BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF034A19

Length=697
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP00228.1|  unnamed protein product                                412   4e-139   Coffea canephora [robusta coffee]
ref|XP_011086470.1|  PREDICTED: uncharacterized protein LOC105168199    407   6e-137   Sesamum indicum [beniseed]
ref|XP_008353107.1|  PREDICTED: uncharacterized protein LOC103416654    400   1e-135   
ref|XP_009605574.1|  PREDICTED: uncharacterized protein LOC104100114    403   1e-135   Nicotiana tomentosiformis
gb|KHN01126.1|  hypothetical protein glysoja_008028                     403   2e-135   Glycine soja [wild soybean]
ref|XP_003517865.1|  PREDICTED: uncharacterized protein LOC100805887    403   2e-135   Glycine max [soybeans]
gb|EYU28651.1|  hypothetical protein MIMGU_mgv1a004456mg                402   5e-135   Erythranthe guttata [common monkey flower]
gb|KJB61190.1|  hypothetical protein B456_009G345200                    398   6e-135   Gossypium raimondii
ref|XP_006357209.1|  PREDICTED: uncharacterized protein LOC102581459    400   2e-134   Solanum tuberosum [potatoes]
ref|XP_003519794.1|  PREDICTED: uncharacterized protein LOC100779863    400   2e-134   Glycine max [soybeans]
ref|XP_004238724.1|  PREDICTED: uncharacterized protein LOC101243707    399   5e-134   Solanum lycopersicum
ref|XP_006660599.1|  PREDICTED: uncharacterized protein LOC102705746    395   6e-134   
ref|XP_003552001.1|  PREDICTED: uncharacterized protein LOC100815535    399   1e-133   Glycine max [soybeans]
ref|XP_009757019.1|  PREDICTED: uncharacterized protein LOC104250177    398   2e-133   Nicotiana sylvestris
gb|KJB61188.1|  hypothetical protein B456_009G345200                    397   3e-133   Gossypium raimondii
gb|KHG00924.1|  Protein FAM69A                                          397   5e-133   Gossypium arboreum [tree cotton]
ref|XP_008339979.1|  PREDICTED: uncharacterized protein LOC103402967    397   5e-133   
ref|XP_008446261.1|  PREDICTED: uncharacterized protein LOC103489044    396   1e-132   Cucumis melo [Oriental melon]
ref|XP_011012739.1|  PREDICTED: uncharacterized protein LOC105116927    396   1e-132   Populus euphratica
ref|XP_008389573.1|  PREDICTED: uncharacterized protein LOC103451910    396   1e-132   
ref|XP_011015682.1|  PREDICTED: uncharacterized protein LOC105119255    396   2e-132   Populus euphratica
ref|NP_001063085.1|  Os09g0392000                                       396   2e-132   
gb|EAZ08986.1|  hypothetical protein OsI_31250                          396   2e-132   Oryza sativa Indica Group [Indian rice]
ref|XP_007222590.1|  hypothetical protein PRUPE_ppa004148mg             395   2e-132   Prunus persica
ref|XP_006438501.1|  hypothetical protein CICLE_v10031248mg             395   2e-132   Citrus clementina [clementine]
ref|XP_004504499.1|  PREDICTED: uncharacterized protein LOC101510072    395   3e-132   Cicer arietinum [garbanzo]
ref|XP_008244965.1|  PREDICTED: uncharacterized protein LOC103343066    395   3e-132   Prunus mume [ume]
ref|XP_003613417.1|  hypothetical protein MTR_5g036420                  395   3e-132   Medicago truncatula
ref|XP_006378189.1|  hypothetical protein POPTR_0010s04630g             394   3e-132   
ref|XP_010533011.1|  PREDICTED: uncharacterized protein LOC104808873    395   5e-132   Tarenaya hassleriana [spider flower]
gb|KDP21286.1|  hypothetical protein JCGZ_21757                         394   7e-132   Jatropha curcas
ref|XP_006378188.1|  hypothetical protein POPTR_0010s04630g             394   1e-131   
ref|XP_004135222.1|  PREDICTED: uncharacterized protein LOC101209749    392   2e-131   Cucumis sativus [cucumbers]
ref|XP_004956736.1|  PREDICTED: uncharacterized protein LOC101782072    393   2e-131   Setaria italica
ref|XP_004297675.1|  PREDICTED: uncharacterized protein LOC101296656    392   4e-131   Fragaria vesca subsp. vesca
ref|XP_010512094.1|  PREDICTED: uncharacterized protein LOC104788107    392   5e-131   Camelina sativa [gold-of-pleasure]
ref|XP_010652908.1|  PREDICTED: uncharacterized protein LOC100251...    388   7e-131   
dbj|BAD94699.1|  hypothetical protein                                   382   8e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007153681.1|  hypothetical protein PHAVU_003G055900g             391   8e-131   Phaseolus vulgaris [French bean]
ref|XP_006390921.1|  hypothetical protein EUTSA_v10018393mg             391   9e-131   Eutrema salsugineum [saltwater cress]
ref|XP_006300446.1|  hypothetical protein CARUB_v10020126mg             391   1e-130   Capsella rubella
ref|XP_010415693.1|  PREDICTED: uncharacterized protein LOC104701657    391   1e-130   Camelina sativa [gold-of-pleasure]
ref|XP_010471012.1|  PREDICTED: uncharacterized protein LOC104750861    391   1e-130   Camelina sativa [gold-of-pleasure]
ref|XP_010913432.1|  PREDICTED: uncharacterized protein LOC105039...    391   1e-130   Elaeis guineensis
ref|XP_009105692.1|  PREDICTED: uncharacterized protein LOC103831561    391   1e-130   Brassica rapa
ref|XP_002887283.1|  hypothetical protein ARALYDRAFT_476140             390   2e-130   
ref|XP_002460179.1|  hypothetical protein SORBIDRAFT_02g024000          390   5e-130   Sorghum bicolor [broomcorn]
emb|CDY38797.1|  BnaA07g28690D                                          389   6e-130   Brassica napus [oilseed rape]
gb|EPS61168.1|  hypothetical protein M569_13630                         379   1e-129   Genlisea aurea
ref|XP_007044484.1|  Zinc finger MYND domain-containing protein 1...    389   1e-129   
ref|XP_009360447.1|  PREDICTED: uncharacterized protein LOC103950916    388   1e-129   
ref|XP_008798032.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    389   1e-129   
ref|XP_002270582.1|  PREDICTED: uncharacterized protein LOC100251...    388   2e-129   Vitis vinifera
ref|XP_009127775.1|  PREDICTED: uncharacterized protein LOC103852633    387   2e-129   Brassica rapa
emb|CDY11612.1|  BnaC06g31270D                                          387   3e-129   Brassica napus [oilseed rape]
emb|CDY03761.1|  BnaA02g14760D                                          387   3e-129   
ref|XP_002520208.1|  conserved hypothetical protein                     386   9e-129   Ricinus communis
ref|XP_010043827.1|  PREDICTED: uncharacterized protein LOC104432932    385   2e-128   Eucalyptus grandis [rose gum]
gb|AAB61100.1|  ESTs gb|R30459,gb|N38441 come from this gene            385   3e-128   Arabidopsis thaliana [mouse-ear cress]
emb|CDY42991.1|  BnaC02g19650D                                          385   4e-128   Brassica napus [oilseed rape]
ref|NP_564985.1|  uncharacterized protein                               384   5e-128   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001142383.1|  uncharacterized protein LOC100274556 precursor     384   5e-128   Zea mays [maize]
tpg|DAA61320.1|  TPA: hypothetical protein ZEAMMB73_635026              384   5e-128   
ref|XP_010683317.1|  PREDICTED: uncharacterized protein LOC104898021    384   5e-128   Beta vulgaris subsp. vulgaris [field beet]
gb|ACG40083.1|  hypothetical protein                                    384   1e-127   Zea mays [maize]
gb|EMS45474.1|  hypothetical protein TRIUR3_21271                       379   3e-127   Triticum urartu
gb|KFK41436.1|  hypothetical protein AALP_AA2G130200                    382   3e-127   Arabis alpina [alpine rockcress]
ref|NP_001061835.1|  Os08g0425000                                       382   6e-127   
gb|EEC83605.1|  hypothetical protein OsI_29292                          382   6e-127   Oryza sativa Indica Group [Indian rice]
ref|XP_010272086.1|  PREDICTED: uncharacterized protein LOC104607...    379   4e-126   Nelumbo nucifera [Indian lotus]
ref|XP_003578075.1|  PREDICTED: uncharacterized protein LOC100824338    378   2e-125   Brachypodium distachyon [annual false brome]
dbj|BAJ97125.1|  predicted protein                                      377   6e-125   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002444358.1|  hypothetical protein SORBIDRAFT_07g020660          376   9e-125   
ref|XP_006856897.1|  hypothetical protein AMTR_s00055p00212390          376   1e-124   Amborella trichopoda
gb|ACN36261.1|  unknown                                                 371   1e-124   Zea mays [maize]
dbj|BAJ99018.1|  predicted protein                                      375   1e-124   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ33873.1|  unnamed protein product                                375   2e-124   Eutrema halophilum
ref|XP_004973463.1|  PREDICTED: uncharacterized protein LOC101781133    375   3e-124   Setaria italica
ref|XP_006659410.1|  PREDICTED: uncharacterized protein LOC102708916    370   3e-124   
dbj|BAJ91369.1|  predicted protein                                      374   5e-124   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009419908.1|  PREDICTED: uncharacterized protein LOC103999...    374   6e-124   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006858155.1|  hypothetical protein AMTR_s00062p00137330          371   5e-123   Amborella trichopoda
ref|NP_001143255.1|  uncharacterized protein LOC100275783 precursor     370   1e-122   
ref|XP_008676929.1|  PREDICTED: uncharacterized protein LOC100275...    370   1e-122   
ref|XP_003574496.1|  PREDICTED: uncharacterized protein LOC100845920    369   9e-122   Brachypodium distachyon [annual false brome]
gb|EAZ42788.1|  hypothetical protein OsJ_27372                          365   5e-121   Oryza sativa Japonica Group [Japonica rice]
gb|ABK24649.1|  unknown                                                 365   2e-120   Picea sitchensis
ref|XP_010445104.1|  PREDICTED: uncharacterized protein LOC104727724    354   5e-120   Camelina sativa [gold-of-pleasure]
ref|XP_006401517.1|  hypothetical protein EUTSA_v10013232mg             361   8e-119   Eutrema salsugineum [saltwater cress]
gb|KCW70170.1|  hypothetical protein EUGRSUZ_F03459                     355   5e-118   Eucalyptus grandis [rose gum]
emb|CDY17285.1|  BnaA10g09190D                                          358   1e-117   Brassica napus [oilseed rape]
ref|XP_009120015.1|  PREDICTED: uncharacterized protein LOC103844940    357   3e-117   Brassica rapa
emb|CDY19873.1|  BnaC09g31390D                                          357   4e-117   Brassica napus [oilseed rape]
ref|XP_009127046.1|  PREDICTED: uncharacterized protein LOC103851917    356   5e-117   Brassica rapa
emb|CDY29265.1|  BnaC01g19170D                                          355   7e-117   Brassica napus [oilseed rape]
emb|CDX89285.1|  BnaA01g16080D                                          354   8e-117   
ref|XP_006413116.1|  hypothetical protein EUTSA_v10024847mg             356   9e-117   Eutrema salsugineum [saltwater cress]
ref|XP_009143005.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    355   9e-117   Brassica rapa
ref|XP_010438669.1|  PREDICTED: uncharacterized protein LOC104722227    354   2e-116   Camelina sativa [gold-of-pleasure]
ref|XP_002867528.1|  hypothetical protein ARALYDRAFT_913846             354   2e-116   Arabidopsis lyrata subsp. lyrata
ref|XP_010267678.1|  PREDICTED: uncharacterized protein LOC104604833    354   2e-116   Nelumbo nucifera [Indian lotus]
ref|XP_010276049.1|  PREDICTED: uncharacterized protein LOC104610902    353   5e-116   Nelumbo nucifera [Indian lotus]
ref|XP_008371266.1|  PREDICTED: uncharacterized protein LOC103434697    353   9e-116   
ref|XP_010433417.1|  PREDICTED: uncharacterized protein LOC104717532    353   9e-116   Camelina sativa [gold-of-pleasure]
ref|XP_006280251.1|  hypothetical protein CARUB_v10026167mg             353   1e-115   
ref|XP_010448765.1|  PREDICTED: uncharacterized protein LOC104731172    352   2e-115   Camelina sativa [gold-of-pleasure]
gb|KFK29208.1|  hypothetical protein AALP_AA7G103200                    351   3e-115   Arabis alpina [alpine rockcress]
ref|NP_200298.1|  uncharacterized protein                               351   4e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864361.1|  hypothetical protein ARALYDRAFT_331828             351   5e-115   Arabidopsis lyrata subsp. lyrata
ref|XP_010448183.1|  PREDICTED: uncharacterized protein LOC104730687    352   7e-115   
ref|XP_010482896.1|  PREDICTED: uncharacterized protein LOC104761505    351   7e-115   Camelina sativa [gold-of-pleasure]
ref|XP_010446119.1|  PREDICTED: uncharacterized protein LOC104728896    354   3e-114   
gb|KHG29749.1|  Transcription activator gutR                            348   4e-114   Gossypium arboreum [tree cotton]
gb|KHN38290.1|  hypothetical protein glysoja_003955                     345   6e-114   Glycine soja [wild soybean]
gb|ABR17461.1|  unknown                                                 347   9e-114   Picea sitchensis
ref|XP_009334822.1|  PREDICTED: uncharacterized protein LOC103927611    347   1e-113   Pyrus x bretschneideri [bai li]
ref|XP_010545218.1|  PREDICTED: uncharacterized protein LOC104817662    347   2e-113   Tarenaya hassleriana [spider flower]
ref|XP_006283454.1|  hypothetical protein CARUB_v10004499mg             348   2e-113   
ref|NP_001044498.2|  Os01g0793500                                       347   2e-113   
dbj|BAB89049.1|  unknown protein                                        347   2e-113   Oryza sativa Japonica Group [Japonica rice]
gb|ACF87807.1|  unknown                                                 341   3e-113   Zea mays [maize]
ref|NP_194432.1|  uncharacterized protein                               346   3e-113   Arabidopsis thaliana [mouse-ear cress]
gb|KJB62763.1|  hypothetical protein B456_009G435000                    346   4e-113   Gossypium raimondii
ref|XP_006367536.1|  PREDICTED: uncharacterized protein LOC102597542    346   5e-113   Solanum tuberosum [potatoes]
ref|XP_011097895.1|  PREDICTED: uncharacterized protein LOC105176701    346   6e-113   
gb|KCW67126.1|  hypothetical protein EUGRSUZ_F00907                     334   8e-113   Eucalyptus grandis [rose gum]
ref|XP_001775460.1|  predicted protein                                  345   9e-113   
ref|XP_003519567.1|  PREDICTED: uncharacterized protein LOC100789...    345   9e-113   Glycine max [soybeans]
emb|CDY20800.1|  BnaA02g09400D                                          347   1e-112   Brassica napus [oilseed rape]
ref|XP_004970230.1|  PREDICTED: uncharacterized protein LOC101777...    345   1e-112   Setaria italica
ref|XP_004970229.1|  PREDICTED: uncharacterized protein LOC101777...    345   2e-112   Setaria italica
ref|XP_007142263.1|  hypothetical protein PHAVU_008G266000g             345   2e-112   Phaseolus vulgaris [French bean]
ref|XP_007211818.1|  hypothetical protein PRUPE_ppa004230mg             344   2e-112   Prunus persica
ref|XP_009420606.1|  PREDICTED: uncharacterized protein LOC104000320    344   3e-112   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP39105.1|  hypothetical protein JCGZ_00862                         343   3e-112   Jatropha curcas
ref|XP_008226932.1|  PREDICTED: uncharacterized protein LOC103326477    343   6e-112   Prunus mume [ume]
ref|XP_006452283.1|  hypothetical protein CICLE_v10008210mg             341   6e-112   Citrus clementina [clementine]
ref|XP_004252023.1|  PREDICTED: uncharacterized protein LOC101252754    343   6e-112   Solanum lycopersicum
ref|XP_008349941.1|  PREDICTED: uncharacterized protein LOC103413239    343   7e-112   
gb|EYU19247.1|  hypothetical protein MIMGU_mgv1a004499mg                343   7e-112   Erythranthe guttata [common monkey flower]
ref|XP_006644833.1|  PREDICTED: uncharacterized protein LOC102706146    343   1e-111   Oryza brachyantha
ref|XP_008385988.1|  PREDICTED: uncharacterized protein LOC103448506    343   2e-111   
ref|XP_010064377.1|  PREDICTED: uncharacterized protein LOC104451417    336   2e-111   
emb|CDY06624.1|  BnaC02g13480D                                          344   2e-111   
ref|XP_007020905.1|  Inositol-1,4,5-trisphosphate 5-phosphatase 4...    343   2e-111   
ref|XP_009378549.1|  PREDICTED: uncharacterized protein LOC103967027    341   3e-111   Pyrus x bretschneideri [bai li]
gb|KHG01773.1|  Tryptophan synthase alpha chain                         341   3e-111   Gossypium arboreum [tree cotton]
ref|XP_008654687.1|  PREDICTED: uncharacterized protein LOC100275...    341   4e-111   Zea mays [maize]
ref|XP_006475148.1|  PREDICTED: uncharacterized protein LOC102609098    341   5e-111   Citrus sinensis [apfelsine]
ref|XP_002522970.1|  conserved hypothetical protein                     340   6e-111   Ricinus communis
gb|KJB13649.1|  hypothetical protein B456_002G087800                    340   6e-111   Gossypium raimondii
ref|XP_004491367.1|  PREDICTED: uncharacterized protein LOC101492149    340   7e-111   Cicer arietinum [garbanzo]
ref|NP_001143111.1|  uncharacterized protein LOC100275589               341   1e-110   Zea mays [maize]
gb|ACN29289.1|  unknown                                                 341   1e-110   Zea mays [maize]
ref|XP_003617489.1|  hypothetical protein MTR_5g092140                  339   2e-110   Medicago truncatula
gb|KHN11935.1|  hypothetical protein glysoja_019908                     338   2e-110   Glycine soja [wild soybean]
ref|XP_009769049.1|  PREDICTED: uncharacterized protein LOC104219979    339   3e-110   Nicotiana sylvestris
gb|KCW67171.1|  hypothetical protein EUGRSUZ_F00962                     335   3e-110   Eucalyptus grandis [rose gum]
ref|XP_003544978.1|  PREDICTED: uncharacterized protein LOC100796964    338   4e-110   Glycine max [soybeans]
ref|XP_002280959.1|  PREDICTED: uncharacterized protein LOC100267...    338   4e-110   Vitis vinifera
ref|XP_009599364.1|  PREDICTED: uncharacterized protein LOC104095030    338   6e-110   Nicotiana tomentosiformis
gb|KCW67034.1|  hypothetical protein EUGRSUZ_F00801                     333   7e-110   Eucalyptus grandis [rose gum]
ref|XP_004295816.2|  PREDICTED: uncharacterized protein LOC101297130    337   1e-109   Fragaria vesca subsp. vesca
ref|XP_008454551.1|  PREDICTED: uncharacterized protein LOC103494941    337   1e-109   Cucumis melo [Oriental melon]
ref|XP_010675677.1|  PREDICTED: uncharacterized protein LOC104891653    337   1e-109   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002316997.1|  hypothetical protein POPTR_0011s14080g             337   2e-109   
ref|XP_011040240.1|  PREDICTED: uncharacterized protein LOC105136541    335   7e-109   Populus euphratica
ref|XP_011095372.1|  PREDICTED: uncharacterized protein LOC105174849    335   8e-109   Sesamum indicum [beniseed]
ref|XP_010060409.1|  PREDICTED: uncharacterized protein LOC104448324    335   1e-108   Eucalyptus grandis [rose gum]
ref|XP_011030808.1|  PREDICTED: uncharacterized protein LOC105130143    334   2e-108   Populus euphratica
ref|XP_006370687.1|  hypothetical protein POPTR_0001s44890g             335   6e-108   
ref|XP_008812430.1|  PREDICTED: uncharacterized protein LOC103723322    333   7e-108   Phoenix dactylifera
ref|XP_004151958.1|  PREDICTED: uncharacterized protein LOC101214437    333   7e-108   Cucumis sativus [cucumbers]
ref|XP_003564372.1|  PREDICTED: uncharacterized protein LOC100827...    333   8e-108   Brachypodium distachyon [annual false brome]
ref|XP_003564373.1|  PREDICTED: uncharacterized protein LOC100827...    332   1e-107   Brachypodium distachyon [annual false brome]
ref|XP_006346228.1|  PREDICTED: uncharacterized protein LOC102585922    332   1e-107   Solanum tuberosum [potatoes]
ref|XP_010930250.1|  PREDICTED: uncharacterized protein LOC105051...    332   1e-107   Elaeis guineensis
ref|XP_009774573.1|  PREDICTED: uncharacterized protein LOC104224588    331   4e-107   Nicotiana sylvestris
ref|XP_009607397.1|  PREDICTED: uncharacterized protein LOC104101619    331   4e-107   Nicotiana tomentosiformis
ref|XP_004244131.1|  PREDICTED: uncharacterized protein LOC101251602    330   7e-107   Solanum lycopersicum
ref|XP_002278686.1|  PREDICTED: uncharacterized protein LOC100241...    330   1e-106   Vitis vinifera
ref|XP_007211816.1|  hypothetical protein PRUPE_ppa004222mg             329   1e-106   Prunus persica
ref|XP_002986592.1|  hypothetical protein SELMODRAFT_124354             328   2e-106   
ref|XP_002965264.1|  hypothetical protein SELMODRAFT_143057             328   3e-106   
ref|XP_009614697.1|  PREDICTED: uncharacterized protein LOC104107...    328   3e-106   Nicotiana tomentosiformis
ref|XP_001781611.1|  predicted protein                                  328   4e-106   
ref|XP_009801187.1|  PREDICTED: uncharacterized protein LOC104246...    328   4e-106   Nicotiana sylvestris
ref|XP_008226933.1|  PREDICTED: uncharacterized protein LOC103326478    328   6e-106   Prunus mume [ume]
ref|XP_004244132.1|  PREDICTED: uncharacterized protein LOC101251905    327   9e-106   Solanum lycopersicum
emb|CDM84540.1|  unnamed protein product                                327   1e-105   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006346229.1|  PREDICTED: uncharacterized protein LOC102586255    327   1e-105   Solanum tuberosum [potatoes]
ref|XP_010644425.1|  PREDICTED: uncharacterized protein LOC100241...    325   9e-105   
gb|EMT03744.1|  hypothetical protein F775_19554                         327   2e-104   
emb|CBI26611.3|  unnamed protein product                                325   3e-104   Vitis vinifera
emb|CDP05764.1|  unnamed protein product                                323   3e-104   Coffea canephora [robusta coffee]
ref|XP_009614695.1|  PREDICTED: uncharacterized protein LOC104107...    322   8e-104   Nicotiana tomentosiformis
dbj|BAJ95380.1|  predicted protein                                      322   9e-104   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO82633.1|  hypothetical protein CISIN_1g0101752mg                  303   4e-101   Citrus sinensis [apfelsine]
emb|CAN60720.1|  hypothetical protein VITISV_022056                     313   4e-100   Vitis vinifera
ref|XP_004158483.1|  PREDICTED: uncharacterized LOC101212346            308   1e-99    
ref|XP_008454552.1|  PREDICTED: uncharacterized protein LOC103494942    311   3e-99    
ref|XP_004152029.1|  PREDICTED: uncharacterized protein LOC101212346    310   7e-99    
gb|KCW67120.1|  hypothetical protein EUGRSUZ_F00901                     304   8e-99    Eucalyptus grandis [rose gum]
ref|XP_010913435.1|  PREDICTED: uncharacterized protein LOC105039...    306   2e-98    
ref|XP_010272087.1|  PREDICTED: uncharacterized protein LOC104607...    307   2e-98    
gb|AGV54795.1|  hypothetical protein                                    307   4e-98    Phaseolus vulgaris [French bean]
ref|XP_009419909.1|  PREDICTED: uncharacterized protein LOC103999...    298   9e-95    
gb|EMS49816.1|  hypothetical protein TRIUR3_06457                       297   2e-93    Triticum urartu
ref|XP_010092131.1|  hypothetical protein L484_017819                   290   2e-90    
gb|EMS65818.1|  hypothetical protein TRIUR3_10678                       282   2e-90    Triticum urartu
gb|EMT12587.1|  hypothetical protein F775_11937                         279   5e-88    
ref|XP_010644428.1|  PREDICTED: uncharacterized protein LOC100241...    274   4e-85    
ref|XP_010930259.1|  PREDICTED: uncharacterized protein LOC105051...    270   8e-84    Elaeis guineensis
ref|XP_006438500.1|  hypothetical protein CICLE_v10031248mg             267   4e-83    
gb|KCW67113.1|  hypothetical protein EUGRSUZ_F00893                     255   3e-78    Eucalyptus grandis [rose gum]
gb|KJB62764.1|  hypothetical protein B456_009G435000                    244   2e-74    Gossypium raimondii
gb|EYU33635.1|  hypothetical protein MIMGU_mgv1a018256mg                244   4e-74    Erythranthe guttata [common monkey flower]
ref|XP_006575675.1|  PREDICTED: uncharacterized protein LOC100789...    241   6e-73    Glycine max [soybeans]
ref|XP_010644433.1|  PREDICTED: uncharacterized protein LOC100267...    239   2e-72    Vitis vinifera
gb|ACF81787.1|  unknown                                                 221   1e-69    Zea mays [maize]
ref|XP_010644430.1|  PREDICTED: uncharacterized protein LOC100241...    229   1e-68    
ref|XP_010644429.1|  PREDICTED: uncharacterized protein LOC100241...    229   4e-68    
gb|KCW67105.1|  hypothetical protein EUGRSUZ_F00888                     218   2e-66    Eucalyptus grandis [rose gum]
gb|KCW67102.1|  hypothetical protein EUGRSUZ_F00885                     218   6e-64    Eucalyptus grandis [rose gum]
ref|XP_010445105.1|  PREDICTED: uncharacterized protein LOC104727725    203   2e-62    
ref|XP_001449176.1|  hypothetical protein                               212   4e-61    Paramecium tetraurelia strain d4-2
gb|KCW67110.1|  hypothetical protein EUGRSUZ_F00891                     197   4e-60    Eucalyptus grandis [rose gum]
ref|XP_001436259.1|  hypothetical protein                               209   5e-60    Paramecium tetraurelia strain d4-2
ref|XP_001455162.1|  hypothetical protein                               208   7e-60    Paramecium tetraurelia strain d4-2
gb|KCW66790.1|  hypothetical protein EUGRSUZ_F00555                     197   2e-58    Eucalyptus grandis [rose gum]
ref|XP_010064383.1|  PREDICTED: uncharacterized protein LOC104451423    193   1e-57    
gb|EEC71626.1|  hypothetical protein OsI_04047                          187   3e-56    Oryza sativa Indica Group [Indian rice]
ref|XP_004027177.1|  hypothetical protein IMG5_188030                   196   5e-55    Ichthyophthirius multifiliis
ref|XP_002878755.1|  predicted protein                                  183   5e-55    
gb|KCW67111.1|  hypothetical protein EUGRSUZ_F00891                     182   2e-54    Eucalyptus grandis [rose gum]
ref|XP_010064375.1|  PREDICTED: uncharacterized protein LOC104451414    181   4e-54    
emb|CDW81161.1|  UNKNOWN                                                189   1e-52    Stylonychia lemnae
gb|EJY77500.1|  hypothetical protein OXYTRI_00869                       188   3e-52    Oxytricha trifallax
gb|KDO82634.1|  hypothetical protein CISIN_1g0101752mg                  175   1e-51    Citrus sinensis [apfelsine]
ref|XP_002872148.1|  hypothetical protein ARALYDRAFT_351537             173   2e-50    
ref|XP_001031695.1|  hypothetical protein TTHERM_00760790               183   2e-50    Tetrahymena thermophila SB210
ref|XP_004346245.1|  hypothetical protein CAOG_05572                    182   5e-50    Capsaspora owczarzaki ATCC 30864
gb|EJY88389.1|  hypothetical protein OXYTRI_16548                       182   1e-49    Oxytricha trifallax
emb|CDW80089.1|  UNKNOWN                                                179   8e-49    Stylonychia lemnae
gb|EAR84506.2|  hypothetical protein TTHERM_00655340                    178   2e-48    Tetrahymena thermophila SB210
ref|XP_001032169.1|  hypothetical protein TTHERM_00655340               178   2e-48    
emb|CDW76296.1|  UNKNOWN                                                174   6e-47    Stylonychia lemnae
ref|XP_008245164.1|  PREDICTED: uncharacterized protein LOC103343273    170   7e-47    
ref|XP_001749148.1|  hypothetical protein                               169   4e-45    Monosiga brevicollis MX1
gb|AGW24477.1|  chloroplast 20 kDa chaperonin                           155   1e-44    Avicennia marina subsp. marina
gb|AFA26195.1|  hypothetical protein                                    161   3e-44    Lolium perenne [perennial ryegrass]
ref|XP_002888842.1|  hypothetical protein ARALYDRAFT_895006             154   5e-44    
gb|EJY86845.1|  hypothetical protein OXYTRI_09854                       164   2e-43    Oxytricha trifallax
ref|XP_010100527.1|  hypothetical protein L484_027842                   160   2e-42    
ref|XP_009405675.1|  PREDICTED: uncharacterized protein LOC103988768    155   2e-41    
emb|CDW73981.1|  UNKNOWN                                                158   3e-41    Stylonychia lemnae
gb|KJB13651.1|  hypothetical protein B456_002G087800                    149   2e-38    Gossypium raimondii
gb|EAY76121.1|  hypothetical protein OsI_04050                          144   6e-37    Oryza sativa Indica Group [Indian rice]
gb|KCW66786.1|  hypothetical protein EUGRSUZ_F005522                    141   2e-36    Eucalyptus grandis [rose gum]
emb|CDW85293.1|  UNKNOWN                                                138   2e-34    Stylonychia lemnae
ref|XP_004997585.1|  hypothetical protein PTSG_01605                    137   7e-34    Salpingoeca rosetta
ref|XP_002677023.1|  predicted protein                                  133   1e-33    Naegleria gruberi strain NEG-M
ref|XP_010064275.1|  PREDICTED: uncharacterized protein LOC104451268    135   2e-33    
ref|XP_009801253.1|  PREDICTED: uncharacterized protein LOC104246...    133   8e-33    Nicotiana sylvestris
gb|EWM29091.1|  hypothetical protein Naga_100024g11                     127   5e-30    Nannochloropsis gaditana
gb|KDO49372.1|  hypothetical protein CISIN_1g038412mg                   117   3e-29    Citrus sinensis [apfelsine]
gb|KCW66787.1|  hypothetical protein EUGRSUZ_F005521                    103   9e-25    Eucalyptus grandis [rose gum]
gb|EJY76018.1|  hypothetical protein OXYTRI_02478                       109   5e-24    Oxytricha trifallax
gb|EPS57942.1|  hypothetical protein M569_16875                         105   2e-23    Genlisea aurea
gb|KJB61191.1|  hypothetical protein B456_009G345200                  99.8    5e-21    Gossypium raimondii
gb|KDO82638.1|  hypothetical protein CISIN_1g0101751mg                99.4    6e-21    Citrus sinensis [apfelsine]
gb|KDO82639.1|  hypothetical protein CISIN_1g0101751mg                97.4    2e-20    Citrus sinensis [apfelsine]
ref|XP_007044485.1|  Zinc finger MYND domain-containing protein 1...  97.1    5e-20    
ref|XP_007020906.1|  Inositol-1,4,5-trisphosphate 5-phosphatase 4...  95.1    4e-19    
ref|XP_002780228.1|  conserved hypothetical protein                   95.1    9e-19    Perkinsus marinus ATCC 50983
gb|KJB62765.1|  hypothetical protein B456_009G435000                  92.4    2e-18    Gossypium raimondii
ref|XP_002773717.1|  conserved hypothetical protein                   90.1    4e-17    Perkinsus marinus ATCC 50983
emb|CDY23519.1|  BnaC06g24880D                                        83.2    5e-17    Brassica napus [oilseed rape]
emb|CBI33030.3|  unnamed protein product                              82.0    1e-16    Vitis vinifera
ref|XP_010060399.1|  PREDICTED: uncharacterized protein LOC104448297  82.0    1e-15    
gb|EJY67182.1|  hypothetical protein OXYTRI_12523                     82.4    5e-15    
gb|KHN17169.1|  hypothetical protein glysoja_010628                   79.3    8e-15    
ref|XP_002780229.1|  conserved hypothetical protein                   82.4    1e-14    
gb|KCW67153.1|  hypothetical protein EUGRSUZ_F00947                   78.2    4e-14    
ref|XP_002780230.1|  conserved hypothetical protein                   80.9    5e-14    
gb|KDO82636.1|  hypothetical protein CISIN_1g0101752mg                64.3    2e-10    
gb|KDO82635.1|  hypothetical protein CISIN_1g0101752mg                63.2    6e-10    
ref|XP_004509910.1|  PREDICTED: uncharacterized protein LOC101495828  62.0    6e-08    
ref|XP_002458625.1|  hypothetical protein SORBIDRAFT_03g036905        57.0    1e-07    
gb|EJY85663.1|  hypothetical protein OXYTRI_16352                     56.2    5e-06    



>emb|CDP00228.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   412 bits (1060),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 190/217 (88%), Positives = 207/217 (95%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FNSTAAWEY R M GKPYGYHNMIFSWIDT++DNYPPP+DAHLV+SVMSMWTR+
Sbjct  304  PDVRAKFNSTAAWEYARKMSGKPYGYHNMIFSWIDTVADNYPPPLDAHLVMSVMSMWTRV  363

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QPTYAANMWNEALNKRL TE L+LYEILAETERRGL+FDQLLTIPEQDEWVYSDGKSTTC
Sbjct  364  QPTYAANMWNEALNKRLETEELNLYEILAETERRGLSFDQLLTIPEQDEWVYSDGKSTTC  423

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+GVFG +A+SIQVTEFTIRDAYMLKI+ENNQTRLP WCNSG+D LPFCQI
Sbjct  424  VAFILAMYKEAGVFGPIADSIQVTEFTIRDAYMLKIFENNQTRLPKWCNSGDDMLPFCQI  483

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELP YNTLEPYANMNENCPSLPP+YERP+ C
Sbjct  484  LGEYRMELPQYNTLEPYANMNENCPSLPPTYERPVRC  520



>ref|XP_011086470.1| PREDICTED: uncharacterized protein LOC105168199 [Sesamum indicum]
Length=528

 Score =   407 bits (1046),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 187/217 (86%), Positives = 203/217 (94%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PEVRARFN+TAAWEY R M GKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTRM
Sbjct  312  PEVRARFNTTAAWEYARQMAGKPYGYHNMIFSWIDTVADNYPPPLDAHLVISVMSMWTRM  371

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALN RLGTEGLDL++ILAETE RG+TFDQLLTIPEQDEWVYSDGKSTTC
Sbjct  372  QPAYAANMWNEALNMRLGTEGLDLHDILAETETRGVTFDQLLTIPEQDEWVYSDGKSTTC  431

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYK +GVFG L+ SIQVTEFTIRDAYMLKIYENN TRLPSWCN+ +D+LPFCQI
Sbjct  432  VAFILAMYKAAGVFGPLSNSIQVTEFTIRDAYMLKIYENNVTRLPSWCNNSDDQLPFCQI  491

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY+MELP YNTLEPY NMNENCPSLPP+YERP+ C
Sbjct  492  LGEYKMELPYYNTLEPYTNMNENCPSLPPTYERPVRC  528



>ref|XP_008353107.1| PREDICTED: uncharacterized protein LOC103416654 [Malus domestica]
Length=416

 Score =   400 bits (1027),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 182/217 (84%), Positives = 201/217 (93%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PEVRA+FNSTAAWEYVR M GKPYGYHNMIFSWIDT++DN+PPP+D HLV+SVMSMWTRM
Sbjct  200  PEVRAKFNSTAAWEYVRSMSGKPYGYHNMIFSWIDTMADNFPPPLDTHLVVSVMSMWTRM  259

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDLYEILAE E R + FD LLTIPEQDEWVYSDGKSTTC
Sbjct  260  QPAYAANMWNEALNKRLGTEGLDLYEILAEVESREMAFDHLLTIPEQDEWVYSDGKSTTC  319

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+G+FG ++ SIQVTEFTIRDAYMLKI+E+NQTRLPSWCN  ++KLPFCQI
Sbjct  320  VAFILAMYKEAGIFGPISNSIQVTEFTIRDAYMLKIFEDNQTRLPSWCNGKDEKLPFCQI  379

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELP YNTLEPYANMNE+CPSLPP+Y+RP  C
Sbjct  380  LGEYRMELPLYNTLEPYANMNEHCPSLPPTYDRPTRC  416



>ref|XP_009605574.1| PREDICTED: uncharacterized protein LOC104100114 [Nicotiana tomentosiformis]
Length=523

 Score =   403 bits (1036),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 185/217 (85%), Positives = 205/217 (94%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PEVRARFN+TAAWEY R M GKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTR+
Sbjct  307  PEVRARFNNTAAWEYARKMSGKPYGYHNMIFSWIDTVADNYPPPLDAHLVISVMSMWTRV  366

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY ILAETE+RG+TFDQLLTIPEQDEWVYSDGKSTTC
Sbjct  367  QPAYAANMWNEALNKRLGTEDLDLYGILAETEKRGITFDQLLTIPEQDEWVYSDGKSTTC  426

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+GVFG ++ SIQVTEFTI+DAY LKI+E+NQTRLPSWCNSG++K+ FCQI
Sbjct  427  VAFILAMYKEAGVFGPISNSIQVTEFTIKDAYTLKIFEDNQTRLPSWCNSGDNKVSFCQI  486

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY+MELP YNTLEPYANMNENCPSLPP+YERP+ C
Sbjct  487  LGEYQMELPQYNTLEPYANMNENCPSLPPNYERPMRC  523



>gb|KHN01126.1| hypothetical protein glysoja_008028 [Glycine soja]
Length=518

 Score =   403 bits (1036),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 180/217 (83%), Positives = 204/217 (94%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PE+RARFNSTAAWEY R M GKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTRM
Sbjct  302  PELRARFNSTAAWEYARSMSGKPYGYHNMIFSWIDTVADNYPPPLDAHLVISVMSMWTRM  361

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDL++IL ETE+RG+ FDQLLTIPEQDEWVYSDGKSTTC
Sbjct  362  QPAYAANMWNEALNKRLGTEDLDLHDILIETEKRGIAFDQLLTIPEQDEWVYSDGKSTTC  421

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL+MYK +G+FG ++ SIQVTEFTIRDAYML+I+E+NQTRLP WCN+ ND+LPFCQI
Sbjct  422  VAFILSMYKAAGIFGPISSSIQVTEFTIRDAYMLRIFEDNQTRLPRWCNNENDRLPFCQI  481

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELPGYNTL+PYANMNE+CPSLPP+Y+RP+ C
Sbjct  482  LGEYRMELPGYNTLDPYANMNEHCPSLPPTYDRPLKC  518



>ref|XP_003517865.1| PREDICTED: uncharacterized protein LOC100805887 [Glycine max]
Length=518

 Score =   403 bits (1035),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 180/217 (83%), Positives = 204/217 (94%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PE+RARFNSTAAWEY R M GKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTRM
Sbjct  302  PELRARFNSTAAWEYARSMSGKPYGYHNMIFSWIDTVADNYPPPLDAHLVISVMSMWTRM  361

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDL++IL ETE+RG+ FDQLLTIPEQDEWVYSDGKSTTC
Sbjct  362  QPAYAANMWNEALNKRLGTEDLDLHDILIETEKRGIAFDQLLTIPEQDEWVYSDGKSTTC  421

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL+MYK +G+FG ++ SIQVTEFTIRDAYML+I+E+NQTRLP WCN+ ND+LPFCQI
Sbjct  422  VAFILSMYKAAGIFGPISSSIQVTEFTIRDAYMLRIFEDNQTRLPRWCNNENDRLPFCQI  481

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELPGYNTL+PYANMNE+CPSLPP+Y+RP+ C
Sbjct  482  LGEYRMELPGYNTLDPYANMNEHCPSLPPTYDRPLKC  518



>gb|EYU28651.1| hypothetical protein MIMGU_mgv1a004456mg [Erythranthe guttata]
Length=526

 Score =   402 bits (1033),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 184/217 (85%), Positives = 201/217 (93%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PE+RARFN+TAAWEY R M GKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTRM
Sbjct  310  PEIRARFNTTAAWEYARQMAGKPYGYHNMIFSWIDTVADNYPPPLDAHLVISVMSMWTRM  369

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALN RLGTE LDLY ILAETERRG+TFDQLLTIPEQDEWVYSDGKSTTC
Sbjct  370  QPAYAANMWNEALNMRLGTEDLDLYGILAETERRGITFDQLLTIPEQDEWVYSDGKSTTC  429

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYK +GVFG +  SIQVTEFTI+DAYMLKI+ENN T+LP+WCN+G+DKLPFCQI
Sbjct  430  VAFILAMYKAAGVFGPVTNSIQVTEFTIKDAYMLKIFENNMTQLPNWCNNGDDKLPFCQI  489

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY+MELP YNTLEPY NMNENCPSLPP+YERP  C
Sbjct  490  LGEYKMELPYYNTLEPYTNMNENCPSLPPTYERPARC  526



