ASH +S +SRDR RERRRPSGWDR
Sbjct  733  PTSAGKTSGQNSGENASHRNSENSRDRSRERRRPSGWDR  771



>ref|XP_004229381.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Solanum lycopersicum]
 ref|XP_010322339.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Solanum lycopersicum]
Length=774

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 154/219 (70%), Positives = 171/219 (78%), Gaps = 6/219 (3%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDGTA+TLIT KEARFAGEL NSL+ AGQ V  ELMDLAMKDGRF
Sbjct  556  DMHVHRIGRTGRAGDKDGTAFTLITHKEARFAGELANSLVAAGQTVSVELMDLAMKDGRF  615

Query  578  rskrdarkgggkrakgrggsgrgvrg-vDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRT  402
            RSKRDARKGGGKRAKGRGG        VD+GLGIGY+ ES+N   +  PSRSAAVNSLRT
Sbjct  616  RSKRDARKGGGKRAKGRGGGNNKGVRGVDFGLGIGYNPESNNPLQSAAPSRSAAVNSLRT  675

Query  401  GMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNA  222
            GMM+QFKS+FVAASSN QNQ + N++G  PNKKM L GFVSGGTIGG++N    SS   A
Sbjct  676  GMMSQFKSSFVAASSNSQNQGMNNTAGAFPNKKMVLQGFVSGGTIGGNSNTPHISSTFTA  735

Query  221  A-----TSVQKPREDASHLssgssrdrqrerrrpSGWDR  120
            A     TS Q  R+ A+  SS SS++R RERRRPSGWDR
Sbjct  736  ATPGGYTSSQPARDGANQKSSESSKERSRERRRPSGWDR  774



>ref|XP_007163191.1| hypothetical protein PHAVU_001G214100g [Phaseolus vulgaris]
 gb|ESW35185.1| hypothetical protein PHAVU_001G214100g [Phaseolus vulgaris]
Length=760

 Score =   215 bits (547),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 148/185 (80%), Gaps = 6/185 (3%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTLITQKEARFAGELVNSL+ AGQNV  ELMDLAMKDGRF
Sbjct  548  DMHVHRIGRTGRAGDKDGVAYTLITQKEARFAGELVNSLVAAGQNVSVELMDLAMKDGRF  607

Query  578  rsk--rdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLR  405
            RSK       G   R +G GG GRGVRGVD+GLGIGY+ ESS    +TVP+RSAAVNSLR
Sbjct  608  RSKRDARKGGGKKGRGRGGGGGGRGVRGVDFGLGIGYNPESS----STVPTRSAAVNSLR  663

Query  404  TGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISN  225
            TGMM+QFKSNFVAASSN +NQ  GN++ M  NK+ ALPGFVSGG+IGGD N  + ++   
Sbjct  664  TGMMSQFKSNFVAASSNSENQGFGNNTSMAANKRPALPGFVSGGSIGGDVNTYQHTASLP  723

Query  224  AATSV  210
            A+++V
Sbjct  724  ASSAV  728



>gb|AGV54423.1| DEAD-box ATP-dependent RNA helicase 24-like protein [Phaseolus 
vulgaris]
Length=760

 Score =   214 bits (546),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 151/185 (82%), Gaps = 6/185 (3%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTLITQKEARFAGELVNSL+ AGQNV  ELMDLAMKDGRF
Sbjct  548  DMHVHRIGRTGRAGDKDGVAYTLITQKEARFAGELVNSLVAAGQNVSVELMDLAMKDGRF  607

Query  578  rskrda--rkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLR  405
            RSKRDA    G   R +G GG GRGVRGVD+GLGIGY+ ESS    +TVP+RSAAVNSLR
Sbjct  608  RSKRDARKGGGKKGRGRGGGGGGRGVRGVDFGLGIGYNPESS----STVPTRSAAVNSLR  663

Query  404  TGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISN  225
            TGMM+QFKSNFVAASSN +NQ  GN++ M  NK+ ALPGFVSGG+IGGD N  + ++   
Sbjct  664  TGMMSQFKSNFVAASSNSENQGFGNNTSMAANKRPALPGFVSGGSIGGDVNTYQHTASLP  723

Query  224  AATSV  210
            A+++V
Sbjct  724  ASSAV  728



>gb|KDO86968.1| hypothetical protein CISIN_1g003881mg [Citrus sinensis]
Length=787

 Score =   214 bits (544),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDGTAYTL+TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  552  DMHVHRIGRTGRAGDKDGTAYTLVTQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRF  611

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTG  399
            RSKRDARKGGGK+ KGRGG+GRGVRGVD+GLGIGY+ ES+N  + +VPSRSAAVNSL+TG
Sbjct  612  RSKRDARKGGGKKGKGRGGAGRGVRGVDFGLGIGYTPESNNTSSQSVPSRSAAVNSLKTG  671

Query  398  MMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSIS  228
            MM QF+SNFVAASSN  ++   NS+    NK+ AL GFVSGG+IGGD N ++T+ ++
Sbjct  672  MMTQFRSNFVAASSNTPSEGFNNSASAYANKRPALRGFVSGGSIGGDVNGTQTTGLT  728



>ref|XP_006444514.1| hypothetical protein CICLE_v10018925mg [Citrus clementina]
 ref|XP_006492349.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Citrus 
sinensis]
 gb|ESR57754.1| hypothetical protein CICLE_v10018925mg [Citrus clementina]
 gb|KDO86969.1| hypothetical protein CISIN_1g003881mg [Citrus sinensis]
 gb|KDO86970.1| hypothetical protein CISIN_1g003881mg [Citrus sinensis]
Length=789

 Score =   214 bits (544),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDGTAYTL+TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  552  DMHVHRIGRTGRAGDKDGTAYTLVTQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRF  611

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTG  399
            RSKRDARKGGGK+ KGRGG+GRGVRGVD+GLGIGY+ ES+N  + +VPSRSAAVNSL+TG
Sbjct  612  RSKRDARKGGGKKGKGRGGAGRGVRGVDFGLGIGYTPESNNTSSQSVPSRSAAVNSLKTG  671

Query  398  MMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSIS  228
            MM QF+SNFVAASSN  ++   NS+    NK+ AL GFVSGG+IGGD N ++T+ ++
Sbjct  672  MMTQFRSNFVAASSNTPSEGFNNSASAYANKRPALRGFVSGGSIGGDVNGTQTTGLT  728



>ref|XP_010069832.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Eucalyptus 
grandis]
 gb|KCW58317.1| hypothetical protein EUGRSUZ_H01004 [Eucalyptus grandis]
Length=797

 Score =   211 bits (536),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 152/230 (66%), Positives = 173/230 (75%), Gaps = 18/230 (8%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTLITQKEARF GELVNSLI AGQNVP ELMDLAMKDGRF
Sbjct  569  DMHVHRIGRTGRAGDKDGVAYTLITQKEARFGGELVNSLIAAGQNVPMELMDLAMKDGRF  628

Query  578  rskrdarkgggkrakgrggsgrgvrgvD------------YGLGIGYSAESSNAPTTTVP  435
            RSKRD+RKGGG++ +GRGG G    G              YGLGIGY+AESS AP+   P
Sbjct  629  RSKRDSRKGGGRKGRGRGGGGGSGGGSGGGGGGRGVRGVDYGLGIGYNAESS-APSQNAP  687

Query  434  SRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDT  255
            SR AAVNSL+TGMMAQFKSNFVAA+SN QNQ + +SS M  +K+ A+ GFVSGGTIGGD 
Sbjct  688  SRPAAVNSLKTGMMAQFKSNFVAAASNSQNQGINSSSNMYASKRPAMTGFVSGGTIGGDA  747

Query  254  NASRTSSISNAAT-----SVQKPREDASHLssgssrdrqrerrrpSGWDR  120
              ++T+  S+  T     +  +P E+A H SS SSRD+ RERRRPSGWDR
Sbjct  748  YKAQTTKSSSTPTSGVNPTGHRPTENAGHRSSESSRDKTRERRRPSGWDR  797



>ref|XP_003625986.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES82204.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=775

 Score =   210 bits (535),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 146/184 (79%), Gaps = 2/184 (1%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTLITQKEARFAGELVNSL+ AGQNV  ELMDLAMKDGRF
Sbjct  558  DMHVHRIGRTGRAGDKDGVAYTLITQKEARFAGELVNSLVAAGQNVSTELMDLAMKDGRF  617

Query  578  rskrdarkgggkrakgrggsgrgvrgv--DYGLGIGYSAESSNAPTTTVPSRSAAVNSLR  405
            RSKRDARKGGG++ KGRGG   G      D+GLGIGYS +S+NAP+  VP RSAAVNSLR
Sbjct  618  RSKRDARKGGGRKGKGRGGGAGGKGVRGVDFGLGIGYSTDSNNAPSNAVPGRSAAVNSLR  677

Query  404  TGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISN  225
            TGMM+QF+S+FVAASS  QN+   N++ M  NK+  L GFVSGG+IGGD N  + ++  N
Sbjct  678  TGMMSQFRSSFVAASSTSQNEGFSNNTSMAVNKRPTLAGFVSGGSIGGDINTHQQTASYN  737

Query  224  AATS  213
             A S
Sbjct  738  PAPS  741



>gb|EYU46816.1| hypothetical protein MIMGU_mgv1a001735mg [Erythranthe guttata]
Length=767

 Score =   209 bits (533),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 151/172 (88%), Gaps = 1/172 (1%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDGTAYTLITQKE RFAGEL+NSL+ AGQNVP ELMDLAMKDGRF
Sbjct  555  DMHVHRIGRTGRAGDKDGTAYTLITQKEVRFAGELINSLVAAGQNVPMELMDLAMKDGRF  614

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTG  399
            RSKRDARKGGGKRAKGRG SGRGVRGVD+GLGIGY++ES  A   T PSR AAVNSLRTG
Sbjct  615  RSKRDARKGGGKRAKGRGSSGRGVRGVDFGLGIGYNSESKPASNAT-PSRPAAVNSLRTG  673

Query  398  MMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASR  243
            MM+Q ++NFV ASSN QNQ L +S+G+  +++ ALPGFVSGGTIGGD +A++
Sbjct  674  MMSQARNNFVPASSNSQNQFLQSSAGVQTHRRTALPGFVSGGTIGGDIHAAK  725



>gb|KJB22489.1| hypothetical protein B456_004G050200 [Gossypium raimondii]
Length=774

 Score =   205 bits (521),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 170/219 (78%), Gaps = 9/219 (4%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTLITQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  559  DMHVHRIGRTGRAGDKDGIAYTLITQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRF  618

Query  578  rskr-darkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRT  402
            RSKR   + G   R +G GGSGRGVRGVD+GLGIGY+ ESSNA +  V SR+AAVNSL+T
Sbjct  619  RSKRNARKGGMKGRGRGGGGSGRGVRGVDFGLGIGYNPESSNASSQAVQSRNAAVNSLKT  678

Query  401  GMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASR-TSSISN  225
            GMMAQ KSNFVAASSN Q+Q   NSS +   ++  L GFVSGGTIGGD N S+ T+S + 
Sbjct  679  GMMAQMKSNFVAASSNSQSQGFNNSSSI---RRPTLSGFVSGGTIGGDINRSQMTTSFNT  735

Query  224  AATS----VQKPREDASHLssgssrdrqrerrrpSGWDR  120
            A TS     Q   ++A+  SS SSRDR RERRRPSGWDR
Sbjct  736  APTSGLNTSQNTGQNATQSSSESSRDRPRERRRPSGWDR  774



>ref|XP_011042271.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Populus euphratica]
Length=800

 Score =   204 bits (519),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 147/175 (84%), Gaps = 0/175 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D+HVHRIGR GRAGDKDG AYTLITQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  552  DVHVHRIGRTGRAGDKDGIAYTLITQKEARFAGELVNSLIAAGQNVSVELMDLAMKDGRF  611

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTG  399
            RSKRD+RKGGGK+ KGRGG  RGVRGVD+GLGIGY+ ES++  +  V SRS AVNSLRTG
Sbjct  612  RSKRDSRKGGGKKGKGRGGGSRGVRGVDFGLGIGYNPESNSTSSPAVTSRSTAVNSLRTG  671

Query  398  MMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSS  234
            +MAQFKSNFVAA+SN Q+  L  SS +  NK+ AL GFVSGG+IGGD N  +T+S
Sbjct  672  VMAQFKSNFVAATSNSQSPGLNTSSSVYANKRPALRGFVSGGSIGGDMNRPQTTS  726



>gb|KJB22487.1| hypothetical protein B456_004G050200 [Gossypium raimondii]
Length=793

 Score =   204 bits (519),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 145/185 (78%), Gaps = 6/185 (3%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTLITQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  559  DMHVHRIGRTGRAGDKDGIAYTLITQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRF  618

Query  578  rsk--rdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLR  405
            RSK       G   R +G GGSGRGVRGVD+GLGIGY+ ESSNA +  V SR+AAVNSL+
Sbjct  619  RSKRNARKGGGKKGRGRGGGGSGRGVRGVDFGLGIGYNPESSNASSQAVQSRNAAVNSLK  678

Query  404  TGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASR-TSSIS  228
            TGMMAQ KSNFVAASSN Q+Q   NSS +   ++  L GFVSGGTIGGD N S+ T+S +
Sbjct  679  TGMMAQMKSNFVAASSNSQSQGFNNSSSI---RRPTLSGFVSGGTIGGDINRSQMTTSFN  735

Query  227  NAATS  213
             A TS
Sbjct  736  TAPTS  740



>gb|KJB22491.1| hypothetical protein B456_004G050200 [Gossypium raimondii]
 gb|KJB22492.1| hypothetical protein B456_004G050200 [Gossypium raimondii]
Length=775

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 152/220 (69%), Positives = 168/220 (76%), Gaps = 10/220 (5%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTLITQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  559  DMHVHRIGRTGRAGDKDGIAYTLITQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRF  618

Query  578  rsk--rdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLR  405
            RSK       G   R +G GGSGRGVRGVD+GLGIGY+ ESSNA +  V SR+AAVNSL+
Sbjct  619  RSKRNARKGGGKKGRGRGGGGSGRGVRGVDFGLGIGYNPESSNASSQAVQSRNAAVNSLK  678

Query  404  TGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASR-TSSIS  228
            TGMMAQ KSNFVAASSN Q+Q   NSS +   ++  L GFVSGGTIGGD N S+ T+S +
Sbjct  679  TGMMAQMKSNFVAASSNSQSQGFNNSSSI---RRPTLSGFVSGGTIGGDINRSQMTTSFN  735

Query  227  NAATS----VQKPREDASHLssgssrdrqrerrrpSGWDR  120
             A TS     Q   ++A+  SS SSRDR RERRRPSGWDR
Sbjct  736  TAPTSGLNTSQNTGQNATQSSSESSRDRPRERRRPSGWDR  775



>gb|KHG13095.1| DEAD-box ATP-dependent RNA helicase 24 -like protein [Gossypium 
arboreum]
Length=731

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 139/182 (76%), Gaps = 5/182 (3%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTLITQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  515  DMHVHRIGRTGRAGDKDGIAYTLITQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRF  574

Query  578  rsk--rdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLR  405
            RSK       G   R +G   SGRGVRGVDYG+GIGY+ ES NA +  V SR+AAVNSL+
Sbjct  575  RSKRNARKGGGKKGRGRGGCRSGRGVRGVDYGMGIGYNPESGNASSQAVQSRNAAVNSLK  634

Query  404  TGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISN  225
            TGMMAQ KSNFVAASSN Q+Q   NSS +   ++  L GFVSGGTIGGD N S+ ++  N
Sbjct  635  TGMMAQMKSNFVAASSNSQSQGFNNSSSI---RRPTLSGFVSGGTIGGDINRSQMATSFN  691

Query  224  AA  219
             A
Sbjct  692  TA  693



>ref|XP_010267974.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Nelumbo nucifera]
Length=771

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 144/221 (65%), Positives = 165/221 (75%), Gaps = 11/221 (5%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTLITQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  554  DMHVHRIGRTGRAGDKDGIAYTLITQKEARFAGELVNSLIAAGQNVSVELMDLAMKDGRF  613

Query  578  rskrdarkgggkrakgrggsgrgvrgvD---YGLGIGYSAESSNAPTTTVPSRSAAVNSL  408
            RSKRDARKG   +  G  G G G RGV    YGLGIGY+ ES+N P+ +VPSRS+AVN+L
Sbjct  614  RSKRDARKGSSGKRGGGRGKGSGGRGVRGVDYGLGIGYNPESANTPSQSVPSRSSAVNAL  673

Query  407  RTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSIS  228
            RTGMMAQFKSNFVAA S+ QN +  ++   N +K+  LPGFVSGG+IGGD N ++T++  
Sbjct  674  RTGMMAQFKSNFVAAKSDSQNSSFSSA---NVSKRPVLPGFVSGGSIGGDANRTQTTTSF  730

Query  227  NAA-----TSVQKPREDASHLssgssrdrqrerrrpSGWDR  120
            N       T+    +E+ S     SS DR RERRRPSGWDR
Sbjct  731  NPTPSGGQTTSGSSKENGSQKKMESSGDRPRERRRPSGWDR  771



>gb|KHG13094.1| DEAD-box ATP-dependent RNA helicase 24 -like protein [Gossypium 
arboreum]
Length=775

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 139/182 (76%), Gaps = 5/182 (3%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTLITQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  559  DMHVHRIGRTGRAGDKDGIAYTLITQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRF  618

Query  578  rsk--rdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLR  405
            RSK       G   R +G   SGRGVRGVDYG+GIGY+ ES NA +  V SR+AAVNSL+
Sbjct  619  RSKRNARKGGGKKGRGRGGCRSGRGVRGVDYGMGIGYNPESGNASSQAVQSRNAAVNSLK  678

Query  404  TGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISN  225
            TGMMAQ KSNFVAASSN Q+Q   NSS +   ++  L GFVSGGTIGGD N S+ ++  N
Sbjct  679  TGMMAQMKSNFVAASSNSQSQGFNNSSSI---RRPTLSGFVSGGTIGGDINRSQMATSFN  735

Query  224  AA  219
             A
Sbjct  736  TA  737



>gb|KHG18820.1| DEAD-box ATP-dependent RNA helicase 24 -like protein [Gossypium 
arboreum]
Length=775

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 139/182 (76%), Gaps = 5/182 (3%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTLITQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  559  DMHVHRIGRTGRAGDKDGIAYTLITQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRF  618

Query  578  rsk--rdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLR  405
            RSK       G   R +G   SGRGVRGVDYG+GIGY+ ES NA +  V SR+AAVNSL+
Sbjct  619  RSKRNARKGGGKKGRGRGGCRSGRGVRGVDYGMGIGYNPESGNASSQAVQSRNAAVNSLK  678

Query  404  TGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISN  225
            TGMMAQ KSNFVAASSN Q+Q   NSS +   ++  L GFVSGGTIGGD N S+ ++  N
Sbjct  679  TGMMAQMKSNFVAASSNSQSQGFNNSSSI---RRPTLSGFVSGGTIGGDINRSQMATSFN  735

Query  224  AA  219
             A
Sbjct  736  TA  737



>gb|KHG30147.1| DEAD-box ATP-dependent RNA helicase 24 -like protein [Gossypium 
arboreum]
Length=689

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 142/185 (77%), Gaps = 6/185 (3%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTLITQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  473  DMHVHRIGRTGRAGDKDGIAYTLITQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRF  532

Query  578  rsk--rdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLR  405
            RSK       G   R +G GGSGRGVRGVD+GLGIGY+ ES NA +  V SR+AAVNSL+
Sbjct  533  RSKRNARKGGGKKGRGRGGGGSGRGVRGVDFGLGIGYNPESCNASSQAVQSRNAAVNSLK  592

Query  404  TGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASR-TSSIS  228
            TGMMAQ KSNFVAASSN  +Q   NSS +   ++  L GFVSGGTIGGD N S+  +S S
Sbjct  593  TGMMAQMKSNFVAASSNSPSQGFNNSSSI---RRPTLSGFVSGGTIGGDINRSQMATSFS  649

Query  227  NAATS  213
             A TS
Sbjct  650  TAPTS  654



>ref|XP_002301515.2| DEAD/DEAH box helicase family protein [Populus trichocarpa]
 gb|EEE80788.2| DEAD/DEAH box helicase family protein [Populus trichocarpa]
Length=807