>gb|KJB61190.1| hypothetical protein B456_009G345200 [Gossypium raimondii]
Length=409

 Score =   398 bits (1022),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 183/217 (84%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FNSTAAWEY R M GKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTR+
Sbjct  193  PDIRAKFNSTAAWEYARSMSGKPYGYHNMIFSWIDTVADNYPPPLDAHLVISVMSMWTRV  252

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY IL ETERRG+TFDQLLTIPEQDEWVYSDGKSTTC
Sbjct  253  QPAYAANMWNEALNKRLGTEDLDLYRILEETERRGITFDQLLTIPEQDEWVYSDGKSTTC  312

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL MYKE+GVFG L+ SIQVTEFTIRDAYMLKI+ENNQT LPSWCN+G+ +LPFCQI
Sbjct  313  VAFILEMYKEAGVFGPLSNSIQVTEFTIRDAYMLKIFENNQTNLPSWCNNGDGRLPFCQI  372

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY MELP YN+LEPYANMNENCPSLPP Y+RP  C
Sbjct  373  LGEYWMELPFYNSLEPYANMNENCPSLPPIYDRPTRC  409



>ref|XP_006357209.1| PREDICTED: uncharacterized protein LOC102581459 [Solanum tuberosum]
Length=524

 Score =   400 bits (1029),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 184/217 (85%), Positives = 203/217 (94%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PEVRARFN+TAAWEY R M GKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTR+
Sbjct  308  PEVRARFNNTAAWEYTRKMSGKPYGYHNMIFSWIDTVADNYPPPLDAHLVISVMSMWTRV  367

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+ LDLY ILAETERRG+TFDQLLTIPEQDEW+YSDG+STTC
Sbjct  368  QPAYAANMWNEALNKRLGTKDLDLYGILAETERRGITFDQLLTIPEQDEWIYSDGQSTTC  427

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+GVFG ++ SIQVTEFTIRDAYMLKI+E+NQTRLPSWCNSG++K  FCQI
Sbjct  428  VAFILAMYKEAGVFGPISNSIQVTEFTIRDAYMLKIFEDNQTRLPSWCNSGDNKFSFCQI  487

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY+MELP YNTL+PYANMNENCPSLPP YERP  C
Sbjct  488  LGEYQMELPQYNTLDPYANMNENCPSLPPHYERPGRC  524



>ref|XP_003519794.1| PREDICTED: uncharacterized protein LOC100779863 [Glycine max]
 gb|KHN28683.1| hypothetical protein glysoja_025417 [Glycine soja]
Length=520

 Score =   400 bits (1028),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 203/217 (94%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PE+RARFNSTAAWEY R M GKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTRM
Sbjct  304  PELRARFNSTAAWEYARSMSGKPYGYHNMIFSWIDTVADNYPPPLDAHLVISVMSMWTRM  363

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDL++IL ETE+RG+ FDQLLTIPEQDEWVYSDGKSTTC
Sbjct  364  QPAYAANMWNEALNKRLGTEDLDLHDILIETEKRGIAFDQLLTIPEQDEWVYSDGKSTTC  423

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL+MYK +G+FG ++ SIQVTEFTIRDAYML+I+E+NQTRLP WCN+ ND+ PFCQI
Sbjct  424  VAFILSMYKAAGIFGPISSSIQVTEFTIRDAYMLRIFEDNQTRLPRWCNNENDRHPFCQI  483

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELPGYNTL+PYANMNE+CPSLPP+Y+RP+ C
Sbjct  484  LGEYRMELPGYNTLDPYANMNEHCPSLPPTYDRPLKC  520



>ref|XP_004238724.1| PREDICTED: uncharacterized protein LOC101243707 [Solanum lycopersicum]
Length=524

 Score =   399 bits (1026),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 184/217 (85%), Positives = 203/217 (94%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRARFN+TAAWEY R M GKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTR+
Sbjct  308  PDVRARFNNTAAWEYARKMSGKPYGYHNMIFSWIDTVADNYPPPLDAHLVISVMSMWTRV  367

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY ILAETERRG+TFDQLLTIPEQDEWVYSDG+STTC
Sbjct  368  QPAYAANMWNEALNKRLGTEDLDLYGILAETERRGITFDQLLTIPEQDEWVYSDGQSTTC  427

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+GVFG ++ SIQVTEFTIRDAYMLKI+E+NQTRLPSWCN G++K+ FCQI
Sbjct  428  VAFILAMYKEAGVFGPISNSIQVTEFTIRDAYMLKIFEDNQTRLPSWCNGGDNKVSFCQI  487

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY+MELP YNTL+PYANMNENCPSLPP YERP  C
Sbjct  488  LGEYQMELPEYNTLDPYANMNENCPSLPPHYERPRRC  524



>ref|XP_006660599.1| PREDICTED: uncharacterized protein LOC102705746 [Oryza brachyantha]
Length=420

 Score =   395 bits (1016),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRARFN +AAW+Y R M+GKPYGYHNMIFSWIDTI DNYPPP+DA+LV++VMSMWTR+
Sbjct  204  PDVRARFNESAAWDYARSMVGKPYGYHNMIFSWIDTIGDNYPPPLDANLVMAVMSMWTRL  263

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL+ I+ ETERRG++FDQLLTIPEQDEWVYSDGKSTTC
Sbjct  264  QPLYAANMWNEALNKRLGTEGLDLHGIIVETERRGMSFDQLLTIPEQDEWVYSDGKSTTC  323

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+G+F   AESIQVTEFTIRDAYMLKI+E+NQ RLPSWCN+  DKLPFCQI
Sbjct  324  VAFILAMYKEAGIFAPFAESIQVTEFTIRDAYMLKIFEDNQARLPSWCNTEADKLPFCQI  383

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELP YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  384  LGEYRMELPEYNTIEPYAKMNENCPSLPPTYKRPARC  420



>ref|XP_003552001.1| PREDICTED: uncharacterized protein LOC100815535 [Glycine max]
 gb|KHN28269.1| hypothetical protein glysoja_040924 [Glycine soja]
Length=531

 Score =   399 bits (1024),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 204/217 (94%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PE+RA+FNSTAAWEY R M GKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTR+
Sbjct  315  PEIRAKFNSTAAWEYARSMSGKPYGYHNMIFSWIDTVADNYPPPLDAHLVISVMSMWTRL  374

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP Y+ANMWNEALNKRLGTEGLDL++IL ETE+RG+ FD+LLTIPEQDEWVYSDGKSTTC
Sbjct  375  QPAYSANMWNEALNKRLGTEGLDLHDILVETEKRGIPFDELLTIPEQDEWVYSDGKSTTC  434

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL+MYKE+ VFG +A SIQVTEFTIRDAYML+I+E+NQTRLPSWCN+ ND++PFCQI
Sbjct  435  VAFILSMYKEAEVFGPIANSIQVTEFTIRDAYMLRIFEDNQTRLPSWCNNENDRIPFCQI  494

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY+MELPGYNTLEPYANMNE CPSLPP+Y+RP  C
Sbjct  495  LGEYKMELPGYNTLEPYANMNEYCPSLPPTYDRPSRC  531



>ref|XP_009757019.1| PREDICTED: uncharacterized protein LOC104250177 [Nicotiana sylvestris]
Length=523

 Score =   398 bits (1022),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 183/217 (84%), Positives = 201/217 (93%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PEVR RFN+TAAWEY R M GKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTR+
Sbjct  307  PEVRTRFNNTAAWEYARKMSGKPYGYHNMIFSWIDTVADNYPPPLDAHLVISVMSMWTRV  366

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY ILAETE+RG+TFDQLLTIPEQDEWVYSDGKSTTC
Sbjct  367  QPAYAANMWNEALNKRLGTEDLDLYGILAETEKRGITFDQLLTIPEQDEWVYSDGKSTTC  426

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+GVFG ++ SIQVTEFTI+DAY LKI+E+NQTRLPSWCNS  +K+ FCQI
Sbjct  427  VAFILAMYKEAGVFGPISNSIQVTEFTIKDAYTLKIFEDNQTRLPSWCNSRENKVSFCQI  486

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY MELP YNTLEPYANMNENCPSLPP+YERP+ C
Sbjct  487  LGEYEMELPQYNTLEPYANMNENCPSLPPNYERPVRC  523



>gb|KJB61188.1| hypothetical protein B456_009G345200 [Gossypium raimondii]
Length=527

 Score =   397 bits (1021),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 183/217 (84%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FNSTAAWEY R M GKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTR+
Sbjct  311  PDIRAKFNSTAAWEYARSMSGKPYGYHNMIFSWIDTVADNYPPPLDAHLVISVMSMWTRV  370

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY IL ETERRG+TFDQLLTIPEQDEWVYSDGKSTTC
Sbjct  371  QPAYAANMWNEALNKRLGTEDLDLYRILEETERRGITFDQLLTIPEQDEWVYSDGKSTTC  430

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL MYKE+GVFG L+ SIQVTEFTIRDAYMLKI+ENNQT LPSWCN+G+ +LPFCQI
Sbjct  431  VAFILEMYKEAGVFGPLSNSIQVTEFTIRDAYMLKIFENNQTNLPSWCNNGDGRLPFCQI  490

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY MELP YN+LEPYANMNENCPSLPP Y+RP  C
Sbjct  491  LGEYWMELPFYNSLEPYANMNENCPSLPPIYDRPTRC  527



>gb|KHG00924.1| Protein FAM69A [Gossypium arboreum]
Length=527

 Score =   397 bits (1020),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 183/217 (84%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FNSTAAWEY R M GKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTR+
Sbjct  311  PDIRAKFNSTAAWEYARSMSGKPYGYHNMIFSWIDTVADNYPPPLDAHLVISVMSMWTRV  370

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY IL ETERRG+TFDQLLTIPEQDEWVYSDGKSTTC
Sbjct  371  QPAYAANMWNEALNKRLGTEDLDLYGILEETERRGITFDQLLTIPEQDEWVYSDGKSTTC  430

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL MYKE+GVFG L+ SIQVTEFTIRDAYMLKI+ENNQT LPSWCN+G+ +LPFCQI
Sbjct  431  VAFILEMYKEAGVFGPLSNSIQVTEFTIRDAYMLKIFENNQTNLPSWCNNGDGRLPFCQI  490

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY MELP YN+LEPYANMNENCPSLPP Y+RP  C
Sbjct  491  LGEYWMELPFYNSLEPYANMNENCPSLPPIYDRPTRC  527



>ref|XP_008339979.1| PREDICTED: uncharacterized protein LOC103402967 [Malus domestica]
Length=526

 Score =   397 bits (1020),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 181/217 (83%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PEVRA+FNSTAAWEYVR M GKPYGYHNMIFSWIDT++DN+PPP+D HLV+SVMSMWTRM
Sbjct  310  PEVRAKFNSTAAWEYVRSMSGKPYGYHNMIFSWIDTMADNFPPPLDTHLVVSVMSMWTRM  369

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDLYEILAE E R + FD LLTIPEQDEWVYSDGKSTTC
Sbjct  370  QPAYAANMWNEALNKRLGTEGLDLYEILAEVESREMAFDHLLTIPEQDEWVYSDGKSTTC  429

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+G+FG ++ SIQVTEFTIRDAYMLKI+E+N TRLPSWCN  ++KLPFCQI
Sbjct  430  VAFILAMYKEAGIFGPISNSIQVTEFTIRDAYMLKIFEDNXTRLPSWCNGKDEKLPFCQI  489

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELP YNTLEPYANMNE+CPSLPP+Y+RP  C
Sbjct  490  LGEYRMELPLYNTLEPYANMNEHCPSLPPTYDRPTRC  526



>ref|XP_008446261.1| PREDICTED: uncharacterized protein LOC103489044 [Cucumis melo]
Length=524

 Score =   396 bits (1017),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 203/217 (94%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RARFNS+AAWEY R M GKPYGYHNMIFSWIDT++DN+PPP+DAHLVISVMSMWTR+
Sbjct  308  PQMRARFNSSAAWEYARSMSGKPYGYHNMIFSWIDTVTDNFPPPLDAHLVISVMSMWTRL  367

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDL++IL ETE+RG+ FD+LLTIPEQDEWVYSDGKSTTC
Sbjct  368  QPAYAANMWNEALNKRLGTEDLDLHDILVETEKRGIPFDELLTIPEQDEWVYSDGKSTTC  427

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+G+FG ++ SIQVTEFTIRDAYMLKI+E+N TRLP+WCN+ +DKLPFCQI
Sbjct  428  VAFILAMYKEAGIFGPVSSSIQVTEFTIRDAYMLKIFEDNHTRLPTWCNNESDKLPFCQI  487

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY+MELP YNTLEPYANMNENCPSLPP+Y+RP  C
Sbjct  488  LGEYKMELPQYNTLEPYANMNENCPSLPPTYDRPTQC  524



>ref|XP_011012739.1| PREDICTED: uncharacterized protein LOC105116927 [Populus euphratica]
Length=540

 Score =   396 bits (1018),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 180/217 (83%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FNSTAAWEY R M GKPYGYHNMIFSWIDTI+DNYPPP+DAHLVISVMSMWTR+
Sbjct  324  PDVRAKFNSTAAWEYARSMSGKPYGYHNMIFSWIDTIADNYPPPLDAHLVISVMSMWTRV  383

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY IL ETERRG+ FD+LLT+PE DEWVYSDG+STTC
Sbjct  384  QPAYAANMWNEALNKRLGTEDLDLYGILGETERRGIAFDELLTVPEHDEWVYSDGQSTTC  443

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYK +GVFG ++ S+QVTEFTIRDAYMLKI+ENNQTRLP WCN+GN +LPFCQI
Sbjct  444  VAFILAMYKAAGVFGPVSSSVQVTEFTIRDAYMLKIFENNQTRLPRWCNNGNVQLPFCQI  503

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY+MELP YN++EPYANMNENCPSLPP YERPI C
Sbjct  504  LGEYQMELPEYNSVEPYANMNENCPSLPPVYERPIQC  540



>ref|XP_008389573.1| PREDICTED: uncharacterized protein LOC103451910 [Malus domestica]
Length=526

 Score =   396 bits (1017),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PE+RA+FNSTAAWEY R M GKPYGYHNMIFSWIDT++DN+PPP+D HLV+SVMSMWTR+
Sbjct  310  PELRAKFNSTAAWEYARSMSGKPYGYHNMIFSWIDTMADNFPPPLDTHLVVSVMSMWTRI  369

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDLYEILAE E R + FD LLTIPEQDEWVYSDGKSTTC
Sbjct  370  QPAYAANMWNEALNKRLGTEGLDLYEILAEVESREMAFDHLLTIPEQDEWVYSDGKSTTC  429

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+G+FG ++ SIQVTEFTIRDAYMLKI+E+NQTRLPSWCN  ++KLPFCQI
Sbjct  430  VAFILAMYKEAGIFGPISNSIQVTEFTIRDAYMLKIFEDNQTRLPSWCNGKDEKLPFCQI  489

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELP YNTLEPYANMNE+CPSLPP+Y+RP  C
Sbjct  490  LGEYRMELPLYNTLEPYANMNEHCPSLPPTYDRPTRC  526



>ref|XP_011015682.1| PREDICTED: uncharacterized protein LOC105119255 [Populus euphratica]
Length=540

 Score =   396 bits (1018),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 180/217 (83%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FNSTAAWEY R M GKPYGYHNMIFSWIDTI+DNYPPP+DAHLVISVMSMWTR+
Sbjct  324  PDVRAKFNSTAAWEYARSMSGKPYGYHNMIFSWIDTIADNYPPPLDAHLVISVMSMWTRV  383

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY IL ETERRG+ FD+LLT+PE DEWVYSDG+STTC
Sbjct  384  QPAYAANMWNEALNKRLGTEDLDLYGILGETERRGIAFDELLTVPEHDEWVYSDGQSTTC  443

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYK +GVFG ++ S+QVTEFTIRDAYMLKI+ENNQTRLP WCN+GN +LPFCQI
Sbjct  444  VAFILAMYKAAGVFGPVSSSVQVTEFTIRDAYMLKIFENNQTRLPRWCNNGNVQLPFCQI  503

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY+MELP YN++EPYANMNENCPSLPP YERPI C
Sbjct  504  LGEYQMELPEYNSVEPYANMNENCPSLPPVYERPIQC  540



>ref|NP_001063085.1| Os09g0392000 [Oryza sativa Japonica Group]
 dbj|BAD26533.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF24999.1| Os09g0392000 [Oryza sativa Japonica Group]
 gb|EAZ44615.1| hypothetical protein OsJ_29237 [Oryza sativa Japonica Group]
 dbj|BAG99992.1| unnamed protein product [Oryza sativa Japonica Group]
Length=546

 Score =   396 bits (1018),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 201/217 (93%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRARFN +AAW+Y R M+GKPYGYHNMIFSWIDTI DNYPPP+DA+LV++VMSMWTR+
Sbjct  330  PDVRARFNESAAWDYARSMVGKPYGYHNMIFSWIDTIGDNYPPPLDANLVMAVMSMWTRL  389

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL+ I+ ETERRG++FDQLLTIPEQDEWVYSDGKSTTC
Sbjct  390  QPLYAANMWNEALNKRLGTEGLDLHGIIVETERRGMSFDQLLTIPEQDEWVYSDGKSTTC  449

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+G+F   AESIQVTEFTIRDAYMLKI+E+NQ RLPSWCN+ +DKLPFCQI
Sbjct  450  VAFILAMYKEAGIFTPFAESIQVTEFTIRDAYMLKIFEDNQARLPSWCNTESDKLPFCQI  509

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELP YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  510  LGEYRMELPEYNTIEPYAKMNENCPSLPPTYKRPARC  546



>gb|EAZ08986.1| hypothetical protein OsI_31250 [Oryza sativa Indica Group]
Length=546

 Score =   396 bits (1018),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 201/217 (93%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRARFN +AAW+Y R M+GKPYGYHNMIFSWIDTI DNYPPP+DA+LV++VMSMWTR+
Sbjct  330  PDVRARFNESAAWDYARSMVGKPYGYHNMIFSWIDTIGDNYPPPLDANLVMAVMSMWTRL  389

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL+ I+ ETERRG++FDQLLTIPEQDEWVYSDGKSTTC
Sbjct  390  QPLYAANMWNEALNKRLGTEGLDLHGIIVETERRGMSFDQLLTIPEQDEWVYSDGKSTTC  449

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+G+F   AESIQVTEFTIRDAYMLKI+E+NQ RLPSWCN+ +DKLPFCQI
Sbjct  450  VAFILAMYKEAGIFTPFAESIQVTEFTIRDAYMLKIFEDNQARLPSWCNTESDKLPFCQI  509

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELP YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  510  LGEYRMELPEYNTIEPYAKMNENCPSLPPTYKRPARC  546



>ref|XP_007222590.1| hypothetical protein PRUPE_ppa004148mg [Prunus persica]
 gb|EMJ23789.1| hypothetical protein PRUPE_ppa004148mg [Prunus persica]
Length=526

 Score =   395 bits (1016),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 199/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PE+RA+FNSTAAWEY R M GKPYGYHNMIFSWIDT++DNYPPP+D HLV+SVMSMWTRM
Sbjct  310  PELRAKFNSTAAWEYARSMSGKPYGYHNMIFSWIDTMADNYPPPLDTHLVVSVMSMWTRM  369

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDLYEIL E E R + FD LLTIPEQDEWVYSDGKSTTC
Sbjct  370  QPAYAANMWNEALNKRLGTEGLDLYEILTEVENREIAFDHLLTIPEQDEWVYSDGKSTTC  429

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+G+FG ++ SIQVTEFTIRDAYMLKI+E+NQTRLPSWCN  ++KLPFCQI
Sbjct  430  VAFILAMYKEAGIFGPISNSIQVTEFTIRDAYMLKIFEDNQTRLPSWCNGKDEKLPFCQI  489

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELP YNT+EPY NMNE+CPSLPP+Y+RP+ C
Sbjct  490  LGEYRMELPEYNTIEPYTNMNEHCPSLPPTYDRPLRC  526



>ref|XP_006438501.1| hypothetical protein CICLE_v10031248mg [Citrus clementina]
 ref|XP_006483762.1| PREDICTED: uncharacterized protein LOC102615522 [Citrus sinensis]
 gb|ESR51741.1| hypothetical protein CICLE_v10031248mg [Citrus clementina]
Length=518

 Score =   395 bits (1015),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/217 (84%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FNSTAAWEY R M GKPYGYHNMIFSWIDT++DNYPPP+DAHLV+SVMSMWTR+
Sbjct  302  PDVRAKFNSTAAWEYARSMSGKPYGYHNMIFSWIDTMADNYPPPLDAHLVVSVMSMWTRV  361

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDL+ IL E E+RG++FDQLLTIPEQDEWVYSDGKSTTC
Sbjct  362  QPAYAANMWNEALNKRLGTEDLDLHGILDEIEKRGISFDQLLTIPEQDEWVYSDGKSTTC  421

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL MYKE+GVFG ++ SIQVTEFTIRDAYMLKI+ENNQTRLPSWCN+   KLPFCQI
Sbjct  422  VAFILEMYKEAGVFGPISNSIQVTEFTIRDAYMLKIFENNQTRLPSWCNNEEAKLPFCQI  481

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELP YNT+EPYANMNENCPSLPPSYERP  C
Sbjct  482  LGEYRMELPQYNTIEPYANMNENCPSLPPSYERPQRC  518



>ref|XP_004504499.1| PREDICTED: uncharacterized protein LOC101510072 [Cicer arietinum]
Length=520

 Score =   395 bits (1014),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 202/217 (93%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++R++FN TAAWEY R M GKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTRM
Sbjct  304  PKLRSKFNLTAAWEYARSMSGKPYGYHNMIFSWIDTVADNYPPPLDAHLVISVMSMWTRM  363

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP+YAANMWNEALNKRLGTE LDL++IL ETE+RG+ FD+LL IPEQDEWVYSDGKSTTC
Sbjct  364  QPSYAANMWNEALNKRLGTEDLDLHDILLETEKRGIAFDELLAIPEQDEWVYSDGKSTTC  423

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL+MYKE+G+FG +  SIQVTEFTIRDAYML+I+E+NQTRLP WCN+ NDKLPFCQI
Sbjct  424  VAFILSMYKEAGIFGPVTSSIQVTEFTIRDAYMLRIFEDNQTRLPRWCNNANDKLPFCQI  483

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELPGYNTL+PYANMNE+CPSLPP+Y+RP  C
Sbjct  484  LGEYRMELPGYNTLDPYANMNEHCPSLPPTYDRPSKC  520



>ref|XP_008244965.1| PREDICTED: uncharacterized protein LOC103343066 [Prunus mume]
Length=526

 Score =   395 bits (1015),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 199/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PE+RA+FNSTAAWEY R M GKPYGYHNMIFSWIDT++DNYPPP+D HLV+SVMSMWTRM
Sbjct  310  PELRAKFNSTAAWEYARSMSGKPYGYHNMIFSWIDTMADNYPPPLDTHLVVSVMSMWTRM  369

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDLYEIL E E R + FD LLTIPE+DEWVYSDGKSTTC
Sbjct  370  QPAYAANMWNEALNKRLGTEGLDLYEILTEVENREIAFDHLLTIPEKDEWVYSDGKSTTC  429

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+G+FG ++ SIQVTEFTIRDAYMLKI+E+NQTRLPSWCN  N+KLPFCQI
Sbjct  430  VAFILAMYKEAGIFGPISNSIQVTEFTIRDAYMLKIFEDNQTRLPSWCNGKNEKLPFCQI  489

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELP YNT+EPY NMNE+CPSLPP+Y+RP+ C
Sbjct  490  LGEYRMELPEYNTIEPYTNMNEHCPSLPPTYDRPLRC  526



>ref|XP_003613417.1| hypothetical protein MTR_5g036420 [Medicago truncatula]
 gb|AES96375.1| plant/F10M23-360 protein [Medicago truncatula]
Length=522

 Score =   395 bits (1015),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 201/217 (93%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PE+RA+FNSTAAWEY R M GKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTRM
Sbjct  306  PEMRAKFNSTAAWEYARSMSGKPYGYHNMIFSWIDTVADNYPPPLDAHLVISVMSMWTRM  365

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDL++I+ ETE+RG+ FD+LL IPEQD+WVYSDGKSTTC
Sbjct  366  QPAYAANMWNEALNKRLGTEDLDLHDIILETEKRGIAFDELLAIPEQDDWVYSDGKSTTC  425

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL+MYKE+G+FG ++ SIQVTEFTIRDAYML+I+E+NQTRLP WCN+ NDKLPFCQI
Sbjct  426  VAFILSMYKEAGIFGPISSSIQVTEFTIRDAYMLRIFEDNQTRLPRWCNNENDKLPFCQI  485

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRME PGYNTL PYANMNE+CPSLPP+Y+RP  C
Sbjct  486  LGEYRMEFPGYNTLVPYANMNEHCPSLPPTYDRPSQC  522



>ref|XP_006378189.1| hypothetical protein POPTR_0010s04630g [Populus trichocarpa]
 gb|ERP55986.1| hypothetical protein POPTR_0010s04630g [Populus trichocarpa]
Length=514

 Score =   394 bits (1013),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 179/216 (83%), Positives = 200/216 (93%), Gaps = 0/216 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FNSTAAWEY R M GKPYGYHNMIFSWIDTI+DNYPPP+DAHLVISVMSMWTR+
Sbjct  286  PDVRAKFNSTAAWEYARSMSGKPYGYHNMIFSWIDTIADNYPPPLDAHLVISVMSMWTRV  345

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY IL ETERRG+ FD+LLT+PE DEWVYSDG+STTC
Sbjct  346  QPAYAANMWNEALNKRLGTEDLDLYGILGETERRGIAFDELLTVPEHDEWVYSDGQSTTC  405

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYK +GVFG ++ S+QVTEFTIRDAYMLKI+ENNQTRLPSWCN+GN +LPFCQI
Sbjct  406  VAFILAMYKAAGVFGPVSSSVQVTEFTIRDAYMLKIFENNQTRLPSWCNNGNVQLPFCQI  465

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIH  50
            +GEY+MELP YN++EPYANMNENCPSLPP Y+RPI 
Sbjct  466  LGEYQMELPEYNSVEPYANMNENCPSLPPVYDRPIQ  501



>ref|XP_010533011.1| PREDICTED: uncharacterized protein LOC104808873 [Tarenaya hassleriana]
Length=530

 Score =   395 bits (1014),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 181/217 (83%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FN+TAAWEY R M GKPYGYHNMIFSWIDT++DNYPPP+DAHL+ISVMSMWTR+
Sbjct  314  PDVRAKFNNTAAWEYARSMSGKPYGYHNMIFSWIDTLADNYPPPLDAHLLISVMSMWTRV  373

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QPTYAANMWNEALNKRLGTEGLDLYEILAETERRG+TFD+LLTIPE+DEWVYSDGKSTTC
Sbjct  374  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGMTFDELLTIPERDEWVYSDGKSTTC  433

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL MYK +GVFG LA+ IQVTEFTIRDAY L+IYE+NQTRLPSWCN    KLPFCQI
Sbjct  434  VAFILQMYKAAGVFGPLADHIQVTEFTIRDAYALRIYEDNQTRLPSWCNDEEGKLPFCQI  493

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +G YRMELPGYN++EPYANMNE+CPSLPP Y RP  C
Sbjct  494  LGGYRMELPGYNSVEPYANMNEHCPSLPPDYGRPSKC  530



>gb|KDP21286.1| hypothetical protein JCGZ_21757 [Jatropha curcas]
Length=529

 Score =   394 bits (1012),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 181/217 (83%), Positives = 199/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FNSTAAWEY R M GKPYGYHNMIFSWIDTI+DNYPPP+DAHLVISVMSMWTR+
Sbjct  313  PDVRAKFNSTAAWEYARSMSGKPYGYHNMIFSWIDTIADNYPPPLDAHLVISVMSMWTRV  372

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY ILAE E+RG+ FD+LLT PEQDEW+YSDGKSTTC
Sbjct  373  QPAYAANMWNEALNKRLGTEDLDLYGILAEIEKRGIAFDELLTAPEQDEWIYSDGKSTTC  432

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+GVFG ++ SIQVTEFTIRDAYMLKI+ENNQTRLP WCN+ N +LPFCQI
Sbjct  433  VAFILAMYKEAGVFGPISSSIQVTEFTIRDAYMLKIFENNQTRLPGWCNNDNGRLPFCQI  492

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY MELP YNT+EPYANMNENCPSLPPSY+RP  C
Sbjct  493  LGEYWMELPEYNTVEPYANMNENCPSLPPSYDRPGRC  529



>ref|XP_006378188.1| hypothetical protein POPTR_0010s04630g [Populus trichocarpa]
 gb|ERP55985.1| hypothetical protein POPTR_0010s04630g [Populus trichocarpa]
Length=552

 Score =   394 bits (1013),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 179/216 (83%), Positives = 200/216 (93%), Gaps = 0/216 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FNSTAAWEY R M GKPYGYHNMIFSWIDTI+DNYPPP+DAHLVISVMSMWTR+
Sbjct  324  PDVRAKFNSTAAWEYARSMSGKPYGYHNMIFSWIDTIADNYPPPLDAHLVISVMSMWTRV  383

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY IL ETERRG+ FD+LLT+PE DEWVYSDG+STTC
Sbjct  384  QPAYAANMWNEALNKRLGTEDLDLYGILGETERRGIAFDELLTVPEHDEWVYSDGQSTTC  443

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYK +GVFG ++ S+QVTEFTIRDAYMLKI+ENNQTRLPSWCN+GN +LPFCQI
Sbjct  444  VAFILAMYKAAGVFGPVSSSVQVTEFTIRDAYMLKIFENNQTRLPSWCNNGNVQLPFCQI  503

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIH  50
            +GEY+MELP YN++EPYANMNENCPSLPP Y+RPI 
Sbjct  504  LGEYQMELPEYNSVEPYANMNENCPSLPPVYDRPIQ  539



>ref|XP_004135222.1| PREDICTED: uncharacterized protein LOC101209749 [Cucumis sativus]
 ref|XP_004155340.1| PREDICTED: uncharacterized LOC101209749 [Cucumis sativus]
 gb|KGN51842.1| hypothetical protein Csa_5G603390 [Cucumis sativus]
Length=524

 Score =   392 bits (1008),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 203/217 (94%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FNS+AAWEY R M GKPYGYHNMIFSWIDT++DN+PPP+DAHLVISVMSMWTR+
Sbjct  308  PQMRAKFNSSAAWEYARSMSGKPYGYHNMIFSWIDTVTDNFPPPLDAHLVISVMSMWTRL  367

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDL++IL ETE+RG+ FD+LLTIPEQD+WVYSDGKSTTC
Sbjct  368  QPAYAANMWNEALNKRLGTEDLDLHDILVETEKRGIPFDELLTIPEQDDWVYSDGKSTTC  427

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+G+FG ++ SIQVTEFTIRDAYMLKI+E+N TRLP+WCN+ +DKLPFCQI
Sbjct  428  VAFILAMYKEAGIFGPVSSSIQVTEFTIRDAYMLKIFEDNHTRLPTWCNNESDKLPFCQI  487

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY+MELP +NTLEPYANMNENCPSLPP+Y+RP  C
Sbjct  488  LGEYKMELPQFNTLEPYANMNENCPSLPPTYDRPTQC  524



>ref|XP_004956736.1| PREDICTED: uncharacterized protein LOC101782072 [Setaria italica]
Length=538

 Score =   393 bits (1010),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 201/217 (93%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRARFN +AAWEYVR M+GKPYGYHNMIFSWIDTI DNYPPP+DA+LV++VMSMWTR+
Sbjct  322  PDVRARFNESAAWEYVRSMVGKPYGYHNMIFSWIDTIGDNYPPPLDANLVMTVMSMWTRV  381

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL  I+ ETERRG++FDQLLTIPEQDEW+YSDGKSTTC
Sbjct  382  QPLYAANMWNEALNKRLGTEGLDLKGIIMETERRGMSFDQLLTIPEQDEWIYSDGKSTTC  441

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+G+FG  AESIQVTEFTIRDAYMLKI+E++  RLPSWCN+ +DKLPFCQI
Sbjct  442  VAFILAMYKEAGIFGPFAESIQVTEFTIRDAYMLKIFEDSLARLPSWCNTESDKLPFCQI  501

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELP YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  502  LGEYRMELPEYNTVEPYAKMNENCPSLPPTYKRPARC  538



>ref|XP_004297675.1| PREDICTED: uncharacterized protein LOC101296656 [Fragaria vesca 
subsp. vesca]
Length=516

 Score =   392 bits (1006),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 199/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PE+R +FNSTAAWEY R M GKPYGYHNMIFSWIDT+++NYPPP+D HLV+SVMSMWTR+
Sbjct  300  PELREKFNSTAAWEYARSMSGKPYGYHNMIFSWIDTMAENYPPPLDTHLVVSVMSMWTRV  359

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRL TEGLDLYEILAE E RG++ D LLTIPEQDEWVYSDGKSTTC
Sbjct  360  QPAYAANMWNEALNKRLSTEGLDLYEILAEVENRGISVDHLLTIPEQDEWVYSDGKSTTC  419

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+G+FG ++ SIQVTEFTIRDAYMLKI+ENNQTRLPSWCN G++KLPFCQI
Sbjct  420  VAFILAMYKEAGIFGPISNSIQVTEFTIRDAYMLKIFENNQTRLPSWCNLGDEKLPFCQI  479

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELP YNT+EPYANMNE+CPSLPP+Y RP  C
Sbjct  480  LGEYRMELPEYNTIEPYANMNEHCPSLPPTYIRPSQC  516



>ref|XP_010512094.1| PREDICTED: uncharacterized protein LOC104788107 [Camelina sativa]
Length=531

 Score =   392 bits (1007),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 180/217 (83%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RARFN+TAAWEY R MLGKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTR+
Sbjct  315  PDIRARFNNTAAWEYARSMLGKPYGYHNMIFSWIDTLADNYPPPLDAHLVISVMSMWTRV  374

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLTIPEQDEWVYSDGKSTTC
Sbjct  375  QPAYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLTIPEQDEWVYSDGKSTTC  434

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYK +GVF  LA+ IQVTEFTIRDAY LK+YENNQTRLPSWCN+   KL FCQI
Sbjct  435  VAFILAMYKAAGVFDPLADHIQVTEFTIRDAYTLKLYENNQTRLPSWCNTEEGKLEFCQI  494

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELPGYNT++PY NMNENCPSLPP+YERP  C
Sbjct  495  LGEYRMELPGYNTIDPYPNMNENCPSLPPNYERPSKC  531



>ref|XP_010652908.1| PREDICTED: uncharacterized protein LOC100251867 isoform X2 [Vitis 
vinifera]
Length=430

 Score =   388 bits (997),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 197/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN+TAAWEY R M GKPYGYHNMIFSWIDTI+DNYPPP+DAHLVISVMSMWTRM
Sbjct  214  PDLRAKFNATAAWEYARSMAGKPYGYHNMIFSWIDTIADNYPPPLDAHLVISVMSMWTRM  273

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YA NMWNEALNKRL TE LDL  ILAETE+RGLTFDQLLTIPEQDEWVYSDGKSTTC
Sbjct  274  QPAYAENMWNEALNKRLETEDLDLLGILAETEKRGLTFDQLLTIPEQDEWVYSDGKSTTC  333

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL MYKE+G+FG  + SIQVTEFTIRDAYMLKI+ENNQ+RLPSWC   + +L FCQI
Sbjct  334  VAFILEMYKEAGIFGPASSSIQVTEFTIRDAYMLKIFENNQSRLPSWCGDEDGRLQFCQI  393

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELP YNT+EPYA+MNENCPSLPP+YERP+ C
Sbjct  394  LGEYRMELPQYNTIEPYAHMNENCPSLPPTYERPVGC  430



>dbj|BAD94699.1| hypothetical protein [Arabidopsis thaliana]
Length=258

 Score =   382 bits (980),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN+TAAWEY R MLGKPYGYHNMIFSWIDT+ DNYPPP+DAHLVISVMSMWTR+
Sbjct  42   PDIRAKFNNTAAWEYARSMLGKPYGYHNMIFSWIDTLGDNYPPPLDAHLVISVMSMWTRV  101

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLTIPEQDEWVYSDGKSTTC
Sbjct  102  QPAYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLTIPEQDEWVYSDGKSTTC  161

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYK +G+F  LA+ IQVTEFTIRDAY LK++E+NQTRLPSWCN+   KL FCQI
Sbjct  162  VAFILAMYKAAGIFDPLADHIQVTEFTIRDAYTLKLFESNQTRLPSWCNTEEGKLDFCQI  221

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELPGYNT+ PY NMN+NCPSLPP+YERP  C
Sbjct  222  LGEYRMELPGYNTIYPYPNMNQNCPSLPPNYERPSKC  258



>ref|XP_007153681.1| hypothetical protein PHAVU_003G055900g [Phaseolus vulgaris]
 gb|ESW25675.1| hypothetical protein PHAVU_003G055900g [Phaseolus vulgaris]
Length=522

 Score =   391 bits (1005),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 201/216 (93%), Gaps = 0/216 (0%)
 Frame = -1

Query  694  EVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRMQ  515
            E+RA+FN+TAAWEY R M GKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTR+Q
Sbjct  307  EIRAKFNNTAAWEYARSMSGKPYGYHNMIFSWIDTVADNYPPPLDAHLVISVMSMWTRLQ  366

Query  514  PTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCV  335
            P Y+ANMWNEALNKRLGTEGLDL++I+ ETE+RG+ FD+LLTIPEQDEWVYSDGKSTTCV
Sbjct  367  PAYSANMWNEALNKRLGTEGLDLHDIIVETEKRGIPFDELLTIPEQDEWVYSDGKSTTCV  426

Query  334  AFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQIV  155
            AFIL+MYKE+GVFG ++ SIQVTEFTIRDAYML+I+E+NQTRLP WCN+ ND+L FCQI+
Sbjct  427  AFILSMYKEAGVFGPVSSSIQVTEFTIRDAYMLRIFEDNQTRLPRWCNNENDQLSFCQIL  486

Query  154  GEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            GEYRMELPGYNTLEPYANMNE CPSLPP Y+RP  C
Sbjct  487  GEYRMELPGYNTLEPYANMNEYCPSLPPIYDRPSQC  522



>ref|XP_006390921.1| hypothetical protein EUTSA_v10018393mg [Eutrema salsugineum]
 gb|ESQ28207.1| hypothetical protein EUTSA_v10018393mg [Eutrema salsugineum]
Length=529

 Score =   391 bits (1005),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 199/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN+TAAWEY R MLGKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTR+
Sbjct  313  PDIRAKFNNTAAWEYARSMLGKPYGYHNMIFSWIDTLADNYPPPLDAHLVISVMSMWTRV  372

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP+YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLTIPEQDEWVYSDGKSTTC
Sbjct  373  QPSYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLTIPEQDEWVYSDGKSTTC  432

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYK +GVFG LA+ IQVTEFTIRDAY L+++E NQTRLPSWCN+   KL FCQI
Sbjct  433  VAFILAMYKAAGVFGPLADHIQVTEFTIRDAYTLRLFEENQTRLPSWCNTEEGKLEFCQI  492

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELPGYNT++PYANMNENCPSLPP YERP  C
Sbjct  493  LGEYRMELPGYNTIQPYANMNENCPSLPPDYERPSKC  529



>ref|XP_006300446.1| hypothetical protein CARUB_v10020126mg [Capsella rubella]
 gb|EOA33344.1| hypothetical protein CARUB_v10020126mg [Capsella rubella]
Length=531

 Score =   391 bits (1005),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN+TAAWEY R MLGKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTR+
Sbjct  315  PDIRAKFNNTAAWEYARSMLGKPYGYHNMIFSWIDTLADNYPPPLDAHLVISVMSMWTRV  374

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLTIPEQDEWVYSDGKSTTC
Sbjct  375  QPAYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLTIPEQDEWVYSDGKSTTC  434

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYK +GVFG LA++IQVTEFTIRDAY LK+YE+NQTRLPSWCN+   KL FCQI
Sbjct  435  VAFILAMYKAAGVFGPLADNIQVTEFTIRDAYALKLYESNQTRLPSWCNTEEGKLDFCQI  494

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELPGYNT++PY NMN+NCPSLPP+YERP  C
Sbjct  495  LGEYRMELPGYNTIDPYPNMNQNCPSLPPNYERPSKC  531



>ref|XP_010415693.1| PREDICTED: uncharacterized protein LOC104701657 [Camelina sativa]
Length=531

 Score =   391 bits (1005),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN+TAAWEY R MLGKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTR+
Sbjct  315  PDIRAKFNNTAAWEYARSMLGKPYGYHNMIFSWIDTLADNYPPPLDAHLVISVMSMWTRV  374

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLTIPEQDEWVYSDGKSTTC
Sbjct  375  QPAYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLTIPEQDEWVYSDGKSTTC  434

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYK +GVF  LA+ IQVTEFTIRDAY LK+YENNQTRLPSWCN+   KL FCQI
Sbjct  435  VAFILAMYKAAGVFDPLADHIQVTEFTIRDAYTLKLYENNQTRLPSWCNTEEGKLEFCQI  494

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELPGYNT++PY NMNENCPSLPP+YERP  C
Sbjct  495  LGEYRMELPGYNTIDPYPNMNENCPSLPPNYERPSKC  531



>ref|XP_010471012.1| PREDICTED: uncharacterized protein LOC104750861 [Camelina sativa]
Length=532