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 149/182 (82%), Gaps = 7/182 (4%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D+HVHRIGR GRAGDKDG AYTLITQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  552  DVHVHRIGRTGRAGDKDGIAYTLITQKEARFAGELVNSLIAAGQNVSVELMDLAMKDGRF  611

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAE--SSNAPTTT-----VPSRSAA  420
            RSKRD+RKGGGK+ KGRGG  RGVRGVD+GLGIGY+ E  S+++P  T     V SRS A
Sbjct  612  RSKRDSRKGGGKKGKGRGGGSRGVRGVDFGLGIGYNPESNSTSSPAVTSRSPAVTSRSTA  671

Query  419  VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRT  240
            VNSLRTG+MAQFKSNFVAA+SN Q+  L  SS +  NK+ AL GFVSGG+IGGD N  +T
Sbjct  672  VNSLRTGVMAQFKSNFVAATSNSQSPGLNTSSSVYANKRPALRGFVSGGSIGGDMNRPQT  731

Query  239  SS  234
            +S
Sbjct  732  TS  733



>gb|KJB22485.1| hypothetical protein B456_004G050000 [Gossypium raimondii]
Length=776

 Score =   198 bits (504),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 165/220 (75%), Gaps = 10/220 (5%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTLITQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  560  DMHVHRIGRTGRAGDKDGIAYTLITQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRF  619

Query  578  rsk--rdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLR  405
            RSK       G   R +G GGSGRGVRGVD+G+GIGY+ ESSNA +  V SR+AAVNSL+
Sbjct  620  RSKRNARKGGGKKGRGRGGGGSGRGVRGVDFGMGIGYNPESSNASSQAVQSRNAAVNSLK  679

Query  404  TGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASR-TSSIS  228
            TGMMAQ KSNFVAAS+N  +Q   NSS +   ++  L GFVSGGTIGGD N S+  +S S
Sbjct  680  TGMMAQMKSNFVAASTNPPSQGFNNSSSI---RRPTLSGFVSGGTIGGDINRSQMATSFS  736

Query  227  NAATS----VQKPREDASHLssgssrdrqrerrrpSGWDR  120
             A TS     Q   E+ +  SS SSRDR RERRRPSGWDR
Sbjct  737  TAPTSGLNTSQNTGENTTQRSSESSRDRPRERRRPSGWDR  776



>ref|XP_004156816.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
24-like [Cucumis sativus]
Length=774

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 164/215 (76%), Gaps = 3/215 (1%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG A+TLITQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  561  DMHVHRIGRTGRAGDKDGRAHTLITQKEARFAGELVNSLIAAGQNVSVELMDLAMKDGRF  620

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAE--SSNAPTTTVPSRSAAVNSLR  405
            RSKRDARK GGK+ K RG +GRGVRGVD+GLGIGY+ E   S   TT V SRSAAVNSLR
Sbjct  621  RSKRDARKKGGKKGKSRGSNGRGVRGVDFGLGIGYNPEGTGSTPSTTDVQSRSAAVNSLR  680

Query  404  TGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISN  225
            TGMMAQFKSNFVAASS   NQ   NS  +  NK+  L GFVSGG+IGG  N S    +S 
Sbjct  681  TGMMAQFKSNFVAASSAPPNQGSSNSYNVPANKRPTLSGFVSGGSIGGGAN-SPAPPVSR  739

Query  224  AATSVQKPREDASHLssgssrdrqrerrrpSGWDR  120
              + +  P E +S  ++ SS DR RER+RPSGWDR
Sbjct  740  GNSYMPNPVEYSSQKNTESSSDRPRERKRPSGWDR  774



>emb|CDP17060.1| unnamed protein product [Coffea canephora]
Length=778

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 177/221 (80%), Gaps = 8/221 (4%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDGTAYTLITQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  558  DMHVHRIGRTGRAGDKDGTAYTLITQKEARFAGELVNSLIAAGQNVSVELMDLAMKDGRF  617

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAV--NSLR  405
            RSKRDARKGGGKR KGRGG GRGVRGVDYGLGIGYSAESS+  +++    S +V  NSLR
Sbjct  618  RSKRDARKGGGKRTKGRGGGGRGVRGVDYGLGIGYSAESSSLSSSSAAVPSRSVAANSLR  677

Query  404  TGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISN  225
            TGMM+QFK+NFVAASSN QNQ + +SS M  NK+  L GFVSGGTIGG+T +++T+  + 
Sbjct  678  TGMMSQFKNNFVAASSNSQNQGVNSSSSMYANKRTVLSGFVSGGTIGGNTGSAQTTGSAG  737

Query  224  AAT------SVQKPREDASHLssgssrdrqrerrrpSGWDR  120
            AAT      +    R+DA   +  SS++R RERRRPSGWDR
Sbjct  738  AATIPSGNNAAGIARDDAIRKNLESSKERPRERRRPSGWDR  778



>ref|XP_010087224.1| DEAD-box ATP-dependent RNA helicase 24 [Morus notabilis]
 gb|EXB28574.1| DEAD-box ATP-dependent RNA helicase 24 [Morus notabilis]
Length=686

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 148/193 (77%), Gaps = 11/193 (6%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDGTAYTLITQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  458  DMHVHRIGRTGRAGDKDGTAYTLITQKEARFAGELVNSLIAAGQNVSVELMDLAMKDGRF  517

Query  578  rskrdarkgggkrakgrggsgrgvrgvD----------YGLGIGYSAESSNAPTTTVPSR  429
            RSKRDARKGGGK+ +GRGG G G  G            +GLGIGY+ ES+NA    VPSR
Sbjct  518  RSKRDARKGGGKKGRGRGGGGGGGGGGGGGGRGVRGVDFGLGIGYNPESNNASPQAVPSR  577

Query  428  SAAVNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNA  249
            SAAVNSLRTGMM QFKSNFVAASSN QNQ   N S    N + AL GFVSGG+IGGD   
Sbjct  578  SAAVNSLRTGMMTQFKSNFVAASSNSQNQGSSNYSSAPTNNRPALAGFVSGGSIGGDIYR  637

Query  248  SRTS-SISNAATS  213
            ++T+ S+S+  TS
Sbjct  638  TQTTNSVSSVPTS  650



>ref|XP_002515267.1| hypothetical protein RCOM_1346600 [Ricinus communis]
 gb|EEF47251.1| hypothetical protein RCOM_1346600 [Ricinus communis]
Length=791

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 143/175 (82%), Gaps = 7/175 (4%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDGTAYTLITQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  551  DMHVHRIGRTGRAGDKDGTAYTLITQKEARFAGELVNSLIAAGQNVSGELMDLAMKDGRF  610

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTG  399
            RSKRDARKG GK+ +GR G GRGVRGVD+GLGIGY+ ESS+  +  VPSRS AVNS R+G
Sbjct  611  RSKRDARKGAGKKGRGRAGVGRGVRGVDFGLGIGYNPESSST-SQAVPSRSTAVNSARSG  669

Query  398  MMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSS  234
            MMAQFKS+FVAASSN Q      S     N + AL GFVSGG+IGGD N ++T+S
Sbjct  670  MMAQFKSSFVAASSNSQ------SPSAYANNRPALRGFVSGGSIGGDLNITQTTS  718



>ref|XP_008454276.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Cucumis melo]
Length=776

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 146/220 (66%), Positives = 162/220 (74%), Gaps = 8/220 (4%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG A+TLITQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  558  DMHVHRIGRTGRAGDKDGRAHTLITQKEARFAGELVNSLIAAGQNVSVELMDLAMKDGRF  617

Query  578  rskrdarkgggkrakgrggsgrgv-----rgvDYGLGIGYSAE-SSNAPTTT-VPSRSAA  420
            RSKRDARK GG    G+ G  RG      RGVD+GLGIGY+ E S + P+TT V SRSAA
Sbjct  618  RSKRDARKKGGGGGGGKKGKSRGSNGRGVRGVDFGLGIGYNPEGSGSTPSTTNVQSRSAA  677

Query  419  VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRT  240
            VNSLRTGMMAQFKSNFVAASS   +Q   NS  M  NK+  L GFVSGG+IGG  N S  
Sbjct  678  VNSLRTGMMAQFKSNFVAASSAPPSQGSSNSYNMPANKRPTLSGFVSGGSIGGGAN-SPA  736

Query  239  SSISNAATSVQKPREDASHLssgssrdrqrerrrpSGWDR  120
              +S   + +  P E +S  ++ SS DR RER+RPSGWDR
Sbjct  737  PPVSRGNSYMPNPVEYSSQKNTESSSDRPRERKRPSGWDR  776



>ref|XP_010938236.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Elaeis 
guineensis]
 ref|XP_010938237.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Elaeis 
guineensis]
 ref|XP_010938238.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Elaeis 
guineensis]
Length=769

 Score =   194 bits (492),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 166/221 (75%), Gaps = 13/221 (6%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDGTAYTLITQKEARFAGELVNSL+TAGQNV  ELMDLAMKDGRF
Sbjct  554  DMHVHRIGRTGRAGDKDGTAYTLITQKEARFAGELVNSLVTAGQNVSPELMDLAMKDGRF  613

Query  578  rskrdarkgggkrakgrggsgrgvrg---vDYGLGIGYSAESSNAPTTTVPSRSAAVNSL  408
            R+KRDARKGG K      G G   RG   VDYGLGIGY+ ES+NA + + PSRS+ VNSL
Sbjct  614  RAKRDARKGGKKGGGRGKGGGASGRGVRGVDYGLGIGYNPESANATSQSAPSRSSTVNSL  673

Query  407  RTGMMAQFKSNFVAASSN----LQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASR-  243
            RTGMMA+FKSNFVAA+SN    ++NQ+  +SSG     +  L GFVSGG IGG+   S+ 
Sbjct  674  RTGMMARFKSNFVAATSNSMGDVRNQSSLSSSG-----RPVLSGFVSGGLIGGEAYKSQP  728

Query  242  TSSISNAATSVQKPREDASHLssgssrdrqrerrrpSGWDR  120
             +S + A+ S     E+ +  +S SSRDR RER+RPSGWDR
Sbjct  729  ATSFTPASKSGGNTSENGNQKNSESSRDRPRERKRPSGWDR  769



>ref|XP_004152219.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Cucumis 
sativus]
 gb|KGN52865.1| hypothetical protein Csa_4G004270 [Cucumis sativus]
Length=777

 Score =   193 bits (491),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 156/221 (71%), Gaps = 9/221 (4%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG A+TLITQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  558  DMHVHRIGRTGRAGDKDGRAHTLITQKEARFAGELVNSLIAAGQNVSVELMDLAMKDGRF  617

Query  578  rskrdarkgggkrakgrggsgrg------vrgvDYGLGIGYSAE--SSNAPTTTVPSRSA  423
            RSKRDARK GG    G             VRGVD+GLGIGY+ E   S   TT V SRSA
Sbjct  618  RSKRDARKKGGGGGGGGKKGKSRGSNGRGVRGVDFGLGIGYNPEGTGSTPSTTNVQSRSA  677

Query  422  AVNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASR  243
            AVNSLRTGMMAQFKSNFVAASS   NQ   NS  +  NK+  L GFVSGG+IGG  N S 
Sbjct  678  AVNSLRTGMMAQFKSNFVAASSAPPNQGSSNSYNVPANKRPTLSGFVSGGSIGGGAN-SP  736

Query  242  TSSISNAATSVQKPREDASHLssgssrdrqrerrrpSGWDR  120
               +S   + +  P E +S  ++ SS DR RER+RPSGWDR
Sbjct  737  APPVSRGNSYMPNPVEYSSQKNTESSSDRPRERKRPSGWDR  777



>ref|XP_010679397.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=772

 Score =   193 bits (490),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 147/187 (79%), Gaps = 13/187 (7%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTLIT KEARFAGE+VNSLI AGQNV  ELMDLAMKDGRF
Sbjct  557  DMHVHRIGRTGRAGDKDGVAYTLITHKEARFAGEMVNSLIAAGQNVTMELMDLAMKDGRF  616

Query  578  rskrdarkgggkrakgrggsgrgvrgvD----YGLGIGYSAESSNA---PTTTVPSRSAA  420
            RSKRDARKGGGK+ KGRGG G G         +GLGIGY+ ES+NA   P T    R+AA
Sbjct  617  RSKRDARKGGGKKGKGRGGGGGGGGRGVRGVDFGLGIGYNTESNNASFQPAT----RTAA  672

Query  419  VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRT  240
            VNSLRTGMMAQFKSNFVAASS+ QNQA  NS+    NK+ +L GFV+GGTIGGD N  ++
Sbjct  673  VNSLRTGMMAQFKSNFVAASSSSQNQATSNSNTFV-NKRPSLSGFVAGGTIGGD-NRPQS  730

Query  239  SSISNAA  219
            +S++N A
Sbjct  731  TSLTNYA  737



>ref|XP_009416320.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Musa 
acuminata subsp. malaccensis]
Length=764

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 142/220 (65%), Positives = 167/220 (76%), Gaps = 14/220 (6%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDGTAYTLIT KEARFAGELVNSLI AGQ+VPAELMDLAMKDGRF
Sbjct  552  DMHVHRIGRTGRAGDKDGTAYTLITHKEARFAGELVNSLIAAGQDVPAELMDLAMKDGRF  611

Query  578  rskrdarkgggkrakgrggsgrgvrg-----vDYGLGIGYSAESSNAPTT-TVPSRSAAV  417
            R+KRDARKG G +  GR G G    G     VD+GLGIGY+ +++NA T+ +VPSRSAAV
Sbjct  612  RAKRDARKGSGGKKGGRRGKGGNGSGRGVRGVDFGLGIGYNPDTANAATSHSVPSRSAAV  671

Query  416  NSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTS  237
            NSLRTGMMAQFKSNFVAASSN +    GN+S      + +L GFVSGG+IGG+   +++ 
Sbjct  672  NSLRTGMMAQFKSNFVAASSNSE----GNTSSTT---RPSLSGFVSGGSIGGEAYKAQSL  724

Query  236  SISNAATSVQKPR-EDASHLssgssrdrqrerrrpSGWDR  120
            +    AT  +  R E+ +  +S S RDR RER+RPSGWDR
Sbjct  725  TTFIPATKNEGSRIENGNQKNSESVRDRPRERKRPSGWDR  764



>ref|XP_007051129.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOX95286.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2 [Theobroma cacao]
Length=781

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 146/189 (77%), Gaps = 10/189 (5%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTLITQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  558  DMHVHRIGRTGRAGDKDGIAYTLITQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRF  617

Query  578  rskrdarkgggkrakgrggsgrgvrgvD------YGLGIGYSAESSNAPTTTVPSRSAAV  417
            RSKRDARKGGGK+ +GRGG G G  G        YGLGIGY+ ESS + +    SR+AAV
Sbjct  618  RSKRDARKGGGKKGRGRGGGGGGGGGGRGVRGVDYGLGIGYNPESSISSSQAAQSRTAAV  677

Query  416  NSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRT-  240
            NSL+TGMMAQFKS+FVAASS  Q Q   NSS +   ++  L GFVSGGTIGGD N ++T 
Sbjct  678  NSLKTGMMAQFKSSFVAASSTSQGQGFSNSSSI---RRPTLAGFVSGGTIGGDINRAQTA  734

Query  239  SSISNAATS  213
            SS++ A TS
Sbjct  735  SSLTTAPTS  743



>ref|XP_011468779.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X2 
[Fragaria vesca subsp. vesca]
Length=745

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 143/183 (78%), Gaps = 9/183 (5%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDGTAYTLIT KEARFAGELVNSL+ AGQNVP ELMDLAMKDGRF
Sbjct  552  DMHVHRIGRTGRAGDKDGTAYTLITHKEARFAGELVNSLVGAGQNVPVELMDLAMKDGRF  611

Query  578  rskrdarkgggkrakgrggsgrgvrg---------vDYGLGIGYSAESSNAPTTTVPSRS  426
            RSKRD+RKGGGK+ KGRGG   G  G         VD+GLGIGY+ ES+++P+  V SRS
Sbjct  612  RSKRDSRKGGGKKGKGRGGGRGGGSGGNSGRGVRGVDFGLGIGYNPESNSSPSPAVTSRS  671

Query  425  AAVNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNAS  246
            AAV SLRTGMM+QFK+ FV+A+SN  +Q  GNS   + NK+ AL GFV+ G+IGG   A 
Sbjct  672  AAVTSLRTGMMSQFKNKFVSATSNSPSQGSGNSLSAHANKRPALRGFVAAGSIGGGIYAP  731

Query  245  RTS  237
            +T+
Sbjct  732  QTT  734



>ref|XP_006840470.1| hypothetical protein AMTR_s00045p00182070 [Amborella trichopoda]
 gb|ERN02145.1| hypothetical protein AMTR_s00045p00182070 [Amborella trichopoda]
Length=768

 Score =   191 bits (486),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 150/198 (76%), Gaps = 16/198 (8%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDK+GTAYTLITQKEARFAGELVNSLI AGQNVP ELMDLA+KDGRF
Sbjct  552  DMHVHRIGRTGRAGDKEGTAYTLITQKEARFAGELVNSLIAAGQNVPPELMDLALKDGRF  611

Query  578  rskrdarkgggkrakgrggsgrgvrg--------vDYGLGIGYSAESSNAPT-TTVPSRS  426
            ++KRDARKG G +  G  G G G  G        VDYGLGIGY+ ES++AP+ +++PSRS
Sbjct  612  KAKRDARKGSGGKKGGGKGKGGGGGGGTGRGVRGVDYGLGIGYNPESASAPSQSSIPSRS  671

Query  425  AAVNSLRTGMMAQFKSNFVAASSN---LQNQALGNSSGMNPNKKMALPGFVSGGTIGGDT  255
            AA+NSLRTGMMAQFKSNFVAA+S+    QN+   +S+    N+ + L GFVSGG+IGG+ 
Sbjct  672  AAMNSLRTGMMAQFKSNFVAATSDDNSSQNEGRSSSNTSTGNRPV-LAGFVSGGSIGGEA  730

Query  254  NASRTSSISNAATSVQKP  201
               ++S   N   S+ KP
Sbjct  731  RGPQSSGAPN---SMSKP  745



>ref|XP_009403707.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Musa 
acuminata subsp. malaccensis]
Length=768

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 145/182 (80%), Gaps = 13/182 (7%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDGTAYTLITQKEARFAGELVNSLI AGQ+VP ELMDLAMKDGRF
Sbjct  558  DMHVHRIGRTGRAGDKDGTAYTLITQKEARFAGELVNSLIAAGQDVPTELMDLAMKDGRF  617

Query  578  rskrda-----rkgggkrakgrggsgrgvrgvDYGLGIGYSAESSN-APTTTVPSRSAAV  417
            R+KRDA      K G  R KG  GSGRGVRGVDYGLGIGY+ ES+N AP+ +V SRSAAV
Sbjct  618  RAKRDARKGSGGKRGAGRGKGGSGSGRGVRGVDYGLGIGYNPESANAAPSHSVQSRSAAV  677

Query  416  NSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTS  237
            NSL+TGMMAQFKSNFVAASSN       +   ++ + K AL GFVSGG+IGG+   +++ 
Sbjct  678  NSLKTGMMAQFKSNFVAASSN-------SKVPISSSTKPALRGFVSGGSIGGEAFKAQSV  730

Query  236  SI  231
            ++
Sbjct  731  AV  732



>ref|XP_004288535.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Fragaria vesca subsp. vesca]
Length=779

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 143/183 (78%), Gaps = 9/183 (5%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDGTAYTLIT KEARFAGELVNSL+ AGQNVP ELMDLAMKDGRF
Sbjct  552  DMHVHRIGRTGRAGDKDGTAYTLITHKEARFAGELVNSLVGAGQNVPVELMDLAMKDGRF  611

Query  578  rskrdarkgggkrakgrggsgrgvrg---------vDYGLGIGYSAESSNAPTTTVPSRS  426
            RSKRD+RKGGGK+ KGRGG   G  G         VD+GLGIGY+ ES+++P+  V SRS
Sbjct  612  RSKRDSRKGGGKKGKGRGGGRGGGSGGNSGRGVRGVDFGLGIGYNPESNSSPSPAVTSRS  671

Query  425  AAVNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNAS  246
            AAV SLRTGMM+QFK+ FV+A+SN  +Q  GNS   + NK+ AL GFV+ G+IGG   A 
Sbjct  672  AAVTSLRTGMMSQFKNKFVSATSNSPSQGSGNSLSAHANKRPALRGFVAAGSIGGGIYAP  731

Query  245  RTS  237
            +T+
Sbjct  732  QTT  734



>gb|KFK37476.1| hypothetical protein AALP_AA4G262200 [Arabis alpina]
Length=758

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 160/231 (69%), Gaps = 26/231 (11%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTLITQ+EARFAGELVNSL+ AGQNVP ELMDLAMKDGRF
Sbjct  534  DMHVHRIGRTGRAGDKDGVAYTLITQREARFAGELVNSLVAAGQNVPPELMDLAMKDGRF  593

Query  578  rs---krdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAV---  417
            +S    R       +   G GG  RGVRGVD+GLGIG+++ESS  P+   PSRSAAV   
Sbjct  594  KSKRDGRKGGGKKSRGRGGGGGGNRGVRGVDFGLGIGFNSESSGTPSQAAPSRSAAVPGR  653

Query  416  -----------NSLRTGMMAQFKSNFVAA--SSNLQNQALGNSSGMNPNKKMALPGFVSG  276
                       NS+RTG+MAQFK++FVAA  S+N QNQ         PNK+++L GFVSG
Sbjct  654  SAAAPSRTGAINSVRTGVMAQFKNSFVAATPSNNPQNQGY-------PNKRLSLTGFVSG  706

Query  275  GTIGGDTNASRTSSISNAATSVQKPREDASHLssgssrdrqrerrrpSGWD  123
            GTIGGD + ++T +   AAT+     ++++  +  SS +R RER+R SGWD
Sbjct  707  GTIGGDMSRTQTQAPPVAATTHNPSLQNSTQTNPHSSENRPRERKRRSGWD  757



>ref|XP_007051128.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX95285.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
Length=838

 Score =   191 bits (485),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 146/189 (77%), Gaps = 10/189 (5%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTLITQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  558  DMHVHRIGRTGRAGDKDGIAYTLITQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRF  617

Query  578  rskrdarkgggkrakgrggsgrgvrgvD------YGLGIGYSAESSNAPTTTVPSRSAAV  417
            RSKRDARKGGGK+ +GRGG G G  G        YGLGIGY+ ESS + +    SR+AAV
Sbjct  618  RSKRDARKGGGKKGRGRGGGGGGGGGGRGVRGVDYGLGIGYNPESSISSSQAAQSRTAAV  677

Query  416  NSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRT-  240
            NSL+TGMMAQFKS+FVAASS  Q Q   NSS +   ++  L GFVSGGTIGGD N ++T 
Sbjct  678  NSLKTGMMAQFKSSFVAASSTSQGQGFSNSSSI---RRPTLAGFVSGGTIGGDINRAQTA  734

Query  239  SSISNAATS  213
            SS++ A TS
Sbjct  735  SSLTTAPTS  743



>ref|XP_009370603.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Pyrus 
x bretschneideri]
Length=778

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 147/175 (84%), Gaps = 2/175 (1%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDGTAYTLITQKEARFAGELVNSL+ AGQ V  ELMDLAMKDGRF
Sbjct  560  DMHVHRIGRTGRAGDKDGTAYTLITQKEARFAGELVNSLVAAGQIVSTELMDLAMKDGRF  619

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTG  399
            RSKRD+RKGGGK+ +GRGG GRGVRGVD+G GIGY+ ES+++ + TVPSRSAAV   RTG
Sbjct  620  RSKRDSRKGGGKKGRGRGGGGRGVRGVDFGQGIGYNTESNSSSSNTVPSRSAAVTPQRTG  679

Query  398  MMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSS  234
            MM QFK+ FVAASSN  +Q  GNSS + PN+  AL GFVSGG+IGG+   ++T+S
Sbjct  680  MMPQFKTKFVAASSNSPSQGSGNSSSV-PNRP-ALRGFVSGGSIGGNVYRTQTTS  732



>ref|XP_009142546.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Brassica rapa]
Length=732

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 138/184 (75%), Gaps = 9/184 (5%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTL+TQ+EARFAGEL+NSL+ AGQNVP ELMDLAMKDGRF
Sbjct  524  DMHVHRIGRTGRAGDKDGVAYTLVTQREARFAGELINSLVAAGQNVPPELMDLAMKDGRF  583

Query  578  rs--krdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLR  405
            +S        G   R +G GG  RGVRGVD+GLGIG+++ESS  P+   PSR   +NS+R
Sbjct  584  KSKRDGRKGGGKKGRGRGGGGGNRGVRGVDFGLGIGFNSESSGTPSQAAPSRKGVINSVR  643

Query  404  TGMMAQFKSNFVAAS-SNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSIS  228
            TG+MAQFK++FVAA+ SN Q+Q      G  PNK+ +L GFVSGGTIGGD   ++T +  
Sbjct  644  TGVMAQFKNSFVAATPSNPQSQ------GGYPNKRPSLMGFVSGGTIGGDMGRTQTQAPP  697

Query  227  NAAT  216
             AA+
Sbjct  698  VAAS  701



>ref|XP_006293732.1| hypothetical protein CARUB_v10022694mg [Capsella rubella]
 gb|EOA26630.1| hypothetical protein CARUB_v10022694mg [Capsella rubella]
Length=761

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 136/185 (74%), Gaps = 11/185 (6%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTL+TQ+EARFAGELVNSL+ AGQNVP ELMDLAMKDGRF
Sbjct  556  DMHVHRIGRTGRAGDKDGVAYTLVTQREARFAGELVNSLVAAGQNVPPELMDLAMKDGRF  615

Query  578  rs--krdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPT-TTVPSRSAAVNSL  408
            +S  +     G   R    GG  RGVRGVD+GLGIG+S+E S  P+    PSRS  +NS+
Sbjct  616  KSKREGRKGGGKKGRGGRGGGGNRGVRGVDFGLGIGFSSEPSGTPSFKAAPSRSGVINSV  675

Query  407  RTGMMAQFKSNFVAAS-SNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSI  231
            RTG+MAQFK++FVAA+ SN QNQA        PNK+ +L GFVSGGTIGGD   +++   
Sbjct  676  RTGVMAQFKNSFVAATPSNPQNQAY-------PNKRPSLIGFVSGGTIGGDMGRTQSQPP  728

Query  230  SNAAT  216
            S A T
Sbjct  729  SVAPT  733



>emb|CDX80096.1| BnaA05g00600D [Brassica napus]
Length=728

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 138/184 (75%), Gaps = 8/184 (4%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTL+TQ+EARFAGEL+NSL+ AGQNVP ELMDLAMKDGRF
Sbjct  519  DMHVHRIGRTGRAGDKDGVAYTLVTQREARFAGELINSLVAAGQNVPPELMDLAMKDGRF  578

Query  578  rs--krdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLR  405
            +S        G   R +G GG  RGVRGVD+GLGIG+++ESS  P+   PSR   +NS+R
Sbjct  579  KSKRDGRKGGGKKGRGRGGGGGNRGVRGVDFGLGIGFNSESSGTPSQAAPSRKGVINSVR  638

Query  404  TGMMAQFKSNFVAAS-SNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSIS  228
            TG+MAQFK++FVAA+ SN Q     +S G  PNK+ +L GFVSGGTIGGD   ++T +  
Sbjct  639  TGVMAQFKNSFVAATPSNPQ-----SSQGGYPNKRPSLMGFVSGGTIGGDMGRTQTQAPP  693

Query  227  NAAT  216
             AA+
Sbjct  694  VAAS  697



>ref|XP_010921475.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Elaeis 
guineensis]
 ref|XP_010921477.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Elaeis 
guineensis]
 ref|XP_010921478.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Elaeis 
guineensis]
Length=767

 Score =   188 bits (478),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 159/237 (67%), Gaps = 45/237 (19%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTLITQKEARFAGELVNSL+ AGQNV +ELM+LAMKDGRF
Sbjct  552  DMHVHRIGRTGRAGDKDGIAYTLITQKEARFAGELVNSLVAAGQNVSSELMNLAMKDGRF  611

Query  578  rskrda---rkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSL  408
            ++KRDA    K GG R KG  GSGRGVRGVDYGLGIGY+ ES+N  + +VPSRSA VNSL
Sbjct  612  KAKRDARKGGKKGGGRGKGGSGSGRGVRGVDYGLGIGYNPESANVTSQSVPSRSATVNSL  671

Query  407  RTGMMAQFKSNFVAASSNLQ----NQALGNSSGMNPNKKMALPGFVSGGTIGGDT-----  255
            RTGMMAQFKSNFVAA+S+ Q    NQ   +SSG     +  L GFVSGG IGG+      
Sbjct  672  RTGMMAQFKSNFVAATSSPQSDGRNQCSISSSG-----RPVLRGFVSGGLIGGEAYRLQQ  726

Query  254  ------------NASRTSSISNAATSVQKPREDASHLssgssrdrqrerrrpSGWDR  120
                        N S   +  N+ +S  +PRE                R+RPSGWDR
Sbjct  727  AASFTPASKSGGNTSENGNQKNSESSRDRPRE----------------RKRPSGWDR  767



>ref|XP_009349922.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Pyrus 
x bretschneideri]
Length=782

 Score =   187 bits (475),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 144/185 (78%), Gaps = 6/185 (3%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDGTAYTLITQKEARFAGELVNSL+ AGQ V  ELMDLAMKDGRF
Sbjct  559  DMHVHRIGRTGRAGDKDGTAYTLITQKEARFAGELVNSLVAAGQIVSTELMDLAMKDGRF  618

Query  578  rskrda---rkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSL  408
            RSKRD+       G+   G GG GRGVRGVD+GLGIGY+ ES+N+ + TV SRSA V  +
Sbjct  619  RSKRDSRKGGGKKGRGRGGGGGGGRGVRGVDFGLGIGYNTESNNSSSHTVASRSATVTPV  678

Query  407  RTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASR-TSSI  231
            RTGMM+QFK+ FVAASSN  +QA GNS    P++  AL GFVSGG+IGGD   ++ TS+I
Sbjct  679  RTGMMSQFKTKFVAASSNSPSQASGNSYSA-PSRP-ALRGFVSGGSIGGDVYRTQATSTI  736

Query  230  SNAAT  216
            + A T
Sbjct  737  APALT  741



>ref|XP_007221465.1| hypothetical protein PRUPE_ppa001666mg [Prunus persica]
 gb|EMJ22664.1| hypothetical protein PRUPE_ppa001666mg [Prunus persica]
Length=783

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 171/225 (76%), Gaps = 15/225 (7%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDGTAYTLITQKEARFAGELVNSL+ AGQNV  ELMDLAMKDGRF
Sbjct  560  DMHVHRIGRTGRAGDKDGTAYTLITQKEARFAGELVNSLVAAGQNVSTELMDLAMKDGRF  619

Query  578  rskrdarkgggkrakgrggsgrgvrgvD-------YGLGIGYSAESSNAPTTTVPSRSAA  420
            RSKRD+RKGGGK+ +GRGG G G  G         YGLGIGY++ES+N+ + T  SRSAA
Sbjct  620  RSKRDSRKGGGKKGRGRGGGGGGGGGGGRGVRGVDYGLGIGYNSESNNSSSHTPTSRSAA  679

Query  419  VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASR-  243
            V SLRTGMM+QFK+ FVAA+SN  +Q  GNSS +   ++ AL GFVSGG+IGGD   ++ 
Sbjct  680  VTSLRTGMMSQFKTKFVAAASNSPSQGSGNSSSV--PQRPALRGFVSGGSIGGDIFRTQA  737

Query  242  TSSISNAATSV-----QKPREDASHLssgssrdrqrerrrpSGWD  123
            T++++ A TSV     Q   E+AS   S SSRD+ RERRR SGWD
Sbjct  738  TNTVTPAPTSVVNISSQNSGENASQKPSESSRDKPRERRRRSGWD  782



>gb|EPS66709.1| hypothetical protein M569_08067 [Genlisea aurea]
Length=753

 Score =   185 bits (470),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 137/189 (72%), Gaps = 15/189 (8%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDGTAYTLIT KEARFAGELVNSLI AGQ+VP ELMDLAMKDGRF
Sbjct  548  DMHVHRIGRTGRAGDKDGTAYTLITSKEARFAGELVNSLIAAGQDVPQELMDLAMKDGRF  607

Query  578  rskrdark----gggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPS------R  429
            R+KRDARK        R  G GG  RGVRGVDYGLGIGY+ ES++AP+    S      R
Sbjct  608  RTKRDARKGGSKRARGRGGGGGGGSRGVRGVDYGLGIGYNPESNSAPSNRAASGGGGGGR  667

Query  428  SAAVNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNP-----NKKMALPGFVSGGTIG  264
             AAV++L+TGMMAQF+SNFV ASSN +NQ +  SS   P       K  L GFVSGGTIG
Sbjct  668  PAAVSALKTGMMAQFRSNFVPASSNTENQFIQRSSNPPPAVQNDGSKRVLRGFVSGGTIG  727

Query  263  GDTNASRTS  237
            G   A+  S
Sbjct  728  GQQTATPQS  736



>emb|CDY37796.1| BnaC04g00290D [Brassica napus]
Length=734

 Score =   185 bits (470),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 137/184 (74%), Gaps = 9/184 (5%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTL+TQ+EARFAGEL+NSL+ AGQNVP ELMDLAMKDGRF
Sbjct  526  DMHVHRIGRTGRAGDKDGVAYTLVTQREARFAGELINSLVAAGQNVPPELMDLAMKDGRF  585

Query  578  rs--krdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLR  405
            +S        G   R +G GG  RGVRGVD+GLGIG+++ESS   +   PSR   +NS+R
Sbjct  586  KSKRDGRKGGGKKGRGRGGGGGNRGVRGVDFGLGIGFNSESSGTLSQAAPSRKGVINSVR  645

Query  404  TGMMAQFKSNFVAAS-SNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSIS  228
            TG+MAQFK++FVAA+ SN Q+Q      G  PNK+ +L GFVSGGTIGGD   ++T +  
Sbjct  646  TGVMAQFKNSFVAATPSNPQSQ------GGYPNKRPSLMGFVSGGTIGGDIGRTQTQTPP  699

Query  227  NAAT  216
             AA+
Sbjct  700  VAAS  703



>ref|XP_008781128.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
24-like [Phoenix dactylifera]
Length=765

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 138/180 (77%), Gaps = 10/180 (6%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTLITQKEARFAGELVNSL+ AGQNV  ELM+LAMKDGRF
Sbjct  552  DMHVHRIGRTGRAGDKDGIAYTLITQKEARFAGELVNSLVAAGQNVSPELMNLAMKDGRF  611

Query  578  rskrdarkgggkrakgrggsg-rgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRT  402
            R+KRDARKGG K      G+  RGVRGVDYGLGIGY+ ES+NA +  VPSRSA VNSLRT
Sbjct  612  RAKRDARKGGRKGGSRGKGASGRGVRGVDYGLGIGYNPESANATSQVVPSRSATVNSLRT  671

Query  401  GMMAQFKSNFVAASSNLQ----NQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSS  234
            GMM Q+KSNFVAA+S+ Q    NQ   +SSG     K  L GFVSGG I G+   S+ ++
Sbjct  672  GMMTQYKSNFVAATSSPQCDGRNQCSISSSG-----KPVLRGFVSGGLISGEAYKSQPAT  726



>emb|CDX95719.1| BnaC03g26000D [Brassica napus]
Length=735

 Score =   184 bits (467),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 137/167 (82%), Gaps = 8/167 (5%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTL+TQ+EARFAGEL+N L+ AGQNVP ELMDLAMKDGRF
Sbjct  523  DMHVHRIGRTGRAGDKDGVAYTLVTQREARFAGELINILVAAGQNVPPELMDLAMKDGRF  582

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTG  399
            +SKRD RKGGGK+  GRGG  RGVRGVD+GLGIG+++ESS   +   PSR   ++S+RTG
Sbjct  583  KSKRDGRKGGGKKGGGRGGGNRGVRGVDFGLGIGFNSESSGTSSQAAPSRKGVISSVRTG  642

Query  398  MMAQFKSNFVAAS-SNLQNQALGNSSGMNPNKKMALPGFVSGGTIGG  261
            +MAQFK++FVAA+ S+ Q+QA        PNK++AL GFVSGGTIGG
Sbjct  643  VMAQFKNSFVAATPSSQQSQAY-------PNKRLALTGFVSGGTIGG  682



>ref|XP_008227876.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Prunus mume]
Length=787

 Score =   184 bits (467),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 145/227 (64%), Positives = 170/227 (75%), Gaps = 17/227 (7%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDGTAYTLITQKEARFAGELVNSL+ AGQN   ELMDLAMKDGRF
Sbjct  562  DMHVHRIGRTGRAGDKDGTAYTLITQKEARFAGELVNSLVAAGQNASTELMDLAMKDGRF  621

Query  578  rskrdarkgggkrakgrggsgrgvrgvD---------YGLGIGYSAESSNAPTTTVPSRS  426
            RSKRD+RKGGGK+ +GRGG G G  G           YGLGIGY++ES+N+ + T  SRS
Sbjct  622  RSKRDSRKGGGKKGRGRGGGGGGGGGGGGGRGVRGVDYGLGIGYNSESNNSSSHTPTSRS  681

Query  425  AAVNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNAS  246
            AAV SLRTGMM+QFK+ FVAA+SN  +Q  GNSS +   ++ AL GFVSGG+IGGD   +
Sbjct  682  AAVTSLRTGMMSQFKTKFVAAASNSPSQGSGNSSSV--PQRSALRGFVSGGSIGGDIYRT  739

Query  245  R-TSSISNAATSV-----QKPREDASHLssgssrdrqrerrrpSGWD  123
            + T++++ A TSV     Q   E+AS   S SSRD+ RERRR SGWD
Sbjct  740  QATNTVTPAPTSVVNISSQNSGENASQKPSESSRDKPRERRRRSGWD  786



>ref|XP_008808687.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Phoenix 
dactylifera]
 ref|XP_008808688.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Phoenix 
dactylifera]
 ref|XP_008808689.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Phoenix 
dactylifera]
Length=771

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 134/174 (77%), Gaps = 12/174 (7%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDGTAYTLITQKEARFAGELVNSL+ AGQNV  ELMDLAMKDGRF
Sbjct  556  DMHVHRIGRTGRAGDKDGTAYTLITQKEARFAGELVNSLVAAGQNVSPELMDLAMKDGRF  615

Query  578  rskrdarkgggkrakgrggsgrgvrgvD---YGLGIGYSAESSNAPTTTVPSRSAAVNSL  408
            R+KRDARKGG K      G G   RGV    YGLGIGY+ ES+NA   +VP+RS+ V+SL
Sbjct  616  RAKRDARKGGKKVGGKGKGGGGSGRGVRGVDYGLGIGYNPESTNATLQSVPNRSSTVSSL  675

Query  407  RTGMMAQFKSNFVAASSNL----QNQALGNSSGMNPNKKMALPGFVSGGTIGGD  258
            RTGM AQFKSNFVAA+SN     +NQ+  +S+G     +  L GFVSGG+IGG+
Sbjct  676  RTGMRAQFKSNFVAATSNPFGDGRNQSSVSSTG-----RPVLAGFVSGGSIGGE  724



>ref|XP_008381412.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Malus 
domestica]
Length=777

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 142/185 (77%), Gaps = 6/185 (3%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDGTAYTLITQKEARFAGELVNSL+ AGQ V  ELMDLAMKDGRF
Sbjct  559  DMHVHRIGRTGRAGDKDGTAYTLITQKEARFAGELVNSLVAAGQIVSTELMDLAMKDGRF  618

Query  578  rskrda---rkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSL  408
            RSKRD+       G+   G GG GRGVRGVD+GLGIGY+ ES+N+ + T  SR A V  +
Sbjct  619  RSKRDSRKGGGKKGRGRGGGGGGGRGVRGVDFGLGIGYNTESNNSSSHTXASRPATVTPV  678

Query  407  RTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASR-TSSI  231
            RTGMM+QFK+ FVAASSN  +QA GNS    P++  AL GFVSGG+IGGD   ++ TS+I
Sbjct  679  RTGMMSQFKTKFVAASSNSPSQASGNSYSA-PSRP-ALRGFVSGGSIGGDVYRTQATSTI  736