 Score =   391 bits (1005),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN+TAAWEY R MLGKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTR+
Sbjct  316  PDIRAKFNNTAAWEYARSMLGKPYGYHNMIFSWIDTLADNYPPPLDAHLVISVMSMWTRV  375

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLTIPEQDEWVYSDGKSTTC
Sbjct  376  QPAYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLTIPEQDEWVYSDGKSTTC  435

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYK +GVF  LA+ IQVTEFTIRDAY LK+YENNQTRLPSWCN+   KL FCQI
Sbjct  436  VAFILAMYKAAGVFDPLADHIQVTEFTIRDAYTLKLYENNQTRLPSWCNTEEGKLEFCQI  495

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELPGYNT++PY NMNENCPSLPP+YERP  C
Sbjct  496  LGEYRMELPGYNTIDPYPNMNENCPSLPPNYERPSKC  532



>ref|XP_010913432.1| PREDICTED: uncharacterized protein LOC105039122 isoform X1 [Elaeis 
guineensis]
Length=534

 Score =   391 bits (1005),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 201/217 (93%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN+TAAW Y R M GKPYGYHNMIFSWIDTI++NYPPP+DA+LV+S+MSMWTR+
Sbjct  318  PDLRAKFNATAAWAYARSMSGKPYGYHNMIFSWIDTITNNYPPPLDANLVMSIMSMWTRL  377

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL++I+ ETERRG+TFDQLLTIPEQDEW YSDGKSTTC
Sbjct  378  QPAYAANMWNEALNKRLGTEGLDLHDIIIETERRGMTFDQLLTIPEQDEWEYSDGKSTTC  437

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL MYKE+G+FG +A SIQVTEFTIRDAYMLKI+ENN TRLPSWCN+  +KLPFCQI
Sbjct  438  VAFILEMYKEAGIFGPIANSIQVTEFTIRDAYMLKIFENNGTRLPSWCNAEEEKLPFCQI  497

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELP YNT+EPYA MNENCPSLPP+YERP+ C
Sbjct  498  LGEYRMELPEYNTIEPYARMNENCPSLPPTYERPVSC  534



>ref|XP_009105692.1| PREDICTED: uncharacterized protein LOC103831561 [Brassica rapa]
Length=526

 Score =   391 bits (1004),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FN+TAAWEY R MLGKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTR+
Sbjct  310  PDVRAKFNNTAAWEYARSMLGKPYGYHNMIFSWIDTLADNYPPPLDAHLVISVMSMWTRV  369

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLTIPEQDEWVYSDGKSTTC
Sbjct  370  QPAYAANMWNEALNKRLGTEELDLYGILEETARRGMSFDELLTIPEQDEWVYSDGKSTTC  429

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYK +GVFG LA+ IQVTEFTIRDAY L+++E+NQTRLPSWCN+   KL FCQI
Sbjct  430  VAFILAMYKAAGVFGPLADHIQVTEFTIRDAYTLRLFEDNQTRLPSWCNTEKGKLEFCQI  489

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GE+RMELPGYNT+EPY NMNENCPSLPP YERP  C
Sbjct  490  LGEFRMELPGYNTIEPYPNMNENCPSLPPDYERPSKC  526



>ref|XP_002887283.1| hypothetical protein ARALYDRAFT_476140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63542.1| hypothetical protein ARALYDRAFT_476140 [Arabidopsis lyrata subsp. 
lyrata]
Length=525

 Score =   390 bits (1003),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 199/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN+TAAWEY R MLGKPYGYHNMIFSWIDT+ DNYPPP+DAHLVISVMSMWTR+
Sbjct  309  PDIRAKFNNTAAWEYARSMLGKPYGYHNMIFSWIDTLGDNYPPPLDAHLVISVMSMWTRV  368

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLTIPEQDEWVYSDGKSTTC
Sbjct  369  QPAYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLTIPEQDEWVYSDGKSTTC  428

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYK +GVFG LA+ IQVTEFTIRDAY LK++E+NQTRLPSWCN+  +KL FCQI
Sbjct  429  VAFILAMYKAAGVFGPLADHIQVTEFTIRDAYTLKLFESNQTRLPSWCNTEEEKLDFCQI  488

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELPGYNT++PY NMN+NCPSLPP+YERP  C
Sbjct  489  LGEYRMELPGYNTIDPYPNMNQNCPSLPPNYERPSKC  525



>ref|XP_002460179.1| hypothetical protein SORBIDRAFT_02g024000 [Sorghum bicolor]
 gb|EER96700.1| hypothetical protein SORBIDRAFT_02g024000 [Sorghum bicolor]
Length=537

 Score =   390 bits (1001),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRARFN +AAWEY + M+G+PYGYHNMIFSWIDTI DNYPPP+DA+LV++VMSMWTR+
Sbjct  321  PDVRARFNESAAWEYAQSMVGQPYGYHNMIFSWIDTIGDNYPPPLDANLVMAVMSMWTRL  380

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL  I+ ETERRG++FDQLLTIPEQDEWVYSDGKSTTC
Sbjct  381  QPVYAANMWNEALNKRLGTEGLDLQGIIIETERRGMSFDQLLTIPEQDEWVYSDGKSTTC  440

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+G+F   +ESIQVTEFTIRDAYMLKI+E+N  RLPSWCN+  DKLPFCQI
Sbjct  441  VAFILAMYKEAGIFAPFSESIQVTEFTIRDAYMLKIFEDNPARLPSWCNTDTDKLPFCQI  500

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELP YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  501  LGEYRMELPEYNTIEPYAKMNENCPSLPPTYKRPARC  537



>emb|CDY38797.1| BnaA07g28690D [Brassica napus]
Length=523

 Score =   389 bits (999),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FN+TAAWEY R MLGKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTR+
Sbjct  307  PDVRAKFNNTAAWEYARSMLGKPYGYHNMIFSWIDTLADNYPPPLDAHLVISVMSMWTRV  366

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLTIPEQDEWVYSDGKSTTC
Sbjct  367  QPAYAANMWNEALNKRLGTEELDLYGILEETARRGMSFDELLTIPEQDEWVYSDGKSTTC  426

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYK +GVFG LA+ IQVTEFTIRDAY L+++E+NQTRLPSWCN+   KL FCQI
Sbjct  427  VAFILAMYKAAGVFGPLADHIQVTEFTIRDAYTLRLFEDNQTRLPSWCNTEKGKLEFCQI  486

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GE+RMELPGYNT++PY NMNENCPSLPP YERP  C
Sbjct  487  LGEFRMELPGYNTIDPYPNMNENCPSLPPDYERPSKC  523



>gb|EPS61168.1| hypothetical protein M569_13630, partial [Genlisea aurea]
Length=249

 Score =   379 bits (972),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+F++ AAWEYVRGM GKPYGYHNMIFSWIDT+++NYPPP+DAHLV+SVMSMW RM
Sbjct  33   PDIRAKFDTKAAWEYVRGMAGKPYGYHNMIFSWIDTVANNYPPPLDAHLVVSVMSMWARM  92

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALN RLGT+ LDLYEIL ETERRG+TFDQLLTIPEQDEW+YSDGKSTTC
Sbjct  93   QPAYAANMWNEALNMRLGTKDLDLYEILFETERRGITFDQLLTIPEQDEWIYSDGKSTTC  152

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL+MYK +GVF   ++S+QVTEFTI+DAYMLKI+E+N TRLP WC +  D L FCQI
Sbjct  153  VAFILSMYKAAGVFSPFSDSVQVTEFTIKDAYMLKIFEDNATRLPGWCQNEKDGLSFCQI  212

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GE+RMELP YNTL+PYANMNENCPSLPP+YERP  C
Sbjct  213  LGEFRMELPYYNTLDPYANMNENCPSLPPTYERPPRC  249



>ref|XP_007044484.1| Zinc finger MYND domain-containing protein 15 isoform 1 [Theobroma 
cacao]
 gb|EOY00316.1| Zinc finger MYND domain-containing protein 15 isoform 1 [Theobroma 
cacao]
Length=527

 Score =   389 bits (998),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 181/217 (83%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VR  FNSTAAWEY R M GKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTR+
Sbjct  311  PDVREDFNSTAAWEYARSMSGKPYGYHNMIFSWIDTVADNYPPPLDAHLVISVMSMWTRV  370

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY IL ETERRG+ FDQLLTIPEQDEWVYSDGKSTTC
Sbjct  371  QPAYAANMWNEALNKRLGTEDLDLYGILDETERRGIAFDQLLTIPEQDEWVYSDGKSTTC  430

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL MYKE+GVFG +A SIQVTEFTIRDAYMLKI+ENNQTRLPSWCN  +   PFCQI
Sbjct  431  VAFILEMYKEAGVFGPIANSIQVTEFTIRDAYMLKIFENNQTRLPSWCNYKDGGFPFCQI  490

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY MELP YNT+EPYANMNENCPSLPP Y+RP  C
Sbjct  491  LGEYWMELPHYNTIEPYANMNENCPSLPPIYDRPTRC  527



>ref|XP_009360447.1| PREDICTED: uncharacterized protein LOC103950916 [Pyrus x bretschneideri]
Length=527

 Score =   388 bits (997),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 178/218 (82%), Positives = 198/218 (91%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PE+RA+FNSTAAWEY R M GKPYGYHNMIFSWIDT++DN+PPP+D HLV+SVMSMWTRM
Sbjct  310  PELRAKFNSTAAWEYARSMSGKPYGYHNMIFSWIDTMADNFPPPLDTHLVVSVMSMWTRM  369

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDLYEILAE E R + FD LLTIPE DEWVYSDGKSTTC
Sbjct  370  QPAYAANMWNEALNKRLGTEGLDLYEILAEVESREMAFDHLLTIPEHDEWVYSDGKSTTC  429

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPS-WCNSGNDKLPFCQ  161
            VAFILAMYKE+G+FG ++ SIQVTEFTIRDAYMLKI+E+NQ RLPS WCN  ++KLPFCQ
Sbjct  430  VAFILAMYKEAGIFGPISNSIQVTEFTIRDAYMLKIFEDNQPRLPSCWCNGKDEKLPFCQ  489

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+GEYRMELP YNTLEPYANMNE+CPSLPP+Y+RP  C
Sbjct  490  ILGEYRMELPLYNTLEPYANMNEHCPSLPPTYDRPTRC  527



>ref|XP_008798032.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103713048 
[Phoenix dactylifera]
Length=539

 Score =   389 bits (998),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 203/217 (94%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN+TAAW Y R M GKPYGYHNMIFSWIDTI++NYPPP+DA+LV+S+MSMWTR+
Sbjct  323  PDLRAKFNATAAWAYARSMSGKPYGYHNMIFSWIDTIANNYPPPLDANLVMSIMSMWTRL  382

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL++I+ ETERRG+TFDQLLTIPEQDEW YSDGKSTTC
Sbjct  383  QPAYAANMWNEALNKRLGTEGLDLHDIIIETERRGMTFDQLLTIPEQDEWEYSDGKSTTC  442

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL MYKE+G+FG +A SIQVTEFTIRDAYMLKI+ENN+TRLPSWCN+  +KLPFCQI
Sbjct  443  VAFILEMYKEAGIFGPIANSIQVTEFTIRDAYMLKIFENNRTRLPSWCNADEEKLPFCQI  502

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +G+Y+MELP YNT+EPYA+MNENCPSLPP+YERP+ C
Sbjct  503  LGDYQMELPDYNTIEPYAHMNENCPSLPPTYERPVIC  539



>ref|XP_002270582.1| PREDICTED: uncharacterized protein LOC100251867 isoform X1 [Vitis 
vinifera]
 emb|CBI32078.3| unnamed protein product [Vitis vinifera]
Length=520

 Score =   388 bits (996),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 197/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN+TAAWEY R M GKPYGYHNMIFSWIDTI+DNYPPP+DAHLVISVMSMWTRM
Sbjct  304  PDLRAKFNATAAWEYARSMAGKPYGYHNMIFSWIDTIADNYPPPLDAHLVISVMSMWTRM  363

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YA NMWNEALNKRL TE LDL  ILAETE+RGLTFDQLLTIPEQDEWVYSDGKSTTC
Sbjct  364  QPAYAENMWNEALNKRLETEDLDLLGILAETEKRGLTFDQLLTIPEQDEWVYSDGKSTTC  423

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL MYKE+G+FG  + SIQVTEFTIRDAYMLKI+ENNQ+RLPSWC   + +L FCQI
Sbjct  424  VAFILEMYKEAGIFGPASSSIQVTEFTIRDAYMLKIFENNQSRLPSWCGDEDGRLQFCQI  483

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELP YNT+EPYA+MNENCPSLPP+YERP+ C
Sbjct  484  LGEYRMELPQYNTIEPYAHMNENCPSLPPTYERPVGC  520



>ref|XP_009127775.1| PREDICTED: uncharacterized protein LOC103852633 [Brassica rapa]
Length=526

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VR +FN+TAAWEY R MLGKPYGYHNMIFSWIDT+ DNYPPP+DAHLVISVMSMWTR+
Sbjct  310  PDVRGKFNNTAAWEYARSMLGKPYGYHNMIFSWIDTLGDNYPPPLDAHLVISVMSMWTRV  369

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLTIPEQDEWVYSDGKSTTC
Sbjct  370  QPAYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLTIPEQDEWVYSDGKSTTC  429

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYK +GVFG LA+ IQVTEFTIRDAY L+++E+NQTRLPSWCN+   KL FCQI
Sbjct  430  VAFILAMYKAAGVFGPLADHIQVTEFTIRDAYTLRLFEDNQTRLPSWCNTEKGKLEFCQI  489

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELPGYNT++PY NMNENCPSLPP YERP  C
Sbjct  490  LGEYRMELPGYNTIDPYPNMNENCPSLPPYYERPSKC  526



>emb|CDY11612.1| BnaC06g31270D [Brassica napus]
Length=525

 Score =   387 bits (995),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FN+TAAWEY R MLGKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTR+
Sbjct  309  PDVRAKFNNTAAWEYARSMLGKPYGYHNMIFSWIDTLADNYPPPLDAHLVISVMSMWTRV  368

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLTIPEQDEWVYSDGKSTTC
Sbjct  369  QPAYAANMWNEALNKRLGTEELDLYGILEETARRGMSFDELLTIPEQDEWVYSDGKSTTC  428

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYK +GVFG LA+ IQVTEFTIRDAY L+++E+NQTRLPSWCN+   KL  CQI
Sbjct  429  VAFILAMYKAAGVFGPLADHIQVTEFTIRDAYTLRMFEDNQTRLPSWCNTEKGKLELCQI  488

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GE+RMELPGYNT++PY NMNENCPSLPP+YERP  C
Sbjct  489  LGEFRMELPGYNTIDPYPNMNENCPSLPPTYERPSKC  525



>emb|CDY03761.1| BnaA02g14760D [Brassica napus]
Length=526

 Score =   387 bits (995),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VR +FN+TAAWEY R MLGKPYGYHNMIFSWIDT+ DNYPPP+DAHLVISVMSMWTR+
Sbjct  310  PDVRGKFNNTAAWEYARSMLGKPYGYHNMIFSWIDTLGDNYPPPLDAHLVISVMSMWTRV  369

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLTIPEQDEWVYSDGKSTTC
Sbjct  370  QPAYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLTIPEQDEWVYSDGKSTTC  429

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYK +GVFG LA+ IQVTEFTIRDAY L+++E+NQTRLPSWCN+   KL FCQI
Sbjct  430  VAFILAMYKAAGVFGPLADHIQVTEFTIRDAYTLRLFEDNQTRLPSWCNTEKGKLEFCQI  489

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELPGYNT++PY NMNENCPSLPP YERP  C
Sbjct  490  LGEYRMELPGYNTIDPYPNMNENCPSLPPYYERPSKC  526



>ref|XP_002520208.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42263.1| conserved hypothetical protein [Ricinus communis]
Length=527

 Score =   386 bits (992),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 199/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FNSTAAWEY R M GKPYGYHNMIFSWIDTI+DNYPPP+DAHL++SVMSMWTR+
Sbjct  311  PDVRAKFNSTAAWEYARRMSGKPYGYHNMIFSWIDTIADNYPPPLDAHLIVSVMSMWTRV  370

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRL TE LDLY ILAE E+RG+TFD+LLT PEQD+W+YSDGKSTTC
Sbjct  371  QPAYAANMWNEALNKRLDTEDLDLYGILAEIEKRGVTFDELLTAPEQDDWIYSDGKSTTC  430

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+GVFG ++ SIQVTEFTIRDAYMLKI+ENNQTRLPSWCN+ N +L FCQI
Sbjct  431  VAFILAMYKEAGVFGPISSSIQVTEFTIRDAYMLKIFENNQTRLPSWCNNDNGRLLFCQI  490

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY MELP YN+LEPYANMNENCPSLPP+Y+RP  C
Sbjct  491  LGEYWMELPDYNSLEPYANMNENCPSLPPNYDRPGRC  527



>ref|XP_010043827.1| PREDICTED: uncharacterized protein LOC104432932 [Eucalyptus grandis]
 gb|KCW85832.1| hypothetical protein EUGRSUZ_B02569 [Eucalyptus grandis]
Length=534

 Score =   385 bits (990),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FNSTAAWEY R MLGKPYGYHNMIFSWIDT+ DNYPPP+DAHLV+SVMSMWTR+
Sbjct  318  PDVRAKFNSTAAWEYARSMLGKPYGYHNMIFSWIDTVGDNYPPPLDAHLVVSVMSMWTRL  377

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDL+ I+ ETE+RG++FD+LLT PEQD+W+YSDGKSTTC
Sbjct  378  QPAYAANMWNEALNKRLGTEELDLHGIIQETEQRGMSFDELLTTPEQDDWMYSDGKSTTC  437

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+GVFG ++ SIQVTEFTIRDAYMLKI+EN+QTRLPSWC++   +LP+CQI
Sbjct  438  VAFILAMYKEAGVFGPISSSIQVTEFTIRDAYMLKIFENSQTRLPSWCSNKGGQLPYCQI  497

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY MELP YNT+EPYANMNENCPSLPPSYERP  C
Sbjct  498  LGEYWMELPEYNTIEPYANMNENCPSLPPSYERPKRC  534



>gb|AAB61100.1| ESTs gb|R30459,gb|N38441 come from this gene [Arabidopsis thaliana]
Length=551

 Score =   385 bits (990),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN+TAAWEY R MLGKPYGYHNMIFSWIDT+ DNYPPP+DAHLVISVMSMWTR+
Sbjct  335  PDIRAKFNNTAAWEYARSMLGKPYGYHNMIFSWIDTLGDNYPPPLDAHLVISVMSMWTRV  394

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLTIPEQDEWVYSDGKSTTC
Sbjct  395  QPAYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLTIPEQDEWVYSDGKSTTC  454

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYK +G+F  LA+ IQVTEFTIRDAY LK++E+NQTRLPSWCN+   KL FCQI
Sbjct  455  VAFILAMYKAAGIFDPLADHIQVTEFTIRDAYTLKLFESNQTRLPSWCNTEEGKLDFCQI  514

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELPGYNT+ PY NMN+NCPSLPP+YERP  C
Sbjct  515  LGEYRMELPGYNTIYPYPNMNQNCPSLPPNYERPSKC  551



>emb|CDY42991.1| BnaC02g19650D [Brassica napus]
Length=529

 Score =   385 bits (988),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++R +FN+TAAWEY R MLGKPYGYHNMIFSWIDT+ DNYPPP+DAHLVISVMSMWTR+
Sbjct  313  PDIRKKFNNTAAWEYARSMLGKPYGYHNMIFSWIDTLGDNYPPPLDAHLVISVMSMWTRV  372

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLTIPEQDEWVYSDGKSTTC
Sbjct  373  QPAYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLTIPEQDEWVYSDGKSTTC  432

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYK +GVFG LA+ IQVTEFTIRDAY L+++E+NQTRLPSWCN+   KL FCQI
Sbjct  433  VAFILAMYKAAGVFGPLADHIQVTEFTIRDAYTLRLFEDNQTRLPSWCNTEKGKLEFCQI  492

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELPGYNT+ PY NMNENCPSLPP YERP  C
Sbjct  493  LGEYRMELPGYNTIYPYPNMNENCPSLPPYYERPSKC  529



>ref|NP_564985.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK25910.1|AF360200_1 unknown protein [Arabidopsis thaliana]
 gb|AAK93691.1| unknown protein [Arabidopsis thaliana]
 gb|AEE35026.1| uncharacterized protein AT1G70160 [Arabidopsis thaliana]
Length=523

 Score =   384 bits (986),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN+TAAWEY R MLGKPYGYHNMIFSWIDT+ DNYPPP+DAHLVISVMSMWTR+
Sbjct  307  PDIRAKFNNTAAWEYARSMLGKPYGYHNMIFSWIDTLGDNYPPPLDAHLVISVMSMWTRV  366

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLTIPEQDEWVYSDGKSTTC
Sbjct  367  QPAYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLTIPEQDEWVYSDGKSTTC  426

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYK +G+F  LA+ IQVTEFTIRDAY LK++E+NQTRLPSWCN+   KL FCQI
Sbjct  427  VAFILAMYKAAGIFDPLADHIQVTEFTIRDAYTLKLFESNQTRLPSWCNTEEGKLDFCQI  486

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELPGYNT+ PY NMN+NCPSLPP+YERP  C
Sbjct  487  LGEYRMELPGYNTIYPYPNMNQNCPSLPPNYERPSKC  523



>ref|NP_001142383.1| uncharacterized protein LOC100274556 precursor [Zea mays]
 gb|ACF88369.1| unknown [Zea mays]
Length=536

 Score =   384 bits (987),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRARFN +AAWEY R M+G PYGYHNMIFSWIDTI DNYPPP+DA+LV++VMSMWTR+
Sbjct  320  PDVRARFNESAAWEYARSMVGNPYGYHNMIFSWIDTIGDNYPPPLDANLVMAVMSMWTRL  379

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE  DL  I+ E ERRG++FDQLLTIPEQDEWVYSDGKSTTC
Sbjct  380  QPVYAANMWNEALNKRLGTEDFDLQGIIMEIERRGMSFDQLLTIPEQDEWVYSDGKSTTC  439

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+G+F   +ESIQVTEFTIRDAYMLKI+E+N  RLP WCN+G DKLPFCQI
Sbjct  440  VAFILAMYKEAGIFTPFSESIQVTEFTIRDAYMLKIFEDNPARLPGWCNAGTDKLPFCQI  499

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELP YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  500  LGEYRMELPEYNTIEPYAKMNENCPSLPPTYKRPARC  536



>tpg|DAA61320.1| TPA: hypothetical protein ZEAMMB73_635026 [Zea mays]
Length=536

 Score =   384 bits (987),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRARFN +AAWEY R M+G PYGYHNMIFSWIDTI DNYPPP+DA+LV++VMSMWTR+
Sbjct  320  PDVRARFNESAAWEYARSMVGNPYGYHNMIFSWIDTIGDNYPPPLDANLVMAVMSMWTRL  379

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE  DL  I+ E ERRG++FDQLLTIPEQDEWVYSDGKSTTC
Sbjct  380  QPVYAANMWNEALNKRLGTEDFDLQGIIMEIERRGMSFDQLLTIPEQDEWVYSDGKSTTC  439

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+G+F   +ESIQVTEFTIRDAYMLKI+E+N  RLP WCN+G DKLPFCQI
Sbjct  440  VAFILAMYKEAGIFTPFSESIQVTEFTIRDAYMLKIFEDNPARLPGWCNAGTDKLPFCQI  499

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELP YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  500  LGEYRMELPEYNTIEPYAKMNENCPSLPPTYKRPARC  536



>ref|XP_010683317.1| PREDICTED: uncharacterized protein LOC104898021 [Beta vulgaris 
subsp. vulgaris]
Length=531

 Score =   384 bits (987),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 197/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P +RA+FNSTAAWE+ R M GKPYGYHNMIFSWIDTI +N+PPP+DAHLVISVMSMWTR+
Sbjct  315  PGMRAKFNSTAAWEFARNMSGKPYGYHNMIFSWIDTIGENFPPPLDAHLVISVMSMWTRV  374

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL+EIL E E RG+ F+QLLTIPEQD+W+YSDGKSTTC
Sbjct  375  QPAYAANMWNEALNKRLGTEGLDLHEILIEIEDRGIAFEQLLTIPEQDDWIYSDGKSTTC  434

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+G+F  L+ESIQVTEFTIRDAYMLKI+E+N TRLPSWC + N  +PFCQI
Sbjct  435  VAFILAMYKEAGIFNPLSESIQVTEFTIRDAYMLKIFEDNTTRLPSWCTTENGHVPFCQI  494

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELP YNT+EPYA+MNENCPSLPP Y+RPI C
Sbjct  495  LGEYRMELPEYNTVEPYAHMNENCPSLPPHYQRPIKC  531



>gb|ACG40083.1| hypothetical protein [Zea mays]
Length=537

 Score =   384 bits (985),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRARFN +AAWEY R M+G PYGYHNMIFSWIDTI DNYPPP+DA+LV++VMSMWTR+
Sbjct  321  PDVRARFNESAAWEYARSMVGNPYGYHNMIFSWIDTIGDNYPPPLDANLVMAVMSMWTRL  380

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDL  I+ E ERRG++FDQLLTIPEQDEWVYSDGKSTTC
Sbjct  381  QPVYAANMWNEALNKRLGTEDLDLQGIIMEIERRGMSFDQLLTIPEQDEWVYSDGKSTTC  440

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYKE+G+F   +ESIQVTEFTIRDAYMLKI+E+N  RLP WCN+  DKLPFCQI
Sbjct  441  VAFILAMYKEAGIFTPFSESIQVTEFTIRDAYMLKIFEDNPARLPGWCNADTDKLPFCQI  500

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELP YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  501  LGEYRMELPEYNTIEPYAKMNENCPSLPPTYKRPARC  537



>gb|EMS45474.1| hypothetical protein TRIUR3_21271 [Triticum urartu]
Length=435

 Score =   379 bits (973),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 197/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++R+RFN +AAW++ R M+GKPYGYHNMIFSWIDTI DNYPPP+DA+LV++VMSMWTR+
Sbjct  219  PDIRSRFNESAAWDFARSMVGKPYGYHNMIFSWIDTIGDNYPPPLDANLVMAVMSMWTRL  278

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL  I+ ETE+RG++FDQLLTIPEQDEWVYSDGKSTTC
Sbjct  279  QPLYAANMWNEALNKRLGTEGLDLQGIILETEKRGMSFDQLLTIPEQDEWVYSDGKSTTC  338

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            V+FILAMYKE+GVF    ESIQVTEFTIRDAYMLKI+E+++TRLPSWC +  DK PFCQI
Sbjct  339  VSFILAMYKEAGVFAPFTESIQVTEFTIRDAYMLKIFEDDRTRLPSWCRTEADKPPFCQI  398

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELP YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  399  LGEYRMELPEYNTIEPYAKMNENCPSLPPTYKRPSRC  435



>gb|KFK41436.1| hypothetical protein AALP_AA2G130200 [Arabis alpina]
Length=527

 Score =   382 bits (981),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++R +FN+TAAWEY R MLGKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTR+
Sbjct  311  PDIREKFNNTAAWEYARSMLGKPYGYHNMIFSWIDTLADNYPPPLDAHLVISVMSMWTRV  370

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLTIPEQDEWVYSDGKSTTC
Sbjct  371  QPAYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLTIPEQDEWVYSDGKSTTC  430

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYK +GVFG +A+ IQVTEFTIRDAY L+I++ NQTRLPSWCN+   KL FCQI
Sbjct  431  VAFILAMYKAAGVFGPIADQIQVTEFTIRDAYTLRIFDENQTRLPSWCNTEEGKLNFCQI  490

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELPGYNT+ PY NMNENCPSLP  YERP  C
Sbjct  491  LGEYRMELPGYNTIHPYPNMNENCPSLPSDYERPSKC  527



>ref|NP_001061835.1| Os08g0425000 [Oryza sativa Japonica Group]
 dbj|BAC98558.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAC99810.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23749.1| Os08g0425000 [Oryza sativa Japonica Group]
 dbj|BAG97186.1| unnamed protein product [Oryza sativa Japonica Group]
Length=547

 Score =   382 bits (981),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRARFN TAAWE+ R M GKPYGYHNMIFSWIDT+SDNYPPP+DA+LV++VMSMWTR+
Sbjct  331  PDVRARFNETAAWEFARSMYGKPYGYHNMIFSWIDTMSDNYPPPLDANLVMAVMSMWTRL  390

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YA+NMWNEALNKRLGTE LDL+ I+ ET +RG++F+QLLTIPEQD+W YSDGKSTTC
Sbjct  391  QPLYASNMWNEALNKRLGTEKLDLHGIITETGKRGMSFNQLLTIPEQDDWEYSDGKSTTC  450

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL+MYK++GVF    ESIQVTEFTIRDAYMLKI+E+NQTRLPSWCNSG D+LPFCQI
Sbjct  451  VAFILSMYKKAGVFAPFTESIQVTEFTIRDAYMLKIFEDNQTRLPSWCNSGADRLPFCQI  510

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY+MELP YNT+EPYANMNENCPS PP+Y RP+ C
Sbjct  511  LGEYKMELPEYNTIEPYANMNENCPSSPPTYTRPLGC  547



>gb|EEC83605.1| hypothetical protein OsI_29292 [Oryza sativa Indica Group]
Length=547

 Score =   382 bits (981),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRARFN TAAWE+ R M GKPYGYHNMIFSWIDT+SDNYPPP+DA+LV++VMSMWTR+
Sbjct  331  PDVRARFNETAAWEFARSMYGKPYGYHNMIFSWIDTMSDNYPPPLDANLVMAVMSMWTRL  390

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YA+NMWNEALNKRLGTE LDL+ I+ ET +RG++F+QLLTIPEQD+W YSDGKSTTC
Sbjct  391  QPLYASNMWNEALNKRLGTEKLDLHGIITETGKRGMSFNQLLTIPEQDDWEYSDGKSTTC  450

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL+MYK++GVF    ESIQVTEFTIRDAYMLKI+E+NQTRLPSWCNSG D+LPFCQI
Sbjct  451  VAFILSMYKKAGVFAPFTESIQVTEFTIRDAYMLKIFEDNQTRLPSWCNSGADRLPFCQI  510

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY+MELP YNT+EPYANMNENCPS PP+Y RP+ C
Sbjct  511  LGEYKMELPEYNTIEPYANMNENCPSSPPTYTRPLGC  547



>ref|XP_010272086.1| PREDICTED: uncharacterized protein LOC104607980 isoform X1 [Nelumbo 
nucifera]
Length=531

 Score =   379 bits (974),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++R +FN+TAAW Y R M GKPYGYHNMIFSWIDT+ +NYPPP+DAHLV+SVM MWTR+
Sbjct  315  PDLRVKFNATAAWAYARNMAGKPYGYHNMIFSWIDTMDENYPPPLDAHLVLSVMFMWTRL  374

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GLDL  ILAE+ERRG++FDQLL IPEQDEWVYSDGKSTTC
Sbjct  375  QPAYAANMWNEALNKRLGTDGLDLPGILAESERRGISFDQLLIIPEQDEWVYSDGKSTTC  434

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL MYKE+G+F  ++ SIQVTEFTIRDAYMLKI+ENN+TRLPSWC++ + +LPFCQI
Sbjct  435  VAFILEMYKEAGIFYPISSSIQVTEFTIRDAYMLKIFENNRTRLPSWCSNADGELPFCQI  494

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY+MELP YNT+EPYANMNENCPSLPP+YERP+ C
Sbjct  495  LGEYQMELPQYNTIEPYANMNENCPSLPPTYERPVRC  531



>ref|XP_003578075.1| PREDICTED: uncharacterized protein LOC100824338 [Brachypodium 
distachyon]
Length=536

 Score =   378 bits (970),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++R+ FN +AAWE+ R M+GKPYGYHNMIFSWIDTI DNYPPP+DA+LV++VMSMWTR+
Sbjct  320  PDIRSTFNESAAWEFARSMVGKPYGYHNMIFSWIDTIGDNYPPPLDANLVMAVMSMWTRL  379

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL+ I+ ETERRG++FDQLLTIPEQDEWVYSDGKSTTC
Sbjct  380  QPLYAANMWNEALNKRLGTEGLDLHGIIVETERRGMSFDQLLTIPEQDEWVYSDGKSTTC  439

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            V+FILAMYKE+GVF    ESIQVTEFTIRDAYMLKI++N+Q RLPSWC +  DK  FCQI
Sbjct  440  VSFILAMYKEAGVFAPFTESIQVTEFTIRDAYMLKIFQNDQARLPSWCQTEADKPTFCQI  499

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY+MELP YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  500  LGEYKMELPEYNTIEPYAKMNENCPSLPPTYKRPSRC  536



>dbj|BAJ97125.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=534

 Score =   377 bits (967),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++R+RFN +AAW++ R M+GKPYGYHNMIFSWIDTI DNYPPP+DA+LV++VMSMWTR+
Sbjct  318  PDIRSRFNESAAWDFARSMVGKPYGYHNMIFSWIDTIGDNYPPPLDANLVMAVMSMWTRL  377

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL  I+ ETE+RG++FDQLLTIPEQDEWVYSDGKSTTC
Sbjct  378  QPLYAANMWNEALNKRLGTEGLDLQGIIFETEKRGMSFDQLLTIPEQDEWVYSDGKSTTC  437

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            V+FILAMYKE+GVF    ESIQVTEFTIRDAYMLKI+E+++ RLPSWC +  DK PFCQI
Sbjct  438  VSFILAMYKEAGVFAPFTESIQVTEFTIRDAYMLKIFEDDRARLPSWCLTEADKPPFCQI  497

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELP YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  498  LGEYRMELPEYNTIEPYAKMNENCPSLPPTYKRPSRC  534



>ref|XP_002444358.1| hypothetical protein SORBIDRAFT_07g020660 [Sorghum bicolor]
 gb|EES13853.1| hypothetical protein SORBIDRAFT_07g020660 [Sorghum bicolor]
Length=542

 Score =   376 bits (966),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 197/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRARFN +AAWE+ R M GKPYGYHNMIFSWIDT+SDNYPPP+DA+LV+++MSMWTR+
Sbjct  326  PDVRARFNESAAWEFARSMYGKPYGYHNMIFSWIDTMSDNYPPPLDANLVMAIMSMWTRL  385

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YA+NMWNEALNKRLGTE LDL+ +++ETE+RGL+F+QLLTIPE+D+W YSDGKSTTC
Sbjct  386  QPHYASNMWNEALNKRLGTEKLDLHGVISETEKRGLSFNQLLTIPERDDWEYSDGKSTTC  445

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL+MYK +GVF    ESIQVTEFTIRDAYMLKI+E+NQTRLPSWCN+  D+LPFCQI
Sbjct  446  VAFILSMYKAAGVFAPFTESIQVTEFTIRDAYMLKIFEDNQTRLPSWCNAAADRLPFCQI  505

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY+M+LP YNT+EPYANMNENCPS PP+Y RP  C
Sbjct  506  LGEYKMDLPEYNTIEPYANMNENCPSAPPTYNRPSRC  542



>ref|XP_006856897.1| hypothetical protein AMTR_s00055p00212390 [Amborella trichopoda]
 gb|ERN18364.1| hypothetical protein AMTR_s00055p00212390 [Amborella trichopoda]
Length=526

 Score =   376 bits (965),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 198/218 (91%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN+TAAWEY R MLGKPYGYHNMIFSWIDTI+DNYPPP+DAHLVISVMSMWTR+
Sbjct  309  PDLRAKFNATAAWEYARSMLGKPYGYHNMIFSWIDTIADNYPPPLDAHLVISVMSMWTRL  368

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRL TEGLDL+ IL ETE+RG++FDQLLTIPEQDEWVYSDGKSTTC
Sbjct  369  QPAYAANMWNEALNKRLETEGLDLHGILLETEKRGISFDQLLTIPEQDEWVYSDGKSTTC  428

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKL-PFCQ  161
            VAFIL MYKE+G+FG ++ SIQVTEFTIRDAYML+I+ENN +RLPSWC++ + K  PFCQ
Sbjct  429  VAFILEMYKEAGIFGPVSNSIQVTEFTIRDAYMLRIFENNSSRLPSWCSNRDTKQPPFCQ  488

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+GEY ME P YNT+E Y +MNENCPSLPP+Y+RP+ C
Sbjct  489  ILGEYHMEFPRYNTVELYGHMNENCPSLPPNYDRPVGC  526



>gb|ACN36261.1| unknown [Zea mays]
Length=392

 Score =   371 bits (952),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 193/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRARF+ +AAWE+ R M GKPYGYHNMIFSWIDT SDNYPPP+DA+LV+++MSMWTR+
Sbjct  176  PDVRARFDESAAWEFARSMCGKPYGYHNMIFSWIDTASDNYPPPLDANLVMAIMSMWTRL  235

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YA+NMWNEALNKRLGTE LDL+ I+ ETERRGL+F+QLLT+PE+D+W YSDGKSTTC
Sbjct  236  QPRYASNMWNEALNKRLGTEKLDLHGIIRETERRGLSFNQLLTVPERDDWEYSDGKSTTC  295

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL+MYK +GVF    ESIQVTEFTIRDAYMLKI+E+NQTRLPSWCN+  D LPFCQI
Sbjct  296  VAFILSMYKAAGVFAPYTESIQVTEFTIRDAYMLKIFEDNQTRLPSWCNAAADGLPFCQI  355

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY+M LP YNT+EPYANMNENCPS PP+Y RP  C
Sbjct  356  LGEYKMGLPEYNTIEPYANMNENCPSAPPTYSRPSRC  392



>dbj|BAJ99018.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=534

 Score =   375 bits (964),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++R+RFN +AAW++ R M+GKPYGYHNMIFSWIDTI DNYPPP+DA+LV++VMSMWTR+
Sbjct  318  PDIRSRFNESAAWDFARSMVGKPYGYHNMIFSWIDTIGDNYPPPLDANLVMAVMSMWTRL  377

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL  I+ ETE+RG++FDQLLTIPEQDEWVYSDGKSTTC
Sbjct  378  QPLYAANMWNEALNKRLGTEGLDLQGIIFETEKRGMSFDQLLTIPEQDEWVYSDGKSTTC  437

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            V+FILAMYKE+GVF    ESIQVTEFTIRDAYMLKI+E++  RLPSWC +  DK PFCQI
Sbjct  438  VSFILAMYKEAGVFAPFTESIQVTEFTIRDAYMLKIFEDDGARLPSWCLTEADKPPFCQI  497

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELP YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  498  LGEYRMELPEYNTIEPYAKMNENCPSLPPTYKRPSRC  534



>dbj|BAJ33873.1| unnamed protein product [Thellungiella halophila]
Length=521

 Score =   375 bits (962),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN+TAAWEY R MLGKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTR+
Sbjct  313  PDIRAKFNNTAAWEYARSMLGKPYGYHNMIFSWIDTLADNYPPPLDAHLVISVMSMWTRV  372

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP+YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLTIPEQDEWVYSDGKSTTC
Sbjct  373  QPSYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLTIPEQDEWVYSDGKSTTC  432

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYK +GVFG LA+ IQVTEFTIRDAY L+++E NQTRLPSWCN+   KL FCQI
Sbjct  433  VAFILAMYKAAGVFGPLADHIQVTEFTIRDAYTLRLFEENQTRLPSWCNTEEGKLEFCQI  492

Query  157  VGEYRMELPGYNTLEPYANMNENCPSL  77
            +GEYRMELPGYNT++PYANMNENCPS 
Sbjct  493  LGEYRMELPGYNTIQPYANMNENCPSF  519



>ref|XP_004973463.1| PREDICTED: uncharacterized protein LOC101781133 [Setaria italica]
Length=546

 Score =   375 bits (963),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRARFN +AAW++ R M GKPYGYHNMIFSWIDT+SDNYPPP+DA+LV+++MSMWTR+
Sbjct  330  PDVRARFNESAAWDFARSMYGKPYGYHNMIFSWIDTMSDNYPPPLDANLVMAIMSMWTRL  389

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YA+NMWNEALNKRLGTE LDL+ I+ ETERRGL+F+QLLTIPE+D+W YSDGKSTTC
Sbjct  390  QPHYASNMWNEALNKRLGTEKLDLHGIITETERRGLSFNQLLTIPERDDWEYSDGKSTTC  449

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL+MYK +GVF    ESIQVTEFTIRDAYMLK++E+NQTRLP WCN+  D+LPFCQI
Sbjct  450  VAFILSMYKAAGVFAPFTESIQVTEFTIRDAYMLKVFEDNQTRLPGWCNAAADRLPFCQI  509

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY+M+LP YNT+EPYANMNENCPS PP+Y RP  C
Sbjct  510  LGEYKMDLPEYNTIEPYANMNENCPSAPPTYSRPARC  546



>ref|XP_006659410.1| PREDICTED: uncharacterized protein LOC102708916 [Oryza brachyantha]
Length=409

 Score =   370 bits (951),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRARFN +AAWE+ R M GKPYGYHNMIFSWIDT+SDN+PPP+DA+LV++VMSMWTR+
Sbjct  193  PDVRARFNESAAWEFARSMYGKPYGYHNMIFSWIDTMSDNFPPPLDANLVMAVMSMWTRL  252

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YA+NMWNEALNKRLGTE LDL+ I+ ET +RG++F+QLLTIPEQD+W YSDGKSTTC
Sbjct  253  QPLYASNMWNEALNKRLGTEKLDLHGIITETGKRGMSFNQLLTIPEQDDWEYSDGKSTTC  312

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL+MYK++GVF    ESIQVTEFTIRDAYMLKI+E+N TRLPSWCN   D+LPFCQI
Sbjct  313  VAFILSMYKKAGVFAPFTESIQVTEFTIRDAYMLKIFEDNHTRLPSWCNHEADRLPFCQI  372

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY+M+LP YNT+EPYANMNENCPS PP+Y RP+ C
Sbjct  373  LGEYKMDLPEYNTIEPYANMNENCPSSPPTYTRPLGC  409



>dbj|BAJ91369.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92745.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=531

 Score =   374 bits (960),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRARFN +AAWE+ R M GKPYGYHNMIFSWIDT+S+NYPPP+DA+LV++ MSMWTR+
Sbjct  315  PDVRARFNESAAWEFARSMYGKPYGYHNMIFSWIDTMSENYPPPLDANLVMAAMSMWTRL  374

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YA+NMWNEALNKRLGTE LDL+ I++ETERRG++F+QLLTIPEQDEW YSDGKSTTC
Sbjct  375  QPHYASNMWNEALNKRLGTEQLDLHGIISETERRGMSFNQLLTIPEQDEWEYSDGKSTTC  434

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFILAMYK +GVF    ESIQVTEFTIRDAYML+I+E+N+TRLP WCN   D+LPFCQ+
Sbjct  435  VAFILAMYKAAGVFAPFTESIQVTEFTIRDAYMLRIFEDNRTRLPGWCNGDADRLPFCQV  494

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY+MELP YNT++PYANMNENCPS PP+Y+RP+ C
Sbjct  495  LGEYKMELPEYNTIQPYANMNENCPSSPPTYDRPLRC  531



>ref|XP_009419908.1| PREDICTED: uncharacterized protein LOC103999784 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=537

 Score =   374 bits (960),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 167/216 (77%), Positives = 196/216 (91%), Gaps = 0/216 (0%)
 Frame = -1

Query  694  EVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRMQ  515
            ++ A FN TAAW+Y R M GKPYGYHNMIFSWIDT+++NYPPP+DA+LV+SVMSMWTR+Q
Sbjct  322  DLHAIFNETAAWDYARSMSGKPYGYHNMIFSWIDTVAENYPPPLDANLVMSVMSMWTRLQ  381

Query  514  PTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCV  335
            P+YAANMWNEALNKRLGTE LDL+EI+ ET+R+G+TFDQLLT+PEQDEW+YSDGKSTTCV
Sbjct  382  PSYAANMWNEALNKRLGTEDLDLHEIIVETQRQGMTFDQLLTMPEQDEWIYSDGKSTTCV  441

Query  334  AFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQIV  155
            AF+L +YKE+G+ G LA SIQVTEFTIRDAYML I+ENNQTRLPSWCN+  +KLPFCQI+
Sbjct  442  AFVLELYKEAGILGPLANSIQVTEFTIRDAYMLNIFENNQTRLPSWCNALEEKLPFCQIL  501

Query  154  GEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            G YRMELP YNT+EPYA+MNENCPSLPP+Y RP  C
Sbjct  502  GYYRMELPQYNTIEPYAHMNENCPSLPPAYTRPERC  537



>ref|XP_006858155.1| hypothetical protein AMTR_s00062p00137330 [Amborella trichopoda]
 gb|ERN19622.1| hypothetical protein AMTR_s00062p00137330 [Amborella trichopoda]
Length=526

 Score =   371 bits (953),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 166/218 (76%), Positives = 195/218 (89%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FN +AAWEY R MLGKPYGYHNMIFSWIDTI DNYPPP+DAHLV SVM+MW ++
Sbjct  309  PDVRAKFNESAAWEYARSMLGKPYGYHNMIFSWIDTIEDNYPPPLDAHLVASVMTMWNKI  368

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL EIL ETER+GL+FD+LLTIPEQD+W+Y+DGKST+C
Sbjct  369  QPAYAANMWNEALNKRLGTEGLDLPEILVETERQGLSFDKLLTIPEQDDWLYTDGKSTSC  428

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAF+L MYK++G+F  +A+SIQVTEFTI+DAY+LK +EN+ +RLP WCN G+D KLPFCQ
Sbjct  429  VAFVLEMYKQAGLFDQIADSIQVTEFTIKDAYILKFFENDTSRLPQWCNKGDDVKLPFCQ  488

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELPGYNTL+PYA MNE CPSLPP YER   C
Sbjct  489  ILGKYRMELPGYNTLQPYAQMNERCPSLPPEYERSREC  526



>ref|NP_001143255.1| uncharacterized protein LOC100275783 precursor [Zea mays]
 gb|ACG30173.1| hypothetical protein [Zea mays]
Length=522

 Score =   370 bits (951),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 193/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRARF+ +AAWE+ R M GKPYGYHNMIFSWIDT SDNYPPP+DA+LV+++MSMWTR+
Sbjct  306  PDVRARFDESAAWEFARSMCGKPYGYHNMIFSWIDTASDNYPPPLDANLVMAIMSMWTRL  365

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YA+NMWNEALNKRLGTE LDL+ I+ ETERRGL+F+QLLT+PE+D+W YSDGKSTTC
Sbjct  366  QPRYASNMWNEALNKRLGTEKLDLHGIIRETERRGLSFNQLLTVPERDDWEYSDGKSTTC  425

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL+MYK +GVF    ESIQVTEFTIRDAYMLKI+E+NQTRLPSWCN+  D LPFCQI
Sbjct  426  VAFILSMYKAAGVFAPYTESIQVTEFTIRDAYMLKIFEDNQTRLPSWCNAAADGLPFCQI  485

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY+M LP YNT+EPYANMNENCPS PP+Y RP  C
Sbjct  486  LGEYKMGLPEYNTIEPYANMNENCPSAPPTYSRPSRC  522



>ref|XP_008676929.1| PREDICTED: uncharacterized protein LOC100275783 isoform X1 [Zea 
mays]
 ref|XP_008676930.1| PREDICTED: uncharacterized protein LOC100275783 isoform X1 [Zea 
mays]
 gb|AFW62202.1| hypothetical protein ZEAMMB73_209421 [Zea mays]
Length=522

 Score =   370 bits (950),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 193/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRARF+ +AAWE+ R M GKPYGYHNMIFSWIDT SDNYPPP+DA+LV+++MSMWTR+
Sbjct  306  PDVRARFDESAAWEFARSMCGKPYGYHNMIFSWIDTASDNYPPPLDANLVMAIMSMWTRL  365

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YA+NMWNEALNKRLGTE LDL+ I+ ETERRGL+F+QLLT+PE+D+W YSDGKSTTC
Sbjct  366  QPRYASNMWNEALNKRLGTEKLDLHGIIRETERRGLSFNQLLTVPERDDWEYSDGKSTTC  425

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL+MYK +GVF    ESIQVTEFTIRDAYMLKI+E+NQTRLPSWCN+  D LPFCQI
Sbjct  426  VAFILSMYKAAGVFAPYTESIQVTEFTIRDAYMLKIFEDNQTRLPSWCNAAADGLPFCQI  485

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY+M LP YNT+EPYANMNENCPS PP+Y RP  C
Sbjct  486  LGEYKMGLPEYNTIEPYANMNENCPSAPPTYSRPSRC  522



>ref|XP_003574496.1| PREDICTED: uncharacterized protein LOC100845920 [Brachypodium 
distachyon]
Length=536

 Score =   369 bits (946),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 163/217 (75%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRARFN +AAWE+   M GKPYGYHNMIFSWIDT+S+NYPPP+DA+L+++VMSMWTR+
Sbjct  320  PDVRARFNESAAWEFALSMYGKPYGYHNMIFSWIDTMSENYPPPLDANLIMAVMSMWTRL  379

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YA+NMWNEALNKRLGTE LDL+ I++ETE+RG++F+QLLT+PEQDEW YSDGKSTTC
Sbjct  380  QPQYASNMWNEALNKRLGTEKLDLHGIISETEKRGMSFNQLLTVPEQDEWEYSDGKSTTC  439

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL+MYK +GVF    ESIQVTEFTIRDAYML+I+E+N TRLP WCN   D LPFCQI
Sbjct  440  VAFILSMYKAAGVFAPFTESIQVTEFTIRDAYMLRIFEDNATRLPGWCNGEADGLPFCQI  499

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY+MELP YNT+EPYANMNENCPS PP+Y+RP+ C
Sbjct  500  LGEYKMELPEYNTIEPYANMNENCPSSPPTYKRPVRC  536



>gb|EAZ42788.1| hypothetical protein OsJ_27372 [Oryza sativa Japonica Group]
Length=484

 Score =   365 bits (937),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 193/217 (89%), Gaps = 5/217 (2%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRARFN TAAWE+ R M GKPYGYHNMIFSWIDT+SDNYPPP+DA+LV++VMSMWTR+
Sbjct  273  PDVRARFNETAAWEFARSMYGKPYGYHNMIFSWIDTMSDNYPPPLDANLVMAVMSMWTRL  332

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YA+NMWNEALNKRLGTE LDL+ I+ ET +RG++F+QLLTIPEQD+W YSDGKSTTC
Sbjct  333  QPLYASNMWNEALNKRLGTEKLDLHGIITETGKRGMSFNQLLTIPEQDDWEYSDGKSTTC  392

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL+MYK++GVF    ESIQ     IRDAYMLKI+E+NQTRLPSWCNSG D+LPFCQI
Sbjct  393  VAFILSMYKKAGVFAPFTESIQ-----IRDAYMLKIFEDNQTRLPSWCNSGADRLPFCQI  447

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY+MELP YNT+EPYANMNENCPS PP+Y RP+ C
Sbjct  448  LGEYKMELPEYNTIEPYANMNENCPSSPPTYTRPLGC  484



>gb|ABK24649.1| unknown [Picea sitchensis]
Length=521

 Score =   365 bits (936),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 162/218 (74%), Positives = 196/218 (90%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN+TAAW+Y R M GKPYGYHNMIFSWIDTI+DNYPPP+DAHLV+S+M+MWTR+
Sbjct  304  PDLRAKFNATAAWDYARNMSGKPYGYHNMIFSWIDTITDNYPPPLDAHLVLSIMAMWTRV  363

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT  LD+  +L E+E+RG+ F+QLLT+PEQD+W+YSDGKSTTC
Sbjct  364  QPNYAANMWNEALNKRLGTMDLDIRGVLIESEKRGIPFEQLLTVPEQDDWIYSDGKSTTC  423

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAFIL MYKE+G+F S++ SIQVTEFTIRDAYM+K +E+N+T LPSWCN  +D KLPFCQ
Sbjct  424  VAFILEMYKEAGLFDSISSSIQVTEFTIRDAYMMKYFESNRTHLPSWCNENDDVKLPFCQ  483

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+GEYRMELPGYNT++PYA MNE CPSLPP+Y+RP  C
Sbjct  484  ILGEYRMELPGYNTIDPYAFMNEQCPSLPPAYDRPTGC  521



>ref|XP_010445104.1| PREDICTED: uncharacterized protein LOC104727724, partial [Camelina 
sativa]
Length=247

 Score =   354 bits (908),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 156/218 (72%), Positives = 190/218 (87%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+ RA+FN TAAWEY R M GKPYGYHN+IFSWIDTIS NYPPP+DAHLV SVM++W+++
Sbjct  30   PDYRAKFNVTAAWEYARSMDGKPYGYHNLIFSWIDTISGNYPPPLDAHLVASVMTVWSKI  89

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL +PEQD+W+YSDGKST+C
Sbjct  90   QPDYAANMWNEALNKRLGTEGLDLPDVLVEVEKRGSSFDELLAVPEQDDWIYSDGKSTSC  149

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE+G+F  ++ SIQVTEFTI+DAYMLK +ENN +R P WCN  +D KLP+CQ
Sbjct  150  IAFILEMYKEAGLFDPISSSIQVTEFTIKDAYMLKFFENNASRFPKWCNDNDDVKLPYCQ  209

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELPGYNT+EPY +MNE+CPSLPP Y RP +C
Sbjct  210  ILGKYRMELPGYNTMEPYPHMNEHCPSLPPKYHRPKNC  247



>ref|XP_006401517.1| hypothetical protein EUTSA_v10013232mg [Eutrema salsugineum]
 gb|ESQ42970.1| hypothetical protein EUTSA_v10013232mg [Eutrema salsugineum]
Length=529

 Score =   361 bits (926),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 159/218 (73%), Positives = 190/218 (87%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FN TAAWEY R M GKPYGYHN+IFSWIDT+SDNYPPP+DAHLV S M++W++M
Sbjct  312  PDVRAKFNVTAAWEYARSMEGKPYGYHNLIFSWIDTVSDNYPPPLDAHLVASFMTVWSKM  371

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL IPEQD W+YSDGKST+C
Sbjct  372  QPDYAANMWNEALNKRLGTEGLDLSDVLVEVEKRGSSFDKLLAIPEQDNWIYSDGKSTSC  431

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE+G+FGSLA S+QVTEFTI+DAYML  +E N +RLP WCN  +  KLP+CQ
Sbjct  432  IAFILEMYKEAGLFGSLANSVQVTEFTIKDAYMLNFFETNASRLPEWCNDNDSVKLPYCQ  491

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELPGYNT+EPY++MNE CPSLPP Y RP +C
Sbjct  492  ILGKYRMELPGYNTMEPYSHMNEQCPSLPPKYNRPENC  529



>gb|KCW70170.1| hypothetical protein EUGRSUZ_F03459 [Eucalyptus grandis]
Length=439

 Score =   355 bits (912),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 157/218 (72%), Positives = 193/218 (89%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN +AAWEY R M GKPYGYHNMIFSWIDTI  NYPPP+DAHLV SVM++W ++
Sbjct  222  PDIRAKFNESAAWEYARSMEGKPYGYHNMIFSWIDTIDGNYPPPLDAHLVASVMTVWNQL  281

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            +P+YAAN+WNEALN RLGTEGLDL +IL ETE+RG +FD+LLTIPE+D+W+YSDGKST+C
Sbjct  282  RPSYAANLWNEALNLRLGTEGLDLPDILVETEKRGSSFDELLTIPEKDDWLYSDGKSTSC  341

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AF+L MYKE+G+FGS+A+SIQVTEFTI+DAYML+ +ENN +RLP WCN  +D KLPFCQ
Sbjct  342  IAFVLEMYKEAGLFGSIADSIQVTEFTIKDAYMLRFFENNSSRLPKWCNDADDVKLPFCQ  401

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYNT++PY +MNE CPSLPP Y RP +C
Sbjct  402  IRGKYRMELPGYNTMDPYPHMNERCPSLPPKYLRPRNC  439



>emb|CDY17285.1| BnaA10g09190D [Brassica napus]
Length=541

 Score =   358 bits (918),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 156/218 (72%), Positives = 190/218 (87%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FN TAAWEY R M GKPYGYHN+IF+WIDT++ NYPPP+DAHLV S M++W ++
Sbjct  324  PDVRAKFNVTAAWEYARSMDGKPYGYHNLIFAWIDTVTANYPPPIDAHLVASFMTVWNKL  383

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GL L ++L E E+RG +FD+LLT+PEQD+WVYSDGKST+C
Sbjct  384  QPEYAANMWNEALNKRLGTKGLGLPDVLVEVEKRGSSFDKLLTVPEQDDWVYSDGKSTSC  443

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE+G+FGSLA SIQVTEFT++DAYML  +ENN +RLP WCN  +  KLPFCQ
Sbjct  444  IAFILEMYKEAGLFGSLASSIQVTEFTLKDAYMLNFFENNTSRLPKWCNDNDSVKLPFCQ  503

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELPGYNT+EPY +MNE CPSLPP Y RP++C
Sbjct  504  ILGKYRMELPGYNTMEPYTHMNEQCPSLPPKYNRPVNC  541



>ref|XP_009120015.1| PREDICTED: uncharacterized protein LOC103844940 [Brassica rapa]
Length=529

 Score =   357 bits (915),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 157/218 (72%), Positives = 189/218 (87%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FN TAAWEY R M GKPYGYHN+IF+WIDT++ NYPPP+DAHLV S M++W ++
Sbjct  312  PDVRAKFNVTAAWEYARSMDGKPYGYHNLIFAWIDTVTANYPPPIDAHLVASFMTVWNKL  371

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGL L ++L E E+RG +FD+LLT+PEQD+WVYSDGKST+C
Sbjct  372  QPEYAANMWNEALNKRLGTEGLGLPDVLVEVEKRGSSFDKLLTVPEQDDWVYSDGKSTSC  431

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE+G+FGSLA SIQVTEFT++DAYML  +ENN +RLP WCN  +  KLPFCQ
Sbjct  432  IAFILEMYKEAGLFGSLASSIQVTEFTLKDAYMLNFFENNASRLPKWCNDNDSVKLPFCQ  491

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELPGYNT+EPY +MNE CPSLPP Y RP +C
Sbjct  492  ILGKYRMELPGYNTMEPYTHMNEQCPSLPPKYNRPGNC  529



>emb|CDY19873.1| BnaC09g31390D [Brassica napus]
Length=541

 Score =   357 bits (915),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 156/218 (72%), Positives = 189/218 (87%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FN TAAWEY R M GKPYGYHN+IF+WIDT++ NYPPP+DAHLV S M++W ++
Sbjct  324  PDVRAKFNVTAAWEYARSMDGKPYGYHNLIFAWIDTVTANYPPPIDAHLVASFMTVWNKL  383

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGL L ++L E E+RG +FD+LLT+PEQD+W+YSDGKST+C
Sbjct  384  QPEYAANMWNEALNKRLGTEGLGLPDVLVEVEKRGSSFDKLLTVPEQDDWIYSDGKSTSC  443

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE+G+FGSLA SIQVTEFT++DAYML  +ENN +RLP WCN  +  KLPFCQ
Sbjct  444  IAFILEMYKEAGLFGSLASSIQVTEFTLKDAYMLNFFENNASRLPKWCNDNDSVKLPFCQ  503

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELPGYNT+EPY +MNE CPSLPP Y RP +C
Sbjct  504  ILGKYRMELPGYNTMEPYTHMNEQCPSLPPKYNRPGNC  541



>ref|XP_009127046.1| PREDICTED: uncharacterized protein LOC103851917 [Brassica rapa]
Length=529

 Score =   356 bits (914),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 190/218 (87%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FN TAAWEY R M GKPYGYHN+IFSWIDT+++NYPPP+D+HLV S M++W++M
Sbjct  312  PDVRAKFNVTAAWEYARSMEGKPYGYHNLIFSWIDTVTENYPPPLDSHLVASFMTVWSKM  371

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GLDL ++L E E+RG +FD+LL IPEQD+WVYSDGKST+C
Sbjct  372  QPDYAANMWNEALNKRLGTKGLDLSDVLVEVEKRGSSFDKLLAIPEQDDWVYSDGKSTSC  431

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE G+FGSLA+S+QVTEFTI+DAYML  +E N +RLP WCN  +  KLP+CQ
Sbjct  432  IAFILEMYKEGGLFGSLADSVQVTEFTIKDAYMLNFFETNASRLPKWCNDNDSVKLPYCQ  491

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRM+LPGYNT+EPY +MNE CPSLPP Y RP +C
Sbjct  492  ILGKYRMQLPGYNTMEPYTHMNEQCPSLPPKYNRPDNC  529



>emb|CDY29265.1| BnaC01g19170D [Brassica napus]
Length=507

 Score =   355 bits (911),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 157/218 (72%), Positives = 190/218 (87%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+ RARFN TAAWEY R M GKPYGYHN+IFSWIDTIS NYPPP+DAHLV SVM++W+++
Sbjct  290  PDYRARFNVTAAWEYARSMDGKPYGYHNLIFSWIDTISGNYPPPLDAHLVASVMTVWSKI  349

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAAN+WNEALNKRLGTEGLDL ++L E E+RG +FD+LL +PEQD W+YSDGKST+C
Sbjct  350  QPDYAANIWNEALNKRLGTEGLDLPDVLVEVEKRGSSFDELLAVPEQDHWIYSDGKSTSC  409

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE G+F  ++ SIQVTEFTI+DAYMLK +ENN +RLP+WCN  +D KLP+CQ
Sbjct  410  IAFILEMYKEGGLFDPISSSIQVTEFTIKDAYMLKFFENNASRLPTWCNDNDDVKLPYCQ  469

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELPGYNT+EPY +MNE+CPSLPP Y RP +C
Sbjct  470  ILGKYRMELPGYNTMEPYPHMNEHCPSLPPKYHRPKNC  507



>emb|CDX89285.1| BnaA01g16080D [Brassica napus]
Length=475

 Score =   354 bits (908),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 188/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+ RARFN TAAWEY R M GKPYGYHN+IFSWIDTIS NYPPP+DAHLV SVM++W+++
Sbjct  258  PDYRARFNVTAAWEYARSMDGKPYGYHNLIFSWIDTISGNYPPPLDAHLVASVMTVWSKI  317

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL  +L E E+RG +FD+LL +PEQDEW+YSDGKST+C
Sbjct  318  QPDYAANMWNEALNKRLGTEGLDLPGVLVEVEKRGSSFDELLAVPEQDEWIYSDGKSTSC  377

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE G+F  ++ SIQVTEFTI+DAYMLK +ENN +RLP WCN  +D KLP+CQ
Sbjct  378  IAFILEMYKEGGLFDPVSSSIQVTEFTIKDAYMLKFFENNASRLPKWCNDNDDVKLPYCQ  437

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELP YNT+EPY +MNE+CPSLPP Y RP +C
Sbjct  438  ILGKYRMELPDYNTMEPYPHMNEHCPSLPPKYHRPKNC  475



>ref|XP_006413116.1| hypothetical protein EUTSA_v10024847mg [Eutrema salsugineum]
 gb|ESQ54569.1| hypothetical protein EUTSA_v10024847mg [Eutrema salsugineum]
Length=546

 Score =   356 bits (914),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 157/218 (72%), Positives = 192/218 (88%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+ RARFN+TAAWEY R M GKPYGYHN+IFSWIDTIS NYPPP+DAHLV SVM++W+++
Sbjct  329  PDYRARFNNTAAWEYARSMDGKPYGYHNLIFSWIDTISGNYPPPLDAHLVASVMTVWSKI  388

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL +PEQD+W+YSDGKST+C
Sbjct  389  QPDYAANMWNEALNKRLGTEGLDLPDVLVEVEKRGSSFDELLAVPEQDDWIYSDGKSTSC  448

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE+G+F  ++ SIQVTEFTI+DAY+LK +ENN +RLP WCN  +D KLP+CQ
Sbjct  449  IAFILEMYKEAGLFDPISSSIQVTEFTIKDAYILKFFENNASRLPKWCNDNDDVKLPYCQ  508

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELPGYNT+EPY +MNE+CPSLPP Y RP +C
Sbjct  509  ILGKYRMELPGYNTMEPYPHMNEHCPSLPPKYHRPSNC  546



>ref|XP_009143005.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103866775 
[Brassica rapa]
Length=523

 Score =   355 bits (912),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 190/218 (87%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+ RARFN TAAWEY R M GKPYGYHN+IFSWIDTIS NYPPP+DAHLV SVM++W+++
Sbjct  306  PDYRARFNVTAAWEYARSMDGKPYGYHNLIFSWIDTISGNYPPPLDAHLVASVMTVWSKI  365

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL +PEQDEW+YSDGKST+C
Sbjct  366  QPDYAANMWNEALNKRLGTEGLDLPDVLVEVEKRGSSFDELLAVPEQDEWIYSDGKSTSC  425

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE G+F  ++ SIQVTEFTI+DAYMLK +ENN +RLP+WCN  +D KLP+CQ
Sbjct  426  IAFILEMYKEGGLFDPISSSIQVTEFTIKDAYMLKFFENNASRLPTWCNDNDDVKLPYCQ  485

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELP YNT+EPY +MNE+CPSLPP Y RP +C
Sbjct  486  ILGKYRMELPDYNTMEPYPHMNEHCPSLPPKYHRPKNC  523



>ref|XP_010438669.1| PREDICTED: uncharacterized protein LOC104722227 [Camelina sativa]
Length=524

 Score =   354 bits (909),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 156/218 (72%), Positives = 190/218 (87%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+ RA+FN TAAWEY R M GKPYGYHN+IFSWIDTIS NYPPP+DAHLV SVM++W+++
Sbjct  307  PDYRAKFNVTAAWEYARSMDGKPYGYHNLIFSWIDTISGNYPPPLDAHLVASVMTVWSKI  366

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL +PEQD+W+YSDGKST+C
Sbjct  367  QPDYAANMWNEALNKRLGTEGLDLPDVLVEVEKRGSSFDELLAVPEQDDWIYSDGKSTSC  426

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE+G+F  ++ SIQVTEFTI+DAYMLK +ENN +R P WCN  +D KLP+CQ
Sbjct  427  IAFILEMYKEAGLFDPISSSIQVTEFTIKDAYMLKFFENNASRFPKWCNDNDDVKLPYCQ  486

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELPGYNT+EPY +MNE+CPSLPP Y RP +C
Sbjct  487  ILGKYRMELPGYNTMEPYPHMNEHCPSLPPKYHRPKNC  524



>ref|XP_002867528.1| hypothetical protein ARALYDRAFT_913846 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43787.1| hypothetical protein ARALYDRAFT_913846 [Arabidopsis lyrata subsp. 
lyrata]
Length=522

 Score =   354 bits (909),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 156/218 (72%), Positives = 190/218 (87%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+ RA+FN TAAWEY R M GKPYGYHN+IFSWIDTIS NYPPP+DAHLV SVM++W+++
Sbjct  305  PDYRAKFNVTAAWEYARSMDGKPYGYHNLIFSWIDTISGNYPPPLDAHLVASVMTVWSKI  364

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL +PEQD+W+YSDGKST+C
Sbjct  365  QPDYAANMWNEALNKRLGTEGLDLPDVLVEVEKRGSSFDELLAVPEQDDWIYSDGKSTSC  424

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE+G+F  ++ SIQVTEFTI+DAYMLK +ENN +R P WCN  +D KLP+CQ
Sbjct  425  IAFILEMYKEAGLFDPISSSIQVTEFTIKDAYMLKFFENNASRFPKWCNDNDDVKLPYCQ  484

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELPGYNT+EPY +MNE+CPSLPP Y RP +C
Sbjct  485  ILGKYRMELPGYNTMEPYPHMNEHCPSLPPKYHRPKNC  522



>ref|XP_010267678.1| PREDICTED: uncharacterized protein LOC104604833 [Nelumbo nucifera]
Length=528

 Score =   354 bits (909),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/218 (74%), Positives = 186/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN +AAWEY R M GKPYG+HNMIFSWIDT   NYPPP+DAHLV SVM++W +M
Sbjct  311  PDLRAKFNESAAWEYARSMAGKPYGFHNMIFSWIDTTYGNYPPPIDAHLVASVMTIWNQM  370

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            +P YAANMWNEALNKRLGTEGLDL EIL ETERRGL+FD+LLTIPEQD+W+YSDGKST+C
Sbjct  371  KPEYAANMWNEALNKRLGTEGLDLPEILVETERRGLSFDKLLTIPEQDDWIYSDGKSTSC  430

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSG-NDKLPFCQ  161
            VAFIL MYK +G+F  +A SIQVTEFTI+DAY LK +ENN +RLP WCN G N KLPFCQ
Sbjct  431  VAFILEMYKHAGLFDPIASSIQVTEFTIKDAYTLKFFENNSSRLPKWCNEGDNVKLPFCQ  490

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I GEYRMELPGYNT++ Y +MNE CPSLPP Y RP  C
Sbjct  491  IKGEYRMELPGYNTMDLYPHMNERCPSLPPEYYRPKGC  528



>ref|XP_010276049.1| PREDICTED: uncharacterized protein LOC104610902 [Nelumbo nucifera]
Length=528

 Score =   353 bits (907),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 159/218 (73%), Positives = 190/218 (87%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+++A+FN +AAWEY + M GKPYG+HNMIFSWIDTI  NYPPP+DAHLV S M++W +M
Sbjct  311  PDIQAKFNESAAWEYAKSMEGKPYGFHNMIFSWIDTIDGNYPPPLDAHLVASGMTVWHQM  370

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAAN+WNEALNKRLGTEGLDL EIL ETERRGL+FD+LLTIPEQD+W+YS+GKST+C
Sbjct  371  QPAYAANLWNEALNKRLGTEGLDLPEILVETERRGLSFDKLLTIPEQDDWLYSNGKSTSC  430

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAFIL MYK++G+FG ++ SIQVTEFTI+DAY LK +ENN +RLP WCN G+D KLPFCQ
Sbjct  431  VAFILEMYKQAGLFGPISSSIQVTEFTIKDAYTLKFFENNSSRLPKWCNEGDDVKLPFCQ  490

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYNT++PY +MNE CPSLPP Y RP  C
Sbjct  491  IRGKYRMELPGYNTMDPYPHMNERCPSLPPQYFRPQGC  528



>ref|XP_008371266.1| PREDICTED: uncharacterized protein LOC103434697 [Malus domestica]
Length=522

 Score =   353 bits (905),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 160/218 (73%), Positives = 185/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY R M G+PYGYHNMIFSWIDTI DNYPPP+DAHLV SVM++W R+
Sbjct  305  PDIRAKFNETAAWEYARSMEGQPYGYHNMIFSWIDTIEDNYPPPLDAHLVASVMTVWNRI  364

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+ L   +IL E E+ G +FDQLLTIPEQD+WVYSDGKST+C
Sbjct  365  QPAYAANMWNEALNKRLGTQNLSFXDILVEVEKSGSSFDQLLTIPEQDDWVYSDGKSTSC  424

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAFIL MYKE+G+F  +A SIQVTEFTI+DAYML I+ENN +RLP WCN G+  KLPFCQ
Sbjct  425  VAFILEMYKEAGLFDPIAGSIQVTEFTIKDAYMLNIFENNSSRLPKWCNDGDTVKLPFCQ  484

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELP YNT+EPY +MNE CPSLPP Y RP +C
Sbjct  485  IKGKYRMELPLYNTMEPYPHMNERCPSLPPKYSRPRNC  522



>ref|XP_010433417.1| PREDICTED: uncharacterized protein LOC104717532 [Camelina sativa]
Length=523

 Score =   353 bits (905),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 189/218 (87%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+ RA+FN TAAWEY R M GKPYGYHN+IFSWIDTI  NYPPP+DAHLV SVM++W+++
Sbjct  306  PDYRAKFNVTAAWEYARSMDGKPYGYHNLIFSWIDTIRGNYPPPLDAHLVASVMTVWSKI  365

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL +PEQD+W+YSDGKST+C
Sbjct  366  QPDYAANMWNEALNKRLGTEGLDLPDVLVEVEKRGSSFDELLAVPEQDDWIYSDGKSTSC  425

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE+G+F  ++ SIQVTEFTI+DAYMLK +ENN +R P WCN  +D KLP+CQ
Sbjct  426  IAFILEMYKEAGLFDPISSSIQVTEFTIKDAYMLKFFENNASRFPKWCNDNDDMKLPYCQ  485

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELPGYNT+EPY +MNE+CPSLPP Y RP +C
Sbjct  486  ILGKYRMELPGYNTMEPYPHMNEHCPSLPPKYHRPKNC  523



>ref|XP_006280251.1| hypothetical protein CARUB_v10026167mg, partial [Capsella rubella]
 gb|EOA13149.1| hypothetical protein CARUB_v10026167mg, partial [Capsella rubella]
Length=563

 Score =   353 bits (907),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 156/218 (72%), Positives = 191/218 (88%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+F+  AAW+Y R M GKPYGYHN+IFSWIDTIS+NYPPP+DAHLV S M++W++M
Sbjct  346  PDVRAKFDVAAAWKYARSMEGKPYGYHNLIFSWIDTISENYPPPLDAHLVASFMTVWSKM  405

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GLDL ++L E E+RG +FD+LLTIPEQD+W+YSDG ST+C
Sbjct  406  QPEYAANMWNEALNKRLGTKGLDLSDVLVEVEKRGSSFDKLLTIPEQDDWIYSDGPSTSC  465

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSG-NDKLPFCQ  161
            +AFIL MYKE+G+FG LA SIQVTEFTI+DAYML  +ENN +RLP+WCN   N KLP+CQ
Sbjct  466  IAFILEMYKEAGLFGPLASSIQVTEFTIKDAYMLNFFENNASRLPTWCNDNDNVKLPYCQ  525

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELPGYNT+EPY++MNE CP+LPP Y RP +C
Sbjct  526  ILGKYRMELPGYNTMEPYSHMNEQCPTLPPKYNRPDNC  563



>ref|XP_010448765.1| PREDICTED: uncharacterized protein LOC104731172 [Camelina sativa]
Length=536

 Score =   352 bits (903),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 191/218 (88%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+F+  AAW++ R M GKPYGYHN+IFSWIDTIS+NYPPP+DAHLV S M++W++M
Sbjct  319  PDVRAKFDVAAAWKFARSMEGKPYGYHNLIFSWIDTISENYPPPLDAHLVASFMTVWSKM  378

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL +PEQD+W+YSDGKST+C
Sbjct  379  QPDYAANMWNEALNKRLGTEGLDLSDVLVEVEKRGSSFDRLLAVPEQDDWIYSDGKSTSC  438

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE+G+FG LA SIQVTEFTI+DAYML  +E N +RLP+WCN  ++ KLP+CQ
Sbjct  439  IAFILEMYKEAGLFGPLASSIQVTEFTIKDAYMLNFFETNASRLPTWCNDNDNVKLPYCQ  498

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELPGYNT+EPY++MNE CP+LPP Y RP +C
Sbjct  499  ILGKYRMELPGYNTMEPYSHMNEQCPTLPPKYNRPDNC  536



>gb|KFK29208.1| hypothetical protein AALP_AA7G103200 [Arabis alpina]
Length=521

 Score =   351 bits (901),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 188/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+ RARFN  AAWEY   M GKPYGYHN+IFSWIDTIS NYPPP+DAHLV SVM++W+++
Sbjct  304  PDYRARFNVAAAWEYAHSMDGKPYGYHNLIFSWIDTISGNYPPPLDAHLVASVMTVWSKI  363

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL +PEQD+W+YSDGKST+C
Sbjct  364  QPDYAANMWNEALNKRLGTEGLDLPDVLVEVEKRGSSFDELLAVPEQDDWIYSDGKSTSC  423

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE+G+F  ++ SIQVTEFTI+DAYMLK +ENN +R P WCN  +D KLP+CQ
Sbjct  424  IAFILEMYKEAGLFDPISSSIQVTEFTIKDAYMLKFFENNASRFPKWCNDNDDVKLPYCQ  483

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELPGYNT+EPY +MNE+CPSLPP Y RP +C
Sbjct  484  ILGKYRMELPGYNTMEPYPHMNEHCPSLPPKYHRPKNC  521



>ref|NP_200298.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB08766.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96551.1| uncharacterized protein AT5G54870 [Arabidopsis thaliana]
Length=531

 Score =   351 bits (901),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 190/218 (87%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+F+  AAW+Y R M GKPYGYHN+IFSWIDT+S+NYPPP+DAHLV S M++W++M
Sbjct  314  PDVRAKFDVAAAWKYARSMEGKPYGYHNLIFSWIDTVSENYPPPLDAHLVASFMTVWSQM  373

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL +PE D+W+YSDGKST+C
Sbjct  374  QPEYAANMWNEALNKRLGTEGLDLSDVLVEVEKRGSSFDKLLAVPELDDWIYSDGKSTSC  433

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE+G+FG LA SIQVTEFTI+DAYML  +ENN +RLP+WCN  +  KLP+CQ
Sbjct  434  IAFILEMYKEAGLFGPLASSIQVTEFTIKDAYMLNFFENNASRLPTWCNDNDSVKLPYCQ  493

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELPGYNT+EPY++MNE CP+LPP Y RP +C
Sbjct  494  ILGKYRMELPGYNTMEPYSHMNEQCPTLPPKYNRPDNC  531



>ref|XP_002864361.1| hypothetical protein ARALYDRAFT_331828 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40620.1| hypothetical protein ARALYDRAFT_331828 [Arabidopsis lyrata subsp. 
lyrata]
Length=529

 Score =   351 bits (900),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 192/218 (88%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P VRA+F+  AAW+Y R M GKPYGYHN+IFSWIDT+S+NYPPP+DAH+V S M++W++M
Sbjct  312  PNVRAKFDVAAAWKYARSMEGKPYGYHNLIFSWIDTVSENYPPPLDAHIVASFMTVWSQM  371

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL +PEQD+W+YSDGKST+C
Sbjct  372  QPEYAANMWNEALNKRLGTEGLDLSDVLVEVEKRGSSFDKLLAVPEQDDWIYSDGKSTSC  431

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL +YKE+G+FG LA SIQVTEFTI+DAYML  +ENN +RLP+WCN+ ++ KLP+CQ
Sbjct  432  IAFILELYKEAGLFGPLANSIQVTEFTIKDAYMLNFFENNASRLPTWCNANDNVKLPYCQ  491

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELPGYNT+EPY++MNE CP+LPP Y RP +C
Sbjct  492  ILGKYRMELPGYNTMEPYSHMNEQCPTLPPKYNRPDNC  529



>ref|XP_010448183.1| PREDICTED: uncharacterized protein LOC104730687 [Camelina sativa]
Length=561

 Score =   352 bits (902),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 189/218 (87%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+ RA+FN TAAWEY R M GKPYGYHN+IFSWIDTIS NYPPP+DAHLV SVM++W+++
Sbjct  344  PDYRAKFNVTAAWEYARSMDGKPYGYHNLIFSWIDTISGNYPPPLDAHLVASVMTVWSKI  403

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL +PEQD+W+YSDGKST+C
Sbjct  404  QPDYAANMWNEALNKRLGTEGLDLPDVLVEVEKRGSSFDELLAVPEQDDWIYSDGKSTSC  463

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE+G+F  ++ SIQVTEFTI+DAYMLK +ENN +R P WCN  +D KLP+CQ
Sbjct  464  IAFILEMYKEAGLFDPISSSIQVTEFTIKDAYMLKFFENNASRFPKWCNDNDDAKLPYCQ  523

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELP YNT+EPY +MNE+CPSLPP Y RP +C
Sbjct  524  ILGKYRMELPDYNTMEPYPHMNEHCPSLPPKYHRPKNC  561



>ref|XP_010482896.1| PREDICTED: uncharacterized protein LOC104761505 [Camelina sativa]
Length=534

 Score =   351 bits (900),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 189/218 (87%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+F+  AAW++ R M GKPYGYHN+IFSWIDTIS+NYPPP+DAHL  S M++W++M
Sbjct  317  PDVRAKFDVAAAWKFARSMEGKPYGYHNLIFSWIDTISENYPPPLDAHLAASFMTVWSKM  376

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL +PEQD+W+YSDGKST+C
Sbjct  377  QPDYAANMWNEALNKRLGTEGLDLSDVLVEVEKRGSSFDRLLAVPEQDDWIYSDGKSTSC  436

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSG-NDKLPFCQ  161
            +AFIL MYKE+G+FG LA SIQVTEFTI+DAYML  +ENN +RLP+WCN   N KLP+CQ
Sbjct  437  IAFILEMYKEAGLFGPLASSIQVTEFTIKDAYMLNFFENNASRLPTWCNDNDNVKLPYCQ  496

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELPGYNT+ PY++MNE CP+LPP Y RP +C
Sbjct  497  ILGKYRMELPGYNTMAPYSHMNEQCPTLPPKYNRPDNC  534



>ref|XP_010446119.1| PREDICTED: uncharacterized protein LOC104728896 [Camelina sativa]
Length=697

 Score =   354 bits (908),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 192/218 (88%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+F+  AAW++ R M GKPYGYHN+IFSWIDTIS+NYPPP+DAHLV S M++W++M
Sbjct  480  PDVRAKFDVAAAWKFARSMEGKPYGYHNLIFSWIDTISENYPPPLDAHLVASFMTVWSKM  539

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL +PEQD+W+YSDGKST+C
Sbjct  540  QPDYAANMWNEALNKRLGTEGLDLSDVLVEVEKRGSSFDRLLAVPEQDDWIYSDGKSTSC  599

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCN-SGNDKLPFCQ  161
            +AFIL +YKE+G+FG LA SIQVTEFTI+DAYML  +ENN +RLP+WCN + N KLP+CQ
Sbjct  600  IAFILEIYKEAGLFGPLASSIQVTEFTIKDAYMLNFFENNASRLPTWCNDNDNVKLPYCQ  659

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELPGYNT+EPY++MNE CP+LPP Y RP +C
Sbjct  660  ILGKYRMELPGYNTMEPYSHMNEQCPTLPPKYNRPDNC  697



>gb|KHG29749.1| Transcription activator gutR [Gossypium arboreum]
Length=531

 Score =   348 bits (894),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 190/218 (87%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FN TAAWEY   M GKPYGYHNMIFSWIDTI  NYPPP+DAHLV SVM++W+++
Sbjct  314  PDVRAKFNETAAWEYALSMAGKPYGYHNMIFSWIDTIGGNYPPPLDAHLVASVMTVWSKI  373

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GL+L +IL ETE+RG +FD+LLTIPEQD W+YSDGKST+C
Sbjct  374  QPEYAANMWNEALNKRLGTQGLNLSDILVETEKRGSSFDELLTIPEQDNWIYSDGKSTSC  433

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AF+L +YKE+G+F  +A+SIQVTEFTI+DAY LK +E++ +RLP WCN  +D KLP+CQ
Sbjct  434  IAFVLELYKEAGLFDPIADSIQVTEFTIKDAYSLKFFESDSSRLPKWCNDADDVKLPYCQ  493