Query  230  SNAAT  216
            + A T
Sbjct  737  TPALT  741



>gb|KDP28272.1| hypothetical protein JCGZ_14043 [Jatropha curcas]
Length=774

 Score =   183 bits (464),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 138/175 (79%), Gaps = 6/175 (3%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYT+ITQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  555  DMHVHRIGRTGRAGDKDGIAYTIITQKEARFAGELVNSLIAAGQNVSVELMDLAMKDGRF  614

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTG  399
            RSKRDARKGGGK+ KGR   GRGVRGVDYGLGIGY+ ES++  +   PSR    NS+RTG
Sbjct  615  RSKRDARKGGGKKGKGRSAGGRGVRGVDYGLGIGYNPESNSTTSNVAPSRPNTGNSVRTG  674

Query  398  MMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSS  234
             M QFKSNFV ASSN        SS    NK+ ALPGFVSGG+IGGD N ++T+S
Sbjct  675  AMTQFKSNFVVASSN------SQSSNNYANKRSALPGFVSGGSIGGDINRTQTTS  723



>ref|XP_006397925.1| hypothetical protein EUTSA_v10001321mg [Eutrema salsugineum]
 gb|ESQ39378.1| hypothetical protein EUTSA_v10001321mg [Eutrema salsugineum]
Length=772

 Score =   183 bits (464),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 138/192 (72%), Gaps = 18/192 (9%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTL+TQ+EARFAGEL+NSL+ AGQNVP ELMDLAMKDGRF
Sbjct  557  DMHVHRIGRTGRAGDKDGVAYTLVTQREARFAGELINSLVAAGQNVPPELMDLAMKDGRF  616

Query  578  rs---krdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVP-------SR  429
            +S    R      G+   G GG  RGVRGVD+GLGIG+++ESS  P    P       SR
Sbjct  617  KSKRDGRKGGGKKGRGRGGGGGGSRGVRGVDFGLGIGFNSESSGTPAQAAPRRSGAAASR  676

Query  428  SAAVNSLRTGMMAQFKSNFVAAS-SNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTN  252
            S A+NS+RTG+MAQFK++FVAA+ SN Q+QA        PNK+ +L GFVSGGTIGG+  
Sbjct  677  SGAINSVRTGVMAQFKNSFVAATPSNPQSQAY-------PNKRPSLMGFVSGGTIGGEMG  729

Query  251  ASRTSSISNAAT  216
             S++ +   A T
Sbjct  730  RSQSQTPPVATT  741



>ref|XP_010506768.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X1 [Camelina sativa]
Length=765

 Score =   183 bits (464),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 134/185 (72%), Gaps = 11/185 (6%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTL+TQ+EARFAGELVNSL+ AGQNVP ELMDLAMKDGRF
Sbjct  557  DMHVHRIGRTGRAGDKDGVAYTLVTQREARFAGELVNSLVAAGQNVPPELMDLAMKDGRF  616

Query  578  rs--krdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPT-TTVPSRSAAVNSL  408
            +S  +     G   R    GG  RGVRGVD+GLGIG+S+E S AP+     SRS  +NS+
Sbjct  617  KSKREGRKGGGKKGRGGRGGGGNRGVRGVDFGLGIGFSSEPSGAPSFKAASSRSGVINSV  676

Query  407  RTGMMAQFKSNFVAA-SSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSI  231
            RTG+MAQFK++FVAA +SN QNQ         PNK+ +L GFVSGGTIGGD   +++   
Sbjct  677  RTGVMAQFKNSFVAATTSNPQNQGY-------PNKRPSLMGFVSGGTIGGDMGRTQSQPP  729

Query  230  SNAAT  216
              A T
Sbjct  730  PVAPT  734



>ref|XP_010506769.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X2 [Camelina sativa]
 ref|XP_010506771.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X3 [Camelina sativa]
Length=765

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 134/185 (72%), Gaps = 11/185 (6%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTL+TQ+EARFAGELVNSL+ AGQNVP ELMDLAMKDGRF
Sbjct  557  DMHVHRIGRTGRAGDKDGVAYTLVTQREARFAGELVNSLVAAGQNVPPELMDLAMKDGRF  616

Query  578  rs--krdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPT-TTVPSRSAAVNSL  408
            +S  +     G   R    GG  RGVRGVD+GLGIG+S+E S AP+     SRS  +NS+
Sbjct  617  KSKREGRKGGGKKGRGGRGGGGNRGVRGVDFGLGIGFSSEPSGAPSFKAASSRSGVINSV  676

Query  407  RTGMMAQFKSNFVAA-SSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSI  231
            RTG+MAQFK++FVAA +SN QNQ         PNK+ +L GFVSGGTIGGD   +++   
Sbjct  677  RTGVMAQFKNSFVAATTSNPQNQGY-------PNKRPSLMGFVSGGTIGGDMGRTQSQPP  729

Query  230  SNAAT  216
              A T
Sbjct  730  PVAPT  734



>ref|XP_008343158.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Malus 
domestica]
Length=778

 Score =   182 bits (463),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 146/175 (83%), Gaps = 2/175 (1%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDGTAYTLITQKEARFAGELVNSL+ AGQ V  ELMDLAMKDGRF
Sbjct  560  DMHVHRIGRTGRAGDKDGTAYTLITQKEARFAGELVNSLVAAGQIVSTELMDLAMKDGRF  619

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTG  399
            RSKRD+RKGGGK+ +GRG  GRGVRGVD+GLGIGY+ ES+N+ + TV SRSAAV   RTG
Sbjct  620  RSKRDSRKGGGKKGRGRGSGGRGVRGVDFGLGIGYNTESNNSSSNTVASRSAAVTPQRTG  679

Query  398  MMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSS  234
            MM+QFK+ FVAASSN  +   GNSS + P++  AL GFVSGG+IGGD   ++T+S
Sbjct  680  MMSQFKTKFVAASSNSPSHGSGNSSSV-PSRP-ALRGFVSGGSIGGDVYRTQTTS  732



>ref|XP_010518432.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Camelina sativa]
Length=764

 Score =   179 bits (454),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 133/185 (72%), Gaps = 11/185 (6%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTL+TQ+EARFAGELVNSL+ AGQNVP ELMDLAMKDGRF
Sbjct  556  DMHVHRIGRTGRAGDKDGVAYTLVTQREARFAGELVNSLVAAGQNVPPELMDLAMKDGRF  615

Query  578  rs--krdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPT-TTVPSRSAAVNSL  408
            +S  +     G   R    GG  RGVRGVD+GLGIG+S+E S A +     SRS  +NS+
Sbjct  616  KSKREGRKGGGKKGRGGRGGGGNRGVRGVDFGLGIGFSSEPSGASSFKAASSRSGVINSV  675

Query  407  RTGMMAQFKSNFVAAS-SNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSI  231
            RTG+MAQFK++FVAA+ SN QNQ         PNK+ +L GFVSGGTIGGD   +++   
Sbjct  676  RTGVMAQFKNSFVAATPSNPQNQGY-------PNKRPSLMGFVSGGTIGGDMGRTQSQPP  728

Query  230  SNAAT  216
              A T
Sbjct  729  QVAPT  733



>ref|XP_006649971.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Oryza 
brachyantha]
Length=772

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 134/229 (59%), Positives = 158/229 (69%), Gaps = 21/229 (9%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMH+HRIGR GRAGDKDGTAYTLITQKE RFAGELV+ LI AGQNVP ELMDLAMKDGRF
Sbjct  549  DMHIHRIGRTGRAGDKDGTAYTLITQKEVRFAGELVHCLIAAGQNVPNELMDLAMKDGRF  608

Query  578  rs-----------krdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPS  432
            R+            +    GGG    G  G GRGVRGVD+GLGIGY+AES     + VP+
Sbjct  609  RANRDSRKGGKKSGKGKGGGGGGGGSGARGRGRGVRGVDFGLGIGYNAESG----SQVPA  664

Query  431  -RSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPN-KKMALPGFVSGGTIGGD  258
             RSAAVNSL+TGMM  FKS+FV+ASSN  + +   S G+ P+  + AL GFVSGGTIGGD
Sbjct  665  PRSAAVNSLKTGMMQNFKSSFVSASSNTPSNS-APSRGVPPSFVRPALRGFVSGGTIGGD  723

Query  257  TNASRTSSISNAATSVQKPREDASH---LssgssrdrqrerrrpSGWDR  120
             N +R    + +     +P E+ +     +  SSRDR RER+RPSGWDR
Sbjct  724  ANPARAVQPAPSFVPASRPAENTTENANPTPESSRDRPRERKRPSGWDR  772



>ref|NP_566099.1| DEAD-box ATP-dependent RNA helicase 24 [Arabidopsis thaliana]
 sp|O22907.2|RH24_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 24 [Arabidopsis 
thaliana]
 gb|AAL15330.1| At2g47330/T8I13.17 [Arabidopsis thaliana]
 gb|AAB63833.2| putative ATP-dependent RNA helicase [Arabidopsis thaliana]
 gb|AAM70580.1| At2g47330/T8I13.17 [Arabidopsis thaliana]
 gb|AEC10828.1| DEAD-box ATP-dependent RNA helicase 24 [Arabidopsis thaliana]
Length=760

 Score =   176 bits (445),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 141/183 (77%), Gaps = 10/183 (5%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGD+DG AYTL+TQ+EARFAGELVNSL+ AGQNVP EL DLAMKDGRF
Sbjct  555  DMHVHRIGRTGRAGDRDGVAYTLVTQREARFAGELVNSLVAAGQNVPPELTDLAMKDGRF  614

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTT-TVPSRSAAVNSLRT  402
               +   + GGK+ +G GG  +GVRGVD+GLGIG+S+ESS  P++   PSRS A+NS+RT
Sbjct  615  -KSKRDGRKGGKKGRGGGGGNKGVRGVDFGLGIGFSSESSRTPSSKAAPSRSGAINSVRT  673

Query  401  GMMAQFKSNFVAAS-SNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISN  225
            G+MAQFK++FVAA+ SN QNQA        PNK+ +L GFVSGGTIGGD   +++ +   
Sbjct  674  GVMAQFKNSFVAATPSNPQNQAY-------PNKRPSLMGFVSGGTIGGDMGRTQSQAPPV  726

Query  224  AAT  216
            A T
Sbjct  727  APT  729



>ref|XP_002467976.1| hypothetical protein SORBIDRAFT_01g037410 [Sorghum bicolor]
 gb|EER94974.1| hypothetical protein SORBIDRAFT_01g037410 [Sorghum bicolor]
Length=766

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 143/200 (72%), Gaps = 23/200 (12%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMH+HRIGR GRAGDKDGTAYTLITQKEARFAGELV+SLI AGQ+VP ELMDLAMKDGRF
Sbjct  546  DMHIHRIGRTGRAGDKDGTAYTLITQKEARFAGELVHSLIAAGQDVPNELMDLAMKDGRF  605

Query  578  rskrda-----rkgggkrakgrggsgrgvrgvDYGLGIGYSAES-SNAPTTTVPSRSAAV  417
            R+KRD+     + G GK   G  G GRGVRGVD+GLGIGY+AES S  P    P RSAAV
Sbjct  606  RAKRDSRKGGKKGGKGKGGGGGAGRGRGVRGVDFGLGIGYNAESGSQVP----PPRSAAV  661

Query  416  NSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRT-  240
            NSL+TGMM QFKS+FV+ SSN  + +    S + P    AL GFVSGGTIGGD   +++ 
Sbjct  662  NSLKTGMMQQFKSSFVSGSSNTPSSS--APSFVRP----ALRGFVSGGTIGGDARPAQSA  715

Query  239  ------SSISNAATSVQKPR  198
                  S  +  A SV  PR
Sbjct  716  PTFVPASRPAQPAPSVPAPR  735



>ref|XP_010544963.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Tarenaya hassleriana]
Length=774

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 131/176 (74%), Gaps = 16/176 (9%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTL++QKEARFAGELVNSLI AGQNVP ELMDLAMKDGRF
Sbjct  557  DMHVHRIGRTGRAGDKDGVAYTLVSQKEARFAGELVNSLIAAGQNVPPELMDLAMKDGRF  616

Query  578  -----rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSA---  423
                   K   +K  G+   G GG GRGVRGVD+G+GIGY+ ES++    T  + S+   
Sbjct  617  RSRRDGRKGGGKKSRGRGGGGSGGGGRGVRGVDFGMGIGYNTESNSNAAATSQAASSRSG  676

Query  422  AVNSLRTGMMAQFKSNFVAASSN-LQNQALGNSSGMNPNKKMALPGFVSGGTIGGD  258
            AVNSLRTG+MAQFKS+FVAASSN  QNQ         PN++ +L GFVSGGTIGG+
Sbjct  677  AVNSLRTGVMAQFKSSFVAASSNPPQNQTY-------PNRRPSLTGFVSGGTIGGE  725



>ref|XP_004984607.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Setaria 
italica]
Length=768

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 136/181 (75%), Gaps = 17/181 (9%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMH+HRIGR GRAGDKDGTAYTLITQKEARFAGELV+SLI AGQ+VP ELMDLAMKDGRF
Sbjct  546  DMHIHRIGRTGRAGDKDGTAYTLITQKEARFAGELVHSLIAAGQDVPNELMDLAMKDGRF  605

Query  578  rskrda------rkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPS-RSAA  420
            R+KRD+        G GK   G  G  RGVRGVD+GLGIGY+AES       VP+ R+AA
Sbjct  606  RAKRDSRKGGKKGGGKGKGGGGGAGRSRGVRGVDFGLGIGYNAESG----AQVPAPRTAA  661

Query  419  VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRT  240
            VNSL+TGMM QFKS+FV+ SSN  + +    S + P    AL GFVSGGTIGGD+  +++
Sbjct  662  VNSLKTGMMQQFKSSFVSGSSNTPSSS--APSFVRP----ALRGFVSGGTIGGDSRPAQS  715

Query  239  S  237
            +
Sbjct  716  A  716



>ref|XP_008654950.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X2 [Zea mays]
Length=750

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 135/180 (75%), Gaps = 16/180 (9%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMH+HRIGR GRAGDKDGTAYTLITQKEA FAGELV+SLI AGQ+VP ELMDLAMKDGRF
Sbjct  546  DMHIHRIGRTGRAGDKDGTAYTLITQKEAHFAGELVHSLIAAGQDVPNELMDLAMKDGRF  605

Query  578  rskrdarkgggkrakgrggsgrgvrgvD-----YGLGIGYSAES-SNAPTTTVPSRSAAV  417
            R+KRD+RKGG K  KG+GG G   RG       +GLGIGY+AES S  P     +RSAAV
Sbjct  606  RAKRDSRKGGKKGGKGKGGVGGAGRGRGVRGVDFGLGIGYNAESGSQVPA----ARSAAV  661

Query  416  NSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTS  237
            NSL+TGM+ +FKS+FV+ SSN  + +    S + P    AL GFVSGGTIGGDT  ++ +
Sbjct  662  NSLKTGMLQRFKSSFVSGSSNTPSSS--APSFVRP----ALRGFVSGGTIGGDTRPAQAA  715



>ref|XP_008654947.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X1 [Zea mays]
 tpg|DAA45029.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=766

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 135/180 (75%), Gaps = 16/180 (9%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMH+HRIGR GRAGDKDGTAYTLITQKEA FAGELV+SLI AGQ+VP ELMDLAMKDGRF
Sbjct  546  DMHIHRIGRTGRAGDKDGTAYTLITQKEAHFAGELVHSLIAAGQDVPNELMDLAMKDGRF  605

Query  578  rskrdarkgggkrakgrggsgrgvrgvD-----YGLGIGYSAES-SNAPTTTVPSRSAAV  417
            R+KRD+RKGG K  KG+GG G   RG       +GLGIGY+AES S  P     +RSAAV
Sbjct  606  RAKRDSRKGGKKGGKGKGGVGGAGRGRGVRGVDFGLGIGYNAESGSQVPA----ARSAAV  661

Query  416  NSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTS  237
            NSL+TGM+ +FKS+FV+ SSN  + +    S + P    AL GFVSGGTIGGDT  ++ +
Sbjct  662  NSLKTGMLQRFKSSFVSGSSNTPSSS--APSFVRP----ALRGFVSGGTIGGDTRPAQAA  715



>ref|XP_003558073.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Brachypodium 
distachyon]
Length=767

 Score =   163 bits (412),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 134/204 (66%), Gaps = 25/204 (12%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMH+HRIGR GRAGDKDGTAYTLITQKE RFAGELV+SLI AGQ+VP ELMDLAMKDGRF
Sbjct  541  DMHIHRIGRTGRAGDKDGTAYTLITQKETRFAGELVHSLIAAGQDVPNELMDLAMKDGRF  600

Query  578  rs----------------krdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPT  447
            R+                        G    G  G GRG+RGVD+GLGIGYS ES   P 
Sbjct  601  RANRDSRKGGKKGGKGKGGGGGGGSSGGGGGGARGRGRGIRGVDFGLGIGYSTES--GPQ  658

Query  446  TTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNK--KMALPGFVSGG  273
               P RSA VN+L+TGMM  FKS+FV+A+S++ +    NS+ +   +  + AL GFVSGG
Sbjct  659  VPAP-RSATVNALKTGMMQNFKSSFVSAASSMPS----NSAPLRAAQFVRPALRGFVSGG  713

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            TIGGD  A+R +  + +  S  +P
Sbjct  714  TIGGDAGAARPAPPAPSFVSTSRP  737



>gb|AFW88580.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=768

 Score =   162 bits (411),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 134/181 (74%), Gaps = 17/181 (9%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMH+HRIGR GRAGDKDGTAYTLITQKEARFAGELV SLI AGQ+VP ELMDLAMKD RF
Sbjct  546  DMHIHRIGRTGRAGDKDGTAYTLITQKEARFAGELVQSLIAAGQDVPNELMDLAMKDVRF  605

Query  578  rskrdarkgggkrakgrggsgrgvrgvD------YGLGIGYSAESSNAPTTTVPS-RSAA  420
            R+KRD+RKGG K  KG+GG G G           +GLGIGY+AES     + VP+ RSAA
Sbjct  606  RAKRDSRKGGKKGGKGKGGVGGGAGRGRGVRGVDFGLGIGYNAESG----SQVPAPRSAA  661

Query  419  VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRT  240
            +NSL+TG+M QFKS+FV+ SSN  + +    S + P    AL GFVSGGTIGGDT  ++ 
Sbjct  662  INSLKTGVMQQFKSSFVSGSSNTPSSS--APSLVRP----ALRGFVSGGTIGGDTRPAQP  715

Query  239  S  237
            +
Sbjct  716  A  716



>ref|NP_001147596.1| pre-mRNA-processing ATP-dependent RNA helicase prp-5 [Zea mays]
 gb|ACG28038.1| pre-mRNA-processing ATP-dependent RNA helicase prp-5 [Zea mays]
Length=768

 Score =   162 bits (411),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 133/181 (73%), Gaps = 17/181 (9%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMH+HRIGR GRAGDKDGTAYTLITQKEARFAGELV SLI AGQ+VP ELMDLAMKD RF
Sbjct  546  DMHIHRIGRTGRAGDKDGTAYTLITQKEARFAGELVQSLIAAGQDVPNELMDLAMKDVRF  605

Query  578  rskrdarkgggkrakgrggsgrgvrgvD------YGLGIGYSAESSNAPTTTVPS-RSAA  420
            R+KRD+RKG  K  KG+GG G G           +GLGIGY+AES     + VP+ RSAA
Sbjct  606  RAKRDSRKGLKKGGKGKGGVGGGAGRGRGVRGVDFGLGIGYNAESG----SQVPAPRSAA  661

Query  419  VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRT  240
            +NSL+TG+M QFKS+FV+ SSN  + +    S + P    AL GFVSGGTIGGDT  ++ 
Sbjct  662  INSLKTGVMQQFKSSFVSGSSNTPSSS--APSLVRP----ALRGFVSGGTIGGDTRPAQP  715

Query  239  S  237
            +
Sbjct  716  A  716



>ref|XP_001779387.1| predicted protein [Physcomitrella patens]
 gb|EDQ55777.1| predicted protein [Physcomitrella patens]
Length=741