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYN++EPYA+MNE CPS+PP Y RP +C
Sbjct  494  IKGKYRMELPGYNSMEPYAHMNERCPSMPPKYFRPQNC  531



>gb|KHN38290.1| hypothetical protein glysoja_003955 [Glycine soja]
Length=439

 Score =   345 bits (885),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 188/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P +RARFN TAAWEY   M GKPYGYHNMIFSWIDT+++NYPPP+DA++V  VM++W+++
Sbjct  222  PALRARFNETAAWEYALSMAGKPYGYHNMIFSWIDTLNENYPPPLDANVVACVMTIWSQL  281

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GLDL E+L E E+RG +FD+LLTIPEQD+W+YSDGKST+C
Sbjct  282  QPEYAANMWNEALNKRLGTKGLDLSEVLVEVEKRGSSFDELLTIPEQDDWIYSDGKSTSC  341

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE+G+F  +A S+QVTEFTI+DAY+L  +ENN TRLP WCN G+  KLP+CQ
Sbjct  342  IAFILEMYKEAGLFDPVASSVQVTEFTIKDAYILNFFENNSTRLPKWCNDGDTVKLPYCQ  401

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRM+LPGYNT++PY +MNE CPSLPP Y RP +C
Sbjct  402  IKGKYRMDLPGYNTMQPYPHMNERCPSLPPKYSRPQNC  439



>gb|ABR17461.1| unknown [Picea sitchensis]
Length=520

 Score =   347 bits (891),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 190/217 (88%), Gaps = 1/217 (0%)
 Frame = -1

Query  694  EVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRMQ  515
            ++RA+FN+TAAW YV  M G+PYGYHNMIFSWIDT++DNYPPP+DAHLV+SVM++W RMQ
Sbjct  304  DLRAKFNATAAWAYVLNMSGEPYGYHNMIFSWIDTLTDNYPPPLDAHLVVSVMTIWNRMQ  363

Query  514  PTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCV  335
            P YAANMWNEALNKRLGT+ LDL  IL ETE+RG++F+ LL IPE+D+W YSDGKSTTC+
Sbjct  364  PDYAANMWNEALNKRLGTKDLDLPSILIETEQRGISFEDLLKIPEKDDWFYSDGKSTTCI  423

Query  334  AFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQI  158
            AFIL MYKE+G+F  ++ SIQVTEFTIRDAYML+ +++N T LPSWCN  ++ +LPFCQI
Sbjct  424  AFILEMYKEAGLFDPISNSIQVTEFTIRDAYMLRFFDDNITNLPSWCNENDEVQLPFCQI  483

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEYRMELPGYNT++PY +MNENCPSLPP+Y RP  C
Sbjct  484  LGEYRMELPGYNTIDPYPHMNENCPSLPPAYHRPKKC  520



>ref|XP_009334822.1| PREDICTED: uncharacterized protein LOC103927611 [Pyrus x bretschneideri]
 ref|XP_009334847.1| PREDICTED: uncharacterized protein LOC103927629 [Pyrus x bretschneideri]
Length=522

 Score =   347 bits (891),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 157/218 (72%), Positives = 184/218 (84%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY R M G+PYGYHNMIFSWIDTI DNYPPP+DAHLV SVM++W ++
Sbjct  305  PDIRAKFNETAAWEYARSMEGQPYGYHNMIFSWIDTIEDNYPPPLDAHLVASVMTVWNQI  364

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+ L   +IL E E+ G +FD+LLTIPEQD+WVYSDGKST+C
Sbjct  365  QPAYAANMWNEALNKRLGTQNLSFPDILVEVEKSGSSFDRLLTIPEQDDWVYSDGKSTSC  424

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAFIL MYKE+G+F  +A SIQVTEFTI+DAYML  +ENN +RLP WCN G+  KLPFCQ
Sbjct  425  VAFILEMYKEAGLFDPIASSIQVTEFTIKDAYMLNFFENNSSRLPKWCNDGDTVKLPFCQ  484

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELP YNT+EPY +MNE CPSLPP Y RP +C
Sbjct  485  IKGKYRMELPLYNTMEPYPHMNERCPSLPPKYSRPRNC  522



>ref|XP_010545218.1| PREDICTED: uncharacterized protein LOC104817662 [Tarenaya hassleriana]
Length=524

 Score =   347 bits (890),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 187/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+ RA+FN TAAWEY R M GKPYGYHNMIFSWIDTIS+NYPPP+DAH+V SVM++W+++
Sbjct  307  PDARAKFNVTAAWEYARNMDGKPYGYHNMIFSWIDTISENYPPPLDAHVVASVMTVWSKI  366

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALN RLGT+ LDL +I+ E E+RG +FD+LLTIPEQD+WVYSDGKST+C
Sbjct  367  QPDYAANMWNEALNMRLGTKDLDLPDIMVEVEKRGSSFDELLTIPEQDDWVYSDGKSTSC  426

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AF+L MYKE+G+F  +A S+QVTEFTI+DAYMLK +E N +RLP+WCN  +D KLP+CQ
Sbjct  427  IAFVLEMYKEAGLFDPIASSVQVTEFTIKDAYMLKFFETNASRLPNWCNDKDDVKLPYCQ  486

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELP YNT+EPY  MNE CPSLPP Y RP  C
Sbjct  487  ILGKYRMELPDYNTMEPYPRMNEQCPSLPPEYHRPDSC  524



>ref|XP_006283454.1| hypothetical protein CARUB_v10004499mg, partial [Capsella rubella]
 gb|EOA16352.1| hypothetical protein CARUB_v10004499mg, partial [Capsella rubella]
Length=557

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 187/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+ RA+FN TAAWEY   M GKPYGYHN+IFSWIDTIS NYPPP+DAHLV SVM++W+++
Sbjct  340  PDYRAKFNVTAAWEYACSMDGKPYGYHNLIFSWIDTISGNYPPPLDAHLVASVMTVWSKI  399

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FDQLL +PEQD+W+YSDGKST+C
Sbjct  400  QPDYAANMWNEALNKRLGTEGLDLPDVLVEVEKRGSSFDQLLAVPEQDDWIYSDGKSTSC  459

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE+G+F  ++ SIQVTEFTI+DAYMLK +ENN +R P WCN  +D  LP+CQ
Sbjct  460  IAFILEMYKEAGLFDPISSSIQVTEFTIKDAYMLKFFENNASRFPKWCNDNDDVNLPYCQ  519

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELP YNT+EPY +MNE+CPSLPP Y RP +C
Sbjct  520  ILGKYRMELPSYNTMEPYPHMNEHCPSLPPKYHRPKNC  557



>ref|NP_001044498.2| Os01g0793500 [Oryza sativa Japonica Group]
 dbj|BAD53001.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG94904.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55516.1| hypothetical protein OsJ_03735 [Oryza sativa Japonica Group]
 dbj|BAF06412.2| Os01g0793500 [Oryza sativa Japonica Group]
Length=539

 Score =   347 bits (891),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 188/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY + M GKPYGYHNMIFSWIDTISDNYPPP+DAH+V SVM+MW ++
Sbjct  322  PDLRAKFNETAAWEYAKSMDGKPYGYHNMIFSWIDTISDNYPPPLDAHVVASVMTMWNKL  381

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMW EALNKRLGT+GLDL EI+ E+E+RG+TFD+LLT+PEQD+WVY+DG+S +C
Sbjct  382  QPEYAANMWKEALNKRLGTKGLDLPEIIVESEKRGMTFDKLLTVPEQDKWVYTDGQSASC  441

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VA++L MYKE+G+F  +A SI+VTEFTI+DAY L  +ENN TRLP WCN  +  KLPFCQ
Sbjct  442  VAYVLMMYKEAGLFDPIASSIEVTEFTIKDAYSLNFFENNMTRLPVWCNKDDSVKLPFCQ  501

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G YRMELPGYNT++PY +MNE CPSLPP+Y RP +C
Sbjct  502  IKGRYRMELPGYNTMQPYPHMNERCPSLPPNYNRPRNC  539



>dbj|BAB89049.1| unknown protein [Oryza sativa Japonica Group]
Length=545

 Score =   347 bits (891),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 188/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY + M GKPYGYHNMIFSWIDTISDNYPPP+DAH+V SVM+MW ++
Sbjct  328  PDLRAKFNETAAWEYAKSMDGKPYGYHNMIFSWIDTISDNYPPPLDAHVVASVMTMWNKL  387

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMW EALNKRLGT+GLDL EI+ E+E+RG+TFD+LLT+PEQD+WVY+DG+S +C
Sbjct  388  QPEYAANMWKEALNKRLGTKGLDLPEIIVESEKRGMTFDKLLTVPEQDKWVYTDGQSASC  447

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VA++L MYKE+G+F  +A SI+VTEFTI+DAY L  +ENN TRLP WCN  +  KLPFCQ
Sbjct  448  VAYVLMMYKEAGLFDPIASSIEVTEFTIKDAYSLNFFENNMTRLPVWCNKDDSVKLPFCQ  507

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G YRMELPGYNT++PY +MNE CPSLPP+Y RP +C
Sbjct  508  IKGRYRMELPGYNTMQPYPHMNERCPSLPPNYNRPRNC  545



>gb|ACF87807.1| unknown [Zea mays]
Length=363

 Score =   341 bits (874),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 185/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAW Y + M GKPYGYHNMIFSWIDTISDNYPPP+DAH+V SVM++W+++
Sbjct  146  PDLRAKFNETAAWIYAKSMEGKPYGYHNMIFSWIDTISDNYPPPLDAHVVASVMTVWSKL  205

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMW EALNKRLGT+GLDL EI+ E+E+RG+TFD+LL++PE D WVY DG+S +C
Sbjct  206  QPEYAANMWKEALNKRLGTKGLDLSEIIVESEKRGITFDKLLSVPENDSWVYEDGQSASC  265

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAF+L MYKE+G+F  +  SI+VTEFTI+DAY+L  +E+N TRLP WCN  +D KLPFCQ
Sbjct  266  VAFVLMMYKEAGLFDPITSSIEVTEFTIKDAYILNFFEDNSTRLPEWCNKDDDVKLPFCQ  325

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYNT++PYA+MNE CPSLPP Y R   C
Sbjct  326  IKGKYRMELPGYNTMKPYAHMNERCPSLPPDYNRTKGC  363



>ref|NP_194432.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB36548.1| putative protein [Arabidopsis thaliana]
 emb|CAB79557.1| putative protein [Arabidopsis thaliana]
 gb|AAL75889.1| AT4g27020/F10M23_360 [Arabidopsis thaliana]
 gb|AAN28849.1| At4g27020/F10M23_360 [Arabidopsis thaliana]
 gb|AEE85285.1| uncharacterized protein AT4G27020 [Arabidopsis thaliana]
Length=523

 Score =   346 bits (888),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 155/219 (71%), Positives = 189/219 (86%), Gaps = 3/219 (1%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+ RA+FN TAAWEY R M GKPYGYHN+IFSWIDTIS NYPPP+DA LV SVM++W+++
Sbjct  306  PDYRAKFNVTAAWEYARSMDGKPYGYHNLIFSWIDTISGNYPPPLDAQLVASVMTVWSKI  365

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL +PEQD+W+YSDGKST+C
Sbjct  366  QPDYAANMWNEALNKRLGTEGLDLPDVLVEVEKRGSSFDELLAVPEQDDWIYSDGKSTSC  425

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND--KLPFC  164
            +AFIL MYKE+G+F  ++ SIQVTEFTI+DAYMLK +E+N +R P WCN  ND  KLP+C
Sbjct  426  IAFILEMYKEAGLFDPISSSIQVTEFTIKDAYMLKFFESNASRFPKWCND-NDVVKLPYC  484

Query  163  QIVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            QI+G+YRMELPGYNT+EPY +MNE+CPSLPP Y RP +C
Sbjct  485  QILGKYRMELPGYNTMEPYPHMNEHCPSLPPKYHRPKNC  523



>gb|KJB62763.1| hypothetical protein B456_009G435000 [Gossypium raimondii]
Length=524

 Score =   346 bits (888),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 189/218 (87%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FN TAAWEY   M GKPYGYHNMIFSWIDTI  NYPPP+DAHLV SVM++W+++
Sbjct  307  PDVRAKFNETAAWEYALSMAGKPYGYHNMIFSWIDTIGGNYPPPLDAHLVASVMTVWSKI  366

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GL+L +IL ETE+RG +FD+LLTIPEQD W+YSDGKST+C
Sbjct  367  QPEYAANMWNEALNKRLGTQGLNLSDILVETEKRGSSFDELLTIPEQDNWIYSDGKSTSC  426

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AF+L +YKE+G+F  +A+SIQVTEFTI+DAY LK +EN+ +RLP WCN  ++ KLP+CQ
Sbjct  427  IAFVLELYKEAGLFDPIADSIQVTEFTIKDAYSLKFFENDSSRLPKWCNDADNVKLPYCQ  486

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYN+++PY +MNE CPS+PP Y RP +C
Sbjct  487  IKGKYRMELPGYNSMDPYVHMNERCPSMPPKYFRPQNC  524



>ref|XP_006367536.1| PREDICTED: uncharacterized protein LOC102597542 [Solanum tuberosum]
Length=537

 Score =   346 bits (888),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 185/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RARFN TAAWEY R M GKPYG+HN+IFSWIDTI  NYP P+DAHLV SVM++W  +
Sbjct  320  PDLRARFNQTAAWEYARSMAGKPYGFHNLIFSWIDTIDGNYPSPLDAHLVASVMTVWNHL  379

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GLDL +IL E E+RG +F +LLTIPEQD+WVYSDGKST+C
Sbjct  380  QPAYAANMWNEALNKRLGTQGLDLPDILVEVEKRGSSFAKLLTIPEQDDWVYSDGKSTSC  439

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AF+L MYKE+G+FG LA SIQVTEFTI+DAY LK +EN+  RLP WCN+ +  KLPFCQ
Sbjct  440  IAFVLEMYKEAGLFGPLASSIQVTEFTIKDAYSLKFFENDTNRLPKWCNADDTVKLPFCQ  499

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELPGYNT++ YA+MNE CPS+PP Y RP  C
Sbjct  500  ILGKYRMELPGYNTMDIYAHMNEKCPSMPPIYYRPQSC  537



>ref|XP_011097895.1| PREDICTED: uncharacterized protein LOC105176701 [Sesamum indicum]
Length=533

 Score =   346 bits (887),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 185/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PE+RA+FN TAAWEY + M GKPYGYHN+IFSWIDTIS NYP P+DAHLV SVM++WT+M
Sbjct  316  PELRAKFNETAAWEYAKSMSGKPYGYHNLIFSWIDTISGNYPAPLDAHLVASVMTVWTQM  375

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YA NMWNEALNKRLG++ L L E+L E E+RG +F +LL IPEQD+WVY+DGKST+C
Sbjct  376  QPAYAGNMWNEALNKRLGSQNLSLSEVLVEVEKRGSSFGELLAIPEQDDWVYADGKSTSC  435

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAF+  +YKE+G+FG LA SIQVTEFTI+DAY LK +ENN +RLP+WCN  +  KLPFCQ
Sbjct  436  VAFVFELYKEAGLFGKLASSIQVTEFTIKDAYSLKFFENNSSRLPTWCNDVDTVKLPFCQ  495

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYNT++PY++MNE CPSLPP Y RP+ C
Sbjct  496  IRGKYRMELPGYNTMDPYSHMNERCPSLPPKYYRPLGC  533



>gb|KCW67126.1| hypothetical protein EUGRSUZ_F00907 [Eucalyptus grandis]
Length=216

 Score =   334 bits (857),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 179/216 (83%), Gaps = 1/216 (0%)
 Frame = -1

Query  691  VRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRMQP  512
            +RA+FN TAAWEY   M GKPYGYHNM+FSWIDTI  NYPPP+DAH+V SVM++W +MQP
Sbjct  1    MRAKFNETAAWEYAESMNGKPYGYHNMLFSWIDTIDANYPPPLDAHVVASVMTVWNQMQP  60

Query  511  TYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVA  332
             YAANMWNEALNKRLGTEGLDL ++L ETE RG +F +LLTIPEQD+WVYSDGKS +CVA
Sbjct  61   AYAANMWNEALNKRLGTEGLDLPDLLVETEMRGSSFAELLTIPEQDDWVYSDGKSASCVA  120

Query  331  FILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQIV  155
            F+L MYK +G+F  ++ S+QVTEFTI+DAY LK +ENN +RLP WCN G+D +LPFCQI 
Sbjct  121  FVLEMYKAAGLFDPISSSVQVTEFTIKDAYSLKFFENNSSRLPKWCNDGDDVELPFCQIR  180

Query  154  GEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            G YRMELP YNT++ Y +MNE CPSLPP Y RP  C
Sbjct  181  GRYRMELPRYNTMDLYPHMNERCPSLPPKYSRPSDC  216



>ref|XP_001775460.1| predicted protein [Physcomitrella patens]
 gb|EDQ59789.1| predicted protein [Physcomitrella patens]
Length=525

 Score =   345 bits (885),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 154/217 (71%), Positives = 188/217 (87%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FN TAAWEY R M G PYGYHNMIFSWIDT +DNYPPP+D++LV S ++MWTR+
Sbjct  309  PDVRAKFNVTAAWEYARRMSGAPYGYHNMIFSWIDTPTDNYPPPLDSNLVASAITMWTRL  368

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP +AANMWNEALNKRLGTEGLDL  ++ E+E+RG++F++LL IPEQD W YSDG STTC
Sbjct  369  QPDFAANMWNEALNKRLGTEGLDLPGVMVESEKRGISFEELLAIPEQDTWEYSDGFSTTC  428

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL MYKE+G+FGS  +SIQVTEFTIRDAYMLK++E++ +RLPSWCN+   K  FCQI
Sbjct  429  VAFILQMYKEAGLFGSFGDSIQVTEFTIRDAYMLKLFEDDVSRLPSWCNATEGKGSFCQI  488

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY ME+P YNT+EPYA+MNE CPSLPP+Y+RP +C
Sbjct  489  LGEYEMEIPDYNTIEPYAHMNERCPSLPPTYDRPKNC  525



>ref|XP_003519567.1| PREDICTED: uncharacterized protein LOC100789468 isoform X1 [Glycine 
max]
Length=519

 Score =   345 bits (884),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 188/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P +RARFN TAAWEY   M GKPYGYHNMIFSWIDT+++NYPPP+DA++V  VM++W+++
Sbjct  302  PALRARFNETAAWEYALSMAGKPYGYHNMIFSWIDTLNENYPPPLDANVVACVMTIWSQL  361

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GLDL E+L E E+RG +FD+LLTIPEQD+W+YSDGKST+C
Sbjct  362  QPEYAANMWNEALNKRLGTKGLDLSEVLVEVEKRGSSFDELLTIPEQDDWIYSDGKSTSC  421

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE+G+F  +A S+QVTEFTI+DAY+L  +ENN TRLP WCN G+  KLP+CQ
Sbjct  422  IAFILEMYKEAGLFDPVASSVQVTEFTIKDAYILNFFENNSTRLPKWCNDGDTVKLPYCQ  481

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRM+LPGYNT++PY +MNE CPSLPP Y RP +C
Sbjct  482  IKGKYRMDLPGYNTMQPYPHMNERCPSLPPKYSRPQNC  519



>emb|CDY20800.1| BnaA02g09400D [Brassica napus]
Length=610

 Score =   347 bits (891),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 185/210 (88%), Gaps = 1/210 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FN TAAWEY R M GKPYGYHN+IFSWIDT+++NYPPP+D+HLV S M++W++M
Sbjct  312  PDVRAKFNVTAAWEYARSMEGKPYGYHNLIFSWIDTVTENYPPPLDSHLVASFMTVWSKM  371

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GLDL ++L E E+RG +FD+LL IPEQD+WVYSDGKST+C
Sbjct  372  QPDYAANMWNEALNKRLGTKGLDLSDVLVEVEKRGSSFDKLLAIPEQDDWVYSDGKSTSC  431

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE G+FGSLA+S+QVTEFTI+DAYML  +E N +RLP WCN  +  KLP+CQ
Sbjct  432  IAFILEMYKEGGLFGSLADSVQVTEFTIKDAYMLNFFETNASRLPKWCNDNDSVKLPYCQ  491

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPP  71
            I+G+YRM+LPGYNT+EPY +MNE CPSLPP
Sbjct  492  ILGKYRMQLPGYNTMEPYTHMNEQCPSLPP  521



>ref|XP_004970230.1| PREDICTED: uncharacterized protein LOC101777322 isoform X2 [Setaria 
italica]
Length=543

 Score =   345 bits (885),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 186/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAW Y + M GKPYGYHNMIFSWIDTISDNYPPP+DAH+V SVM++WT++
Sbjct  326  PDLRAKFNETAAWNYAKNMSGKPYGYHNMIFSWIDTISDNYPPPLDAHVVASVMTVWTKL  385

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAAN+W EALNKRLGT+GLDL EI+ E+ERRG+TFD+LLT+PE+D WVY DG+S +C
Sbjct  386  QPEYAANLWKEALNKRLGTKGLDLPEIIVESERRGITFDKLLTVPEKDNWVYEDGQSASC  445

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AF+L MYKE+G+FG +  S++VTEFTI+DAY L  +E+N TRLP WCN G+  KLPFCQ
Sbjct  446  IAFVLMMYKEAGLFGPITNSVEVTEFTIKDAYTLNFFEDNSTRLPEWCNKGDSVKLPFCQ  505

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G YRMELPGYNT++PYA+MNE CPSLPP Y+R   C
Sbjct  506  IKGRYRMELPGYNTMKPYAHMNERCPSLPPDYKRTKGC  543



>ref|XP_004970229.1| PREDICTED: uncharacterized protein LOC101777322 isoform X1 [Setaria 
italica]
Length=554

 Score =   345 bits (886),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 186/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAW Y + M GKPYGYHNMIFSWIDTISDNYPPP+DAH+V SVM++WT++
Sbjct  337  PDLRAKFNETAAWNYAKNMSGKPYGYHNMIFSWIDTISDNYPPPLDAHVVASVMTVWTKL  396

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAAN+W EALNKRLGT+GLDL EI+ E+ERRG+TFD+LLT+PE+D WVY DG+S +C
Sbjct  397  QPEYAANLWKEALNKRLGTKGLDLPEIIVESERRGITFDKLLTVPEKDNWVYEDGQSASC  456

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AF+L MYKE+G+FG +  S++VTEFTI+DAY L  +E+N TRLP WCN G+  KLPFCQ
Sbjct  457  IAFVLMMYKEAGLFGPITNSVEVTEFTIKDAYTLNFFEDNSTRLPEWCNKGDSVKLPFCQ  516

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G YRMELPGYNT++PYA+MNE CPSLPP Y+R   C
Sbjct  517  IKGRYRMELPGYNTMKPYAHMNERCPSLPPDYKRTKGC  554



>ref|XP_007142263.1| hypothetical protein PHAVU_008G266000g [Phaseolus vulgaris]
 gb|ESW14257.1| hypothetical protein PHAVU_008G266000g [Phaseolus vulgaris]
Length=544

 Score =   345 bits (885),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 190/218 (87%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RARFN +AAWEY   M+GKPYGYHNMIFSWIDT++ NYPPP+DA++V  VM++W ++
Sbjct  327  PDLRARFNESAAWEYALSMIGKPYGYHNMIFSWIDTLNGNYPPPLDANVVACVMTIWNQI  386

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GLDL E+L E E+RG +FD+LLTIPEQD+WVY+DGKST+C
Sbjct  387  QPEYAANMWNEALNKRLGTKGLDLPEVLVEVEKRGSSFDELLTIPEQDDWVYTDGKSTSC  446

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE+G+FG +A S+QVTEFTI+DAY+L  +ENN +RLP WCN G+  KLP+CQ
Sbjct  447  IAFILEMYKEAGLFGPIASSVQVTEFTIKDAYILNFFENNSSRLPKWCNDGDTVKLPYCQ  506

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YR+ELPGYN++EPY++MNE CPSLPP Y RP +C
Sbjct  507  IKGKYRVELPGYNSMEPYSHMNERCPSLPPKYSRPKNC  544



>ref|XP_007211818.1| hypothetical protein PRUPE_ppa004230mg [Prunus persica]
 gb|EMJ13017.1| hypothetical protein PRUPE_ppa004230mg [Prunus persica]
Length=522

 Score =   344 bits (883),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 185/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY R M G+PYGYHN+IFSWIDTI DNYPPP+DAH+V SVM++W  +
Sbjct  305  PDIRAKFNETAAWEYARSMEGQPYGYHNLIFSWIDTIQDNYPPPLDAHVVASVMTVWNHI  364

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QPTYAANMWNEALNKRLGT+ L   +IL E E+RG +FD+LLT+PEQD+W+YSDGKST+C
Sbjct  365  QPTYAANMWNEALNKRLGTQNLSFPDILVEVEKRGSSFDELLTVPEQDDWLYSDGKSTSC  424

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAFIL MYKE+G+F  +A SIQVTEFTI+DAYMLK +ENN +RLP WCN G+  KLPFCQ
Sbjct  425  VAFILEMYKEAGLFDPIASSIQVTEFTIKDAYMLKFFENNSSRLPKWCNDGDSVKLPFCQ  484

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELP YN++EPY++MNE C SLPP Y R  +C
Sbjct  485  IKGKYRMELPEYNSMEPYSHMNERCESLPPKYSRSRNC  522



>ref|XP_009420606.1| PREDICTED: uncharacterized protein LOC104000320 [Musa acuminata 
subsp. malaccensis]
Length=537

 Score =   344 bits (882),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 156/218 (72%), Positives = 185/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FN+TAAWEY + ML KPYGYHNMIFSWIDTISDNYPPP+D+H+V SVM+MW ++
Sbjct  320  PDVRAKFNNTAAWEYGKSMLDKPYGYHNMIFSWIDTISDNYPPPLDSHVVASVMTMWNKI  379

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GLDL EI+ E E+ G +FD LLTIPEQD+WVY+DGKST+C
Sbjct  380  QPAYAANMWNEALNKRLGTQGLDLPEIIVEAEKNGTSFDNLLTIPEQDDWVYTDGKSTSC  439

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAFIL MYK +G+FGS A SIQVTEFTI+DAY L  +E+N +RLP WCN  ++ KLP+CQ
Sbjct  440  VAFILEMYKAAGLFGSNASSIQVTEFTIKDAYTLNFFESNSSRLPKWCNKDDNVKLPYCQ  499

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G YRMELPGYNT++PY +MNENC SLPP Y R   C
Sbjct  500  IKGRYRMELPGYNTMQPYPHMNENCASLPPYYSRTKDC  537



>gb|KDP39105.1| hypothetical protein JCGZ_00862 [Jatropha curcas]
Length=524

 Score =   343 bits (881),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 187/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY   M GKPYGYHNMIFSWIDTI  NYPPP+DAHLV SVM++W+++
Sbjct  307  PDIRAKFNETAAWEYALSMNGKPYGYHNMIFSWIDTIEGNYPPPLDAHLVASVMTVWSQI  366

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGL L +IL ETE+RG +F +LLTIPEQD+W+Y+DGKST+C
Sbjct  367  QPAYAANMWNEALNKRLGTEGLALPDILVETEKRGSSFGELLTIPEQDDWMYTDGKSTSC  426

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AF+L MYKE+G+F  +A S+QVTEFTI+DAY L+ +ENN +RLP WCN G+D KLPFCQ
Sbjct  427  IAFVLEMYKEAGLFDPIASSVQVTEFTIKDAYTLRFFENNSSRLPKWCNDGDDVKLPFCQ  486

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELP YNT++PY +MNE CPSLPP Y RP +C
Sbjct  487  IRGKYRMELPDYNTIDPYPHMNEMCPSLPPKYFRPQNC  524



>ref|XP_008226932.1| PREDICTED: uncharacterized protein LOC103326477 [Prunus mume]
Length=522

 Score =   343 bits (879),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 185/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY R M G+PYGYHN+IFSWIDTI DNYPPP+DAH+V SVM++W  +
Sbjct  305  PDIRAKFNETAAWEYARSMEGQPYGYHNLIFSWIDTIQDNYPPPLDAHVVASVMTVWNHI  364

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QPTYAANMWNEALNKRLGT+ L   +IL + E+RG +FD+LLT+PEQD+W+YSDGKST+C
Sbjct  365  QPTYAANMWNEALNKRLGTQNLSFPDILVDVEKRGSSFDELLTVPEQDDWLYSDGKSTSC  424

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAFIL MYKE+G+F  +A SIQVTEFTI+DAYMLK +ENN +RLP WCN G+  KLPFCQ
Sbjct  425  VAFILEMYKEAGLFDPIASSIQVTEFTIKDAYMLKFFENNSSRLPKWCNDGDTVKLPFCQ  484

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELP YN++EPY++MNE C SLPP Y R  +C
Sbjct  485  IKGKYRMELPEYNSMEPYSHMNERCESLPPKYSRSRNC  522



>ref|XP_006452283.1| hypothetical protein CICLE_v10008210mg [Citrus clementina]
 gb|ESR65523.1| hypothetical protein CICLE_v10008210mg [Citrus clementina]
Length=463

 Score =   341 bits (874),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 181/218 (83%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY   M GKPYGYHNMIFSWIDT S NYPPP+DAHLV S M+MW  +
Sbjct  246  PDMRAKFNETAAWEYALSMDGKPYGYHNMIFSWIDTRSGNYPPPLDAHLVASGMTMWNHI  305

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL +IL ETERRG  FD+LLTIPEQD+W+YSDGKST+C
Sbjct  306  QPAYAANMWNEALNKRLGTEGLDLPDILVETERRGTPFDELLTIPEQDDWIYSDGKSTSC  365

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAF+L MYKE+G+F  +  SIQVTEFTI+DAY L+ +ENN +RLP WCN  +  KLP+CQ
Sbjct  366  VAFVLEMYKEAGLFDPIGSSIQVTEFTIKDAYSLRFFENNSSRLPKWCNDADTVKLPYCQ  425

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYN L+PY +MNE CPS+PP Y R  +C
Sbjct  426  IRGKYRMELPGYNVLDPYPHMNERCPSMPPKYSRTANC  463



>ref|XP_004252023.1| PREDICTED: uncharacterized protein LOC101252754 [Solanum lycopersicum]
Length=523

 Score =   343 bits (879),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 184/218 (84%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY + M GKPYG+HN+IFSWIDTI  NYP P+DAHLV SVM++W  +
Sbjct  306  PDLRAKFNQTAAWEYAQSMEGKPYGFHNLIFSWIDTIDGNYPSPLDAHLVASVMTVWNHL  365

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT GLDL +IL E E+RG +F +LLTIPEQD+WVYSDGKST+C
Sbjct  366  QPAYAANMWNEALNKRLGTRGLDLPDILVEIEKRGSSFAKLLTIPEQDDWVYSDGKSTSC  425

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AF+L MYKE+G+FG LA SIQVTEFTI+DAY LK +ENN  RLP WCN+ +  KLPFCQ
Sbjct  426  IAFVLEMYKEAGLFGPLASSIQVTEFTIKDAYSLKFFENNTNRLPMWCNADDTVKLPFCQ  485

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELPGYNT++ YA+MNE CPS+PP Y RP  C
Sbjct  486  ILGKYRMELPGYNTMDVYAHMNEKCPSMPPKYYRPQSC  523



>ref|XP_008349941.1| PREDICTED: uncharacterized protein LOC103413239 [Malus domestica]
Length=522

 Score =   343 bits (879),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 184/218 (84%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY R M G+PYG+HN+IFSWIDTI DNYPPP+DAH+V SVM++W ++
Sbjct  305  PDIRAKFNETAAWEYARSMEGQPYGFHNLIFSWIDTIEDNYPPPLDAHVVASVMTVWNQI  364

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+ L   +IL E E+RG +FDQLLTIPEQD+W YSDGKST+C
Sbjct  365  QPAYAANMWNEALNKRLGTQNLTFPDILVEVEKRGSSFDQLLTIPEQDDWEYSDGKSTSC  424

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAFIL MYKE+G+FG +A SIQVTEFTI+DAYMLK +ENN +RLP WCN G+  KLPFCQ
Sbjct  425  VAFILEMYKEAGLFGPIASSIQVTEFTIKDAYMLKFFENNSSRLPKWCNDGDTVKLPFCQ  484

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELP YNT+E Y +MNE CPSLPP Y R  +C
Sbjct  485  IKGKYRMELPLYNTMETYPHMNERCPSLPPKYSRLQNC  522



>gb|EYU19247.1| hypothetical protein MIMGU_mgv1a004499mg [Erythranthe guttata]
Length=524

 Score =   343 bits (879),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 182/219 (83%), Gaps = 2/219 (1%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PE+RA FN TAAWEY + M GKPYGYHN+IFSWIDT+S NYPPP+DAHLV SVM++WT+M
Sbjct  306  PELRAVFNETAAWEYAKSMSGKPYGYHNLIFSWIDTVSGNYPPPLDAHLVASVMTVWTQM  365

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            +P YA N+WNEALNKRLGT+   L EIL E E+RG +F +LL IPEQD+W+Y DGKST+C
Sbjct  366  KPAYAGNIWNEALNKRLGTQNFSLSEILVEVEKRGSSFGELLAIPEQDDWIYVDGKSTSC  425

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND--KLPFC  164
            VAFI  MYKE+G+FG LA SIQVTEFTI+DAY LK++ENN TRLP WCN+  D  KLPFC
Sbjct  426  VAFIFEMYKEAGLFGELATSIQVTEFTIKDAYSLKLFENNSTRLPEWCNNDADTVKLPFC  485

Query  163  QIVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            QI G+YRMELPGYNT++PY +MNE CPS+ P Y RP+ C
Sbjct  486  QIKGKYRMELPGYNTMDPYPHMNERCPSMTPEYSRPVGC  524



>ref|XP_006644833.1| PREDICTED: uncharacterized protein LOC102706146 [Oryza brachyantha]
Length=540

 Score =   343 bits (879),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 188/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY + M GKPYGYHNMIFSWIDTISDNYPPP+DAH+V SVM+MW ++
Sbjct  323  PDLRAKFNETAAWEYAKSMDGKPYGYHNMIFSWIDTISDNYPPPLDAHVVASVMTMWNKL  382

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMW EALNKRLGT+GLDL EI+ E+E+RG TFD+LLTIPEQD+WVY+DG+S +C
Sbjct  383  QPEYAANMWEEALNKRLGTKGLDLPEIIVESEKRGTTFDKLLTIPEQDKWVYTDGQSASC  442

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VA++L MYK++G+F  ++ SI+VTEFTI+DAY L  +E+N TRLP WCN  +  +LPFCQ
Sbjct  443  VAYVLMMYKDAGLFDPISNSIEVTEFTIKDAYSLNFFEDNMTRLPVWCNKDDSVELPFCQ  502

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G YRMELPGYNT++PYA+MNE CPSLPP+Y RP +C
Sbjct  503  IKGRYRMELPGYNTMQPYAHMNEKCPSLPPNYNRPENC  540



>ref|XP_008385988.1| PREDICTED: uncharacterized protein LOC103448506 [Malus domestica]
Length=552

 Score =   343 bits (879),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 184/218 (84%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY R M G+PYG+HN+IFSWIDTI DNYPPP+DAH+V SVM++W ++
Sbjct  335  PDIRAKFNETAAWEYARSMEGQPYGFHNLIFSWIDTIEDNYPPPLDAHVVASVMTVWNQI  394

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+ L   +IL E E+RG +FDQLLTIPEQD+W YSDGKST+C
Sbjct  395  QPAYAANMWNEALNKRLGTQNLTFPDILVEVEKRGSSFDQLLTIPEQDDWEYSDGKSTSC  454

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAFIL MYKE+G+FG +A SIQVTEFTI+DAYMLK +ENN +RLP WCN G+  KLPFCQ
Sbjct  455  VAFILEMYKEAGLFGPIASSIQVTEFTIKDAYMLKFFENNSSRLPKWCNDGDTVKLPFCQ  514

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELP YNT+E Y +MNE CPSLPP Y R  +C
Sbjct  515  IKGKYRMELPLYNTMETYPHMNERCPSLPPKYSRLQNC  552



>ref|XP_010064377.1| PREDICTED: uncharacterized protein LOC104451417 [Eucalyptus grandis]
Length=359

 Score =   336 bits (862),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 181/218 (83%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY   M GKPYGYHNM+FSWIDTI  NYPPP+DAH+V SVM++W +M
Sbjct  142  PDMRAKFNETAAWEYAESMNGKPYGYHNMLFSWIDTIDANYPPPLDAHVVASVMTVWNQM  201

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL ++L ETE RG +F +LLTIPEQD+WVYSDGKS +C
Sbjct  202  QPAYAANMWNEALNKRLGTEGLDLPDLLVETEMRGSSFAELLTIPEQDDWVYSDGKSASC  261

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAF+L MYK +G+F  ++ S+QVTEFTI+DAY LK +ENN +RLP WCN G+D +LPFCQ
Sbjct  262  VAFVLEMYKAAGLFDPISSSVQVTEFTIKDAYSLKFFENNSSRLPKWCNDGDDVELPFCQ  321

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G YRMELP YNT++ Y +MNE CPSLPP Y RP  C
Sbjct  322  IRGRYRMELPRYNTMDLYPHMNERCPSLPPKYSRPSDC  359



>emb|CDY06624.1| BnaC02g13480D [Brassica napus]
Length=610

 Score =   344 bits (883),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 150/210 (71%), Positives = 185/210 (88%), Gaps = 1/210 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FN +AAWEY R M GKPYGYHN+IFSWIDT+S+NYPPP+D+HLV S M++W++M
Sbjct  312  PDVRAKFNVSAAWEYARSMEGKPYGYHNLIFSWIDTVSENYPPPLDSHLVASFMTVWSKM  371

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GLDL ++L E E+RG +FD+LL IPEQD+W+YSDGKST+C
Sbjct  372  QPDYAANMWNEALNKRLGTKGLDLSDVLVEVEKRGSSFDKLLAIPEQDDWIYSDGKSTSC  431

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE G+FGSLA+SIQVTEFT++DAYML  +E N +RLP WCN  +  KLP+CQ
Sbjct  432  IAFILEMYKEGGLFGSLADSIQVTEFTLKDAYMLNFFETNASRLPKWCNDNDSVKLPYCQ  491

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPP  71
            I+G+YRM+LPGYNT+EPY +MNE CPSLPP
Sbjct  492  ILGKYRMQLPGYNTMEPYTHMNELCPSLPP  521



>ref|XP_007020905.1| Inositol-1,4,5-trisphosphate 5-phosphatase 4 isoform 1 [Theobroma 
cacao]
 gb|EOY12430.1| Inositol-1,4,5-trisphosphate 5-phosphatase 4 isoform 1 [Theobroma 
cacao]
Length=567

 Score =   343 bits (879),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 186/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FN TAAWEY + M G+PYGYHNMIFSWIDTI  NYPPP+DAHLV SVM++W ++
Sbjct  350  PDVRAKFNETAAWEYAQSMAGQPYGYHNMIFSWIDTIDGNYPPPLDAHLVASVMTVWNKI  409

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL +IL E E+RG +FD LLTIPEQD W+YSDGKS +C
Sbjct  410  QPEYAANMWNEALNKRLGTEGLDLSDILVEVEKRGSSFDALLTIPEQDGWIYSDGKSASC  469

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AF+L MYK +G+F  +A+SI+VTEFTI+DAY L+ +ENN ++LP WCN  +D KLP+CQ
Sbjct  470  IAFVLEMYKAAGLFDPIADSIEVTEFTIKDAYTLRFFENNSSQLPKWCNDADDVKLPYCQ  529

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELPG+N+++PY +MNE CPS+PP Y RP +C
Sbjct  530  ILGKYRMELPGFNSIDPYPHMNERCPSMPPKYSRPQNC  567



>ref|XP_009378549.1| PREDICTED: uncharacterized protein LOC103967027 [Pyrus x bretschneideri]
Length=522

 Score =   341 bits (875),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 183/218 (84%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY R M G+PYG+HN+IFSWIDTI DNYPPP+DAH+V SVM++W ++
Sbjct  305  PDIRAKFNETAAWEYARSMEGQPYGFHNLIFSWIDTIEDNYPPPLDAHVVASVMTVWNQI  364

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALN RLGT+ L   +IL E E+RG +FDQLLTIPEQD+W YSDGKST+C
Sbjct  365  QPAYAANMWNEALNTRLGTKNLTFPDILVEVEKRGSSFDQLLTIPEQDDWEYSDGKSTSC  424

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAFIL MYKE+G+FG +A SIQVTEFTI+DAYMLK +ENN +RLP WCN G+  KLPFCQ
Sbjct  425  VAFILEMYKEAGLFGPIASSIQVTEFTIKDAYMLKFFENNSSRLPKWCNDGDTVKLPFCQ  484

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELP YNT+E Y +MNE CPSLPP Y R  +C
Sbjct  485  IKGKYRMELPLYNTMETYPHMNERCPSLPPKYSRSQNC  522



>gb|KHG01773.1| Tryptophan synthase alpha chain [Gossypium arboreum]
Length=531

 Score =   341 bits (875),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 186/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FN TAAWEY   M GKPYGYHNM+FSWIDTI  NYPPP+DAHLV S M++W++M
Sbjct  314  PDVRAKFNETAAWEYALSMAGKPYGYHNMLFSWIDTIDGNYPPPLDAHLVASAMTVWSKM  373

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAAN+WNEALNKRLGT+GLDL +IL E E+ G +FDQLLTIPEQD+W+YSDGKST+C
Sbjct  374  QPEYAANLWNEALNKRLGTKGLDLSDILVEIEKHGSSFDQLLTIPEQDDWLYSDGKSTSC  433