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 119/151 (79%), Gaps = 9/151 (6%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D HVHRIGR GRAGDKDG A+TL+T KEARFAGELVNSLI AGQNVP ELMDLAMKDGR+
Sbjct  561  DSHVHRIGRTGRAGDKDGVAHTLVTGKEARFAGELVNSLIAAGQNVPTELMDLAMKDGRY  620

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTT--VPSRSAAVNSLR  405
            R++R+ R+ GG + KG  G GR VRGVD+GLGIGYSA+++NA  +   +PSR +AV+SLR
Sbjct  621  RAQREGRRRGGGQGKGGRGGGRNVRGVDFGLGIGYSADAANAAPSKEDIPSRGSAVDSLR  680

Query  404  TGMMAQFKSNFVAASSNLQNQALGNSSGMNP  312
             GMMA+FKSNFVAA++        NS G  P
Sbjct  681  QGMMARFKSNFVAANTP-------NSVGYTP  704



>gb|EEE58924.1| hypothetical protein OsJ_10575 [Oryza sativa Japonica Group]
Length=696

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 133/205 (65%), Gaps = 25/205 (12%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMH+HRIGR GRAGDKDGTAYTLITQKE RFAGELV+ LI AGQ+VP ELMDLAMKDGRF
Sbjct  472  DMHIHRIGRTGRAGDKDGTAYTLITQKEVRFAGELVHCLIAAGQDVPNELMDLAMKDGRF  531

Query  578  rs------------krdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVP  435
            R+            K     GGG    G  G GRGVRGVD+GLGIGY+AES + P     
Sbjct  532  RANRDSRKGGKKSGKGKGGGGGGGGGSGARGRGRGVRGVDFGLGIGYNAESGSVPA----  587

Query  434  SRSAAVNSLRTGMMAQFKSNFVAAS-----SNLQNQALGNSSGMNPNKKMALPGFVSGGT  270
             RSAA+NSL+TGMM  FKS+FV+AS     SN        SS + P    AL GFVSGGT
Sbjct  588  PRSAALNSLKTGMMQNFKSSFVSASSSNTPSNSAPSRGAPSSFVRP----ALRGFVSGGT  643

Query  269  IGGDTNASRTSSISNAATSVQKPRE  195
            IGGD N +R    + +     +P E
Sbjct  644  IGGDANQARAVLPAPSFVPASRPAE  668



>ref|NP_001049904.1| Os03g0308500 [Oryza sativa Japonica Group]
 sp|Q10MH8.1|RH24_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 24 [Oryza sativa 
Japonica Group]
 gb|ABF95549.1| DEAD/DEAH box helicase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11818.1| Os03g0308500 [Oryza sativa Japonica Group]
 dbj|BAG96306.1| unnamed protein product [Oryza sativa Japonica Group]
Length=770

 Score =   157 bits (396),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 132/205 (64%), Gaps = 25/205 (12%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMH+HRIGR GRAGDKDGTAYTLITQKE RFAGELV+ LI AGQ+VP ELMDLAMKDGRF
Sbjct  546  DMHIHRIGRTGRAGDKDGTAYTLITQKEVRFAGELVHCLIAAGQDVPNELMDLAMKDGRF  605

Query  578  rs------------krdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVP  435
            R+            K     GGG    G  G GRGVRGVD+GLGIGY+AES + P     
Sbjct  606  RANRDSRKGGKKSGKGKGGGGGGGGGSGARGRGRGVRGVDFGLGIGYNAESGSVPA----  661

Query  434  SRSAAVNSLRTGMMAQFKSNFVAA-----SSNLQNQALGNSSGMNPNKKMALPGFVSGGT  270
             RSAA+NSL+TGMM  FKS+FV+A      SN        SS + P    AL GFVSGGT
Sbjct  662  PRSAALNSLKTGMMQNFKSSFVSASSSNTPSNSAPSRGAPSSFVRP----ALRGFVSGGT  717

Query  269  IGGDTNASRTSSISNAATSVQKPRE  195
            IGGD N +R    + +     +P E
Sbjct  718  IGGDANQARAVLPAPSFVPASRPAE  742



>dbj|BAJ97115.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=764

 Score =   156 bits (395),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 136/201 (68%), Gaps = 22/201 (11%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMH+HRIGR GRAGDKDGTAYTLITQKE+RFAGELV+SLI AGQ+VP ELMDLAMKDGRF
Sbjct  541  DMHIHRIGRTGRAGDKDGTAYTLITQKESRFAGELVHSLIAAGQDVPNELMDLAMKDGRF  600

Query  578  rs------------krdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVP  435
            R+            K     GGG    G  G GRG+RGVD+GLGIGY +ES   P    P
Sbjct  601  RANRDSRKGGKKGGKGKGGGGGGGGGGGARGRGRGIRGVDFGLGIGYGSES--GPQVPAP  658

Query  434  SRSAAVNSLRTGMMAQFKSNFVAASSNLQNQAL---GNSSGMNPNKKMALPGFVSGGTIG  264
             RSA VN+L+TGMM  FKS+FV+ASS+  + +    G  S + P    AL GFVSGGTIG
Sbjct  659  -RSATVNTLKTGMMQNFKSSFVSASSSAPSNSTPSRGTPSFVKP----ALRGFVSGGTIG  713

Query  263  GDTNASRTSSISNAATSVQKP  201
            GD+ A+R + +  +     +P
Sbjct  714  GDSGAARPAPVVPSFVPASRP  734



>gb|EEC75096.1| hypothetical protein OsI_11255 [Oryza sativa Indica Group]
Length=1023

 Score =   157 bits (398),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 137/210 (65%), Gaps = 29/210 (14%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMH+HRIGR GRAGDKDGTAYTLITQKE RFAGELV+ LI AGQ+VP ELMDLAMKDGRF
Sbjct  558  DMHIHRIGRTGRAGDKDGTAYTLITQKEVRFAGELVHCLIAAGQDVPNELMDLAMKDGRF  617

Query  578  rskrdarkgggkrakgrggsgrgvrg----------------vDYGLGIGYSAESSNAPT  447
            R+ RD+RKGG K  KG+GG G G  G                VD+GLGIGY+AES + P 
Sbjct  618  RANRDSRKGGKKSGKGKGGGGGGGGGGGGGSGACGRGRGVRGVDFGLGIGYNAESGSVPA  677

Query  446  TTVPSRSAAVNSLRTGMMAQFKSNFVAA-----SSNLQNQALGNSSGMNPNKKMALPGFV  282
                 RSAAVNSL+TGMM  FKS+FV+A      SN        SS + P    AL GFV
Sbjct  678  ----PRSAAVNSLKTGMMQNFKSSFVSASSSNTPSNSAPSRGAPSSFVRP----ALRGFV  729

Query  281  SGGTIGGDTNASRTSSISNAATSVQKPRED  192
            SGGTIGGD N +R    + +     +P E+
Sbjct  730  SGGTIGGDANQARAVQPAPSFVPASRPAEN  759



>gb|EMS61774.1| DEAD-box ATP-dependent RNA helicase 24 [Triticum urartu]
Length=765

 Score =   149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 126/182 (69%), Gaps = 19/182 (10%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMH+HRIGR GRAGDKDGTAYTLITQKE+RFAGELV+SLI AGQ+VP ELMDLAMKDGRF
Sbjct  541  DMHIHRIGRTGRAGDKDGTAYTLITQKESRFAGELVHSLIAAGQDVPNELMDLAMKDGRF  600

Query  578  rs--------------krdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTT  441
            R+              K     GGG    G G  GRG+RGVD+GLGIGY +ES   P   
Sbjct  601  RANRDSRKGGKKGGKGKGGGGGGGGGGGGGGGARGRGIRGVDFGLGIGYGSES--GPQVP  658

Query  440  VPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGG  261
             P RSA VN+L+TGMM  FKS+FV+ASS+  + +        P  K AL GFVSGGTIGG
Sbjct  659  AP-RSATVNTLKTGMMQNFKSSFVSASSSAPSNSAPLRGA--PFVKPALRGFVSGGTIGG  715

Query  260  DT  255
            D+
Sbjct  716  DS  717



>gb|EMT30425.1| DEAD-box ATP-dependent RNA helicase 24 [Aegilops tauschii]
Length=789

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 126/185 (68%), Gaps = 24/185 (13%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMH+HRIGR GRAGDKDGTAYTLITQKE+RFAGELV+SLI AGQ+VP ELMDLAMKDGRF
Sbjct  541  DMHIHRIGRTGRAGDKDGTAYTLITQKESRFAGELVHSLIAAGQDVPNELMDLAMKDGRF  600

Query  578  rs--------------krdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTT  441
            R+              K     GGG    G  G GRG+RGVD+GLGIGY +ES   P   
Sbjct  601  RANRDSRKGGKKGGKGKGGGGGGGGGGGGGARGRGRGIRGVDFGLGIGYGSES--GPQVP  658

Query  440  VPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQAL---GNSSGMNPNKKMALPGFVSGGT  270
             P RSA VN L+TGMM  FKS+FV+ASS+  + +    G  S + P     L GFVSGGT
Sbjct  659  AP-RSATVNVLKTGMMQNFKSSFVSASSSAPSNSAPSRGAPSFVKPT----LRGFVSGGT  713

Query  269  IGGDT  255
            IGGD+
Sbjct  714  IGGDS  718



>ref|XP_009135930.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like, partial 
[Brassica rapa]
Length=636

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTL+TQ+EARFAGEL+NSL+ AGQNVP ELMDLAMKDGRF
Sbjct  526  DMHVHRIGRTGRAGDKDGVAYTLVTQREARFAGELINSLVAAGQNVPQELMDLAMKDGRF  585

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSR  429
            +SKRD RKGGGK+  GRGG  RGVRGVD+GLGIG+++ESS   +   PSR
Sbjct  586  KSKRDGRKGGGKKGGGRGGGNRGVRGVDFGLGIGFNSESSGTSSQAAPSR  635



>emb|CDX83333.1| BnaA03g21730D [Brassica napus]
Length=637

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTL+TQ+EARFAGEL+NSL+ AGQNVP ELMDLAMKDGRF
Sbjct  526  DMHVHRIGRTGRAGDKDGVAYTLVTQREARFAGELINSLVAAGQNVPQELMDLAMKDGRF  585

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSR  429
            +SKRD RKGGGK+  GRGG  RGVRGVD+GLGIG+++ESS   +   PSR
Sbjct  586  KSKRDGRKGGGKKGGGRGGGNRGVRGVDFGLGIGFNSESSGTSSQAAPSR  635



>ref|XP_002980961.1| hypothetical protein SELMODRAFT_51367, partial [Selaginella moellendorffii]
 gb|EFJ18146.1| hypothetical protein SELMODRAFT_51367, partial [Selaginella moellendorffii]
Length=653

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 104/144 (72%), Gaps = 9/144 (6%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D HVHR+GR GRAGDK+G AYTL+TQKEARFAG+LVN  + AGQNVP+ELMDLAMKDGRF
Sbjct  510  DTHVHRVGRTGRAGDKEGVAYTLVTQKEARFAGDLVNGFVAAGQNVPSELMDLAMKDGRF  569

Query  578  rskrdarkgggkrakgrggsgrgvrgvD---YGLGIGYSAESSNAPTTTV------PSRS  426
            R++R+ R+ GGK      G G G RGV    YGLGIGYS ++S+ P+  V          
Sbjct  570  RAQREGRRKGGKGGGRGKGGGGGGRGVRGVDYGLGIGYSRDASSNPSAPVHQARKSSGVG  629

Query  425  AAVNSLRTGMMAQFKSNFVAASSN  354
            AA +S  + MM +FK++FVAASS+
Sbjct  630  AASSSPSSSMMTRFKNSFVAASSS  653



>ref|XP_006388445.1| hypothetical protein POPTR_0184s002103g, partial [Populus trichocarpa]
 gb|ERP47359.1| hypothetical protein POPTR_0184s002103g, partial [Populus trichocarpa]
Length=127

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D+HVHRIGR GRAGDKDG AYTLITQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  59   DVHVHRIGRTGRAGDKDGIAYTLITQKEARFAGELVNSLIAAGQNVSVELMDLAMKDGRF  118



>ref|XP_002989340.1| hypothetical protein SELMODRAFT_41331, partial [Selaginella moellendorffii]
 gb|EFJ09614.1| hypothetical protein SELMODRAFT_41331, partial [Selaginella moellendorffii]
Length=653

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 102/144 (71%), Gaps = 9/144 (6%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D HVHR+GR GRAGDK+G AYTL+ QKEARFAG+LVN  + AGQNVP+ELMDLAMKDGRF
Sbjct  510  DTHVHRVGRTGRAGDKEGVAYTLVAQKEARFAGDLVNGFVAAGQNVPSELMDLAMKDGRF  569

Query  578  rskrdarkgggkrakgrggsgrgvrgvD---YGLGIGYSAESSNAPTTTV------PSRS  426
            R++R+ R+ GGK      G G G RGV    YGLGIGYS ++S+ P+  V          
Sbjct  570  RAQREGRRKGGKGGGRGKGGGGGGRGVRGVDYGLGIGYSRDASSNPSAPVHQARKSSGVG  629

Query  425  AAVNSLRTGMMAQFKSNFVAASSN  354
            AA +S  + MM +FK +FVAASS+
Sbjct  630  AASSSPSSSMMTRFKDSFVAASSS  653



>gb|KJB22488.1| hypothetical protein B456_004G050200 [Gossypium raimondii]
Length=660

 Score =   111 bits (278),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGR  582
            DMHVHRIGR GRAGDKDG AYTLITQKEARFAGELVNSLI AGQNV  ELMDLAMK GR
Sbjct  559  DMHVHRIGRTGRAGDKDGIAYTLITQKEARFAGELVNSLIAAGQNVSMELMDLAMKVGR  617


 Score = 36.6 bits (83),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  508  CVAWIMVWVLDTVQNQVMLQLPLFQ  434
            CV  I+VWVLD +QN VML L LF+
Sbjct  631  CVELILVWVLDIIQNPVMLHLRLFK  655



>gb|KJB22484.1| hypothetical protein B456_004G050000 [Gossypium raimondii]
Length=661

 Score =   111 bits (278),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGR  582
            DMHVHRIGR GRAGDKDG AYTLITQKEARFAGELVNSLI AGQNV  ELMDLAMK GR
Sbjct  560  DMHVHRIGRTGRAGDKDGIAYTLITQKEARFAGELVNSLIAAGQNVSMELMDLAMKVGR  618


 Score = 36.6 bits (83),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  508  CVAWIMVWVLDTVQNQVMLQLPLFQ  434
            CV  I+VWVLD +QN VML L LF+
Sbjct  632  CVELILVWVLDIIQNPVMLHLRLFK  656



>ref|XP_010507898.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Camelina 
sativa]
Length=647

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTL+TQ+EARFAG+LVNSL+ AGQNVP ELMDLAMKDGRF
Sbjct  556  DMHVHRIGRTGRAGDKDGVAYTLVTQREARFAGDLVNSLVAAGQNVPPELMDLAMKDGRF  615



>gb|KJB22490.1| hypothetical protein B456_004G050200 [Gossypium raimondii]
Length=636

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR GRAGDKDG AYTLITQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  559  DMHVHRIGRTGRAGDKDGIAYTLITQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRF  618



>ref|XP_002882116.1| hypothetical protein ARALYDRAFT_483908 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58375.1| hypothetical protein ARALYDRAFT_483908 [Arabidopsis lyrata subsp. 
lyrata]
Length=739

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 113/183 (62%), Gaps = 32/183 (17%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            DMHVHRIGR                       GELV SL+ AGQ VP ELMDLAMKDGRF
Sbjct  556  DMHVHRIGR----------------------TGELVTSLVAAGQIVPPELMDLAMKDGRF  593

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTV-PSRSAAVNSLRT  402
            +SKRD RKGG K   G   +        +GLGIG+S+ESS  P++   PSRS  +NS+RT
Sbjct  594  KSKRDGRKGGKKGRGGGAANKGVRGVD-FGLGIGFSSESSGTPSSKAAPSRSGTINSVRT  652

Query  401  GMMAQFKSNFVAAS-SNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISN  225
            G+MAQFK++FVAA+ SN Q+QA        PNK+ +L GFVSGGTIGGD   +++ +   
Sbjct  653  GVMAQFKNSFVAATPSNPQSQAY-------PNKRPSLMGFVSGGTIGGDMGRTQSQAPPV  705

Query  224  AAT  216
            A T
Sbjct  706  APT  708



>ref|XP_010518433.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X2 
[Camelina sativa]
Length=657

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGR  582
            DMHVHRIGR GRAGDKDG AYTL+TQ+EARFAGELVNSL+ AGQNVP ELMDLAMK GR
Sbjct  556  DMHVHRIGRTGRAGDKDGVAYTLVTQREARFAGELVNSLVAAGQNVPPELMDLAMKVGR  614



>ref|XP_006444513.1| hypothetical protein CICLE_v10018925mg [Citrus clementina]
 gb|ESR57753.1| hypothetical protein CICLE_v10018925mg [Citrus clementina]
 gb|KDO86971.1| hypothetical protein CISIN_1g003881mg [Citrus sinensis]
 gb|KDO86972.1| hypothetical protein CISIN_1g003881mg [Citrus sinensis]
Length=630

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGR  582
            DMHVHRIGR GRAGDKDGTAYTL+TQKEARFAGELVNSLI AGQNV  ELMDLAMK GR
Sbjct  552  DMHVHRIGRTGRAGDKDGTAYTLVTQKEARFAGELVNSLIAAGQNVSMELMDLAMKVGR  610



>ref|XP_011079539.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X2 
[Sesamum indicum]
Length=654

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDG  585
            DMHVHRIGR GRAGDKDGTAYTLITQKEARFAGELVNSLI AGQNV  ELMDLAMK G
Sbjct  558  DMHVHRIGRTGRAGDKDGTAYTLITQKEARFAGELVNSLIAAGQNVSTELMDLAMKVG  615



>ref|XP_007051130.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 3, partial [Theobroma cacao]
 gb|EOX95287.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 3, partial [Theobroma cacao]
Length=622

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGR  582
            DMHVHRIGR GRAGDKDG AYTLITQKEARFAGELVNSLI AGQNV  ELMDLAMK GR
Sbjct  558  DMHVHRIGRTGRAGDKDGIAYTLITQKEARFAGELVNSLIAAGQNVSMELMDLAMKVGR  616



>gb|KDO86973.1| hypothetical protein CISIN_1g003881mg [Citrus sinensis]
Length=618

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMK  591
            DMHVHRIGR GRAGDKDGTAYTL+TQKEARFAGELVNSLI AGQNV  ELMDLAMK
Sbjct  552  DMHVHRIGRTGRAGDKDGTAYTLVTQKEARFAGELVNSLIAAGQNVSMELMDLAMK  607



>ref|XP_008353905.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Malus 
domestica]
Length=428

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMK  591
            DMHVHRIGR GRAGDKDGTAYTLI QKEARFAGELVNSL+ AGQ V  ELMDLAMK
Sbjct  370  DMHVHRIGRTGRAGDKDGTAYTLIAQKEARFAGELVNSLVAAGQIVSTELMDLAMK  425



>ref|XP_009758479.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X2 
[Nicotiana sylvestris]
Length=636

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMK  591
            DMHVHRIGR GRAGDKDGTAYTLITQKEARFAGEL NSL+ AGQ V  ELMDLAMK
Sbjct  559  DMHVHRIGRTGRAGDKDGTAYTLITQKEARFAGELANSLVAAGQTVSIELMDLAMK  614



>ref|XP_009610166.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X2 
[Nicotiana tomentosiformis]
Length=636

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMK  591
            DMHVHRIGR GRAGDKDGTAYTLITQKEARFAGEL NSL+ AGQ V  ELMDLAMK
Sbjct  559  DMHVHRIGRTGRAGDKDGTAYTLITQKEARFAGELANSLVAAGQTVSIELMDLAMK  614



>ref|XP_010679398.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=666

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAM  594
            DMHVHRIGR GRAGDKDG AYTLIT KEARFAGE+VNSLI AGQNV  ELMDLAM
Sbjct  557  DMHVHRIGRTGRAGDKDGVAYTLITHKEARFAGEMVNSLIAAGQNVTMELMDLAM  611



>ref|XP_005643999.1| DEAD-domain-containing protein, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19455.1| DEAD-domain-containing protein, partial [Coccomyxa subellipsoidea 
C-169]
Length=561