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AF+L MYKE+G+F  +A+ IQVTEFTI+DAY L+ +ENN +RLP WCN  ++ KLP+CQ
Sbjct  434  IAFVLEMYKEAGLFDPIADLIQVTEFTIKDAYTLRFFENNSSRLPKWCNDADNVKLPYCQ  493

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELPG+N+++PY +MNE CPS PP Y RP +C
Sbjct  494  ILGKYRMELPGFNSMDPYPHMNERCPSKPPKYSRPPNC  531



>ref|XP_008654687.1| PREDICTED: uncharacterized protein LOC100275589 isoform X1 [Zea 
mays]
 gb|ACR35704.1| unknown [Zea mays]
 gb|AFW84864.1| hypothetical protein ZEAMMB73_247218 [Zea mays]
Length=542

 Score =   341 bits (875),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 185/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAW Y + M GKPYGYHNMIFSWIDTISDNYPPP+DAH+V SVM++W+++
Sbjct  325  PDLRAKFNETAAWIYAKSMEGKPYGYHNMIFSWIDTISDNYPPPLDAHVVASVMTVWSKL  384

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMW EALNKRLGT+GLDL EI+ E+E+RG+TFD+LL++PE D WVY DG+S +C
Sbjct  385  QPEYAANMWKEALNKRLGTKGLDLSEIIVESEKRGITFDKLLSVPENDSWVYEDGQSASC  444

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAF+L MYKE+G+F  +  SI+VTEFTI+DAY+L  +E+N TRLP WCN  +D KLPFCQ
Sbjct  445  VAFVLMMYKEAGLFDPITSSIEVTEFTIKDAYILNFFEDNSTRLPEWCNKDDDVKLPFCQ  504

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYNT++PYA+MNE CPSLPP Y R   C
Sbjct  505  IKGKYRMELPGYNTMKPYAHMNERCPSLPPDYNRTKGC  542



>ref|XP_006475148.1| PREDICTED: uncharacterized protein LOC102609098 [Citrus sinensis]
 gb|KDO62608.1| hypothetical protein CISIN_1g009605mg [Citrus sinensis]
Length=531

 Score =   341 bits (874),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 181/218 (83%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY   M GKPYGYHNMIFSWIDT S NYPPP+DAHLV S M+MW  +
Sbjct  314  PDMRAKFNETAAWEYALSMDGKPYGYHNMIFSWIDTRSGNYPPPLDAHLVASGMTMWNHI  373

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL +IL ETERRG  FD+LLTIPEQD+W+YSDGKST+C
Sbjct  374  QPAYAANMWNEALNKRLGTEGLDLPDILVETERRGTPFDELLTIPEQDDWIYSDGKSTSC  433

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAF+L MYKE+G+F  +  SIQVTEFTI+DAY L+ +ENN +RLP WCN  +  KLP+CQ
Sbjct  434  VAFVLEMYKEAGLFDPIGSSIQVTEFTIKDAYSLRFFENNSSRLPKWCNDADTVKLPYCQ  493

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYN L+PY +MNE CPS+PP Y R  +C
Sbjct  494  IRGKYRMELPGYNVLDPYPHMNERCPSMPPKYSRTANC  531



>ref|XP_002522970.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39400.1| conserved hypothetical protein [Ricinus communis]
Length=524

 Score =   340 bits (873),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 188/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+++A+FN TAAW+Y   M G+PYGYHNMIFSWIDTI  NYPPP+DAHLV SVM++W+++
Sbjct  307  PDMQAKFNETAAWDYALSMNGQPYGYHNMIFSWIDTIDKNYPPPLDAHLVASVMTVWSQI  366

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GL L +IL E E+RG +F +LL++PEQD+W+Y+DGKST+C
Sbjct  367  QPAYAANMWNEALNKRLGTQGLGLPDILVEVEKRGSSFGELLSVPEQDDWLYTDGKSTSC  426

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AF+LAMYKE+G+F  +A SIQVTEFTI+DAY L+ +EN+ +RLP WCN G+D KLPFCQ
Sbjct  427  IAFVLAMYKEAGLFDPIASSIQVTEFTIKDAYALRFFENDSSRLPKWCNDGDDVKLPFCQ  486

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYNT++PY +MNE CPSLPP Y RP +C
Sbjct  487  IKGKYRMELPGYNTMDPYPHMNEMCPSLPPKYSRPRNC  524



>gb|KJB13649.1| hypothetical protein B456_002G087800 [Gossypium raimondii]
Length=530

 Score =   340 bits (873),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 147/218 (67%), Positives = 187/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FN TA+WEY   M GKPYGYHNM+FSWIDTI  NYPPP+DAHLV S M++W++M
Sbjct  313  PDVRAKFNETASWEYALSMAGKPYGYHNMLFSWIDTIDGNYPPPLDAHLVASAMTVWSKM  372

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAAN+WNEALNKRLGT+GLDL +IL E E+ G +FDQLLT+PEQD+W+YSDGKST+C
Sbjct  373  QPEYAANLWNEALNKRLGTKGLDLSDILVEIEKLGSSFDQLLTVPEQDDWIYSDGKSTSC  432

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AF+L MYKE+G+F  +A+SIQVTEFTI+DAY L+ +ENN ++LP WCN  ++ KLP+CQ
Sbjct  433  IAFVLEMYKEAGLFDPIADSIQVTEFTIKDAYTLRFFENNSSQLPKWCNDADNVKLPYCQ  492

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRMELPG+N+++PY +MNE CPS PP Y RP +C
Sbjct  493  ILGKYRMELPGFNSMDPYPHMNERCPSKPPKYSRPPNC  530



>ref|XP_004491367.1| PREDICTED: uncharacterized protein LOC101492149 [Cicer arietinum]
Length=525

 Score =   340 bits (872),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 186/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RARFN TAAWEY   M G+PYGYHNMIFSWIDT+S NYPPP+DA++V  VM++W+++
Sbjct  308  PDMRARFNETAAWEYALSMDGQPYGYHNMIFSWIDTLSGNYPPPLDANVVACVMTIWSQL  367

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GLDL E+L E ERRG +FD+LLTIPEQD+W+YSDGKST+C
Sbjct  368  QPEYAANMWNEALNKRLGTKGLDLSEVLVEVERRGSSFDELLTIPEQDDWLYSDGKSTSC  427

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAFILAMYK +G+F  +A SIQVTEFTI+DAY+L  +ENN +RLP+WCN G+  KLP+CQ
Sbjct  428  VAFILAMYKAAGLFDPIASSIQVTEFTIKDAYILNFFENNASRLPTWCNDGDTVKLPYCQ  487

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYNT++PY +MNE CPSLP  Y R   C
Sbjct  488  IKGKYRMELPGYNTMQPYPHMNERCPSLPTKYSRTKSC  525



>ref|NP_001143111.1| uncharacterized protein LOC100275589 [Zea mays]
 gb|ACG29052.1| hypothetical protein [Zea mays]
Length=559

 Score =   341 bits (874),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 185/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAW Y + M GKPYGYHNMIFSWIDTISDNYPPP+DAH+V SVM++W+++
Sbjct  342  PDLRAKFNETAAWIYAKSMEGKPYGYHNMIFSWIDTISDNYPPPLDAHVVASVMTVWSKL  401

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMW EALNKRLGT+GLDL EI+ E+E+RG+TFD+LL++PE D WVY DG+S +C
Sbjct  402  QPEYAANMWKEALNKRLGTKGLDLSEIIVESEKRGITFDKLLSVPENDSWVYEDGQSASC  461

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAF+L MYKE+G+F  +  SI+VTEFTI+DAY+L  +E+N TRLP WCN  +D KLPFCQ
Sbjct  462  VAFVLMMYKEAGLFDPITSSIEVTEFTIKDAYILNFFEDNSTRLPEWCNKDDDVKLPFCQ  521

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYNT++PYA+MNE CPSLPP Y R   C
Sbjct  522  IKGKYRMELPGYNTMKPYAHMNERCPSLPPDYNRTKGC  559



>gb|ACN29289.1| unknown [Zea mays]
 gb|AFW84862.1| hypothetical protein ZEAMMB73_247218 [Zea mays]
Length=559

 Score =   341 bits (874),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 185/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAW Y + M GKPYGYHNMIFSWIDTISDNYPPP+DAH+V SVM++W+++
Sbjct  342  PDLRAKFNETAAWIYAKSMEGKPYGYHNMIFSWIDTISDNYPPPLDAHVVASVMTVWSKL  401

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMW EALNKRLGT+GLDL EI+ E+E+RG+TFD+LL++PE D WVY DG+S +C
Sbjct  402  QPEYAANMWKEALNKRLGTKGLDLSEIIVESEKRGITFDKLLSVPENDSWVYEDGQSASC  461

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAF+L MYKE+G+F  +  SI+VTEFTI+DAY+L  +E+N TRLP WCN  +D KLPFCQ
Sbjct  462  VAFVLMMYKEAGLFDPITSSIEVTEFTIKDAYILNFFEDNSTRLPEWCNKDDDVKLPFCQ  521

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYNT++PYA+MNE CPSLPP Y R   C
Sbjct  522  IKGKYRMELPGYNTMKPYAHMNERCPSLPPDYNRTKGC  559



>ref|XP_003617489.1| hypothetical protein MTR_5g092140 [Medicago truncatula]
 gb|AET00448.1| plant/F10M23-360 protein [Medicago truncatula]
Length=525

 Score =   339 bits (870),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 186/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RARFN TAAWEY   M G+PYGYHNMIFSWIDT+S NYPPP+DA++V  VM++W+++
Sbjct  308  PDMRARFNETAAWEYALSMDGQPYGYHNMIFSWIDTLSGNYPPPLDANVVACVMTIWSQL  367

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GLDL E+L E E+RG +F +LLTIPEQD+W YSDGKST+C
Sbjct  368  QPAYAANMWNEALNKRLGTKGLDLPEVLVEVEKRGSSFAELLTIPEQDDWTYSDGKSTSC  427

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAFILAMYKE+G+F  +A SIQVTEFTI+DAY+L  +ENN +RLP+WCN G+  KLP+CQ
Sbjct  428  VAFILAMYKEAGLFDPIASSIQVTEFTIKDAYLLNFFENNSSRLPTWCNDGDTVKLPYCQ  487

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYNT++PY +MNE CPSLP  Y R  +C
Sbjct  488  IKGKYRMELPGYNTMQPYPHMNERCPSLPTKYSRTKNC  525



>gb|KHN11935.1| hypothetical protein glysoja_019908 [Glycine soja]
Length=486

 Score =   338 bits (867),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 185/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RARFN TAAWEY   M GKPYGYHNMIFSWIDT++ NYPPP+DA++V  VM++W+++
Sbjct  269  PDLRARFNETAAWEYALSMAGKPYGYHNMIFSWIDTLNGNYPPPLDANVVACVMTIWSQL  328

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GLDL E+L E E+RG +FD+LLTIPEQD W YSDGKST+C
Sbjct  329  QPEYAANMWNEALNKRLGTKGLDLPEVLVEVEKRGSSFDELLTIPEQDYWTYSDGKSTSC  388

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE+G+F  ++ S+QVTEFTI+DAY+L  +ENN +RLP WCN G+  KLP+CQ
Sbjct  389  IAFILEMYKEAGLFDPISSSVQVTEFTIKDAYILNFFENNSSRLPKWCNDGDTVKLPYCQ  448

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYNT++PY +MNE CPSLPP Y R  +C
Sbjct  449  IKGKYRMELPGYNTMQPYPHMNEKCPSLPPKYSRAQNC  486



>ref|XP_009769049.1| PREDICTED: uncharacterized protein LOC104219979 [Nicotiana sylvestris]
Length=526

 Score =   339 bits (869),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 185/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY R M+GKPYG+HN+IFSWIDT+  NYP P+DAHLV SVM++W ++
Sbjct  309  PDLRAKFNETAAWEYARSMVGKPYGFHNLIFSWIDTLDGNYPSPLDAHLVASVMTVWNQL  368

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GL L +IL E E+RG +F +LLTIPEQD+WVY+DGKST+C
Sbjct  369  QPAYAANMWNEALNKRLGTQGLGLPDILVEVEKRGSSFAKLLTIPEQDDWVYTDGKSTSC  428

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAFIL MYKE+G+FG LA SIQVTEFTI+DAY LK +EN+  RLP WCN+ +  KLPFCQ
Sbjct  429  VAFILEMYKEAGLFGPLAGSIQVTEFTIKDAYSLKFFENDPNRLPKWCNADDTVKLPFCQ  488

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYNT++ Y +MNE CPS+PP Y RP+ C
Sbjct  489  IRGKYRMELPGYNTMDIYPHMNEKCPSMPPKYYRPLSC  526



>gb|KCW67171.1| hypothetical protein EUGRSUZ_F00962 [Eucalyptus grandis]
Length=408

 Score =   335 bits (858),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 181/218 (83%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY   M GKPYGYHNM+FSWIDTI  NYPPP+DAH+V SVM++W +M
Sbjct  191  PDMRAKFNETAAWEYAESMNGKPYGYHNMLFSWIDTIDANYPPPLDAHVVASVMTVWNQM  250

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL ++L ETE RG +F +LLTIPEQD+WVYSDGKS +C
Sbjct  251  QPAYAANMWNEALNKRLGTEGLDLPDLLVETEMRGSSFAELLTIPEQDDWVYSDGKSASC  310

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAF+L MYK +G+F  ++ SIQVTEFTI+DAY LK +ENN +RLP WCN G++ +LPFCQ
Sbjct  311  VAFVLEMYKAAGLFDPISSSIQVTEFTIKDAYSLKFFENNSSRLPKWCNDGDNVELPFCQ  370

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G YRMELPGYNT++ Y +MNE CPSLPP Y R   C
Sbjct  371  IRGRYRMELPGYNTMDLYPHMNERCPSLPPKYSRLSDC  408



>ref|XP_003544978.1| PREDICTED: uncharacterized protein LOC100796964 [Glycine max]
Length=525

 Score =   338 bits (868),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 185/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RARFN TAAWEY   M GKPYGYHNMIFSWIDT++ NYPPP+DA++V  VM++W+++
Sbjct  308  PDLRARFNETAAWEYALSMAGKPYGYHNMIFSWIDTLNGNYPPPLDANVVACVMTIWSQL  367

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GLDL E+L E E+RG +FD+LLTIPEQD W YSDGKST+C
Sbjct  368  QPEYAANMWNEALNKRLGTKGLDLPEVLVEVEKRGSSFDELLTIPEQDYWTYSDGKSTSC  427

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AFIL MYKE+G+F  ++ S+QVTEFTI+DAY+L  +ENN +RLP WCN G+  KLP+CQ
Sbjct  428  IAFILEMYKEAGLFDPISSSVQVTEFTIKDAYILNFFENNSSRLPKWCNDGDTVKLPYCQ  487

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYNT++PY +MNE CPSLPP Y R  +C
Sbjct  488  IKGKYRMELPGYNTMQPYPHMNEKCPSLPPKYSRAQNC  525



>ref|XP_002280959.1| PREDICTED: uncharacterized protein LOC100267545 isoform X1 [Vitis 
vinifera]
 emb|CBI26614.3| unnamed protein product [Vitis vinifera]
Length=531

 Score =   338 bits (868),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 183/218 (84%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P +RA+FN TAAWEY R   GKPYGYHNMIFSWIDT+ +NYPPP+DAH+V SVM++W +M
Sbjct  314  PHLRAKFNETAAWEYARSSEGKPYGYHNMIFSWIDTLDENYPPPLDAHVVASVMTVWNQM  373

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            +P YAAN+WNEALNKRLGT+ L L EIL ETE+RG +FD+LLTIPEQD+WVY+DGKST+C
Sbjct  374  KPAYAANLWNEALNKRLGTQDLALPEILVETEKRGSSFDELLTIPEQDDWVYTDGKSTSC  433

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSG-NDKLPFCQ  161
            VAFIL MYKE+G+FG  A SIQVTEFTI+DAY L  +ENN +RLP WCN G N +LP+CQ
Sbjct  434  VAFILEMYKEAGLFGPSASSIQVTEFTIKDAYTLNFFENNSSRLPKWCNDGDNVQLPYCQ  493

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELP YNTL+PY +MNE CPSLPP Y R  +C
Sbjct  494  IKGKYRMELPEYNTLDPYPHMNERCPSLPPKYLRSANC  531



>ref|XP_009599364.1| PREDICTED: uncharacterized protein LOC104095030 [Nicotiana tomentosiformis]
Length=526

 Score =   338 bits (866),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 185/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY R M+GKPYG+HN+IFSWIDT+  NYP P+DAHLV SVM++W ++
Sbjct  309  PDLRAKFNETAAWEYARSMVGKPYGFHNLIFSWIDTLDGNYPSPLDAHLVASVMTVWNQL  368

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GLDL +IL E E+RG +F +LLTIPEQD+WVY+DGKST+C
Sbjct  369  QPAYAANMWNEALNKRLGTQGLDLPDILVEVEKRGSSFAKLLTIPEQDDWVYTDGKSTSC  428

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAFIL MYKE+G+FG  A SIQVTEFTI+DAY LK +E++  +LP WCN+ +  KLPFCQ
Sbjct  429  VAFILEMYKEAGLFGPFAGSIQVTEFTIKDAYSLKFFEDDPNQLPKWCNADDTVKLPFCQ  488

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYNT++ Y +MNE CPS+PP Y RP+ C
Sbjct  489  IRGKYRMELPGYNTMDIYPHMNEKCPSMPPKYYRPLSC  526



>gb|KCW67034.1| hypothetical protein EUGRSUZ_F00801 [Eucalyptus grandis]
Length=390

 Score =   333 bits (854),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 182/218 (83%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAW+Y   M GKPYGYHNM+FSWIDTI  NYPPP+DA++V SVM++W +M
Sbjct  173  PDMRAKFNETAAWDYAESMNGKPYGYHNMLFSWIDTIDANYPPPLDAYVVASVMTVWNQM  232

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL ++L ETE RG +F +LLTIPEQD+WVYSDGKS +C
Sbjct  233  QPAYAANMWNEALNKRLGTEGLDLPDLLVETEMRGSSFAELLTIPEQDDWVYSDGKSASC  292

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAF+L MYK +G+F  ++ SIQVT+FTI+DAY LK +ENN +RLP WCN G+D +LPFCQ
Sbjct  293  VAFVLEMYKAAGLFDPISSSIQVTKFTIKDAYSLKFFENNSSRLPKWCNDGDDVELPFCQ  352

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G Y+MELPGYNT++ Y +MNE CPSLPP Y RP  C
Sbjct  353  IQGRYQMELPGYNTMDLYPHMNERCPSLPPKYSRPSDC  390



>ref|XP_004295816.2| PREDICTED: uncharacterized protein LOC101297130 [Fragaria vesca 
subsp. vesca]
Length=536

 Score =   337 bits (865),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 182/218 (83%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY R M G+PYGYHNMIFSWIDT+  NYPPP+DAH+V SVM++W ++
Sbjct  319  PDIRAKFNETAAWEYARSMEGRPYGYHNMIFSWIDTVDGNYPPPLDAHVVASVMTVWDQI  378

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            +PTYAAN+WNEALNKRL T+ L   EIL E E+RG +FDQLLT+PEQD+W+YSDGKST+C
Sbjct  379  KPTYAANLWNEALNKRLETQNLSFPEILVEVEKRGSSFDQLLTVPEQDDWLYSDGKSTSC  438

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAFIL MYKE+G+F  +  SIQVTEFTI+DAYMLK +ENN +RLP WCN G+  KLPFCQ
Sbjct  439  VAFILEMYKEAGLFDPIPSSIQVTEFTIKDAYMLKFFENNSSRLPKWCNDGDTVKLPFCQ  498

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELP YN +EPY +MNE CPSLPP Y R  +C
Sbjct  499  IKGKYRMELPEYNIMEPYPHMNERCPSLPPKYSRSQNC  536



>ref|XP_008454551.1| PREDICTED: uncharacterized protein LOC103494941 [Cucumis melo]
Length=537

 Score =   337 bits (865),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 185/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEYVR M+GKPYGYHN+IFSWIDT   NYPPP+DAHLV SVM++WTR+
Sbjct  320  PDLRAKFNETAAWEYVRSMVGKPYGYHNLIFSWIDTTHGNYPPPLDAHLVASVMTIWTRV  379

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            +PT AAN+WNEALN RLGT+GLDL EIL E E++G +F +LL IPEQD+W+Y+DGKS +C
Sbjct  380  RPTLAANLWNEALNIRLGTKGLDLPEILVEVEKQGSSFGELLAIPEQDDWIYADGKSASC  439

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAFIL MYKE+G+FG LA SIQVTEFTI+DAY L  YENN TRLP WC+  +D KLP+CQ
Sbjct  440  VAFILQMYKEAGLFGPLASSIQVTEFTIKDAYTLNFYENNSTRLPKWCHGRDDVKLPYCQ  499

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRM+L GYN+++PY +MNE CPSLP  Y RP +C
Sbjct  500  ILGKYRMDLQGYNSIDPYKHMNERCPSLPTEYFRPKNC  537



>ref|XP_010675677.1| PREDICTED: uncharacterized protein LOC104891653 [Beta vulgaris 
subsp. vulgaris]
Length=523

 Score =   337 bits (864),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 182/218 (83%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY R M G+PYGYHN+IFSW+DTI+ NYPPP+DAHLV SVM++W  M
Sbjct  306  PDLRAKFNETAAWEYARSMDGQPYGYHNLIFSWVDTINMNYPPPLDAHLVASVMTIWYHM  365

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAAN+W EALNKRLGTE L+L EIL E E+RG +FD+LLTIPEQD+W+Y DGKS +C
Sbjct  366  QPEYAANLWKEALNKRLGTEDLELPEILVEVEKRGSSFDELLTIPEQDDWIYEDGKSVSC  425

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSG-NDKLPFCQ  161
            VA++L +YK +G+FGSL  SIQ  EFTI+DAY LK +EN+ +RLPSWCN G N KLPFCQ
Sbjct  426  VAYVLQIYKAAGLFGSLFSSIQANEFTIKDAYSLKFFENDPSRLPSWCNDGDNVKLPFCQ  485

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G YRMELPGYNT++PYA+MNE CPSLPP Y RP  C
Sbjct  486  IRGRYRMELPGYNTIDPYAHMNERCPSLPPKYYRPKTC  523



>ref|XP_002316997.1| hypothetical protein POPTR_0011s14080g [Populus trichocarpa]
 gb|EEE97609.1| hypothetical protein POPTR_0011s14080g [Populus trichocarpa]
Length=526

 Score =   337 bits (863),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 184/218 (84%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FN TAAWEY   M GKPYGYHNMIFSWIDT+  NYPPP+D+H+V SVM++W  M
Sbjct  309  PDVRAKFNETAAWEYALSMNGKPYGYHNMIFSWIDTLDGNYPPPLDSHVVASVMTVWNHM  368

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GLDL ++L E E+RG +F +LLTIPEQD+W+Y+DGKST+C
Sbjct  369  QPEYAANMWNEALNKRLGTQGLDLPDVLVEVEKRGSSFGELLTIPEQDDWLYADGKSTSC  428

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AF+L MYKE+G+F  ++ S+QVTEFTI+DAY L+ +ENN +RLP WCN G+D KLPFCQ
Sbjct  429  IAFVLEMYKEAGLFDPISGSVQVTEFTIKDAYTLRFFENNSSRLPKWCNDGDDVKLPFCQ  488

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELP YNT++PY +MNE CPSLPP Y R  +C
Sbjct  489  IKGKYRMELPEYNTMDPYPHMNERCPSLPPKYYRTQNC  526



>ref|XP_011040240.1| PREDICTED: uncharacterized protein LOC105136541 [Populus euphratica]
Length=526

 Score =   335 bits (859),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 148/218 (68%), Positives = 182/218 (83%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FN TAAWEY   M GKPYGYHN+IFSWIDT+  NYPPP+DAH+V S M++W  +
Sbjct  309  PDVRAKFNETAAWEYALSMKGKPYGYHNLIFSWIDTLDGNYPPPLDAHVVASFMTVWNHI  368

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GLDL +IL E E+RG +F +LLTIPEQD+W+Y+DGKST+C
Sbjct  369  QPEYAANMWNEALNKRLGTQGLDLPDILVEVEKRGSSFGKLLTIPEQDDWLYTDGKSTSC  428

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AF+L MYKE+G+F  +  S+QVTEFTI+DAY L+ +ENN +RLP WCN G+D KLPFCQ
Sbjct  429  IAFVLEMYKEAGLFDPITSSVQVTEFTIKDAYTLRFFENNSSRLPKWCNDGDDVKLPFCQ  488

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELP YNT++PY +MNE CPSLPP Y R  +C
Sbjct  489  IKGQYRMELPEYNTMDPYPHMNERCPSLPPKYFRTQNC  526



>ref|XP_011095372.1| PREDICTED: uncharacterized protein LOC105174849 [Sesamum indicum]
Length=533

 Score =   335 bits (859),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 180/218 (83%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN +AAWEY + M G PYGYHN+IFSWIDTI+ NYP P+DAHLV SVM++WT++
Sbjct  316  PDLRAKFNESAAWEYAKSMSGLPYGYHNLIFSWIDTINGNYPAPLDAHLVASVMTVWTQL  375

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
             P YA NMWNEALNKRLGT+ L L EI+ E E+RG +F +LL IPEQD WVY+DGKST+C
Sbjct  376  APAYAGNMWNEALNKRLGTQNLSLSEIIVEVEKRGSSFGELLAIPEQDNWVYADGKSTSC  435

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAF+  MY+E+G+FG LA SIQVTEFTI+DAY LK +ENN +RLP WCN G+  KLPFCQ
Sbjct  436  VAFVFEMYEEAGLFGELASSIQVTEFTIKDAYSLKFFENNSSRLPKWCNDGDTVKLPFCQ  495

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYNT++PY +MNE CPSLPP Y RP  C
Sbjct  496  IRGKYRMELPGYNTMDPYPHMNERCPSLPPKYLRPAGC  533



>ref|XP_010060409.1| PREDICTED: uncharacterized protein LOC104448324 [Eucalyptus grandis]
Length=523

 Score =   335 bits (858),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 181/218 (83%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY   M GKPYGYHNM+FSWIDTI  NYPPP+DAH+V SVM++W +M
Sbjct  306  PDMRAKFNETAAWEYAESMNGKPYGYHNMLFSWIDTIDANYPPPLDAHVVASVMTVWNQM  365

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL ++L ETE RG +F +LLTIPEQD+WVYSDGKS +C
Sbjct  366  QPAYAANMWNEALNKRLGTEGLDLPDLLVETEMRGSSFAELLTIPEQDDWVYSDGKSASC  425

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAF+L MYK +G+F  ++ SIQVTEFTI+DAY LK +ENN +RLP WCN G++ +LPFCQ
Sbjct  426  VAFVLEMYKAAGLFDPISSSIQVTEFTIKDAYSLKFFENNSSRLPKWCNDGDNVELPFCQ  485

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G YRMELPGYNT++ Y +MNE CPSLPP Y R   C
Sbjct  486  IRGRYRMELPGYNTMDLYPHMNERCPSLPPKYSRLSDC  523



>ref|XP_011030808.1| PREDICTED: uncharacterized protein LOC105130143 [Populus euphratica]
Length=526

 Score =   334 bits (856),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 147/218 (67%), Positives = 182/218 (83%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FN TAAWEY   M GKPYGYHNMIFSWIDT+  NYPPP+D+H+V SVM++W  M
Sbjct  309  PDVRAKFNETAAWEYALSMNGKPYGYHNMIFSWIDTLDGNYPPPLDSHVVASVMTVWNHM  368

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GLDL ++L E E+RG +F +LL IPEQD+W+Y+DGKS +C
Sbjct  369  QPEYAANMWNEALNKRLGTQGLDLPDVLVEVEKRGSSFGELLAIPEQDDWLYADGKSASC  428

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AF+L MYKE+G+F  ++ S+QVTEFTI+DAY L+ +ENN +RLP WCN G+D KLPFCQ
Sbjct  429  IAFVLEMYKEAGLFDPISGSVQVTEFTIKDAYTLRFFENNSSRLPKWCNDGDDVKLPFCQ  488

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELP YNT++PY +MNE CPSLPP Y R  +C
Sbjct  489  IKGKYRMELPEYNTMDPYPHMNERCPSLPPKYYRTQNC  526



>ref|XP_006370687.1| hypothetical protein POPTR_0001s44890g [Populus trichocarpa]
 gb|ERP67256.1| hypothetical protein POPTR_0001s44890g [Populus trichocarpa]
Length=585

 Score =   335 bits (858),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 148/218 (68%), Positives = 181/218 (83%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FN TAAWEY   M G PYGYHN+IFSWIDT+  NYPPP+DAHLV S M++W  +
Sbjct  368  PDVRAKFNETAAWEYALSMKGNPYGYHNLIFSWIDTLDGNYPPPLDAHLVASFMTVWNHI  427

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GLDL +IL E E+RG +F +LLTIPEQD+W+Y+DGKST+C
Sbjct  428  QPEYAANMWNEALNKRLGTQGLDLPDILVEVEKRGSSFGKLLTIPEQDDWLYTDGKSTSC  487

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AF+L MYKE+G+F  +  S+QVTEFTI+DAY L+ +ENN +RLP WCN G+D KLPFCQ
Sbjct  488  IAFVLEMYKEAGLFDPITSSVQVTEFTIKDAYTLRFFENNSSRLPKWCNDGDDVKLPFCQ  547

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELP YNT++PY +MNE CPSLPP Y R  +C
Sbjct  548  IKGQYRMELPEYNTMDPYPHMNERCPSLPPKYFRTQNC  585



>ref|XP_008812430.1| PREDICTED: uncharacterized protein LOC103723322 [Phoenix dactylifera]
Length=537

 Score =   333 bits (853),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 147/218 (67%), Positives = 181/218 (83%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FNSTAAWEY   M+GKPYGYHNMIFSWIDTIS NYP P+D+HLV S M+MW ++
Sbjct  320  PDVRAKFNSTAAWEYAESMIGKPYGYHNMIFSWIDTISGNYPSPLDSHLVASAMTMWNKL  379

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAAN+WNEALNKRLGTEGLDL  I+ E E+ G++FD+LLT+PE D WVYSDGKS +C
Sbjct  380  QPAYAANLWNEALNKRLGTEGLDLPAIMVEAEKLGISFDKLLTVPEHDNWVYSDGKSASC  439

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            + FILAMYK++G+F  +A +IQVTEFTI+DAY L  +E+N +RLP WCN  ++ KLPFCQ
Sbjct  440  IVFILAMYKDAGLFDPIASNIQVTEFTIKDAYTLNFFESNSSRLPEWCNKDDNVKLPFCQ  499

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G YRMELP +NT++PY +MNE CPSLPP Y R  +C
Sbjct  500  IMGRYRMELPEFNTIQPYPHMNERCPSLPPDYARSSYC  537



>ref|XP_004151958.1| PREDICTED: uncharacterized protein LOC101214437 [Cucumis sativus]
 ref|XP_004158470.1| PREDICTED: uncharacterized LOC101214437 [Cucumis sativus]
 gb|KGN57971.1| hypothetical protein Csa_3G416640 [Cucumis sativus]
Length=536

 Score =   333 bits (853),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 184/218 (84%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEYVR M+GKPYGYHN+IFSWIDT   NYPPP+DAHLV SVM++WTR+
Sbjct  319  PDLRAKFNETAAWEYVRSMVGKPYGYHNLIFSWIDTTHGNYPPPLDAHLVASVMTIWTRV  378

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            +PT AAN+WNEALN RLGT+GLDL EIL E E++G +F +LL IPEQD+WVY+DGKS +C
Sbjct  379  RPTLAANLWNEALNIRLGTKGLDLPEILVEVEKQGSSFGELLAIPEQDDWVYADGKSASC  438

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAFIL MYKE+G+FG LA SIQVTEFTI+DAY L  YENN +RLP WC+  +D KLP+CQ
Sbjct  439  VAFILEMYKEAGLFGPLASSIQVTEFTIKDAYSLNFYENNSSRLPKWCHGRDDVKLPYCQ  498

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G+YRM+L GYN+++ Y +MNE CPSLP  Y RP +C
Sbjct  499  ILGKYRMDLQGYNSIDLYKHMNEKCPSLPTEYFRPKNC  536



>ref|XP_003564372.1| PREDICTED: uncharacterized protein LOC100827139 isoform X1 [Brachypodium 
distachyon]
Length=542

 Score =   333 bits (853),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 148/217 (68%), Positives = 183/217 (84%), Gaps = 1/217 (0%)
 Frame = -1

Query  694  EVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRMQ  515
            ++RA+FN TAAW Y + M GKPYGYHNMIFSWIDTIS NYPPP+DAH+V SVM++W ++Q
Sbjct  326  DLRAKFNETAAWNYAKKMNGKPYGYHNMIFSWIDTISHNYPPPLDAHVVASVMTVWNKLQ  385

Query  514  PTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCV  335
            P YAANMW EALNKRLGT+GLDL EI+ E+E+RG TFD+LLTIPEQD+WVY+DG+S +CV
Sbjct  386  PDYAANMWKEALNKRLGTKGLDLPEIIVESEKRGTTFDKLLTIPEQDKWVYTDGQSASCV  445

Query  334  AFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQI  158
            A++L MYKE+G+F  ++ S++VTEFTI+DAY+L  YE+N TRLP WCN  +  KLPFCQI
Sbjct  446  AYVLMMYKEAGLFEPISSSVEVTEFTIKDAYVLNFYEDNTTRLPEWCNKDDSVKLPFCQI  505

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
             G YRMELPGYNT++PY +MNE CPSLPP Y R  +C
Sbjct  506  KGRYRMELPGYNTMKPYPHMNERCPSLPPDYLRTQNC  542



>ref|XP_003564373.1| PREDICTED: uncharacterized protein LOC100827139 isoform X2 [Brachypodium 
distachyon]
Length=535

 Score =   332 bits (852),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 148/217 (68%), Positives = 183/217 (84%), Gaps = 1/217 (0%)
 Frame = -1

Query  694  EVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRMQ  515
            ++RA+FN TAAW Y + M GKPYGYHNMIFSWIDTIS NYPPP+DAH+V SVM++W ++Q
Sbjct  319  DLRAKFNETAAWNYAKKMNGKPYGYHNMIFSWIDTISHNYPPPLDAHVVASVMTVWNKLQ  378

Query  514  PTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCV  335
            P YAANMW EALNKRLGT+GLDL EI+ E+E+RG TFD+LLTIPEQD+WVY+DG+S +CV
Sbjct  379  PDYAANMWKEALNKRLGTKGLDLPEIIVESEKRGTTFDKLLTIPEQDKWVYTDGQSASCV  438

Query  334  AFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQI  158
            A++L MYKE+G+F  ++ S++VTEFTI+DAY+L  YE+N TRLP WCN  +  KLPFCQI
Sbjct  439  AYVLMMYKEAGLFEPISSSVEVTEFTIKDAYVLNFYEDNTTRLPEWCNKDDSVKLPFCQI  498

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
             G YRMELPGYNT++PY +MNE CPSLPP Y R  +C
Sbjct  499  KGRYRMELPGYNTMKPYPHMNERCPSLPPDYLRTQNC  535



>ref|XP_006346228.1| PREDICTED: uncharacterized protein LOC102585922 [Solanum tuberosum]
Length=527

 Score =   332 bits (851),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 181/218 (83%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY + M G PYG+HN+IFSWIDTI  NYP P+DA+LV SVM++W ++
Sbjct  310  PDLRAKFNETAAWEYAKSMTGMPYGFHNLIFSWIDTIDGNYPSPLDANLVASVMTVWNQL  369

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+ L L ++L E E+RG +F +LL IPEQD+WVYSDGKST+C
Sbjct  370  QPAYAANMWNEALNKRLGTKNLSLPDVLVEVEKRGFSFAKLLAIPEQDDWVYSDGKSTSC  429

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNS-GNDKLPFCQ  161
            VAFIL MYKE+G+FG LA SIQVTEFTI+DAY LK +ENN +RLP WCN+  N KLPFCQ
Sbjct  430  VAFILEMYKEAGLFGELASSIQVTEFTIKDAYSLKFFENNSSRLPKWCNADDNVKLPFCQ  489

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYN+++ Y +MNE CPS+PP Y RP  C
Sbjct  490  IRGKYRMELPGYNSMDLYPHMNERCPSMPPKYYRPQSC  527



>ref|XP_010930250.1| PREDICTED: uncharacterized protein LOC105051475 isoform X1 [Elaeis 
guineensis]
Length=542

 Score =   332 bits (852),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 181/218 (83%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FNSTAAWEY   M+GKPYGYHNMIFSWIDTIS NYPPP+D+HLV S M++W+ +
Sbjct  325  PDVRAKFNSTAAWEYANSMIGKPYGYHNMIFSWIDTISGNYPPPLDSHLVASAMTVWSNI  384

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAAN+WNEALN RLGTEGLDL  I+ E E+ G++FD+LLT+PEQD+WVYSDGKS +C
Sbjct  385  QPAYAANLWNEALNLRLGTEGLDLPAIMVEAEKLGISFDKLLTVPEQDDWVYSDGKSASC  444

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNS-GNDKLPFCQ  161
            +AF+L MYKE+G+F  +A +IQVTEFTI+DAY LK +ENN + LP WCN   N KLP+CQ
Sbjct  445  IAFVLVMYKEAGLFDPIAANIQVTEFTIKDAYTLKFFENNSSHLPEWCNKDDNVKLPYCQ  504

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G YRMELP YNTL+PY +MNE CPSLP  Y R  +C
Sbjct  505  ILGRYRMELPEYNTLQPYPHMNERCPSLPLDYARSSYC  542



>ref|XP_009774573.1| PREDICTED: uncharacterized protein LOC104224588 [Nicotiana sylvestris]
Length=525

 Score =   331 bits (848),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 181/218 (83%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY + M G+PYGYHN+IFSWIDTI  NYP P+DAHLV SVM++W ++
Sbjct  308  PDLRAKFNETAAWEYAKSMDGQPYGYHNLIFSWIDTIDGNYPSPLDAHLVASVMTVWNQL  367

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YA+NMWNEALNKRLGT+ L L ++L E E+RG +F +LLTIPEQD+WVYSDGKST+C
Sbjct  368  QPAYASNMWNEALNKRLGTQNLSLPDVLVEVEKRGSSFAELLTIPEQDDWVYSDGKSTSC  427

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAFIL MYKE+G+FG LA SIQVTEFTI+DAY LK +E N +RLP WCN+ +  KLPFCQ
Sbjct  428  VAFILEMYKEAGLFGELASSIQVTEFTIKDAYSLKFFETNSSRLPKWCNADDSVKLPFCQ  487

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYN+++ Y  MNE CPS+PP Y RP  C
Sbjct  488  IRGKYRMELPGYNSMDIYPYMNERCPSMPPKYYRPQGC  525



>ref|XP_009607397.1| PREDICTED: uncharacterized protein LOC104101619 [Nicotiana tomentosiformis]
 ref|XP_009607398.1| PREDICTED: uncharacterized protein LOC104101619 [Nicotiana tomentosiformis]
Length=525

 Score =   331 bits (848),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 148/218 (68%), Positives = 182/218 (83%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY + M G+PYGYHN+IFSWIDTI  NYP P+DAHLV SVM++W ++
Sbjct  308  PDLRAKFNETAAWEYAKSMDGQPYGYHNLIFSWIDTIDGNYPSPLDAHLVASVMTVWNQL  367

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YA+NMWNEALNKRLGT+ L L ++L E E+RG +F +LLTIPE+D+WVYSDGKST+C
Sbjct  368  QPAYASNMWNEALNKRLGTQNLSLPDVLVEVEKRGSSFAELLTIPEKDDWVYSDGKSTSC  427

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAFIL MYKE+G+FG LA SIQVTEFTI+DAY LK +E N +RLP WCN+ +  KLPFCQ
Sbjct  428  VAFILEMYKEAGLFGELASSIQVTEFTIKDAYSLKFFETNSSRLPKWCNADDSVKLPFCQ  487

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYN+++ Y +MNE CPS+PP Y RP  C
Sbjct  488  IRGKYRMELPGYNSMDLYPHMNERCPSMPPKYYRPQGC  525



>ref|XP_004244131.1| PREDICTED: uncharacterized protein LOC101251602 [Solanum lycopersicum]
Length=527

 Score =   330 bits (846),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 178/218 (82%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY + M G PYGYHN+IFSWIDTI  NYP P+DA+LV SVM++W  +
Sbjct  310  PDLRAKFNETAAWEYAKSMAGMPYGYHNLIFSWIDTIDGNYPSPLDANLVASVMTVWNHL  369

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+ L L +IL E E+RG +F +LL IPE+D+WVYSDGKST+C
Sbjct  370  QPAYAANMWNEALNKRLGTKNLSLPDILVEVEKRGFSFAKLLAIPEKDDWVYSDGKSTSC  429

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNS-GNDKLPFCQ  161
            VAFIL MYKE+G+FG  A SIQVTEFTI+DAY LK +ENN +RLP WCN+  N  LPFCQ
Sbjct  430  VAFILEMYKEAGLFGEFASSIQVTEFTIKDAYSLKFFENNSSRLPKWCNADDNVSLPFCQ  489

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I GEYRMELP YN+++PY +MNE CPS+PP Y RP  C
Sbjct  490  IRGEYRMELPEYNSIDPYPHMNERCPSMPPKYFRPQSC  527