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D HVHR+GR GRAGDKDG AYTL+T +EARFAGELVNSL  A Q VP  LMDLA KDG F
Sbjct  486  DTHVHRVGRTGRAGDKDGVAYTLVTPREARFAGELVNSLAAANQQVPKALMDLAAKDGHF  545



>dbj|BAK04860.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97876.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=415

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAE  612
            DMH+HRIGR GRAGDKDGTAYTLITQKE+RFAGELV+SLI AGQ+VP E
Sbjct  367  DMHIHRIGRTGRAGDKDGTAYTLITQKESRFAGELVHSLIAAGQDVPNE  415



>emb|CEG84746.1| Putative Adenosinetriphosphatase [Rhizopus microsporus]
Length=477

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HR+GR GRAG+K GTAYTLITQKE RFAGELV  L T+GQ VP+EL++LAMK+ RF
Sbjct  343  DSHTHRVGRTGRAGEK-GTAYTLITQKEDRFAGELVRHLETSGQAVPSELLNLAMKNSRF  401



>emb|CEI91338.1| hypothetical protein RMCBS344292_05633 [Rhizopus microsporus]
Length=699

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HR+GR GRAG+K GTAYTLITQKE RFAGELV  L T+GQ VP+EL++LAMK+ RF
Sbjct  564  DSHTHRVGRTGRAGEK-GTAYTLITQKEDRFAGELVRHLETSGQAVPSELLNLAMKNSRF  622



>emb|CEI97815.1| Putative Adenosinetriphosphatase [Rhizopus microsporus]
Length=495

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HR+GR GRAG+K GTAYTLITQKE RFAGELV  L T+GQ VP+EL++LAMK+ RF
Sbjct  359  DSHTHRVGRTGRAGEK-GTAYTLITQKEDRFAGELVRHLETSGQAVPSELLNLAMKNSRF  417



>emb|CEG65407.1| hypothetical protein RMATCC62417_02199 [Rhizopus microsporus]
Length=747

 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HR+GR GRAG+K GTAYTLITQKE RFAGELV  L T+GQ VP+EL++LAMK+ RF
Sbjct  610  DSHTHRVGRTGRAGEK-GTAYTLITQKEDRFAGELVRHLETSGQAVPSELLNLAMKNSRF  668



>gb|ESA03679.1| hypothetical protein GLOINDRAFT_5342 [Rhizophagus irregularis 
DAOM 181602]
Length=792

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D HVHRIGR GRAG+K GTAYTLITQKE +FAG+LV +L ++GQ VP+ LMDLAM++ RF
Sbjct  616  DSHVHRIGRTGRAGEK-GTAYTLITQKEDKFAGDLVRNLESSGQVVPSSLMDLAMQNARF  674



>dbj|GAN07211.1| ATP-dependent RNA helicase DDX42-like [Mucor ambiguus]
Length=722

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 49/60 (82%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HR+GR GRAG+K GTA+TLITQKE RFAGELV  L T+GQ VP EL++LAMK+ RF
Sbjct  596  DSHTHRVGRTGRAGEK-GTAFTLITQKEDRFAGELVTHLETSGQVVPPELLNLAMKNSRF  654



>emb|CEP11906.1| hypothetical protein [Parasitella parasitica]
Length=1218

 Score = 88.2 bits (217),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -1

Query  758   DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
             D H HR+GR GRAG+K GTAYTLITQKE RFAGELV  L  +GQ VP EL+DLAMK+ RF
Sbjct  1088  DSHTHRVGRTGRAGEK-GTAYTLITQKEDRFAGELVTHLEASGQIVPPELLDLAMKNSRF  1146



>ref|XP_006388446.1| hypothetical protein POPTR_0184s002101g, partial [Populus trichocarpa]
 gb|ERP47360.1| hypothetical protein POPTR_0184s002101g, partial [Populus trichocarpa]
Length=151

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  440  VPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGG  261
            V SRS AVNSLRTG+MAQFK+NFVAA+SN Q+  L  SS +  NK+ AL GFVSGG+IGG
Sbjct  9    VTSRSTAVNSLRTGVMAQFKNNFVAATSNSQSPGLNTSSSVYANKRPALRGFVSGGSIGG  68

Query  260  DTNASRTSS  234
            D N  +T+S
Sbjct  69   DMNRPQTTS  77



>ref|XP_005849956.1| hypothetical protein CHLNCDRAFT_6836, partial [Chlorella variabilis]
 gb|EFN57854.1| hypothetical protein CHLNCDRAFT_6836, partial [Chlorella variabilis]
Length=461

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D HVHRIGR GRAGDKDG AYTL+   E R AG+LV +L TAGQ VPA L +LA +D RF
Sbjct  390  DTHVHRIGRTGRAGDKDGVAYTLLLPHETRIAGDLVQNLATAGQEVPAMLHELAARDPRF  449



>emb|CDS07964.1| hypothetical protein LRAMOSA01913 [Absidia idahoensis var. thermophila]
Length=706

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D HVHRIGR GRAG+K GTAYTLIT+KE +FAGELV +L ++GQ VP +LM+LAM + RF
Sbjct  565  DSHVHRIGRTGRAGEK-GTAYTLITKKEDKFAGELVRNLESSGQQVPMDLMNLAMSNPRF  623



>gb|EPB84356.1| adenosinetriphosphatase [Mucor circinelloides f. circinelloides 
1006PhL]
Length=693

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HR+GR GRAG+K GTA+TLITQKE RFAGEL+  L  +GQ VP EL++LAMK+ RF
Sbjct  574  DSHTHRVGRTGRAGEK-GTAFTLITQKEDRFAGELITHLEASGQVVPPELLNLAMKNSRF  632



>gb|EIE89314.1| hypothetical protein RO3G_14025 [Rhizopus delemar RA 99-880]
Length=674

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HR+GR GRAG+K GTAYTLITQKE RFAGELV  L  +GQ V +EL++LAMK+ RF
Sbjct  534  DSHTHRVGRTGRAGEK-GTAYTLITQKEERFAGELVRHLEASGQTVSSELLNLAMKNPRF  592



>emb|CDH49031.1| atp-dependent rna helicase ddx42-like [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=701

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D HVHRIGR GRAG+K GTAYTLIT+KE +FAG+LV +L  +GQ VP +LM LAM + RF
Sbjct  559  DSHVHRIGRTGRAGEK-GTAYTLITKKEDKFAGDLVRNLENSGQAVPMDLMSLAMTNPRF  617



>ref|XP_002732809.1| PREDICTED: ATP-dependent RNA helicase DDX42-like [Saccoglossus 
kowalevskii]
Length=795

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG K GTAYTL+TQK+  FAG+LV +L  AGQ VP +LMDLAM++  F
Sbjct  584  DTHTHRIGRTGRAGIK-GTAYTLVTQKDVNFAGDLVRNLEGAGQRVPEKLMDLAMQNSWF  642



>ref|XP_005189100.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Musca domestica]
Length=769

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K GTAYTL+T+K+  FAG LV +L  A Q VP +LMDLAMK   F
Sbjct  589  DTHTHRIGRTGRAGEK-GTAYTLVTEKDKEFAGHLVRNLEGADQEVPQDLMDLAMKSSWF  647



>gb|KFD64928.1| hypothetical protein M514_06320 [Trichuris suis]
Length=697

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D HVHRIGR GRAG+K G+AYTL+T+K+  FAG LV SL    QNVP  L+DLAM+   F
Sbjct  507  DTHVHRIGRTGRAGEK-GSAYTLVTEKDKEFAGHLVRSLEAVNQNVPKALLDLAMQSTWF  565



>emb|CDW58801.1| ATP dependent RNA helicase DDX42 [Trichuris trichiura]
Length=661

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D HVHRIGR GRAG+K G+AYTL+T+K+  FAG LV SL    QNVP  L+DLAM+   F
Sbjct  473  DTHVHRIGRTGRAGEK-GSAYTLVTEKDKEFAGHLVRSLEAVNQNVPKALLDLAMQSTWF  531



>ref|XP_008111755.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X2 [Anolis 
carolinensis]
Length=761

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 86/162 (53%), Gaps = 33/162 (20%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A QNV  EL+DLAM++  F
Sbjct  417  DTHTHRIGRTGRAGEK-GVAYTLLTHKDSNFAGDLVRNLEGANQNVSKELLDLAMQNAWF  475

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYS------AESSNAPTTTV-------  438
            R  R     G K   G             G G+GY       +ES +  +  V       
Sbjct  476  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSESVDRGSNNVMVNYEAY  522

Query  437  -PSRSAA---VNSLRTGMMAQFKSNFVAASSNLQNQALGNSS  324
             PS  A    +++++    +Q+KS+FVAAS    NQ  G+SS
Sbjct  523  KPSSGAMGDRLSAMKAAFQSQYKSHFVAAS--FSNQKTGSSS  562



>gb|KFD52829.1| hypothetical protein M513_06320 [Trichuris suis]
Length=810

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 56/156 (36%), Positives = 82/156 (53%), Gaps = 22/156 (14%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D HVHRIGR GRAG+K G+AYTL+T+K+  FAG LV SL    QNVP  L+DLAM+   F
Sbjct  620  DTHVHRIGRTGRAGEK-GSAYTLVTEKDKEFAGHLVRSLEAVNQNVPKALLDLAMQSTWF  678

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNA-PTTTVPS-------RSA  423
            R  R  ++   +   G             G G+GY+ +  +A P   + S        +A
Sbjct  679  RKTRFKKEKAKRPGIG-------------GFGLGYTEKGKDAQPLGNMQSAHVSFAGSNA  725

Query  422  AVNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMN  315
            A +S  +  +A  KS + ++  +   QA  +++  N
Sbjct  726  ATSSSGSSRLAAIKSAYASSYQSTFKQASADTAWDN  761



>emb|CAG07234.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=737

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 83/168 (49%), Gaps = 39/168 (23%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q V  ELMDLAM++  F
Sbjct  428  DTHTHRIGRTGRAGEK-GVAYTLLTSKDSSFAGDLVRNLEGANQAVSKELMDLAMQNPWF  486

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYS------AESSN-------------  456
            R  R     G K   G             G G+GY       AESS              
Sbjct  487  RKSRFKAGKGKKPNIG-------------GGGLGYKERPGLGAESSERSGGTSSFLSSSL  533

Query  455  ----APTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGNSS  324
                 PTT   +    VN++R    AQ+KS+FVAAS N    ++  SS
Sbjct  534  EGYSKPTTG--ALGERVNAMRQAFQAQYKSSFVAASGNPPKLSVKTSS  579



>ref|XP_003222696.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X1 [Anolis 
carolinensis]
 ref|XP_008111753.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X1 [Anolis 
carolinensis]
 ref|XP_008111754.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X1 [Anolis 
carolinensis]
Length=924

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 86/162 (53%), Gaps = 33/162 (20%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A QNV  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTHKDSNFAGDLVRNLEGANQNVSKELLDLAMQNAWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYS------AESSNAPTTTV-------  438
            R  R     G K   G             G G+GY       +ES +  +  V       
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSESVDRGSNNVMVNYEAY  685

Query  437  -PSRSAA---VNSLRTGMMAQFKSNFVAASSNLQNQALGNSS  324
             PS  A    +++++    +Q+KS+FVAAS    NQ  G+SS
Sbjct  686  KPSSGAMGDRLSAMKAAFQSQYKSHFVAAS--FSNQKTGSSS  725



>ref|XP_011412959.1| PREDICTED: ATP-dependent RNA helicase DDX42-like [Crassostrea 
gigas]
Length=731

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 81/150 (54%), Gaps = 27/150 (18%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T+K+  FAG LV +L TAGQ+VP  L++LA K+  F
Sbjct  567  DTHTHRIGRTGRAGEK-GFAYTLVTEKDKDFAGHLVRNLETAGQHVPHALLELAEKNPWF  625

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGI----GYSAESSNAPT------------  447
            +  R  + G GK+    G           GLG     G  AESS                
Sbjct  626  KKIRGKQGGKGKKLNLGGK----------GLGFKERPGLGAESSTKVQDSSSLSSYRGIG  675

Query  446  TTVPSRSAAVNSLRTGMMAQFKSNFVAASS  357
            T+   +S  +++++    AQFKSNFVAA S
Sbjct  676  TSAGPQSDRLSAMKAAFTAQFKSNFVAAES  705



>gb|EKC34097.1| ATP-dependent RNA helicase DDX42 [Crassostrea gigas]
Length=788

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 81/150 (54%), Gaps = 27/150 (18%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T+K+  FAG LV +L TAGQ+VP  L++LA K+  F
Sbjct  624  DTHTHRIGRTGRAGEK-GFAYTLVTEKDKDFAGHLVRNLETAGQHVPHALLELAEKNPWF  682

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGI----GYSAESSNAPT------------  447
            +  R  + G GK+    G           GLG     G  AESS                
Sbjct  683  KKIRGKQGGKGKKLNLGGK----------GLGFKERPGLGAESSTKVQDSSSLSSYRGIG  732

Query  446  TTVPSRSAAVNSLRTGMMAQFKSNFVAASS  357
            T+   +S  +++++    AQFKSNFVAA S
Sbjct  733  TSAGPQSDRLSAMKAAFTAQFKSNFVAAES  762



>ref|XP_003965007.1| PREDICTED: ATP-dependent RNA helicase DDX42-like [Takifugu rubripes]
Length=872

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 77/155 (50%), Gaps = 38/155 (25%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q V  ELMDLAM++  F
Sbjct  573  DTHTHRIGRTGRAGEK-GVAYTLLTNKDSTFAGDLVRNLEGANQAVSKELMDLAMQNPWF  631

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSA----------------------E  465
            R  R     G +   G             G G+GY                        E
Sbjct  632  RKSRFKAGKGKRLHIG-------------GGGLGYKERPGLGAESSERSSSSGFLPSSYE  678

Query  464  SSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAAS  360
            S + PTT   +    VN++R    AQ+KS+FVAAS
Sbjct  679  SYSKPTTG--ALGERVNAMRQAFQAQYKSSFVAAS  711



>ref|XP_007434065.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Python bivittatus]
Length=923

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 88/162 (54%), Gaps = 33/162 (20%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+TQK++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  579  DTHTHRIGRTGRAGEK-GVAYTLLTQKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  637

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYS------AESSNAPTTTV-------  438
            R  R     G K   G             G G+GY       +E+ +  + +V       
Sbjct  638  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENVDRGSNSVMVNYEAY  684

Query  437  -PSRSAA---VNSLRTGMMAQFKSNFVAASSNLQNQALGNSS  324
             PS  A    +++++    +Q+KS+FVAAS    NQ  G+SS
Sbjct  685  KPSSGAMGDRLSAMKAAFQSQYKSHFVAAS--FSNQKTGSSS  724



>gb|KFH71949.1| adenosinetriphosphatase [Mortierella verticillata NRRL 6337]
Length=939

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D HVHR+GR GRAG+K GTAYTLIT+K+ RFAGELV +L   GQ V  +++ +AM++ RF
Sbjct  609  DSHVHRVGRTGRAGEK-GTAYTLITEKDDRFAGELVRNLEEFGQTVEPDVLKIAMQNPRF  667



>ref|XP_003704217.1| PREDICTED: ATP-dependent RNA helicase DDX42-like [Megachile rotundata]
Length=774

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K GTAYTL+T+K+  FAG LV +L  A Q VP  LMDLAM+   F
Sbjct  583  DTHTHRIGRTGRAGEK-GTAYTLVTEKDKEFAGHLVRNLEGANQEVPKSLMDLAMQSAWF  641



>ref|XP_003494399.1| PREDICTED: ATP-dependent RNA helicase DDX42-like [Bombus impatiens]
Length=774

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K GTAYTL+T+K+  FAG LV +L  A Q VP  LMDLAM+   F
Sbjct  583  DTHTHRIGRTGRAGEK-GTAYTLVTEKDKEFAGHLVRNLEGANQEVPKSLMDLAMQSAWF  641



>ref|XP_003695134.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent RNA helicase DDX42-like 
[Apis florea]
Length=772

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K GTAYTL+T+K+  FAG LV +L  A Q VP  LMDLAM+   F
Sbjct  583  DTHTHRIGRTGRAGEK-GTAYTLVTEKDKEFAGHLVRNLEGANQEVPKSLMDLAMQSAWF  641



>ref|XP_003400196.1| PREDICTED: ATP-dependent RNA helicase DDX42-like [Bombus terrestris]
Length=774

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K GTAYTL+T+K+  FAG LV +L  A Q VP  LMDLAM+   F
Sbjct  583  DTHTHRIGRTGRAGEK-GTAYTLVTEKDKEFAGHLVRNLEGANQEVPKSLMDLAMQSAWF  641



>ref|XP_624210.1| PREDICTED: ATP-dependent RNA helicase DDX42-like isoform X2 [Apis 
mellifera]
 ref|XP_006557909.1| PREDICTED: ATP-dependent RNA helicase DDX42-like isoform X1 [Apis 
mellifera]
Length=772

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K GTAYTL+T+K+  FAG LV +L  A Q VP  LMDLAM+   F
Sbjct  583  DTHTHRIGRTGRAGEK-GTAYTLVTEKDKEFAGHLVRNLEGANQEVPKSLMDLAMQSAWF  641



>gb|ETE73951.1| ATP-dependent RNA helicase DDX42, partial [Ophiophagus hannah]
Length=976

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 87/162 (54%), Gaps = 33/162 (20%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+TQK++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  627  DTHTHRIGRTGRAGEK-GVAYTLLTQKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  685

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYS------AESSNAPTTTV-------  438
            R  R     G K   G             G G+GY       +E+ +    +V       
Sbjct  686  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENVDRGNNSVMVNYEAY  732

Query  437  -PSRSAA---VNSLRTGMMAQFKSNFVAASSNLQNQALGNSS  324
             PS  A    +++++    +Q+KS+FVAAS    NQ  G+SS
Sbjct  733  KPSSGAMGDRLSAMKAAFQSQYKSHFVAAS--FSNQKTGSSS  772



>dbj|BAB25270.3| unnamed protein product [Mus musculus]
Length=427

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 81/163 (50%), Gaps = 34/163 (21%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  78   DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  136

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S       V S   A
Sbjct  137  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNNVMSNYEA  183

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSS  324
                       + +++    +Q+KS+FVAAS  L NQ  G SS
Sbjct  184  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LSNQKAGTSS  224



>ref|XP_010153672.1| PREDICTED: ATP-dependent RNA helicase DDX42-like, partial [Eurypyga 
helias]
Length=376

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  21   DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  79

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  80   RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  126

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  127  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  173

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  174  TSAGSLNSVPTSSAQQNAANPDSP  197



>ref|XP_011183991.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Bactrocera cucurbitae]
Length=785

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K GTAYTL+T K+  FAG LV +L  A Q VP +LM+LAMK   F
Sbjct  597  DTHTHRIGRTGRAGEK-GTAYTLVTDKDKEFAGHLVRNLEGADQQVPDDLMELAMKSSWF  655



>ref|XP_011212733.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Bactrocera dorsalis]
Length=786

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K GTAYTL+T K+  FAG LV +L  A Q VP +LM+LAMK   F
Sbjct  597  DTHTHRIGRTGRAGEK-GTAYTLVTDKDKEFAGHLVRNLEGADQQVPDDLMELAMKSSWF  655



>ref|XP_005439531.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Falco cherrug]
Length=931

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A S   P
Sbjct  733  TSAGSLNSVPTSSAQQNAASPDSP  756



>ref|XP_004526774.1| PREDICTED: ATP-dependent RNA helicase DDX42-like isoform X1 [Ceratitis 
capitata]
Length=780

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K GTAYTL+T K+  FAG LV +L  A Q VP +LM+LAMK   F
Sbjct  596  DTHTHRIGRTGRAGEK-GTAYTLVTDKDKEFAGHLVRNLEGADQQVPDDLMELAMKSSWF  654



>ref|XP_004526775.1| PREDICTED: ATP-dependent RNA helicase DDX42-like isoform X2 [Ceratitis 
capitata]
Length=769

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K GTAYTL+T K+  FAG LV +L  A Q VP +LM+LAMK   F
Sbjct  585  DTHTHRIGRTGRAGEK-GTAYTLVTDKDKEFAGHLVRNLEGADQQVPDDLMELAMKSSWF  643



>ref|XP_011141579.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Harpegnathos saltator]
 ref|XP_011141580.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Harpegnathos saltator]
 gb|EFN83169.1| ATP-dependent RNA helicase DDX42 [Harpegnathos saltator]
Length=770

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K GTAYTL+T+K+  F+G LV +L  A Q VP  LMDLAM+   F
Sbjct  581  DTHTHRIGRTGRAGEK-GTAYTLVTEKDKEFSGHLVRNLEGANQEVPKSLMDLAMQSAWF  639



>ref|XP_011155541.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Solenopsis invicta]
Length=768

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K GTA+TL+T+K+  FAG LV +L  A Q VP  LMDLAM+   F
Sbjct  582  DTHTHRIGRTGRAGEK-GTAFTLVTEKDKEFAGHLVRNLEGANQEVPKSLMDLAMQSAWF  640



>ref|XP_011333820.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Cerapachys biroi]
 gb|EZA57506.1| ATP-dependent RNA helicase DDX42 [Cerapachys biroi]
Length=769

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K GTAYTL+T+K+  FAG LV +L  A Q VP  L+DLAM+   F
Sbjct  581  DTHTHRIGRTGRAGEK-GTAYTLVTEKDKEFAGHLVRNLEGANQEVPKSLIDLAMQSAWF  639



>ref|XP_001603249.2| PREDICTED: ATP-dependent RNA helicase DDX42 [Nasonia vitripennis]
Length=793

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K GTAYTL+T+K+  FAG LV +L  A Q VP  LMDLA++   F
Sbjct  583  DTHTHRIGRTGRAGEK-GTAYTLVTEKDKEFAGHLVRNLEGANQEVPKSLMDLALQSNWF  641



>gb|EFZ20748.1| hypothetical protein SINV_08125 [Solenopsis invicta]
Length=764

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K GTA+TL+T+K+  FAG LV +L  A Q VP  LMDLAM+   F
Sbjct  582  DTHTHRIGRTGRAGEK-GTAFTLVTEKDKEFAGHLVRNLEGANQEVPKSLMDLAMQSAWF  640



>ref|XP_011406654.1| PREDICTED: ATP-dependent RNA helicase DDX42-like [Amphimedon 
queenslandica]
Length=580

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D HVHRIGR GRAG K GTAYTL+  K+   AG+LV +L TA Q VP EL+ LAM++ RF
Sbjct  417  DTHVHRIGRTGRAGTK-GTAYTLVLPKDVNLAGDLVRNLETADQVVPEELLSLAMQNARF  475



>ref|XP_007562270.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Poecilia formosa]
Length=907

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K+  FAG+LV +L  A Q VP ELMDLAM++  F
Sbjct  578  DTHTHRIGRTGRAGEK-GVAYTLLTSKDTSFAGDLVRNLEGANQAVPKELMDLAMQNPWF  636



>ref|XP_008414524.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Poecilia reticulata]
Length=901

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K+  FAG+LV +L  A Q VP ELMDLAM++  F
Sbjct  578  DTHTHRIGRTGRAGEK-GVAYTLLTSKDTSFAGDLVRNLEGANQAVPKELMDLAMQNPWF  636



>gb|KDR08431.1| hypothetical protein L798_01778 [Zootermopsis nevadensis]
Length=733

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K GTAYTL+T K+  FAG LV +L  A Q+VP  L+DLAM+   F
Sbjct  572  DTHTHRIGRTGRAGEK-GTAYTLVTDKDKEFAGHLVRNLEGANQDVPQSLLDLAMQSAWF  630



>ref|XP_009462900.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Nipponia nippon]
Length=954

 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 96/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  579  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  637

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S +    +V S   A
Sbjct  638  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDHGNNNSVMSNYEA  684

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  685  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  731

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  732  TSAGSLNSVPTSSAQQNAANPDSP  755



>ref|XP_005796709.1| PREDICTED: ATP-dependent RNA helicase DDX42-like [Xiphophorus 
maculatus]
Length=899

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K+  FAG+LV +L  A Q VP ELMDLAM++  F
Sbjct  576  DTHTHRIGRTGRAGEK-GVAYTLLTSKDTSFAGDLVRNLEGANQAVPKELMDLAMQNPWF  634



>ref|XP_011053634.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Acromyrmex echinatior]
 gb|EGI65860.1| ATP-dependent RNA helicase DDX42 [Acromyrmex echinatior]
Length=752

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K GTAYTL+T+K+  FAG LV +L  A Q VP  L+DLAM+   F
Sbjct  566  DTHTHRIGRTGRAGEK-GTAYTLVTEKDKEFAGHLVRNLEGANQEVPKSLIDLAMQSSWF  624



>ref|XP_006616469.1| PREDICTED: ATP-dependent RNA helicase DDX42-like [Apis dorsata]
Length=772

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K GTAYTL+T+K+  F G LV +L  A Q VP  LMDLAM+   F
Sbjct  583  DTHTHRIGRTGRAGEK-GTAYTLVTEKDKEFTGHLVRNLEGANQEVPKSLMDLAMQSAWF  641



>ref|XP_010131293.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Buceros rhinoceros 
silvestris]
Length=910

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 99/194 (51%), Gaps = 25/194 (13%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTT-----VPSRSAA--  420
            R  R     G K   G GG G   R    GLG   S  S+N    +      PS  A   
Sbjct  639  RKSRFKGGKGKKLNIGGGGLGYRERP---GLGSENSDRSNNNSVMSNYEAYKPSSGAMGD  695

Query  419  -VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASR  243
             + +++    +Q+KS+FVAAS  L NQ  G+S+              SG T  G  N+  
Sbjct  696  RLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGWTSAGSLNSVP  742

Query  242  TSSISNAATSVQKP  201
            TSS    A +   P
Sbjct  743  TSSAQQNAANPDNP  756



>ref|XP_010220070.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent RNA helicase DDX42 
[Tinamus guttatus]
Length=945

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 96/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S     ++V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSESSDRGNNSSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSSGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  733  TSAGSLNSVPTSSAQQNAANADGP  756



>gb|EGT53299.1| hypothetical protein CAEBREN_28318 [Caenorhabditis brenneri]
Length=831

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D HVHRIGR GRAG K GTAYTL+T+K+    G LV +L +  Q VP +LMDLAMK   F
Sbjct  603  DTHVHRIGRTGRAGHK-GTAYTLVTEKDIEMVGHLVKNLESVSQEVPNQLMDLAMKSSWF  661



>ref|XP_009094836.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Serinus canaria]
Length=943

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 96/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAE----SSNAP-----------TT  444
            R  R     G K   G             G G+GY       S NA              
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENADRGNNNSVMSNYEA  685

Query  443  TVPSRSAA---VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
              PS  A    + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A + + P
Sbjct  733  TSAGSLNSVPTSSAQQNAANPESP  756



>gb|KFM68309.1| ATP-dependent RNA helicase DDX42, partial [Stegodyphus mimosarum]
Length=359

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T+K+  FAG LV +L  A Q VP  LMDLAM+   F
Sbjct  194  DTHTHRIGRTGRAGEK-GIAYTLVTEKDKEFAGHLVRNLEGANQAVPQALMDLAMQSAWF  252



>ref|XP_011309575.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Fopius arisanus]
Length=775

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HR+GR GRAG+K GTAYTL+T+K+  F+G LV +L  A Q VP  LMDLAM+   F
Sbjct  584  DTHTHRVGRTGRAGEK-GTAYTLVTEKDKEFSGHLVRNLEGANQEVPKSLMDLAMQSSWF  642



>ref|XP_010118012.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Chlamydotis macqueenii]
Length=933

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  733  TSAGSLNSVPTSSAQQNAANPDSP  756



>ref|XP_009484257.1| PREDICTED: ATP-dependent RNA helicase DDX42, partial [Pelecanus 
crispus]
Length=802

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  423  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  481

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  482  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGSNNSVMSNYEA  528

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  529  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  575

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  576  TSAGSLNSVPTSSAQQNAANPDSP  599



>ref|XP_009700459.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Cariama cristata]
Length=927

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  733  TSAGSLNSVPTSSAQQNAANPDSP  756



>ref|XP_005513666.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent RNA helicase DDX42 
[Columba livia]
Length=948

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  571  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  629

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  630  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  676

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  677  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  723

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  724  TSAGSLNSVPTSSAQQNAANPDSP  747



>ref|XP_010291871.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Phaethon lepturus]
Length=933

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  733  TSAGSLNSVPTSSAQQNAANPDSP  756



>ref|XP_009815142.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Gavia stellata]
Length=925

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  733  TSAGSLNSVPTSSAQQNAANPDSP  756



>ref|XP_009500504.1| PREDICTED: ATP-dependent RNA helicase DDX42, partial [Phalacrocorax 
carbo]
Length=645

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  298  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  356

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  357  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  403

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  404  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  450

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  451  TSAGSLNSVPTSSAQQNAANPDSP  474



>ref|XP_009318712.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Pygoscelis adeliae]
Length=937

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  733  TSAGSLNSVPTSSAQQNAANPDSP  756



>ref|XP_008557882.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Microplitis demolitor]
Length=774

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K GTAYTL+++K+  FAG LV +L  A Q VP  LMDLAM+   F
Sbjct  588  DTHTHRIGRTGRAGEK-GTAYTLVSEKDKEFAGHLVRNLEGADQEVPKCLMDLAMQSSWF  646



>ref|XP_009929118.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X1 [Haliaeetus 
albicilla]
 ref|XP_010559696.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X1 [Haliaeetus 
leucocephalus]
Length=950

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  733  TSAGSLNSVPTSSAQQNAANPDSP  756



>ref|XP_009943052.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent RNA helicase DDX42 
[Opisthocomus hoazin]
Length=913

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSSGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  733  TSAGSLNSVPTSSAQQNAANSDSP  756



>ref|XP_009286175.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent RNA helicase DDX42 
[Aptenodytes forsteri]
Length=932

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  733  TSAGSLNSVPTSSAQQNAANPDSP  756



>ref|XP_005070291.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Mesocricetus auratus]
Length=811

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 92/204 (45%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  462  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  520

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S       V S   A
Sbjct  521  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNNVMSNYEA  567

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G SS              SG 
Sbjct  568  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LSNQKTGTSSAG-----------ASGW  614

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  T+S      S   P
Sbjct  615  TSAGSLNSVPTNSTQQGHNSPDSP  638



>ref|XP_009974055.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Tyto alba]
Length=917

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  733  TSAGSLNSVPTSSAQQNAANPDSP  756



>ref|XP_009576804.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Fulmarus glacialis]
Length=925

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  733  TSAGSLNSVPTSSAQQNAANPDSP  756



>ref|NP_001026097.1| ATP-dependent RNA helicase DDX42 [Gallus gallus]
 sp|Q5F485.1|DDX42_CHICK RecName: Full=ATP-dependent RNA helicase DDX42; AltName: Full=DEAD 
box protein 42 [Gallus gallus]
 emb|CAH65049.1| hypothetical protein RCJMB04_2e15 [Gallus gallus]
Length=944

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKPNIG-------------GGGLGYRERPGLGSESSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSSGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  733  TSAGSLNSVPTSSAQQNAANPDSP  756



>ref|XP_009882142.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Charadrius vociferus]
Length=927

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  733  TSAGSLNSVPTSSAQQNAANPDSP  756



>ref|XP_003213086.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Meleagris gallopavo]
Length=944

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSESSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSSGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  733  TSAGSLNSVPTSSAQQNAANPDSP  756



>ref|XP_010307118.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Balearica regulorum 
gibbericeps]
Length=909

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  733  TSAGSLNSVPTSSAQQNAANPDSP  756



>ref|XP_009929120.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X2 [Haliaeetus 
albicilla]
 ref|XP_009929121.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X2 [Haliaeetus 
albicilla]
 ref|XP_010559697.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X2 [Haliaeetus 
leucocephalus]
Length=787

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  417  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  475

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  476  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  522

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  523  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  569

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  570  TSAGSLNSVPTSSAQQNAANPDSP  593



>ref|XP_005235891.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent RNA helicase DDX42 
[Falco peregrinus]
Length=951

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  733  TSAGSLNSVPTSSAQQNAANPDSP  756



>gb|AAH43036.4| DEAD (Asp-Glu-Ala-Asp) box polypeptide 42 [Mus musculus]
Length=810

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 81/163 (50%), Gaps = 34/163 (21%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  461  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  519

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S       V S   A
Sbjct  520  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNNVMSNYEA  566

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSS  324
                       + +++    +Q+KS+FVAAS  L NQ  G SS
Sbjct  567  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LSNQKAGTSS  607



>emb|CAB43268.1| hypothetical protein [Homo sapiens]
Length=365

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  7    DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  65



>dbj|BAC33675.1| unnamed protein product [Mus musculus]
Length=810

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 81/163 (50%), Gaps = 34/163 (21%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  461  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  519

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S       V S   A
Sbjct  520  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNNVMSNYEA  566

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSS  324
                       + +++    +Q+KS+FVAAS  L NQ  G SS
Sbjct  567  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LSNQKAGTSS  607



>ref|NP_497743.1| Protein C46F11.4 [Caenorhabditis elegans]
 emb|CAB03765.1| C46F11.4 [Caenorhabditis elegans]
Length=811

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D HVHRIGR GRAG K GTAYTL+T+K+    G LV +L +  Q VP  LMDLAMK   F
Sbjct  592  DTHVHRIGRTGRAGHK-GTAYTLVTEKDIEMVGHLVKNLESVSQEVPKPLMDLAMKSSWF  650



>gb|ERE69243.1| ATP-dependent RNA helicase DDX42 [Cricetulus griseus]
Length=799

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 81/163 (50%), Gaps = 34/163 (21%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  450  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  508

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S       V S   A
Sbjct  509  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNNVMSNYEA  555

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSS  324
                       + +++    +Q+KS+FVAAS  L NQ  G SS
Sbjct  556  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LSNQKAGTSS  596



>ref|XP_009908841.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Picoides pubescens]
Length=820

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 71/193 (37%), Positives = 92/193 (48%), Gaps = 45/193 (23%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+SS              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSSAG-----------ASGW  732

Query  272  TIGGDTNASRTSS  234
            T  G  N+  TSS
Sbjct  733  TSAGSLNSVPTSS  745



>ref|NP_082350.3| ATP-dependent RNA helicase DDX42 [Mus musculus]
 ref|XP_006534344.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X1 [Mus musculus]
 sp|Q810A7.3|DDX42_MOUSE RecName: Full=ATP-dependent RNA helicase DDX42; AltName: Full=DEAD 
box protein 42 [Mus musculus]
 dbj|BAE41388.1| unnamed protein product [Mus musculus]
Length=929

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 92/204 (45%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S       V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNNVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G SS              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LSNQKAGTSSAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  T+S      S   P
Sbjct  733  TSAGSLNSVPTNSAQQGHNSPDNP  756



>gb|EDL34279.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 42, isoform CRA_a [Mus 
musculus]
Length=927

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 92/204 (45%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  578  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  636

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S       V S   A
Sbjct  637  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNNVMSNYEA  683

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G SS              SG 
Sbjct  684  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LSNQKAGTSSAG-----------ASGW  730

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  T+S      S   P
Sbjct  731  TSAGSLNSVPTNSAQQGHNSPDNP  754



>ref|XP_006125806.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Pelodiscus sinensis]
Length=945

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 96/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GIAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAE------------SSNAPTTTV-  438
            R  R     G K   G             G G+GY               SSN  +    
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSDGSDRGNSSNVMSNYEA  685

Query  437  --PSRSAA---VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
              PS  A    + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  T+S    A S   P
Sbjct  733  TSAGSLNSVPTNSAQQNAASPDSP  756



>ref|XP_001943796.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Acyrthosiphon pisum]
 ref|XP_008187382.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Acyrthosiphon pisum]
Length=737

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K GTA+TL+T K+  FAG LV SL   GQ VP  L+DLAM+   F
Sbjct  568  DTHTHRIGRTGRAGEK-GTAFTLVTPKDHEFAGHLVRSLEGVGQEVPKPLIDLAMQSSWF  626



>ref|XP_003501916.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X1 [Cricetulus 
griseus]
 ref|XP_007628942.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X2 [Cricetulus 
griseus]
 gb|EGV99174.1| ATP-dependent RNA helicase DDX42 [Cricetulus griseus]
Length=928

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 81/163 (50%), Gaps = 34/163 (21%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  579  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  637

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S       V S   A
Sbjct  638  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNNVMSNYEA  684

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSS  324
                       + +++    +Q+KS+FVAAS  L NQ  G SS
Sbjct  685  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LSNQKAGTSS  725



>ref|XP_010208580.1| PREDICTED: ATP-dependent RNA helicase DDX42-like, partial [Colius 
striatus]
Length=205

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  114  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  172



>ref|XP_010178876.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X2 [Mesitornis 
unicolor]
Length=927

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 94/204 (46%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A     P
Sbjct  733  TSAGSLNSVPTSSAQQNAAHPDSP  756



>ref|XP_008636714.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Corvus brachyrhynchos]
Length=872

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 96/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  +      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENTDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A + + P
Sbjct  733  TSAGSLNSVPTSSAQQNAANPESP  756



>ref|XP_009068482.1| PREDICTED: ATP-dependent RNA helicase DDX42, partial [Acanthisitta 
chloris]
Length=756

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  423  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  481

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  482  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  528

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  529  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  575

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  576  TSAGSLNSVPTSSAQQNAANSNSP  599



>dbj|BAE42635.1| unnamed protein product [Mus musculus]
Length=929

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 92/204 (45%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S       V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNNVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G SS              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LSNQKAGTSSAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  T+S      S   P
Sbjct  733  TSAGSLNSVPTNSAQQGHNSPDNP  756



>ref|XP_010178875.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X1 [Mesitornis 
unicolor]
Length=941

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 94/204 (46%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A     P
Sbjct  733  TSAGSLNSVPTSSAQQNAAHPDSP  756



>ref|XP_009944313.1| PREDICTED: ATP-dependent RNA helicase DDX42, partial [Leptosomus 
discolor]
Length=797

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  733  TSAGSLNSVPTSSAQQNAANPDSP  756



>ref|XP_005059918.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Ficedula albicollis]
Length=1270

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 96/205 (47%), Gaps = 45/205 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  +      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENTDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKPR  198
            T  G  N+  TSS    +   + P+
Sbjct  733  TSAGSLNSVPTSSAQQNSAGAESPK  757



>ref|XP_010082319.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent RNA helicase DDX42 
[Pterocles gutturalis]
Length=926

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  733  TSAGSLNSVPTSSAQQNAANPDGP  756



>gb|EDL34280.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 42, isoform CRA_b [Mus 
musculus]
Length=1012

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 81/163 (50%), Gaps = 34/163 (21%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  663  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  721

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S       V S   A
Sbjct  722  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNNVMSNYEA  768

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSS  324
                       + +++    +Q+KS+FVAAS  L NQ  G SS
Sbjct  769  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LSNQKAGTSS  809



>ref|XP_009553734.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Cuculus canorus]
Length=1004

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 94/204 (46%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S       V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNNVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  733  TSAGSLNSVPTSSAQQNAANSDSP  756



>dbj|BAG50996.1| unnamed protein product [Homo sapiens]
Length=407

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  49   DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  107



>dbj|BAG53696.1| unnamed protein product [Homo sapiens]
Length=484

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  126  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  184



>ref|XP_010412362.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent RNA helicase DDX42 
[Corvus cornix cornix]
Length=825

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 96/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  +      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENTDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A + + P
Sbjct  733  TSAGSLNSVPTSSAQQNAANPESP  756



>ref|XP_003381401.1| ATP-dependent RNA helicase DDX42 [Trichinella spiralis]
 gb|EFV62545.1| ATP-dependent RNA helicase DDX42 [Trichinella spiralis]
Length=741

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D HVHRIGR GRAG+K G AYTL+T K+  FAG LV SL +  Q VP  L++LAM+   F
Sbjct  530  DTHVHRIGRTGRAGEK-GFAYTLVTDKDKEFAGHLVKSLESVNQEVPTALLNLAMQSAWF  588



>ref|XP_005141681.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Melopsittacus undulatus]
Length=934

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS      + + P
Sbjct  733  TSAGSLNSVPTSSAQQNTANPETP  756



>ref|NP_001100529.1| ATP-dependent RNA helicase DDX42 [Rattus norvegicus]
 ref|XP_006247658.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X1 [Rattus 
norvegicus]
 ref|XP_006247659.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X1 [Rattus 
norvegicus]
 gb|EDM06369.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 42 (predicted) [Rattus 
norvegicus]
Length=929