>ref|XP_002278686.1| PREDICTED: uncharacterized protein LOC100241838 isoform X3 [Vitis 
vinifera]
Length=524

 Score =   330 bits (845),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 147/217 (68%), Positives = 178/217 (82%), Gaps = 0/217 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P +RA+FN TAAWEY R M GKPYGYHNMIFSWID + +NYPPP+DAH+V + M++W +M
Sbjct  308  PHLRAKFNETAAWEYARSMEGKPYGYHNMIFSWIDALDENYPPPLDAHVVAAGMTVWNQM  367

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
             P YAAN+WNEALNKRLGT+ L L EIL ETE RG +F +LLTIPEQD+WVY+DGKST+C
Sbjct  368  WPAYAANLWNEALNKRLGTQNLSLPEILIETETRGSSFAELLTIPEQDDWVYTDGKSTSC  427

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL MYKE+G+FG +A SIQ TEFTI+DAY L  +EN+ +RLP WCN G+   P+CQI
Sbjct  428  VAFILEMYKEAGLFGPIASSIQGTEFTIKDAYTLSFFENDSSRLPKWCNDGDIVQPYCQI  487

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
             G+YRMELP YNTL+PY++MNE CPSLPP Y R  +C
Sbjct  488  KGKYRMELPEYNTLDPYSHMNEKCPSLPPKYSRSANC  524



>ref|XP_007211816.1| hypothetical protein PRUPE_ppa004222mg [Prunus persica]
 gb|EMJ13015.1| hypothetical protein PRUPE_ppa004222mg [Prunus persica]
Length=522

 Score =   329 bits (843),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 180/218 (83%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+F+ TAAWEY R M G+ +GYHN+IFSWIDTI DNYPPPVDAH+V SVM++W  +
Sbjct  305  PDIRAKFSETAAWEYARSMEGQSFGYHNVIFSWIDTIKDNYPPPVDAHMVASVMTVWNNI  364

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+ L L EIL E E+RG +FD+LLT+PEQD W+YSDGKST+ 
Sbjct  365  QPAYAANMWNEALNKRLGTQNLSLPEILVEVEKRGSSFDELLTLPEQDYWLYSDGKSTSS  424

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAFIL MYK++G+F  +A SIQVTEFTI+DAYMLK +ENN  RLP WCN G+  KLPFCQ
Sbjct  425  VAFILEMYKQAGLFDPIASSIQVTEFTIKDAYMLKFFENNSCRLPKWCNDGDTVKLPFCQ  484

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELP YN++EPY++MNE C SLP  Y R  +C
Sbjct  485  IKGKYRMELPEYNSMEPYSHMNERCESLPQKYSRSRNC  522



>ref|XP_002986592.1| hypothetical protein SELMODRAFT_124354 [Selaginella moellendorffii]
 gb|EFJ12449.1| hypothetical protein SELMODRAFT_124354 [Selaginella moellendorffii]
Length=509

 Score =   328 bits (841),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 179/216 (83%), Gaps = 1/216 (0%)
 Frame = -1

Query  691  VRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRMQP  512
            +R +FN TAAWEY R M GKPYGYHNMIFSWIDT  DNYPP +D++LV SV+++WTR+QP
Sbjct  294  MREKFNLTAAWEYARSMDGKPYGYHNMIFSWIDTPVDNYPPQLDSNLVASVLTVWTRLQP  353

Query  511  TYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVA  332
             YAANMWNEALNKRL T+GLDL  ++ E E RG+ F++LL IPE+D+W+YSDGKST+CVA
Sbjct  354  EYAANMWNEALNKRLDTQGLDLPGVMREAEHRGIPFEELLAIPEKDDWIYSDGKSTSCVA  413

Query  331  FILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQIV  155
            F+L MYKE+G+FG LA SIQVTEFTIRDAYML  +E N +RLP WCN+ +D  LPFCQI+
Sbjct  414  FVLQMYKEAGLFGELASSIQVTEFTIRDAYMLSFFEKNSSRLPKWCNAHDDPPLPFCQIL  473

Query  154  GEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            G YRMELP YNTL PYA+M+E CPS+PP Y RP  C
Sbjct  474  GTYRMELPDYNTLVPYASMDERCPSVPPDYYRPSGC  509



>ref|XP_002965264.1| hypothetical protein SELMODRAFT_143057 [Selaginella moellendorffii]
 gb|EFJ34102.1| hypothetical protein SELMODRAFT_143057 [Selaginella moellendorffii]
Length=509

 Score =   328 bits (841),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 179/216 (83%), Gaps = 1/216 (0%)
 Frame = -1

Query  691  VRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRMQP  512
            +R +FN TAAWEY R M GKPYGYHNMIFSWIDT  DNYPP +D++LV SV+++WTR+QP
Sbjct  294  MREKFNLTAAWEYARSMDGKPYGYHNMIFSWIDTPVDNYPPQLDSNLVASVLTVWTRLQP  353

Query  511  TYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVA  332
             YAANMWNEALNKRL T+GLDL  ++ E E RG+ F++LL IPE+D+W+YSDGKST+CVA
Sbjct  354  EYAANMWNEALNKRLDTQGLDLPGVMREAEHRGIPFEELLAIPEKDDWIYSDGKSTSCVA  413

Query  331  FILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQIV  155
            F+L MYKE+G+FG LA SIQVTEFTIRDAYML  +E N +RLP WCN+ +D  LPFCQI+
Sbjct  414  FVLQMYKEAGLFGELASSIQVTEFTIRDAYMLSFFEKNSSRLPKWCNAHDDPPLPFCQIL  473

Query  154  GEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            G YRMELP YNTL PYA+M+E CPS+PP Y RP  C
Sbjct  474  GTYRMELPDYNTLVPYASMDERCPSVPPDYYRPSGC  509



>ref|XP_009614697.1| PREDICTED: uncharacterized protein LOC104107565 isoform X2 [Nicotiana 
tomentosiformis]
Length=528

 Score =   328 bits (842),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 148/218 (68%), Positives = 179/218 (82%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY + M GKPYGYHN+IFSWIDTI  NYP P+DAHLV SVM+++ ++
Sbjct  311  PDLRAKFNETAAWEYAKSMAGKPYGYHNLIFSWIDTIDGNYPSPLDAHLVASVMTVFNQL  370

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            +P YA+N+WNEALNKRLGT+ L L  IL E E+RG +F +LLTIPEQD+W YSDGKS +C
Sbjct  371  KPAYASNLWNEALNKRLGTQNLSLPNILVEVEKRGSSFAELLTIPEQDDWDYSDGKSASC  430

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VA+IL MYKE G+FG LA SIQVTEFTI+DAY LK +ENN +RLP WCN+ +  KLPFCQ
Sbjct  431  VAYILEMYKEGGLFGELASSIQVTEFTIKDAYTLKFFENNSSRLPKWCNADDSVKLPFCQ  490

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYNT++PY  MNE CPS+PP Y RP  C
Sbjct  491  IRGKYRMELPGYNTMDPYPRMNERCPSMPPKYYRPQGC  528



>ref|XP_001781611.1| predicted protein [Physcomitrella patens]
 gb|EDQ53567.1| predicted protein [Physcomitrella patens]
Length=506

 Score =   328 bits (840),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 184/216 (85%), Gaps = 0/216 (0%)
 Frame = -1

Query  694  EVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRMQ  515
            ++RA+FN+T AW+Y   M GKPYGYHNMIFSWIDT + NYP P+D +LV S +++WTR+Q
Sbjct  291  DMRAKFNNTRAWDYALHMNGKPYGYHNMIFSWIDTPNANYPAPLDCNLVASAITVWTRLQ  350

Query  514  PTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCV  335
            P YA+NMWNEALNKRLGT+GLDL  ++ ETER+G+ F++LL IPE+D W YSDG ST+CV
Sbjct  351  PDYASNMWNEALNKRLGTKGLDLPGVMVETERQGIPFEELLAIPEKDNWKYSDGYSTSCV  410

Query  334  AFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQIV  155
            AF+L +YK++G+FGS+A+S+QVTEFT+RDAYMLK YE++++RLP+WC + N    +CQI+
Sbjct  411  AFVLEIYKQAGLFGSVADSVQVTEFTVRDAYMLKFYEDDKSRLPAWCGTSNTSRTYCQIL  470

Query  154  GEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            GEY MELPGYNT+EPYANMNE CPSLPPSY+RP  C
Sbjct  471  GEYDMELPGYNTIEPYANMNERCPSLPPSYDRPAQC  506



>ref|XP_009801187.1| PREDICTED: uncharacterized protein LOC104246940 isoform X1 [Nicotiana 
sylvestris]
Length=528

 Score =   328 bits (841),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 146/218 (67%), Positives = 180/218 (83%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY + M GKPYGYHN+IFSWIDTI  NYP P+DAHL+ SVM+++ ++
Sbjct  311  PDLRAKFNKTAAWEYAKSMAGKPYGYHNLIFSWIDTIDGNYPSPLDAHLIASVMTVFNQL  370

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            +P YA+N+WNEALNKRLGT+ L L  IL E E+RG +F +LL IPEQD+WVYSDGKS +C
Sbjct  371  KPAYASNLWNEALNKRLGTQNLSLPNILVEVEKRGSSFAELLIIPEQDDWVYSDGKSASC  430

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VA+I+ MYKE G+FG LA SIQVTEFTI+DAY LK +ENN +RLP WCN+ +  KLPFCQ
Sbjct  431  VAYIMEMYKEGGLFGELASSIQVTEFTIKDAYTLKFFENNSSRLPKWCNADDTVKLPFCQ  490

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYNT++PY +MNE CPS+PP Y RP  C
Sbjct  491  IRGKYRMELPGYNTMDPYPHMNERCPSMPPKYYRPQGC  528



>ref|XP_008226933.1| PREDICTED: uncharacterized protein LOC103326478 [Prunus mume]
Length=522

 Score =   328 bits (840),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 148/218 (68%), Positives = 180/218 (83%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+F+ TAAWEY R M G+ +GYHN+IFSWIDTI DNYPPPVDAH+V SVM++W  +
Sbjct  305  PDIRAKFSETAAWEYARSMEGQSFGYHNVIFSWIDTIKDNYPPPVDAHMVASVMTVWNNI  364

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+ L L +IL E E+RG +FD+LLT+PEQD W+YSDGKST+ 
Sbjct  365  QPAYAANMWNEALNKRLGTQNLSLPDILVEVEKRGSSFDELLTLPEQDYWLYSDGKSTSS  424

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAFIL MYK++G+F  +A SIQVTEFTI+DAYMLK +ENN  RLP WCN G+  KLPFCQ
Sbjct  425  VAFILEMYKQAGLFDPIASSIQVTEFTIKDAYMLKFFENNSCRLPKWCNDGDTVKLPFCQ  484

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELP YN++EPY++MNE C SLP  Y R  +C
Sbjct  485  IKGKYRMELPEYNSVEPYSHMNERCESLPQKYSRSRNC  522



>ref|XP_004244132.1| PREDICTED: uncharacterized protein LOC101251905 [Solanum lycopersicum]
Length=528

 Score =   327 bits (839),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 148/218 (68%), Positives = 178/218 (82%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY R M GK YGYHN+IFSWIDTI  NYPPPVDAHLV SVM++W ++
Sbjct  311  PDLRAKFNETAAWEYARSMEGKSYGYHNLIFSWIDTIDGNYPPPVDAHLVASVMTVWNQI  370

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
             P Y +N+WNEALNKRLGT+ L L +IL E E+RG +F +LL IPEQD+WVYSDGKS +C
Sbjct  371  APEYGSNLWNEALNKRLGTQNLSLPDILVEVEKRGSSFAKLLAIPEQDDWVYSDGKSASC  430

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAFIL MYKE G+FG LA SIQVTEFTI+DAY L ++ENN +RLP WCN+ +  KLPFCQ
Sbjct  431  VAFILEMYKEGGLFGELANSIQVTEFTIKDAYTLNLFENNSSRLPKWCNADDTMKLPFCQ  490

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYN+++ Y +MNE CPS+PP Y RP  C
Sbjct  491  IRGKYRMELPGYNSMDLYPHMNERCPSMPPKYYRPQGC  528



>emb|CDM84540.1| unnamed protein product [Triticum aestivum]
Length=539

 Score =   327 bits (839),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 147/217 (68%), Positives = 183/217 (84%), Gaps = 1/217 (0%)
 Frame = -1

Query  694  EVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRMQ  515
            ++RA+FN TAAW Y + M GKPYGYHNMIFSWIDTIS+NYPPP+DAH+V SVM++W ++Q
Sbjct  323  DLRAKFNETAAWIYAKKMNGKPYGYHNMIFSWIDTISNNYPPPLDAHVVASVMTVWNKLQ  382

Query  514  PTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCV  335
            P YAA+MW EALNKRLGT+GLDL EI+ E+E+RG+TFD+LLTIPE+D WVY+DG+S +CV
Sbjct  383  PDYAASMWTEALNKRLGTKGLDLPEIIVESEKRGMTFDKLLTIPEKDNWVYTDGQSASCV  442

Query  334  AFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQI  158
            A++L MYKE+G+F  ++ SI+VTEFTI+DAY+L  +E N TRLPSWCN  +  KLPFCQI
Sbjct  443  AYVLMMYKEAGLFEPISSSIEVTEFTIKDAYILNFFEANMTRLPSWCNKDDTVKLPFCQI  502

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
             G YRMELPGYN +EPYA+MNE C SLPP Y R  +C
Sbjct  503  KGRYRMELPGYNAMEPYAHMNERCASLPPDYLRDENC  539



>ref|XP_006346229.1| PREDICTED: uncharacterized protein LOC102586255 [Solanum tuberosum]
Length=528

 Score =   327 bits (837),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 148/218 (68%), Positives = 176/218 (81%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY R M GK YGYHN+IFSWIDTI  NYPPPVDAHLV SVM++W ++
Sbjct  311  PDLRAKFNETAAWEYARSMAGKSYGYHNLIFSWIDTIDGNYPPPVDAHLVASVMTVWNQI  370

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
             P Y +N+WNEALNKRLGT+ L L  IL E E+RG +F +LL IPEQD+WVYSDGKS +C
Sbjct  371  APEYGSNLWNEALNKRLGTQNLSLPNILVEVEKRGSSFAKLLAIPEQDDWVYSDGKSASC  430

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAFIL MYKE G+FG  A SIQVTEFTIRDAY L ++ENN +RLP WCN+ +  KLPFCQ
Sbjct  431  VAFILEMYKEGGLFGEFANSIQVTEFTIRDAYTLNLFENNSSRLPKWCNADDTVKLPFCQ  490

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYN+++ Y +MNE CPS+PP Y RP  C
Sbjct  491  IRGKYRMELPGYNSMDLYPHMNERCPSMPPKYYRPQGC  528



>ref|XP_010644425.1| PREDICTED: uncharacterized protein LOC100241838 isoform X1 [Vitis 
vinifera]
 ref|XP_010644426.1| PREDICTED: uncharacterized protein LOC100241838 isoform X1 [Vitis 
vinifera]
 ref|XP_010644427.1| PREDICTED: uncharacterized protein LOC100241838 isoform X1 [Vitis 
vinifera]
Length=545

 Score =   325 bits (833),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P +RA+FN TAAWEY R M GKPYGYHNMIFSWID + +NYPPP+DAH+V + M++W +M
Sbjct  308  PHLRAKFNETAAWEYARSMEGKPYGYHNMIFSWIDALDENYPPPLDAHVVAAGMTVWNQM  367

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
             P YAAN+WNEALNKRLGT+ L L EIL ETE RG +F +LLTIPEQD+WVY+DGKST+C
Sbjct  368  WPAYAANLWNEALNKRLGTQNLSLPEILIETETRGSSFAELLTIPEQDDWVYTDGKSTSC  427

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL MYKE+G+FG +A SIQ TEFTI+DAY L  +EN+ +RLP WCN G+   P+CQI
Sbjct  428  VAFILEMYKEAGLFGPIASSIQGTEFTIKDAYTLSFFENDSSRLPKWCNDGDIVQPYCQI  487

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSY  65
             G+YRMELP YNTL+PY++MNE CPSLPP Y
Sbjct  488  KGKYRMELPEYNTLDPYSHMNEKCPSLPPKY  518



>gb|EMT03744.1| hypothetical protein F775_19554 [Aegilops tauschii]
Length=637

 Score =   327 bits (838),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 147/217 (68%), Positives = 181/217 (83%), Gaps = 1/217 (0%)
 Frame = -1

Query  694  EVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRMQ  515
            ++RA+FN TAAW Y   M GKPYGYHNMIFSWIDTIS+NYPPP+DAH+V SVM++W ++Q
Sbjct  421  DLRAKFNETAAWIYAEKMNGKPYGYHNMIFSWIDTISNNYPPPLDAHVVASVMTVWNKLQ  480

Query  514  PTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCV  335
            P YAA+MW EALNKRLGT+GLDL EI+ E+E+RG+TFD+LLTIPE+D WVY+DG+S +CV
Sbjct  481  PDYAASMWTEALNKRLGTKGLDLPEIIVESEKRGMTFDKLLTIPEKDNWVYTDGQSASCV  540

Query  334  AFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQI  158
            A++L MYKE+G+F  ++ SI VTEFTI+DAY+L  +E N TRLPSWCN  +  KLPFCQI
Sbjct  541  AYVLMMYKEAGLFEPISSSIDVTEFTIKDAYILNFFEANMTRLPSWCNKDDTVKLPFCQI  600

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
             G YRMELPGYN +EPYA+MNE C SLPP Y R  +C
Sbjct  601  KGRYRMELPGYNAMEPYAHMNERCASLPPDYVRDENC  637



>emb|CBI26611.3| unnamed protein product [Vitis vinifera]
Length=590

 Score =   325 bits (834),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P +RA+FN TAAWEY R M GKPYGYHNMIFSWID + +NYPPP+DAH+V + M++W +M
Sbjct  353  PHLRAKFNETAAWEYARSMEGKPYGYHNMIFSWIDALDENYPPPLDAHVVAAGMTVWNQM  412

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
             P YAAN+WNEALNKRLGT+ L L EIL ETE RG +F +LLTIPEQD+WVY+DGKST+C
Sbjct  413  WPAYAANLWNEALNKRLGTQNLSLPEILIETETRGSSFAELLTIPEQDDWVYTDGKSTSC  472

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL MYKE+G+FG +A SIQ TEFTI+DAY L  +EN+ +RLP WCN G+   P+CQI
Sbjct  473  VAFILEMYKEAGLFGPIASSIQGTEFTIKDAYTLSFFENDSSRLPKWCNDGDIVQPYCQI  532

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSY  65
             G+YRMELP YNTL+PY++MNE CPSLPP Y
Sbjct  533  KGKYRMELPEYNTLDPYSHMNEKCPSLPPKY  563



>emb|CDP05764.1| unnamed protein product [Coffea canephora]
Length=527

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 145/218 (67%), Positives = 175/218 (80%), Gaps = 1/218 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P  RA+FN TAAWEY R M G  YG+HN+IFSWIDTI  NYPPP+DAHLV SVM++W+++
Sbjct  310  PHFRAKFNETAAWEYARSMEGLSYGFHNLIFSWIDTIEGNYPPPLDAHLVASVMTVWSQL  369

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QPTYAAN+WNEALNKRLGT+GL L EIL E E+RG +F +LL IPE+D W Y DGKS +C
Sbjct  370  QPTYAANLWNEALNKRLGTQGLGLPEILVEVEKRGSSFAELLAIPERDNWTYVDGKSASC  429

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAF+L MYKE+G+FG L  SI+VTEFTI+DAY L I+EN+ + LP WC  G+  +LPFCQ
Sbjct  430  VAFVLEMYKEAGIFGELGNSIEVTEFTIKDAYSLNIFENDSSHLPQWCKDGDTVELPFCQ  489

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G+YRMELPGYNT+ PY +MNE CPS+PP Y RP  C
Sbjct  490  IRGKYRMELPGYNTINPYPHMNERCPSMPPEYYRPEGC  527



>ref|XP_009614695.1| PREDICTED: uncharacterized protein LOC104107565 isoform X1 [Nicotiana 
tomentosiformis]
Length=533

 Score =   322 bits (826),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 148/223 (66%), Positives = 179/223 (80%), Gaps = 6/223 (3%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY + M GKPYGYHN+IFSWIDTI  NYP P+DAHLV SVM+++ ++
Sbjct  311  PDLRAKFNETAAWEYAKSMAGKPYGYHNLIFSWIDTIDGNYPSPLDAHLVASVMTVFNQL  370

Query  517  QPTYAANMWNEALNKRLGTE-----GLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDG  353
            +P YA+N+WNEALNKRLGT+      L L  IL E E+RG +F +LLTIPEQD+W YSDG
Sbjct  371  KPAYASNLWNEALNKRLGTQQMLMQNLSLPNILVEVEKRGSSFAELLTIPEQDDWDYSDG  430

Query  352  KSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-K  176
            KS +CVA+IL MYKE G+FG LA SIQVTEFTI+DAY LK +ENN +RLP WCN+ +  K
Sbjct  431  KSASCVAYILEMYKEGGLFGELASSIQVTEFTIKDAYTLKFFENNSSRLPKWCNADDSVK  490

Query  175  LPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            LPFCQI G+YRMELPGYNT++PY  MNE CPS+PP Y RP  C
Sbjct  491  LPFCQIRGKYRMELPGYNTMDPYPRMNERCPSMPPKYYRPQGC  533



>dbj|BAJ95380.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=541

 Score =   322 bits (826),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 182/217 (84%), Gaps = 1/217 (0%)
 Frame = -1

Query  694  EVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRMQ  515
            ++R +FN TAAW Y + M GKPYGYHNMIFSWIDTIS+NYPPP+DAH+V SVM++W ++Q
Sbjct  325  DLREKFNETAAWIYAKKMNGKPYGYHNMIFSWIDTISNNYPPPLDAHVVASVMTVWNKLQ  384

Query  514  PTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCV  335
            P YAA+MW EALNKRLGT+GLDL EI+ E+E+RG+TFD+LLTIPE+D+WVY+DG+S +CV
Sbjct  385  PDYAASMWTEALNKRLGTKGLDLPEIIVESEKRGMTFDKLLTIPEKDKWVYTDGQSASCV  444

Query  334  AFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQI  158
            A++L MYKE+G+F  ++ SI+VTEFTI+DAY+L  +E N TRLP+WCN  +  KLPFCQI
Sbjct  445  AYVLMMYKEAGLFEPISSSIEVTEFTIKDAYILNFFEANMTRLPAWCNKDDTVKLPFCQI  504

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
             G YRMELPGYN +E YA+MNE C SLPP Y R  +C
Sbjct  505  KGRYRMELPGYNAMEQYAHMNERCASLPPDYVRDENC  541



>gb|KDO82633.1| hypothetical protein CISIN_1g0101752mg, partial [Citrus sinensis]
Length=168

 Score =   303 bits (775),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = -1

Query  550  VISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDE  371
            V+SVMSMWTR+QP YAANMWNEALNKRLGTE LDL+ IL E E+RG++FDQLLTIPEQDE
Sbjct  1    VVSVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLHGILDEIEKRGISFDQLLTIPEQDE  60

Query  370  WVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCN  191
            WVYSDGKSTTCVAFIL MYKE+GVFG ++ SIQVTEFTIRDAYMLKI+ENNQTRLPSWCN
Sbjct  61   WVYSDGKSTTCVAFILEMYKEAGVFGPISNSIQVTEFTIRDAYMLKIFENNQTRLPSWCN  120

Query  190  SGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +   KLPFCQI+GEYRMELP YNT+EPYANMNENCPSLPPSYERP  C
Sbjct  121  NEEAKLPFCQILGEYRMELPQYNTIEPYANMNENCPSLPPSYERPQRC  168



>emb|CAN60720.1| hypothetical protein VITISV_022056 [Vitis vinifera]
Length=555

 Score =   313 bits (803),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 147/248 (59%), Positives = 178/248 (72%), Gaps = 31/248 (13%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P +RA+FN TAAWEY R M GKPYGYHNMIFSWID + +NYPPP+DAH+V + M++W +M
Sbjct  308  PHLRAKFNETAAWEYARSMEGKPYGYHNMIFSWIDALDENYPPPLDAHVVAAGMTVWNQM  367

Query  517  QPTYAANMWNEALNKRLGTE-------------------------------GLDLYEILA  431
             P YAAN+WNEALNKRLGT+                                L L EIL 
Sbjct  368  WPAYAANLWNEALNKRLGTQTALGIWDLAFKDPPKYPRSDVDIIMADLKNQNLSLPEILI  427

Query  430  ETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIR  251
            ETE RG +F +LLTIPEQD+WVY+DGKST+CVAFIL MYKE+G+FG +A SIQ TEFTI+
Sbjct  428  ETETRGSSFAELLTIPEQDDWVYTDGKSTSCVAFILEMYKEAGLFGPIASSIQGTEFTIK  487

Query  250  DAYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPP  71
            DAY L  +EN+ +RLP WCN G+   P+CQI G+YRMELP YNTL+PY++MNE CPSLPP
Sbjct  488  DAYTLSFFENDSSRLPKWCNDGDIVQPYCQIKGKYRMELPEYNTLDPYSHMNEKCPSLPP  547

Query  70   SYERPIHC  47
             Y R  +C
Sbjct  548  KYSRSANC  555



>ref|XP_004158483.1| PREDICTED: uncharacterized LOC101212346 [Cucumis sativus]
Length=438

 Score =   308 bits (790),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 136/222 (61%), Positives = 174/222 (78%), Gaps = 6/222 (3%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWE+++ M+GKPYGYHN+IFSWIDT   N+P P+DAH+V S M++W +M
Sbjct  218  PDLRAKFNETAAWEFLKTMVGKPYGYHNLIFSWIDTTQGNFPSPLDAHMVASAMTIWNQM  277

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP++A  +WNEALNKRLGT+GL+L EIL E E++G +F +LL IPEQD W YSDGKS TC
Sbjct  278  QPSFAGKLWNEALNKRLGTKGLELAEILVEVEKQGSSFGELLAIPEQDVWTYSDGKSATC  337

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-----KL  173
            VA ++ +YK +G+FG L  SIQ TEFT++DAY LK YE+N +RLP WCN G D     +L
Sbjct  338  VALVVEIYKVAGLFGPLTSSIQATEFTVKDAYTLKFYEDNLSRLPKWCNDGGDNYENKQL  397

Query  172  PFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            P+CQI+G YRMELP YNT+ PY +MNE CPSL P Y  P +C
Sbjct  398  PYCQILGNYRMELPDYNTIHPYQHMNEKCPSL-PDYAHPKNC  438



>ref|XP_008454552.1| PREDICTED: uncharacterized protein LOC103494942 [Cucumis melo]
Length=538

 Score =   311 bits (796),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 136/222 (61%), Positives = 174/222 (78%), Gaps = 6/222 (3%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWE+++ M+GKPYGYHN+IFSWIDT   N+P P+DAH+V S M++W +M
Sbjct  318  PDLRAKFNETAAWEFLKTMVGKPYGYHNLIFSWIDTTHGNFPSPLDAHMVASAMTIWNQM  377

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP++A  +WNEALNKRLGT+GL+L E+L E E++G +F +LL IPEQDEW YSDGKS TC
Sbjct  378  QPSFAGKLWNEALNKRLGTKGLELAEVLVEVEKKGSSFGELLAIPEQDEWTYSDGKSATC  437

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-----KL  173
            VA ++ +YK +G+FG L  SIQ TEFT++DAY LK YE+N +RLP WCN G D     +L
Sbjct  438  VALVVEIYKVAGLFGPLTSSIQATEFTVKDAYTLKFYEDNLSRLPKWCNDGGDNYENKQL  497

Query  172  PFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            P+CQI+G YRMELP YNT+ PY +MNE CPSL P Y  P  C
Sbjct  498  PYCQILGNYRMELPDYNTIHPYQHMNEKCPSL-PDYVHPKDC  538



>ref|XP_004152029.1| PREDICTED: uncharacterized protein LOC101212346 [Cucumis sativus]
 gb|KGN57972.1| hypothetical protein Csa_3G416650 [Cucumis sativus]
Length=527

 Score =   310 bits (793),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 136/222 (61%), Positives = 174/222 (78%), Gaps = 6/222 (3%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWE+++ M+GKPYGYHN+IFSWIDT   N+P P+DAH+V S M++W +M
Sbjct  307  PDLRAKFNETAAWEFLKTMVGKPYGYHNLIFSWIDTTQGNFPSPLDAHMVASAMTIWNQM  366

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP++A  +WNEALNKRLGT+GL+L EIL E E++G +F +LL IPEQD W YSDGKS TC
Sbjct  367  QPSFAGKLWNEALNKRLGTKGLELAEILVEVEKQGSSFGELLAIPEQDVWTYSDGKSATC  426

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-----KL  173
            VA ++ +YK +G+FG L  SIQ TEFT++DAY LK YE+N +RLP WCN G D     +L
Sbjct  427  VALVVEIYKVAGLFGPLTSSIQATEFTVKDAYTLKFYEDNLSRLPKWCNDGGDNYENKQL  486

Query  172  PFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            P+CQI+G YRMELP YNT+ PY +MNE CPSL P Y  P +C
Sbjct  487  PYCQILGNYRMELPDYNTIHPYQHMNEKCPSL-PDYAHPKNC  527



>gb|KCW67120.1| hypothetical protein EUGRSUZ_F00901 [Eucalyptus grandis]
Length=368

 Score =   304 bits (779),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 178/228 (78%), Gaps = 11/228 (5%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAW+Y + M GKPYGYHNM+FSWI TI+ NYPP +DAH+V SVM++  +M
Sbjct  134  PDMRAKFNETAAWKYAQSMNGKPYGYHNMLFSWIGTINANYPPLLDAHVVASVMTVCNQM  193

Query  517  QPTYAANMWNEALNKRLGTE----------GLDLYEILAETERRGLTFDQLLTIPEQDEW  368
            QP YAANMWNEALNKRLGTE            DL +++ +TE RG +F +LLTIPEQD+W
Sbjct  194  QPAYAANMWNEALNKRLGTEVPSYSICNCLAWDLPDLIVKTEMRGSSFAELLTIPEQDDW  253

Query  367  VYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNS  188
            VYSDG+S +CVAF+L +YK + +F  ++ SIQVTEFTI+DAY L+ +ENN +RLP WCN 
Sbjct  254  VYSDGRSASCVAFVLEIYKAARLFDPISRSIQVTEFTIKDAYSLRFFENNSSRLPKWCND  313

Query  187  GND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            G+D +  FCQI G YRMELPGYNT++PY +MNE CPSLPP Y RP +C
Sbjct  314  GDDVEFLFCQIRGRYRMELPGYNTMDPYPHMNEMCPSLPPKYSRPSNC  361



>ref|XP_010913435.1| PREDICTED: uncharacterized protein LOC105039122 isoform X2 [Elaeis 
guineensis]
Length=453

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = -1

Query  550  VISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDE  371
            V+S+MSMWTR+QP YAANMWNEALNKRLGTEGLDL++I+ ETERRG+TFDQLLTIPEQDE
Sbjct  286  VMSIMSMWTRLQPAYAANMWNEALNKRLGTEGLDLHDIIIETERRGMTFDQLLTIPEQDE  345

Query  370  WVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCN  191
            W YSDGKSTTCVAFIL MYKE+G+FG +A SIQVTEFTIRDAYMLKI+ENN TRLPSWCN
Sbjct  346  WEYSDGKSTTCVAFILEMYKEAGIFGPIANSIQVTEFTIRDAYMLKIFENNGTRLPSWCN  405

Query  190  SGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +  +KLPFCQI+GEYRMELP YNT+EPYA MNENCPSLPP+YERP+ C
Sbjct  406  AEEEKLPFCQILGEYRMELPEYNTIEPYARMNENCPSLPPTYERPVSC  453



>ref|XP_010272087.1| PREDICTED: uncharacterized protein LOC104607980 isoform X2 [Nelumbo 
nucifera]
Length=500

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 169/217 (78%), Gaps = 31/217 (14%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++R +FN+TAAW Y R M GKPYGYHNMIFSWIDT+ +NYPPP+DAHL           
Sbjct  315  PDLRVKFNATAAWAYARNMAGKPYGYHNMIFSWIDTMDENYPPPLDAHL-----------  363

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
                                GLDL  ILAE+ERRG++FDQLL IPEQDEWVYSDGKSTTC
Sbjct  364  --------------------GLDLPGILAESERRGISFDQLLIIPEQDEWVYSDGKSTTC  403

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL MYKE+G+F  ++ SIQVTEFTIRDAYMLKI+ENN+TRLPSWC++ + +LPFCQI
Sbjct  404  VAFILEMYKEAGIFYPISSSIQVTEFTIRDAYMLKIFENNRTRLPSWCSNADGELPFCQI  463

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +GEY+MELP YNT+EPYANMNENCPSLPP+YERP+ C
Sbjct  464  LGEYQMELPQYNTIEPYANMNENCPSLPPTYERPVRC  500



>gb|AGV54795.1| hypothetical protein [Phaseolus vulgaris]
Length=522

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -1

Query  559  AHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPE  380
            AHLVISVMSMWTR+QP Y+ANMWNEALNKRLGTEGLDL++I+ ETE+RG+ FD+LLTIPE
Sbjct  352  AHLVISVMSMWTRLQPAYSANMWNEALNKRLGTEGLDLHDIIVETEKRGIPFDELLTIPE  411

Query  379  QDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPS  200
            QDEWVYSDGKSTTCVAFIL+MYKE+GVFG ++ SIQVTEFTIRDAYML+I+E+NQTRLP 
Sbjct  412  QDEWVYSDGKSTTCVAFILSMYKEAGVFGPVSSSIQVTEFTIRDAYMLRIFEDNQTRLPR  471

Query  199  WCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            WCN+ ND+L FCQI+GEYRMELPGYNTLEPYANMNE CPSLPP Y+RP  C
Sbjct  472  WCNNENDQLSFCQILGEYRMELPGYNTLEPYANMNEYCPSLPPIYDRPSQC  522



>ref|XP_009419909.1| PREDICTED: uncharacterized protein LOC103999784 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=506

 Score =   298 bits (764),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 165/216 (76%), Gaps = 31/216 (14%)
 Frame = -1

Query  694  EVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRMQ  515
            ++ A FN TAAW+Y R M GKPYGYHNMIFSWIDT+++NYPPP+DA+L            
Sbjct  322  DLHAIFNETAAWDYARSMSGKPYGYHNMIFSWIDTVAENYPPPLDANL------------  369

Query  514  PTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCV  335
                                LDL+EI+ ET+R+G+TFDQLLT+PEQDEW+YSDGKSTTCV
Sbjct  370  -------------------DLDLHEIIVETQRQGMTFDQLLTMPEQDEWIYSDGKSTTCV  410

Query  334  AFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQIV  155
            AF+L +YKE+G+ G LA SIQVTEFTIRDAYML I+ENNQTRLPSWCN+  +KLPFCQI+
Sbjct  411  AFVLELYKEAGILGPLANSIQVTEFTIRDAYMLNIFENNQTRLPSWCNALEEKLPFCQIL  470

Query  154  GEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            G YRMELP YNT+EPYA+MNENCPSLPP+Y RP  C
Sbjct  471  GYYRMELPQYNTIEPYAHMNENCPSLPPAYTRPERC  506



>gb|EMS49816.1| hypothetical protein TRIUR3_06457 [Triticum urartu]
Length=589

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/236 (59%), Positives = 175/236 (74%), Gaps = 35/236 (15%)
 Frame = -1

Query  694  EVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRMQ  515
            ++RA+FN TAAW Y + M GKPYGYHNMIFSWIDTIS+NYPPP+DAH+V SVM++W ++Q
Sbjct  257  DLRAKFNETAAWIYAKKMNGKPYGYHNMIFSWIDTISNNYPPPLDAHVVASVMTVWNKLQ  316

Query  514  PTYAANMWNEALNKRLGTE----------------------------------GLDLYEI  437
            P YAA+MW EALNKRLGT+                                  GLDL EI
Sbjct  317  PDYAASMWTEALNKRLGTKVVPGPSFGSSIHLADSLVCDNKLLCDHNPAGMDNGLDLPEI  376

Query  436  LAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFT  257
            + E+E+RG+TFD+LLTIPE+D WVY+DG+S +CVA++L MYKE+G+F  ++ SI+VTEFT
Sbjct  377  IVESEKRGMTFDKLLTIPEKDNWVYTDGQSASCVAYVLMMYKEAGLFEPISSSIEVTEFT  436

Query  256  IRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNE  92
            I+DAY+L  +E N TRLPSWCN  +  KLPFCQI G YRMELPGYNT+EPYA+MNE
Sbjct  437  IKDAYILNFFEANMTRLPSWCNKDDTVKLPFCQIKGRYRMELPGYNTMEPYAHMNE  492



>ref|XP_010092131.1| hypothetical protein L484_017819 [Morus notabilis]
 gb|EXB50282.1| hypothetical protein L484_017819 [Morus notabilis]
Length=624

 Score =   290 bits (743),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 161/189 (85%), Gaps = 1/189 (1%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+ RA+FN TAAWEY R M GKPYGYHNM+F+WIDT++ NYPPP+DAH V SVM++W ++
Sbjct  335  PDTRAKFNETAAWEYARSMEGKPYGYHNMLFAWIDTVNGNYPPPLDAHAVASVMTVWNQI  394

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP+YAAN+WNEALNKRLGTEGLDL  IL ETE++GL+FD+LLTIPEQD+W+Y+DGKST+C
Sbjct  395  QPSYAANLWNEALNKRLGTEGLDLPSILVETEKQGLSFDKLLTIPEQDDWLYADGKSTSC  454

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AF+L MYK +G+F  +A SIQVTEFTI+DAY LK ++++ +R P WCN  +D KLP+CQ
Sbjct  455  IAFVLEMYKAAGLFDPIASSIQVTEFTIKDAYTLKFFDDDLSRQPKWCNDADDVKLPYCQ  514

Query  160  IVGEYRMEL  134
            I+G  R EL
Sbjct  515  ILGNKRAEL  523



>gb|EMS65818.1| hypothetical protein TRIUR3_10678 [Triticum urartu]
Length=353

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = -1

Query  550  VISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDE  371
            V++ MSMWTR+QP YA+NMWNEALNKRLGTE LDL+ I++ETERRG++F+QLLTIPEQDE
Sbjct  186  VMAAMSMWTRLQPHYASNMWNEALNKRLGTEQLDLHGIISETERRGMSFNQLLTIPEQDE  245

Query  370  WVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCN  191
            W YSDGKSTTCVAFILAMYK +GVF    ESIQVTEFTIRDAY L+I+E+N+TRLP WCN
Sbjct  246  WEYSDGKSTTCVAFILAMYKAAGVFAPFTESIQVTEFTIRDAYTLRIFEDNRTRLPGWCN  305

Query  190  SGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
               D LPFCQI+GEY+MELP YNT++PYANMNENCPS PP+Y RP+ C
Sbjct  306  GDADGLPFCQILGEYKMELPEYNTIQPYANMNENCPSSPPTYSRPLRC  353



>gb|EMT12587.1| hypothetical protein F775_11937 [Aegilops tauschii]
Length=453

 Score =   279 bits (714),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 150/174 (86%), Gaps = 6/174 (3%)
 Frame = -1

Query  550  VISVMSMWTRMQPTYAANMWNEALNKRLGTE------GLDLYEILAETERRGLTFDQLLT  389
            V++ MSMWTR+QP YA+NMWNEALNKRLGTE       LDL+ I++ETERRG++F+QLLT
Sbjct  280  VMAAMSMWTRLQPHYASNMWNEALNKRLGTERTEKLTQLDLHGIISETERRGMSFNQLLT  339

Query  388  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  209
            IPEQDEW YSDGKSTTCVAFILAMYK +GVF    ESIQVTEFTIRDAYML+I+E+N+TR
Sbjct  340  IPEQDEWEYSDGKSTTCVAFILAMYKAAGVFAPFTESIQVTEFTIRDAYMLRIFEDNRTR  399

Query  208  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            LP WCN   D LPFCQI+GEY+MELP YNT++PYANMNENCPS PP+Y+RP+ C
Sbjct  400  LPGWCNGDADGLPFCQILGEYKMELPEYNTIQPYANMNENCPSSPPTYDRPLRC  453



>ref|XP_010644428.1| PREDICTED: uncharacterized protein LOC100241838 isoform X2 [Vitis 
vinifera]
Length=538

 Score =   274 bits (701),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 149/188 (79%), Gaps = 0/188 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P +RA+FN TAAWEY R M GKPYGYHNMIFSWID + +NYPPP+DAH+V + M++W +M
Sbjct  308  PHLRAKFNETAAWEYARSMEGKPYGYHNMIFSWIDALDENYPPPLDAHVVAAGMTVWNQM  367

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
             P YAAN+WNEALNKRLGT+ L L EIL ETE RG +F +LLTIPEQD+WVY+DGKST+C
Sbjct  368  WPAYAANLWNEALNKRLGTQNLSLPEILIETETRGSSFAELLTIPEQDDWVYTDGKSTSC  427

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
            VAFIL MYKE+G+FG +A SIQ TEFTI+DAY L  +EN+ +RLP WCN G+   P+CQI
Sbjct  428  VAFILEMYKEAGLFGPIASSIQGTEFTIKDAYTLSFFENDSSRLPKWCNDGDIVQPYCQI  487

Query  157  VGEYRMEL  134
                   L
Sbjct  488  KASISASL  495



>ref|XP_010930259.1| PREDICTED: uncharacterized protein LOC105051475 isoform X2 [Elaeis 
guineensis]
Length=511

 Score =   270 bits (690),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 156/218 (72%), Gaps = 32/218 (15%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FNSTAAWEY   M+GKPYGYHNMIFSWIDTIS NYPPP+D+HL           
Sbjct  325  PDVRAKFNSTAAWEYANSMIGKPYGYHNMIFSWIDTISGNYPPPLDSHL-----------  373

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
                                GLDL  I+ E E+ G++FD+LLT+PEQD+WVYSDGKS +C
Sbjct  374  --------------------GLDLPAIMVEAEKLGISFDKLLTVPEQDDWVYSDGKSASC  413

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            +AF+L MYKE+G+F  +A +IQVTEFTI+DAY LK +ENN + LP WCN  ++ KLP+CQ
Sbjct  414  IAFVLVMYKEAGLFDPIAANIQVTEFTIKDAYTLKFFENNSSHLPEWCNKDDNVKLPYCQ  473

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I+G YRMELP YNTL+PY +MNE CPSLP  Y R  +C
Sbjct  474  ILGRYRMELPEYNTLQPYPHMNERCPSLPLDYARSSYC  511



>ref|XP_006438500.1| hypothetical protein CICLE_v10031248mg [Citrus clementina]
 gb|ESR51740.1| hypothetical protein CICLE_v10031248mg [Citrus clementina]
Length=473

 Score =   267 bits (683),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FNSTAAWEY R M GKPYGYHNMIFSWIDT++DNYPPP+DAHLV+SVMSMWTR+
Sbjct  302  PDVRAKFNSTAAWEYARSMSGKPYGYHNMIFSWIDTMADNYPPPLDAHLVVSVMSMWTRV  361

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE LDL+ IL E E+RG++FDQLLTIPEQDEWVYSDGKSTTC
Sbjct  362  QPAYAANMWNEALNKRLGTEDLDLHGILDEIEKRGISFDQLLTIPEQDEWVYSDGKSTTC  421

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTI  254
            VAFIL MYKE+GVFG ++ SIQVTEFT+
Sbjct  422  VAFILEMYKEAGVFGPISNSIQVTEFTV  449



>gb|KCW67113.1| hypothetical protein EUGRSUZ_F00893 [Eucalyptus grandis]
Length=496

 Score =   255 bits (652),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 153/218 (70%), Gaps = 31/218 (14%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWE+   M GKPY    +++                  V SVM++W +M
Sbjct  309  PDMRAKFNETAAWEHAESMNGKPYESIVLLY------------------VASVMTVWNQM  350

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTEGLDL ++L ETE RG +F +LLTIPEQD+WVYSDGKS +C
Sbjct  351  QPAYAANMWNEALNKRLGTEGLDLPDLLVETEMRGSSFAELLTIPEQDDWVYSDGKSASC  410

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            VAF+L +            SIQVTEFTI+DAY LK +ENN +RLP W N G+D +LPFCQ
Sbjct  411  VAFVLEI------------SIQVTEFTIKDAYSLKFFENNSSRLPKWSNDGDDVELPFCQ  458

Query  160  IVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            I G YRMELPGYNT++ Y +MNE CPSLPP Y RP  C
Sbjct  459  IQGRYRMELPGYNTMDLYPHMNERCPSLPPKYSRPSDC  496



>gb|KJB62764.1| hypothetical protein B456_009G435000 [Gossypium raimondii]
Length=460

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P+VRA+FN TAAWEY   M GKPYGYHNMIFSWIDTI  NYPPP+DAHLV SVM++W+++
Sbjct  307  PDVRAKFNETAAWEYALSMAGKPYGYHNMIFSWIDTIGGNYPPPLDAHLVASVMTVWSKI  366

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GL+L +IL ETE+RG +FD+LLTIPEQD W+YSDGKST+C
Sbjct  367  QPEYAANMWNEALNKRLGTQGLNLSDILVETEKRGSSFDELLTIPEQDNWIYSDGKSTSC  426

Query  337  VAFILAMYKESGVFGSLAESIQVTEFT  257
            +AF+L +YKE+G+F  +A+SIQVTEFT
Sbjct  427  IAFVLELYKEAGLFDPIADSIQVTEFT  453



>gb|EYU33635.1| hypothetical protein MIMGU_mgv1a018256mg, partial [Erythranthe 
guttata]
Length=505

 Score =   244 bits (624),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 128/160 (80%), Gaps = 0/160 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAWEY + M GKPYGYHN+IFSWIDTI  NYP P+DAHLV SVM++WT+M
Sbjct  346  PDIRAKFNETAAWEYAKSMEGKPYGYHNLIFSWIDTIDGNYPEPLDAHLVASVMTVWTQM  405

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YA NMWNEALNKRLGT+   L ++L E E+RG +F  LL  PEQD WVY+DGKS +C
Sbjct  406  QPAYAGNMWNEALNKRLGTQNFSLSQVLVEVEKRGSSFGALLAAPEQDNWVYADGKSASC  465

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENN  218
            V F+  MYKE+G+FG L  SIQ +EFTI+DAY LK +ENN
Sbjct  466  VVFVFEMYKEAGLFGKLGSSIQASEFTIKDAYSLKFFENN  505



>ref|XP_006575675.1| PREDICTED: uncharacterized protein LOC100789468 isoform X2 [Glycine 
max]
Length=464

 Score =   241 bits (614),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P +RARFN TAAWEY   M GKPYGYHNMIFSWIDT+++NYPPP+DA++V  VM++W+++
Sbjct  302  PALRARFNETAAWEYALSMAGKPYGYHNMIFSWIDTLNENYPPPLDANVVACVMTIWSQL  361

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGT+GLDL E+L E E+RG +FD+LLTIPEQD+W+YSDGKST+C
Sbjct  362  QPEYAANMWNEALNKRLGTKGLDLSEVLVEVEKRGSSFDELLTIPEQDDWIYSDGKSTSC  421

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTI  254
            +AFIL MYKE+G+F  +A S+QVTEFTI
Sbjct  422  IAFILEMYKEAGLFDPVASSVQVTEFTI  449



>ref|XP_010644433.1| PREDICTED: uncharacterized protein LOC100267545 isoform X2 [Vitis 
vinifera]
Length=468

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P +RA+FN TAAWEY R   GKPYGYHNMIFSWIDT+ +NYPPP+DAH+V SVM++W +M
Sbjct  314  PHLRAKFNETAAWEYARSSEGKPYGYHNMIFSWIDTLDENYPPPLDAHVVASVMTVWNQM  373

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            +P YAAN+WNEALNKRLGT+ L L EIL ETE+RG +FD+LLTIPEQD+WVY+DGKST+C
Sbjct  374  KPAYAANLWNEALNKRLGTQDLALPEILVETEKRGSSFDELLTIPEQDDWVYTDGKSTSC  433

Query  337  VAFILAMYKESGVFGSLAESIQVTEFT  257
            VAFIL MYKE+G+FG  A SIQVTEFT
Sbjct  434  VAFILEMYKEAGLFGPSASSIQVTEFT  460



>gb|ACF81787.1| unknown [Zea mays]
Length=122

 Score =   221 bits (563),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -1

Query  412  LTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLK  233
            ++FDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKE+G+F   +ESIQVTEFTIRDAYMLK
Sbjct  1    MSFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKEAGIFTPFSESIQVTEFTIRDAYMLK  60

Query  232  IYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPI  53
            I+E+N  RLP WCN+G DKLPFCQI+GEYRMELP YNT+EPYA MNENCPSLPP+Y+RP 
Sbjct  61   IFEDNPARLPGWCNAGTDKLPFCQILGEYRMELPEYNTIEPYAKMNENCPSLPPTYKRPA  120

Query  52   HC  47
             C
Sbjct  121  RC  122



>ref|XP_010644430.1| PREDICTED: uncharacterized protein LOC100241838 isoform X5 [Vitis 
vinifera]
 ref|XP_010644431.1| PREDICTED: uncharacterized protein LOC100241838 isoform X5 [Vitis 
vinifera]
 ref|XP_010644432.1| PREDICTED: uncharacterized protein LOC100241838 isoform X5 [Vitis 
vinifera]
Length=467

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P +RA+FN TAAWEY R M GKPYGYHNMIFSWID + +NYPPP+DAH+V + M++W +M
Sbjct  308  PHLRAKFNETAAWEYARSMEGKPYGYHNMIFSWIDALDENYPPPLDAHVVAAGMTVWNQM  367

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
             P YAAN+WNEALNKRLGT+ L L EIL ETE RG +F +LLTIPEQD+WVY+DGKST+C
Sbjct  368  WPAYAANLWNEALNKRLGTQNLSLPEILIETETRGSSFAELLTIPEQDDWVYTDGKSTSC  427

Query  337  VAFILAMYKESGVFGSLAESIQVTEFT  257
            VAFIL MYKE+G+FG +A SIQ TEFT
Sbjct  428  VAFILEMYKEAGLFGPIASSIQGTEFT  454



>ref|XP_010644429.1| PREDICTED: uncharacterized protein LOC100241838 isoform X4 [Vitis 
vinifera]
Length=505

 Score =   229 bits (584),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P +RA+FN TAAWEY R M GKPYGYHNMIFSWID + +NYPPP+DAH+V + M++W +M
Sbjct  308  PHLRAKFNETAAWEYARSMEGKPYGYHNMIFSWIDALDENYPPPLDAHVVAAGMTVWNQM  367

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
             P YAAN+WNEALNKRLGT+ L L EIL ETE RG +F +LLTIPEQD+WVY+DGKST+C
Sbjct  368  WPAYAANLWNEALNKRLGTQNLSLPEILIETETRGSSFAELLTIPEQDDWVYTDGKSTSC  427

Query  337  VAFILAMYKESGVFGSLAESIQVTEFT  257
            VAFIL MYKE+G+FG +A SIQ TEFT
Sbjct  428  VAFILEMYKEAGLFGPIASSIQGTEFT  454



>gb|KCW67105.1| hypothetical protein EUGRSUZ_F00888 [Eucalyptus grandis]
Length=296

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 126/168 (75%), Gaps = 21/168 (13%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA+FN TAAW+Y + M GKPYGYHNM+FSWIDTI  NYPPP+DAH+V SVM++W +M
Sbjct  116  PDMRAKFNLTAAWKYAQSMNGKPYGYHNMLFSWIDTIDANYPPPLDAHVVASVMTVWNQM  175

Query  517  QPTYAANMWNEALNKRLG---------------------TEGLDLYEILAETERRGLTFD  401
            QP YAANMWNEALNKRLG                     TEGLDL +++ ETE RG +F 
Sbjct  176  QPAYAANMWNEALNKRLGTELPSHSICNCLCDIMHLVLHTEGLDLLDLMVETEMRGSSFA  235

Query  400  QLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFT  257
            +LLTIP+QD+WVYSDGKST+CV F+L M K +G+F  ++ SIQVTEFT
Sbjct  236  ELLTIPKQDDWVYSDGKSTSCVVFVLQMDKAAGLFDPISSSIQVTEFT  283



>gb|KCW67102.1| hypothetical protein EUGRSUZ_F00885 [Eucalyptus grandis]
Length=484

 Score =   218 bits (554),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 134/203 (66%), Gaps = 33/203 (16%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            P++RA FN TAAW   R                                V SVM++W +M
Sbjct  309  PDMRAIFNETAAWSMQR--------------------------------VASVMTVWNQM  336

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
            QP YAANMWNEALNKRLGTE         ETE RG +F +LLTIPEQD+WVYSDGKS +C
Sbjct  337  QPAYAANMWNEALNKRLGTEVPSHSIGNLETEMRGSSFAELLTIPEQDDWVYSDGKSASC  396

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQ  161
            V F+L MYK +G F  ++ SIQVTEFTI+DAY LK +ENN +RLP WCN G++ +LPFCQ
Sbjct  397  VVFVLEMYKAAGRFDPISSSIQVTEFTIKDAYSLKFFENNSSRLPKWCNDGDNVELPFCQ  456

Query  160  IVGEYRMELPGYNTLEPYANMNE  92
            I G Y+MELPGYNT++PY +MNE
Sbjct  457  IRGRYQMELPGYNTMDPYPHMNE  479



>ref|XP_010445105.1| PREDICTED: uncharacterized protein LOC104727725 [Camelina sativa]
Length=131

 Score =   203 bits (516),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 110/128 (86%), Gaps = 1/128 (1%)
 Frame = -1

Query  427  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  248
             E+RG +FD+LL +PEQD+W+YSDGKST+C+AFIL MYKE+G+F  ++ SIQVTEFTI+D
Sbjct  4    VEKRGSSFDELLAVPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPISSSIQVTEFTIKD  63

Query  247  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPP  71
            AYMLK +ENN +R P WCN  +D KLP+CQI+G+YRMELPGYNT+EPY +MNE+CPSLPP
Sbjct  64   AYMLKFFENNASRFPKWCNDNDDVKLPYCQILGKYRMELPGYNTMEPYPHMNEHCPSLPP  123

Query  70   SYERPIHC  47
             Y RP +C
Sbjct  124  KYHRPKNC  131



>ref|XP_001449176.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK81779.1| unnamed protein product [Paramecium tetraurelia]
Length=552

 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 137/217 (63%), Gaps = 3/217 (1%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PE RA+++   A ++   M G+PYGYHN IF WIDT  DNYP  + A L   + S   + 
Sbjct  339  PEKRAQWDQEGALKFWNFMEGQPYGYHNFIFGWIDTPKDNYPTLLSAELATYIFSFIEKF  398

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
             P+ +  M  EALNKRLGTEGL + EI  E  +RG+   +L  + E+DEW+YSDG S  C
Sbjct  399  APSISTKMVGEALNKRLGTEGLTIPEITIEAAKRGIEIAELYAMVEKDEWIYSDGPSQVC  458

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
             +F++ +YK +G+FG     I+ TEFT +D Y +  ++ +   +P  C   +  LP+CQI
Sbjct  459  SSFVIGLYKAAGLFGEY--HIEATEFTPKDVYQMNFFDKDYV-VPKKCKDNDPDLPYCQI  515

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +G +RMEL GYNT++PY +MNE CPS  P Y+RP  C
Sbjct  516  MGTHRMELEGYNTIDPYEHMNERCPSQAPDYKRPADC  552



>gb|KCW67110.1| hypothetical protein EUGRSUZ_F00891 [Eucalyptus grandis]
Length=148

 Score =   197 bits (502),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = -1

Query  460  EGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAE  281
            +GLDL ++L ETE RG +F +LLTIP+QD+WVYSDG S +CVAF+L MYK +G+F  ++ 
Sbjct  10   QGLDLPDLLLETEMRGSSFAELLTIPQQDDWVYSDGNSASCVAFVLEMYKATGLFDPISG  69

Query  280  SIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYA  104
            SIQVTEFTI+DAY LK ++NN  RLP  CN G+D +LPFCQI G YRMELPGYNT++PY 
Sbjct  70   SIQVTEFTIKDAYSLKFFKNNSRRLPKLCNDGDDAELPFCQIRGRYRMELPGYNTMDPYP  129

Query  103  NMNENCPSLPPSYERPIHC  47
            +MNE CP+LPP Y RP  C
Sbjct  130  HMNERCPTLPPKYSRPSDC  148



>ref|XP_001436259.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK68862.1| unnamed protein product [Paramecium tetraurelia]
Length=552

 Score =   209 bits (531),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 134/217 (62%), Gaps = 3/217 (1%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PE RA++N   A ++   M G PYGYHN IF WIDT  DNYP  + A L   + S   + 
Sbjct  339  PEKRAQWNQEGALKFWNFMEGCPYGYHNFIFGWIDTPKDNYPSLLSAELATYIFSFIEKF  398

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
             P+ +  M  E LNKRLGTEGL + EI  E  +RG+   +L  + E+D W+YSDG S  C
Sbjct  399  APSISNKMVGEGLNKRLGTEGLTIPEITIEAAKRGIEIAELYAMVEKDNWIYSDGPSQVC  458

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
             +F++ +YK +G+FG     I+ TEFT +D Y +  ++ N   +P  C   +  LP+CQI
Sbjct  459  SSFVIGLYKAAGLFGEY--HIEATEFTPKDVYQMNFFDKNYV-VPKKCKDNDPDLPYCQI  515

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +G +RMEL GYNT++PY +MNE CPS  P Y+RP  C
Sbjct  516  MGTHRMELEGYNTIDPYEHMNERCPSQAPDYKRPADC  552



>ref|XP_001455162.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK87765.1| unnamed protein product [Paramecium tetraurelia]
Length=553

 Score =   208 bits (530),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 97/217 (45%), Positives = 137/217 (63%), Gaps = 3/217 (1%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PE RA+++   A  Y + M G+PYGYH  +F WIDT +DNYP P+ A     + S + ++
Sbjct  340  PEKRAQWDQEGALAYWKKMEGQPYGYHTFLFGWIDTPTDNYPKPLSAEFATYMFSFFEKI  399

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
             P    ++  EALNKRLGTEGL + E+  E  ++G+   +L  + E+DEWVYSDG S  C
Sbjct  400  APGPITSLVGEALNKRLGTEGLSVSEVAIEAAKQGIELAELYAMVERDEWVYSDGPSQAC  459

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
             AF+  MYK +G+F      I+  EFT +D Y LK +++N   +P  C   +  LP+CQ+
Sbjct  460  AAFVTGMYKAAGLFKPF--HIEALEFTPKDIYQLKFFDSN-YEVPKKCKKNDPDLPYCQL  516

Query  157  VGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +G +R+EL GYNT+EPY NMNE CPS+ P + RP  C
Sbjct  517  MGTHRIELEGYNTVEPYENMNERCPSVAPEFIRPDGC  553



>gb|KCW66790.1| hypothetical protein EUGRSUZ_F00555 [Eucalyptus grandis]
Length=255

 Score =   197 bits (500),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -1

Query  670  TAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMW  491
            TAA EY + M GKPYGYHNM+  WIDTI  NYPPP+DA +V SVM++W +MQP  A NMW
Sbjct  113  TAALEYAQFMNGKPYGYHNMLLRWIDTIDANYPPPLDARVVASVMTVWNQMQPACAPNMW  172

Query  490  NEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYK  311
            NEALNK+LGT+GLDL +++ E E RG +F +LLTIPEQD+WVY+DGKST+CVAF+L +YK
Sbjct  173  NEALNKQLGTKGLDLPDLIVEREMRGPSFAELLTIPEQDDWVYNDGKSTSCVAFVLEIYK  232

Query  310  ESGVFGSLAESIQVTEFTI  254
             +G+F  ++ SIQVT+FT+
Sbjct  233  AAGLFDPISSSIQVTKFTV  251



>ref|XP_010064383.1| PREDICTED: uncharacterized protein LOC104451423 [Eucalyptus grandis]
Length=207

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -1

Query  694  EVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRMQ  515
            ++RA+FN TAAW+Y + M GKPYGYHNM+FSWIDTI  NYPPP+DAH+V S+M++W +MQ
Sbjct  67   DMRAKFNKTAAWKYAQSMNGKPYGYHNMLFSWIDTIDANYPPPLDAHVVASIMTVWNQMQ  126

Query  514  PTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCV  335
            P YAANM NEALNKRLGTEGLDL +++ ET+ RG +F +LLTI EQD+WVYSDGKS +CV
Sbjct  127  PAYAANMGNEALNKRLGTEGLDLPDVIVETKMRGSSFAELLTILEQDDWVYSDGKSASCV  186

Query  334  AFILAMYKE  308
            A  L   K+
Sbjct  187  ALFLKYTKQ  195



>gb|EEC71626.1| hypothetical protein OsI_04047 [Oryza sativa Indica Group]
Length=123

 Score =   187 bits (474),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 103/123 (84%), Gaps = 1/123 (1%)
 Frame = -1

Query  412  LTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLK  233
            +TFD+LLT+PEQD+WVY+DG+S +CVA++L MYKE+G+F  +A SI+VTEFTI+DAY L 
Sbjct  1    MTFDKLLTVPEQDKWVYTDGQSASCVAYVLMMYKEAGLFDPIASSIEVTEFTIKDAYSLN  60

Query  232  IYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYERP  56
             +ENN TRLP WCN  +  KLPFCQI G YRMELPGYNT++PY +MNE CPSLPP+Y RP
Sbjct  61   FFENNMTRLPVWCNKDDSVKLPFCQIKGRYRMELPGYNTMQPYPHMNERCPSLPPNYNRP  120

Query  55   IHC  47
             +C
Sbjct  121  RNC  123



>ref|XP_004027177.1| hypothetical protein IMG5_188030 [Ichthyophthirius multifiliis]
 gb|EGR27832.1| hypothetical protein IMG5_188030 [Ichthyophthirius multifiliis]
Length=570

 Score =   196 bits (498),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/218 (43%), Positives = 140/218 (64%), Gaps = 7/218 (3%)
 Frame = -1

Query  694  EVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRMQ  515
            E+RA+FN+ AA E+ + + G PYGYHN +F WIDT  ++ P  +D + + SV S+  +  
Sbjct  358  EIRAKFNNKAASEWFKKVEGLPYGYHNFLFGWIDTEKESLPAILDINFLYSVFSLLEKFL  417

Query  514  PTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCV  335
            P        EALN+RL T+ L+L EI     +R +T  QL ++PEQD W+YSDG+S  C 
Sbjct  418  PKLVNTFLGEALNQRLKTKDLNLGEIYTVMSQRNITLSQLFSMPEQDSWIYSDGQSMVCS  477

Query  334  AFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQIV  155
            +F+ A++K  G+F +L   I  TEFT RD Y    ++ N  + P+ C   ND LP+CQI+
Sbjct  478  SFVAAVWKAGGIFENL--EINATEFTPRDIYQTNFFDLNYKK-PAKC--LNDGLPYCQIM  532

Query  154  GEYRMELP--GYNTLEPYANMNENCPSLPPSYERPIHC  47
            G+++M++   GY+T++PY++MNE CPS+PP Y R   C
Sbjct  533  GKFKMDITSDGYSTIDPYSHMNEKCPSVPPLYSRTKGC  570



>ref|XP_002878755.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55014.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=114

 Score =   183 bits (465),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -1

Query  478  NKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGV  299
            NKRLGTE L+L  IL ET RRG++FD+LLTIPEQDEWVYSDGKST+CVAFILAMYK +GV
Sbjct  1    NKRLGTEDLNLCGILEETARRGISFDELLTIPEQDEWVYSDGKSTSCVAFILAMYKAAGV  60

Query  298  FGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRME  137
            FG LA  IQV EFTIRDAY  K++E+NQTRLPSWCN+  +KL FC I+GEYRME
Sbjct  61   FGPLANHIQVIEFTIRDAYTPKLFESNQTRLPSWCNTEEEKLDFCHILGEYRME  114



>gb|KCW67111.1| hypothetical protein EUGRSUZ_F00891 [Eucalyptus grandis]
Length=126

 Score =   182 bits (463),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 100/125 (80%), Gaps = 1/125 (1%)
 Frame = -1

Query  418  RGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYM  239
            RG +F +LLTIP+QD+WVYSDG S +CVAF+L MYK +G+F  ++ SIQVTEFTI+DAY 
Sbjct  2    RGSSFAELLTIPQQDDWVYSDGNSASCVAFVLEMYKATGLFDPISGSIQVTEFTIKDAYS  61

Query  238  LKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYE  62
            LK ++NN  RLP  CN G+D +LPFCQI G YRMELPGYNT++PY +MNE CP+LPP Y 
Sbjct  62   LKFFKNNSRRLPKLCNDGDDAELPFCQIRGRYRMELPGYNTMDPYPHMNERCPTLPPKYS  121

Query  61   RPIHC  47
            RP  C
Sbjct  122  RPSDC  126



>ref|XP_010064375.1| PREDICTED: uncharacterized protein LOC104451414 [Eucalyptus grandis]
Length=133

 Score =   181 bits (460),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 101/125 (81%), Gaps = 1/125 (1%)
 Frame = -1

Query  418  RGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYM  239
            RG +F +LLTIPEQD+WVYSDG+S +CVAF+L +YK + +F  ++ SIQVTEFTI+DAY 
Sbjct  2    RGSSFAELLTIPEQDDWVYSDGRSASCVAFVLEIYKAARLFDPISRSIQVTEFTIKDAYS  61

Query  238  LKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYE  62
            L+ +ENN +RLP WCN G+D +  FCQI G YRMELPGYNT++PY +MNE CPSLPP Y 
Sbjct  62   LRFFENNSSRLPKWCNDGDDVEFLFCQIRGRYRMELPGYNTMDPYPHMNEMCPSLPPKYS  121

Query  61   RPIHC  47
            RP +C
Sbjct  122  RPSNC  126



>emb|CDW81161.1| UNKNOWN [Stylonychia lemnae]
Length=581

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/220 (43%), Positives = 133/220 (60%), Gaps = 8/220 (4%)
 Frame = -1

Query  694  EVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRMQ  515
            E RA+FN TAA E+     G PYGYHN +F WIDT  DN PP +   LV  V S+  +  
Sbjct  366  EARAKFNETAAREFFNQTEGLPYGYHNFLFGWIDTPEDNLPPIIPPGLVPVVFSVLEKFT  425

Query  514  PTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYS----DGKS  347
            P+     +N+ALN RL T GL++  I AE  +R LT +QL+   E + W Y+    DG++
Sbjct  426  PSTVDIFFNQALNHRLNTTGLNIEGIAAEAAQRNLTVEQLMAQVEVEGWNYTGLQNDGRA  485

Query  346  TTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPF  167
              C A++ A+Y+ +G+F      I   EFT RD Y L +Y+ N  R P  C   +  LP+
Sbjct  486  YVCSAYVAALYQAAGLFPG---KINGPEFTPRDVYTLNVYDLNYNR-PDACVKADPTLPY  541

Query  166  CQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            CQ++G+YRM LPGY+T+ PYA+M+E CP++ P + RP  C
Sbjct  542  CQLLGKYRMTLPGYSTISPYAHMSEKCPTIAPDFVRPDKC  581



>gb|EJY77500.1| hypothetical protein OXYTRI_00869 [Oxytricha trifallax]
Length=566

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/221 (43%), Positives = 135/221 (61%), Gaps = 7/221 (3%)
 Frame = -1

Query  694  EVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRMQ  515
            E R +FN TAA E+       PYGYHN +F+W+DT SDN PP +   ++ +V S++  + 
Sbjct  348  EARQQFNETAAREFFFFTENLPYGYHNFLFAWLDTPSDNNPPVLPPGILSNVFSIFETVM  407

Query  514  PTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYS-----DGK  350
            P  A    N+ALNKRLGT GL++ EI  E   R LT D ++ +PE + W Y      DG+
Sbjct  408  PEVADIFMNQALNKRLGTHGLNMAEIANEAALRNLTVDDVIAMPEIEGWEYEGIKPRDGR  467

Query  349  STTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLP  170
            S  C  ++ A+YK +G+FG++  S    E T +D Y+LKIY++   +    C   +   P
Sbjct  468  SYVCSTYLTAVYKAAGLFGNM--SFNPGEQTPKDLYLLKIYDDKPDQRNKECLKYDPGQP  525

Query  169  FCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            +CQ++G+YRM+ PGYNT+ PY NMNE CPS+ P YER   C
Sbjct  526  YCQLLGKYRMKFPGYNTIVPYPNMNERCPSIAPEYERTDGC  566



>gb|KDO82634.1| hypothetical protein CISIN_1g0101752mg, partial [Citrus sinensis]
Length=123

 Score =   175 bits (443),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 98/123 (80%), Gaps = 5/123 (4%)
 Frame = -1

Query  550  VISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDE  371
            V+SVMSMWTR+QP YAANMWNEALNKRLGTE LDL+ IL E E+RG++FDQLLTIPEQDE
Sbjct  1    VVSVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLHGILDEIEKRGISFDQLLTIPEQDE  60

Query  370  WVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAY-----MLKIYENNQTRL  206
            WVYSDGKSTTCVAFIL MYKE+GVFG ++ SIQVTEFT+           +I  +N   +
Sbjct  61   WVYSDGKSTTCVAFILEMYKEAGVFGPISNSIQVTEFTVSIKLFGLLCFTQIASSNSLHI  120

Query  205  PSW  197
             SW
Sbjct  121  FSW  123



>ref|XP_002872148.1| hypothetical protein ARALYDRAFT_351537 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48407.1| hypothetical protein ARALYDRAFT_351537 [Arabidopsis lyrata subsp. 
lyrata]
Length=146

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -1

Query  463  TEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLA  284
             + L+L  IL E  RRG++FD+LLTIPEQDEWVYSDGKST CVAFILAMYK +GVFG LA
Sbjct  33   VQDLNLCGILEEIARRGMSFDELLTIPEQDEWVYSDGKSTACVAFILAMYKAAGVFGPLA  92

Query  283  ESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  134
              IQVTEFTIRDAY  K++E+NQTRLPSWCN+  +KL FCQI+GEYRMEL
Sbjct  93   NHIQVTEFTIRDAYTPKLFESNQTRLPSWCNTEEEKLDFCQILGEYRMEL  142



>ref|XP_001031695.1| hypothetical protein TTHERM_00760790 [Tetrahymena thermophila]
 gb|EAR84032.1| hypothetical protein TTHERM_00760790 [Tetrahymena thermophila 
SB210]
Length=570

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/218 (42%), Positives = 134/218 (61%), Gaps = 7/218 (3%)
 Frame = -1

Query  694  EVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRMQ  515
            E+R +FN+TAA E+   + G PYGYHN +F WIDT + N P  +D + V SV+++  +  
Sbjct  358  EIRQKFNNTAALEWFETVEGVPYGYHNFLFGWIDTENKNLPAVLDINFVYSVLTLIEKFI  417

Query  514  PTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCV  335
            P    ++  EA+NKRLGTE L+L ++     +R LT  ++  IPEQD W+YSDG S  C 
Sbjct  418  PAVPKSLVGEAMNKRLGTENLNLVQLYEVMFQRNLTVAEVFAIPEQDSWIYSDGPSMVCS  477

Query  334  AFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQIV  155
            +F+ A++K  G+F  L   I  TEFT RD Y    ++    + P  C    D LP+CQI+
Sbjct  478  SFVAAIWKAGGLFDGL--EINATEFTPRDVYQTNFFDKKYKK-PEKCLK--DGLPYCQIM  532

Query  154  GEYRMELP--GYNTLEPYANMNENCPSLPPSYERPIHC  47
            G++ M++   GY+++ PY+NM E+CPS PP + R   C
Sbjct  533  GKFVMDVATDGYSSINPYSNMFEHCPSQPPLFLRTKGC  570



>ref|XP_004346245.1| hypothetical protein CAOG_05572 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE95080.1| hypothetical protein CAOG_005572 [Capsaspora owczarzaki ATCC 
30864]
Length=582

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/225 (39%), Positives = 138/225 (61%), Gaps = 14/225 (6%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTR-  521
            PE RA+FN TAA  +V+ ++G  YG+ NM+F+W+DT   N P PVD H ++ ++S+    
Sbjct  351  PEKRAQFNETAAIAFVKSVVGNLYGFQNMLFTWLDTPDQNMPAPVDQHYLVVMLSLLDPI  410

Query  520  MQP----TYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYS--  359
            ++P     +  ++WN A N+RLGT      EI A      ++F QL+++PEQD W+Y+  
Sbjct  411  LEPLLVELHTPSLWNVAFNRRLGTAYTRCVEIFAHAAAHNVSFGQLISMPEQDWWIYAGH  470

Query  358  -----DGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWC  194
                 DG +  C  F+   YK  G+FG+L +SI   EFT  D Y L  ++     +P+ C
Sbjct  471  EPWYPDGIAMVCDVFVCYTYKAGGLFGNLTDSINCAEFTPLDVYELAWFDT--APIPAKC  528

Query  193  NSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYER  59
             + +    +CQI+G+YR++LP +NT++P+A+M ENCPS+PP  +R
Sbjct  529  QAADPGNKWCQILGKYRIQLPEFNTVQPFAHMRENCPSMPPYADR  573



>gb|EJY88389.1| hypothetical protein OXYTRI_16548 [Oxytricha trifallax]
Length=589

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 138/221 (62%), Gaps = 7/221 (3%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PE RA+FN TAA E+ R   G PYGYHN +F WIDT  DN+PP + +  +  V S+    
Sbjct  372  PESRAKFNETAAREFFRQTEGLPYGYHNFLFGWIDTPVDNWPPLLPSGFIPIVFSILEGF  431

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYS----DGK  350
             P+      N+ LNKRLGT GL+L +I AE   R LT + L++  E + W Y+    DGK
Sbjct  432  TPSTVDIFLNQGLNKRLGTSGLNLKQIAAEAATRNLTIEDLMSQVEVEGWEYTGLPNDGK  491

Query  349  STTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLP  170
            S  C A++ A+Y+ +G+FG+   +I   EFT +D Y L  ++ +  + P+ C   +   P
Sbjct  492  SYVCSAYVAAVYRAAGMFGNF--TINGPEFTPKDVYTLAFFDLDYKK-PAVCAQADPDQP  548

Query  169  FCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            FCQ +G+YRME PGY+T+ PY +M+E+CP++ P ++RP +C
Sbjct  549  FCQFLGKYRMEFPGYSTIVPYDHMDEHCPTIAPEFDRPANC  589



>emb|CDW80089.1| UNKNOWN [Stylonychia lemnae]
Length=582

 Score =   179 bits (454),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 95/221 (43%), Positives = 132/221 (60%), Gaps = 7/221 (3%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PE RA+FN TAA E+     G PYGYHN +F W+DT  DN+PP + +H +  V S+    
Sbjct  365  PEARAKFNETAAREFFNQTEGLPYGYHNFLFGWVDTPVDNWPPLLPSHFINIVFSILEGF  424

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYS----DGK  350
             P+      N+ALN RL T GL+L ++ AE   R LT + L++  E + W Y+    DG+
Sbjct  425  TPSTVDIFLNQALNHRLNTTGLNLKQVAAEAANRNLTVEDLMSQVEVEGWTYTGLQNDGR  484

Query  349  STTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLP  170
            S  C A++ A+YK +G+FG     I   EFT RD Y L  ++ N  + P  C   +   P
Sbjct  485  SYVCSAYVAAVYKAAGLFGDF--HINGPEFTPRDVYTLNFFDLNYKK-PESCQQVDPSQP  541

Query  169  FCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            FCQI+G+YRM LPGY+T+ PY +M+E CPS+ P + RP  C
Sbjct  542  FCQILGKYRMTLPGYSTITPYEHMDEKCPSIAPDFVRPDGC  582



>gb|EAR84506.2| hypothetical protein TTHERM_00655340 [Tetrahymena thermophila 
SB210]
Length=570

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/218 (40%), Positives = 134/218 (61%), Gaps = 7/218 (3%)
 Frame = -1

Query  694  EVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRMQ  515
            E R +FN+TAA EY   + G PYGY   ++ W+DT + + P  +D + V S +++  +  
Sbjct  358  ENRKKFNNTAAVEYFLNLEGTPYGYSTFLYGWVDTENKSLPAILDVNFVYSALTLVEKFY  417

Query  514  PTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCV  335
            P+   ++ NE LN RLGT+ L+L ++     ++ LT  ++  IPEQD W+YS G S  C 
Sbjct  418  PSIPKSIINEGLNHRLGTQDLNLVQLYEVMYQKNLTIAEVFAIPEQDSWLYSYGHSLVCS  477

Query  334  AFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQIV  155
            AF+  +++  G+FG L   I V+EFT RD Y +K ++ N  + P  C+   D LP+CQI+
Sbjct  478  AFVAGVWRAGGLFGDL--QINVSEFTPRDVYQMKFFDKNFKK-PEKCHK--DGLPYCQIM  532

Query  154  GEYRMEL--PGYNTLEPYANMNENCPSLPPSYERPIHC  47
            G++ M++   GYN++ PY +MNE+CPS PP Y R   C
Sbjct  533  GKFVMDVITDGYNSITPYEHMNEHCPSQPPFYLRTQGC  570



>ref|XP_001032169.1| hypothetical protein TTHERM_00655340 [Tetrahymena thermophila]
Length=583

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/218 (40%), Positives = 134/218 (61%), Gaps = 7/218 (3%)
 Frame = -1

Query  694  EVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRMQ  515
            E R +FN+TAA EY   + G PYGY   ++ W+DT + + P  +D + V S +++  +  
Sbjct  371  ENRKKFNNTAAVEYFLNLEGTPYGYSTFLYGWVDTENKSLPAILDVNFVYSALTLVEKFY  430

Query  514  PTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCV  335
            P+   ++ NE LN RLGT+ L+L ++     ++ LT  ++  IPEQD W+YS G S  C 
Sbjct  431  PSIPKSIINEGLNHRLGTQDLNLVQLYEVMYQKNLTIAEVFAIPEQDSWLYSYGHSLVCS  490

Query  334  AFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQIV  155
            AF+  +++  G+FG L   I V+EFT RD Y +K ++ N  + P  C+   D LP+CQI+
Sbjct  491  AFVAGVWRAGGLFGDL--QINVSEFTPRDVYQMKFFDKNFKK-PEKCHK--DGLPYCQIM  545

Query  154  GEYRMEL--PGYNTLEPYANMNENCPSLPPSYERPIHC  47
            G++ M++   GYN++ PY +MNE+CPS PP Y R   C
Sbjct  546  GKFVMDVITDGYNSITPYEHMNEHCPSQPPFYLRTQGC  583



>emb|CDW76296.1| UNKNOWN [Stylonychia lemnae]
Length=589

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 87/220 (40%), Positives = 124/220 (56%), Gaps = 7/220 (3%)
 Frame = -1

Query  691  VRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRMQP  512
             R+ FN+T A E+     G  YG+HN +F+W+DT +DN PP +   ++ +  S+   + P
Sbjct  372  ARSMFNNTKAQEFFNQTEGIAYGFHNFLFAWLDTPNDNNPPVLPPGMLANTFSLVETISP  431

Query  511  TYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVY-----SDGKS  347
                   N+ALNKRLGT+GL L +I  E  +R LT D ++ +PE D W Y      DG+S
Sbjct  432  EVVDIFMNQALNKRLGTKGLTLSQISVEAAKRNLTLDDVIAMPELDGWEYEGLEPKDGRS  491

Query  346  TTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPF  167
              C  ++ A+ K +GVFG +       E T RD Y L I+E   T     C       P+
Sbjct  492  YVCSTYVTAVMKAAGVFGDMI--FNPGEQTPRDMYQLTIFETTSTWRSKKCQETEPNTPW  549

Query  166  CQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYERPIHC  47
            CQI+G Y+M  PG++T++PY +MNE CPS+ P YER   C
Sbjct  550  CQILGAYKMSFPGFSTVKPYPHMNERCPSIAPKYERTEGC  589



>ref|XP_008245164.1| PREDICTED: uncharacterized protein LOC103343273 [Prunus mume]
Length=365

 Score =   170 bits (430),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 88/111 (79%), Gaps = 3/111 (3%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PE+RA  NS  AWEY + M GKPYGYHNM+FSWIDT++DNYPP +D HLV+S   M T  
Sbjct  240  PELRANLNSMEAWEYAQSMSGKPYGYHNMMFSWIDTMADNYPPRLDTHLVVS---MRTST  296

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWV  365
            QP Y+ANMWNEALNKRLG EGLDLYEIL E E R + FD LLTIPEQDEWV
Sbjct  297  QPAYSANMWNEALNKRLGKEGLDLYEILIEIENREIAFDNLLTIPEQDEWV  347



>ref|XP_001749148.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ85954.1| predicted protein [Monosiga brevicollis MX1]
Length=543

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 89/218 (41%), Positives = 125/218 (57%), Gaps = 6/218 (3%)
 Frame = -1

Query  694  EVRARFNSTAAWEYVRGML-GKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            E RA+FN+T A E+   +  G PYGY NM+F+WIDT   NYP  +D+HL   ++     +
Sbjct  330  EYRAKFNNTKATEWFLNVAEGLPYGYANMLFTWIDTPEANYPGTLDSHLHELLIGFANAI  389

Query  517  QPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTC  338
                +  +W+ ALNKRL T  +    +L     R ++F +L+ +PEQDEW Y DG +  C
Sbjct  390  SYELSGLLWDRALNKRLNTVNMTTVPLLNLAHSRNISFTELMEMPEQDEWQYDDGYNMVC  449

Query  337  VAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQI  158
               +   +K  G+FG L    Q TEFT  D Y L I+  N T  P++C   +  LPFCQI
Sbjct  450  DVLVCEAWKAGGLFGDL--DFQCTEFTNWDDYTLAIF--NTTAPPAYCQQIDPGLPFCQI  505

Query  157  VGEYRMELPGYNTLEPYANMNENCP-SLPPSYERPIHC  47
            +G+YRM LP YN+    A+M E CP   PP +++P  C
Sbjct  506  LGDYRMSLPTYNSRPMVAHMAERCPRGTPPDFDKPAGC  543



>gb|AGW24477.1| chloroplast 20 kDa chaperonin, partial [Avicennia marina var. 
marina]
Length=84

 Score =   155 bits (393),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -1

Query  697  PEVRARFNSTAAWEYVRGMLGKPYGYHNMIFSWIDTISDNYPPPVDAHLVISVMSMWTRM  518
            PE+R+RFN+TAAWEY R M GKPYGYHNMIFSWIDT++DNYPPP+DAHLVISVMSMWTRM
Sbjct  5    PEIRSRFNNTAAWEYARQMAGKPYGYHNMIFSWIDTVADNYPPPLDAHLVISVMSMWTRM  64

Query  517  QPTYAANMWNEALNKRLGTE  458
            QP YAANMWNEALN RLGTE
Sbjct  65   QPAYAANMWNEALNMRLGTE  84



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1185322056160