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 92/204 (45%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S       V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGSNNNVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LSNQKAGTSTAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  T+S      S   P
Sbjct  733  TSAGSLNSVPTNSAQQGHNSPDNP  756



>ref|XP_306246.4| Anopheles gambiae str. PEST AGAP012523-PA [Anopheles gambiae 
str. PEST]
 gb|EAA02455.4| AGAP012523-PA [Anopheles gambiae str. PEST]
Length=720

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K GTAYTLIT K+  F+G LV +L  A Q+VP +LM LAM+   F
Sbjct  530  DTHTHRIGRTGRAGEK-GTAYTLITDKDKEFSGHLVRNLEGANQDVPEDLMKLAMQSSWF  588



>ref|XP_006017900.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent RNA helicase DDX42 
[Alligator sinensis]
Length=980

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 96/211 (45%), Gaps = 63/211 (30%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  595  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  653

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S     + V S   A
Sbjct  654  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNSNVMSNYEA  700

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNS------------------  327
                       +++++    +Q+KS+F+AAS  L NQ  G+S                  
Sbjct  701  YKPSTGAMGDRLSAMKAAFQSQYKSHFIAAS--LNNQKSGSSTAGASGWTSAGSLNSVPT  758

Query  326  -----SGMNPNKKMA------LPGFVSGGTI  267
                 S  NP  ++A      +PGF S G +
Sbjct  759  SSAQQSAANPESQLATAAAKGIPGFTSAGNL  789



>ref|XP_010006331.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Chaetura pelagica]
Length=944

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 93/204 (46%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S       V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNNVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSSGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS     T    P
Sbjct  733  TSAGSLNSVPTSSAQQNVTGPDGP  756



>ref|XP_005994677.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X4 [Latimeria 
chalumnae]
Length=736

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 82/153 (54%), Gaps = 31/153 (20%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T KE  FAG+LV +L  A Q V  ELMDLAM++  F
Sbjct  417  DTHTHRIGRTGRAGEK-GVAYTLLTSKENMFAGDLVRNLEGANQYVSKELMDLAMQNPWF  475

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYS------AESSNAPTTTVPSRSAA-  420
            R  R     G K   G             G G+GY       +++S+   +TV S   A 
Sbjct  476  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSDTSDRTNSTVMSNYEAY  522

Query  419  ----------VNSLRTGMMAQFKSNFVAASSNL  351
                      +++++    +Q+K++F+AASS++
Sbjct  523  KPSTGAMGDRLSAMKAAFQSQYKNHFIAASSSV  555



>ref|XP_002193200.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Taeniopygia guttata]
Length=923

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 68/201 (34%), Positives = 97/201 (48%), Gaps = 41/201 (20%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  +      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENTDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+           G+ S G
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAA-------GASGWTSAG  736

Query  272  TIGGDTNASRTSSISNAATSV  210
            ++     +S   + +N  +SV
Sbjct  737  SLNSVPTSSAQQNAANPESSV  757



>ref|XP_005994674.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X1 [Latimeria 
chalumnae]
 ref|XP_005994675.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X2 [Latimeria 
chalumnae]
Length=898

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 82/153 (54%), Gaps = 31/153 (20%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T KE  FAG+LV +L  A Q V  ELMDLAM++  F
Sbjct  579  DTHTHRIGRTGRAGEK-GVAYTLLTSKENMFAGDLVRNLEGANQYVSKELMDLAMQNPWF  637

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYS------AESSNAPTTTVPSRSAA-  420
            R  R     G K   G             G G+GY       +++S+   +TV S   A 
Sbjct  638  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSDTSDRTNSTVMSNYEAY  684

Query  419  ----------VNSLRTGMMAQFKSNFVAASSNL  351
                      +++++    +Q+K++F+AASS++
Sbjct  685  KPSTGAMGDRLSAMKAAFQSQYKNHFIAASSSV  717



>ref|XP_009637948.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Egretta garzetta]
Length=927

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 92/193 (48%), Gaps = 45/193 (23%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSS  234
            T  G  N+  TSS
Sbjct  733  TSAGSLNSVPTSS  745



>ref|XP_009674257.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Struthio camelus 
australis]
Length=953

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 71/194 (37%), Positives = 98/194 (51%), Gaps = 28/194 (14%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM+    
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQ----  634

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTT-----VPSRSAA--  420
               + ++  GGK  K   G G        GLG   S   +N+   +      PS  A   
Sbjct  635  --VQKSKFKGGKGKKLNIGGGGLGYRERPGLGSESSDRGNNSSVMSNYEAYKPSTGAMGD  692

Query  419  -VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASR  243
             + +++    +Q+KS+FVAAS  L NQ  G+S+              SG T  G  N+  
Sbjct  693  RLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGWTSAGSLNSVP  739

Query  242  TSSISNAATSVQKP  201
            TSS   +A +   P
Sbjct  740  TSSAQQSAVNPDSP  753



>ref|XP_002008043.1| GI12051 [Drosophila mojavensis]
 gb|EDW18519.1| GI12051 [Drosophila mojavensis]
Length=797

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K+  FAG LV +L  A Q VP +LM+LAMK   F
Sbjct  602  DTHTHRIGRTGRAGEK-GNAYTLVTDKDKEFAGHLVRNLEGADQTVPDDLMELAMKSSWF  660



>ref|XP_005994676.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X3 [Latimeria 
chalumnae]
Length=749

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 82/153 (54%), Gaps = 31/153 (20%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T KE  FAG+LV +L  A Q V  ELMDLAM++  F
Sbjct  430  DTHTHRIGRTGRAGEK-GVAYTLLTSKENMFAGDLVRNLEGANQYVSKELMDLAMQNPWF  488

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYS------AESSNAPTTTVPSRSAA-  420
            R  R     G K   G             G G+GY       +++S+   +TV S   A 
Sbjct  489  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSDTSDRTNSTVMSNYEAY  535

Query  419  ----------VNSLRTGMMAQFKSNFVAASSNL  351
                      +++++    +Q+K++F+AASS++
Sbjct  536  KPSTGAMGDRLSAMKAAFQSQYKNHFIAASSSV  568



>ref|XP_001985416.1| GH17046 [Drosophila grimshawi]
 gb|EDV97764.1| GH17046 [Drosophila grimshawi]
Length=811

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 76/161 (47%), Gaps = 34/161 (21%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K+  FAG LV +L  A Q VP +LM+LAMK   F
Sbjct  619  DTHTHRIGRTGRAGEK-GNAYTLVTDKDKEFAGHLVRNLEGADQAVPDDLMELAMKSSWF  677

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTV----PSRSAA---  420
            RS R  +  G K                  +G+GY  +S NA T T     P +  A   
Sbjct  678  RSSRFKQGKGRKPLNNF-------------MGLGYREQSGNAATGTTTGSAPGKGPASET  724

Query  419  -------------VNSLRTGMMAQFKSNFVAASSNLQNQAL  336
                          +++R    +Q+ S F A+S     Q +
Sbjct  725  SRSLSGAGPATDRYSAMRQAFRSQYNSQFRASSDRTWEQTV  765



>ref|XP_004597309.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Ochotona princeps]
Length=937

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 82/163 (50%), Gaps = 34/163 (21%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S       V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNNVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSS  324
                       + +++    +Q+KS+FVAAS  L NQ  G+S+
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LSNQKAGSST  726



>ref|XP_001696911.1| hypothetical protein CHLREDRAFT_176229 [Chlamydomonas reinhardtii]
 gb|EDP00603.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=435

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMK  591
            D H+HR+GR GRAGDK+G A +L+T  +ARFA +L+ SL  AGQ VP  L +LAM+
Sbjct  334  DTHIHRVGRTGRAGDKEGRAISLLTPGDARFAAQLLQSLTAAGQEVPPALAELAMR  389



>ref|XP_010167373.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Caprimulgus carolinensis]
Length=947

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 92/193 (48%), Gaps = 45/193 (23%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSS  234
            T  G  N+  TSS
Sbjct  733  TSAGSLNSVPTSS  745



>ref|XP_010775224.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Notothenia coriiceps]
Length=936

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 96/202 (48%), Gaps = 52/202 (26%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K+  FAG+LV +L  A Q V  ELMDLAM++  F
Sbjct  600  DTHTHRIGRTGRAGEK-GVAYTLLTNKDTTFAGDLVRNLEGANQAVSKELMDLAMQNPWF  658

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY---------SAE-----SSNAPTTT  441
            R  R     G K   G             G G+GY         S+E     SS+  + +
Sbjct  659  RKSRFKSGKGKKLNIG-------------GGGLGYRERPGLGAESSERKMLCSSSFESYS  705

Query  440  VPSRSAA---VNSLRTGMMAQFKSNFVAAS------SNLQNQALG---------------  333
             P+  A    + ++++   +Q+KS+FVAAS      S   N   G               
Sbjct  706  KPATGAMGDRMTAMKSAFQSQYKSHFVAASSGPPKLSTKSNSTSGWTSAGSLSSVPTESA  765

Query  332  NSSGMNPNKKMALPGFVSGGTI  267
            N S  +    M++PGF S G++
Sbjct  766  NGSEWSQGAAMSMPGFTSAGSL  787



>ref|XP_005029343.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X1 [Anas 
platyrhynchos]
Length=942

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSESSDRGNNNSVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSSGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    + +   P
Sbjct  733  TSAGSLNSVPTSSAQQNSANPDSP  756



>ref|XP_005029345.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X3 [Anas 
platyrhynchos]
Length=779

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 83/163 (51%), Gaps = 34/163 (21%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  417  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  475

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  476  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSESSDRGNNNSVMSNYEA  522

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSS  324
                       + +++    +Q+KS+FVAAS  L NQ  G+S+
Sbjct  523  YKPSSGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSA  563



>gb|ETN66901.1| DEAD box ATP-dependent RNA helicase [Anopheles darlingi]
Length=798

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K GTAYTLIT K+  F+G LV +L  A Q VP EL+ LAM+   F
Sbjct  601  DTHTHRIGRTGRAGEK-GTAYTLITDKDKEFSGHLVRNLEGANQEVPEELLKLAMQSSWF  659



>gb|EOA94497.1| ATP-dependent RNA helicase DDX42, partial [Anas platyrhynchos]
Length=940

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 95/204 (47%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  578  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  636

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  637  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSESSDRGNNNSVMSNYEA  683

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  684  YKPSSGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSAAG-----------ASGW  730

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    + +   P
Sbjct  731  TSAGSLNSVPTSSAQQNSANPDSP  754



>ref|NP_001080569.1| ATP-dependent RNA helicase DDX42 [Xenopus laevis]
 sp|Q7ZY47.1|DDX42_XENLA RecName: Full=ATP-dependent RNA helicase DDX42; AltName: Full=DEAD 
box protein 42 [Xenopus laevis]
 gb|AAH43977.1| Ddx42-prov protein [Xenopus laevis]
Length=947

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 82/156 (53%), Gaps = 32/156 (21%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T KE+ FAG+LV +L  A Q V  EL+DLAM++  F
Sbjct  577  DTHTHRIGRTGRAGEK-GVAYTLLTSKESNFAGDLVRNLEGANQYVSKELLDLAMQNSWF  635

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYS------AESSNAPT---------T  444
            R  R     G K   G             G G+GY       AESS   T          
Sbjct  636  RKSRFKAGKGKKLNIG-------------GGGLGYRERPGLGAESSEHGTGGNVMSNYEA  682

Query  443  TVPSRSAA---VNSLRTGMMAQFKSNFVAASSNLQN  345
              PS  A    ++++++   +Q+K++FVAAS++ Q 
Sbjct  683  FKPSGGAMGDRLSAMKSAFQSQYKNHFVAASASTQK  718



>ref|XP_005002031.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent RNA helicase DDX42 
[Cavia porcellus]
Length=933

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 93/204 (46%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTT--------------  441
            R  R     G K   G             G G+GY          T              
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENTDRGNNNNVMSNYEA  685

Query  440  -VPSRSAA---VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
              PS  A    + +++    +Q+KS+FVAAS  L NQ  G SS   P          SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LSNQKAG-SSAAGP----------SGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  T+S     +S   P
Sbjct  733  TSAGSLNSVPTNSAQQGHSSPDSP  756



>ref|XP_002047225.1| GJ13322 [Drosophila virilis]
 gb|EDW69567.1| GJ13322 [Drosophila virilis]
Length=797

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K+  FAG LV +L  A Q VP +LM+LAMK   F
Sbjct  606  DTHTHRIGRTGRAGEK-GNAYTLVTDKDKEFAGHLVRNLEGADQTVPDDLMELAMKSSWF  664



>ref|XP_008504049.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Calypte anna]
Length=946

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 94/204 (46%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S       V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNNVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+S+              SG 
Sbjct  686  YKPSSGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSATG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS     T+   P
Sbjct  733  TSAGSLNSVPTSSAQQNPTNPDGP  756



>ref|XP_002410726.1| ATP-dependent RNA helicase, putative [Ixodes scapularis]
 gb|EEC04596.1| ATP-dependent RNA helicase, putative, partial [Ixodes scapularis]
Length=658

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMK  591
            D H HR+GR GRAG+K G AYTLIT KE  FAG LV +L  A Q VP  LMDLAM+
Sbjct  511  DTHTHRVGRTGRAGEK-GVAYTLITDKEKEFAGHLVRNLEGANQGVPQSLMDLAMQ  565



>ref|XP_005029344.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X2 [Anas 
platyrhynchos]
Length=814

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 83/163 (51%), Gaps = 34/163 (21%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  452  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  510

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S      +V S   A
Sbjct  511  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSESSDRGNNNSVMSNYEA  557

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSS  324
                       + +++    +Q+KS+FVAAS  L NQ  G+S+
Sbjct  558  YKPSSGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSSA  598



>ref|XP_003113047.1| hypothetical protein CRE_25460 [Caenorhabditis remanei]
 gb|EFP09301.1| hypothetical protein CRE_25460 [Caenorhabditis remanei]
Length=852

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D HVHRIGR GRAG K GTAYTL+T+K+    G LV +L +  Q VP  L+DLAMK   F
Sbjct  609  DTHVHRIGRTGRAGHK-GTAYTLVTEKDIEMVGHLVKNLESVSQEVPKPLLDLAMKCAWF  667



>ref|XP_001653010.1| AAEL001317-PA [Aedes aegypti]
 gb|EAT47577.1| AAEL001317-PA [Aedes aegypti]
Length=799

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HR+GR GRAG+K GTAYTL+  K+  FAG LV +L  A Q VP ELM LAM+   F
Sbjct  606  DTHTHRVGRTGRAGEK-GTAYTLVVDKDKEFAGHLVRNLEGANQEVPEELMKLAMQSAWF  664



>ref|XP_004630218.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Octodon degus]
Length=906

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 92/204 (45%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  551  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  609

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTT--------------  441
            R  R     G K   G             G G+GY          T              
Sbjct  610  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENTDRGNNNNVMSNYEA  656

Query  440  -VPSRSAA---VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
              PS  A    + +++    +Q+KS+FVAAS  L NQ  G SS   P          SG 
Sbjct  657  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LSNQKAG-SSAAGP----------SGW  703

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  T+S      S   P
Sbjct  704  TSAGSLNSVPTNSAQQGHNSPDSP  727



>ref|XP_009987983.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent RNA helicase DDX42 
[Tauraco erythrolophus]
Length=945

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 94/204 (46%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNPWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGY-------SAESSNAPTTTVPSRSAA  420
            R  R     G K   G             G G+GY       S  S       V S   A
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENSDRGNNNNVMSNYEA  685

Query  419  -----------VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
                       + +++    +Q+KS+FVAAS  L NQ  G+++              SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LNNQKTGSAAAG-----------ASGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  TSS    A +   P
Sbjct  733  TSAGSLNSVPTSSAQQNAANPDSP  756



>ref|XP_004868683.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Heterocephalus glaber]
Length=934

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 92/204 (45%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTT--------------  441
            R  R     G K   G             G G+GY          T              
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENTDRGNNNNVMSNYEA  685

Query  440  -VPSRSAA---VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
              PS  A    + +++    +Q+KS+FVAAS  L NQ  G SS   P          SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LSNQKAG-SSAAGP----------SGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  T+S      S   P
Sbjct  733  TSAGSLNSVPTNSAQQGHNSPDSP  756



>ref|XP_002121386.1| PREDICTED: ATP-dependent RNA helicase DDX42-like [Ciona intestinalis]
Length=727

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG K GTAYTL+T K+  F+G+LV +L  AGQ VP +L+ LA+++ +F
Sbjct  570  DTHTHRIGRTGRAGQK-GTAYTLVTSKDTYFSGDLVRNLEGAGQRVPDDLLQLALQNSKF  628



>ref|XP_005402246.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X1 [Chinchilla 
lanigera]
 ref|XP_005402247.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X2 [Chinchilla 
lanigera]
 ref|XP_005402248.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X3 [Chinchilla 
lanigera]
Length=935

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 92/204 (45%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTT--------------  441
            R  R     G K   G             G G+GY          T              
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENTDRGNNNNVMSNYEA  685

Query  440  -VPSRSAA---VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
              PS  A    + +++    +Q+KS+FVAAS  L NQ  G SS   P          SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LSNQKAG-SSAAGP----------SGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  T+S      S   P
Sbjct  733  TSAGSLNSVPTNSAQQGHNSPDSP  756



>ref|XP_004891560.1| PREDICTED: ATP-dependent RNA helicase DDX42 [Heterocephalus glaber]
Length=934

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 92/204 (45%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  580  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  638

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTT--------------  441
            R  R     G K   G             G G+GY          T              
Sbjct  639  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENTDRGNNNNVMSNYEA  685

Query  440  -VPSRSAA---VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
              PS  A    + +++    +Q+KS+FVAAS  L NQ  G SS   P          SG 
Sbjct  686  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LSNQKAG-SSAAGP----------SGW  732

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  T+S      S   P
Sbjct  733  TSAGSLNSVPTNSAQQGHNSPDSP  756



>gb|EHB07352.1| ATP-dependent RNA helicase DDX42 [Heterocephalus glaber]
Length=935

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 92/204 (45%), Gaps = 45/204 (22%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  581  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  639

Query  578  rskrdarkgggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTT--------------  441
            R  R     G K   G             G G+GY          T              
Sbjct  640  RKSRFKGGKGKKLNIG-------------GGGLGYRERPGLGSENTDRGNNNNVMSNYEA  686

Query  440  -VPSRSAA---VNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGG  273
              PS  A    + +++    +Q+KS+FVAAS  L NQ  G SS   P          SG 
Sbjct  687  YKPSTGAMGDRLTAMKAAFQSQYKSHFVAAS--LSNQKAG-SSAAGP----------SGW  733

Query  272  TIGGDTNASRTSSISNAATSVQKP  201
            T  G  N+  T+S      S   P
Sbjct  734  TSAGSLNSVPTNSAQQGHNSPDSP  757



>gb|KFB45936.1| AGAP012523-PA-like protein [Anopheles sinensis]
Length=802

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K GTAYTLIT K+  F+G LV +L  A Q VP +LM LAM+   F
Sbjct  604  DTHTHRIGRTGRAGEK-GTAYTLITDKDKEFSGHLVRNLEGANQEVPDDLMKLAMQSSWF  662



>gb|AGV54888.1| MAP3K3/DDX42 fusion protein 1, partial [Homo sapiens]
Length=554

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  323  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  381



>ref|XP_001957842.1| GF23818 [Drosophila ananassae]
 gb|EDV40648.1| GF23818 [Drosophila ananassae]
Length=795

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G A+TL+T K+  FAG LV +L  A Q VP +LM+LAMK   F
Sbjct  592  DTHTHRIGRTGRAGEK-GNAFTLVTDKDKEFAGHLVRNLEGADQQVPEDLMELAMKSSWF  650



>ref|XP_010854727.1| PREDICTED: ATP-dependent RNA helicase DDX42 isoform X2 [Bison 
bison bison]
Length=784

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = -1

Query  758  DMHVHRIGRXGRAGDKDGTAYTLITQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  579
            D H HRIGR GRAG+K G AYTL+T K++ FAG+LV +L  A Q+V  EL+DLAM++  F
Sbjct  417  DTHTHRIGRTGRAGEK-GVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWF  475



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260