BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF033N18

Length=504
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008464378.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      241   2e-77   Cucumis melo [Oriental melon]
ref|XP_004138029.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    241   2e-77   Cucumis sativus [cucumbers]
gb|KDP22561.1|  hypothetical protein JCGZ_26392                         240   4e-77   Jatropha curcas
ref|XP_009615553.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      239   7e-77   Nicotiana tomentosiformis
ref|XP_011083414.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    239   7e-77   Sesamum indicum [beniseed]
ref|XP_011073121.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    238   2e-76   Sesamum indicum [beniseed]
gb|ABB87105.1|  ubiquitin conjugating enzyme-like                       238   4e-76   Solanum tuberosum [potatoes]
ref|NP_001275389.1|  ubiquitin-conjugating enzyme E2 27-like            237   4e-76   Solanum tuberosum [potatoes]
ref|NP_001233964.1|  ubiquitin conjugating enzyme                       237   4e-76   Solanum lycopersicum
gb|EYU32921.1|  hypothetical protein MIMGU_mgv1a014267mg                236   1e-75   Erythranthe guttata [common monkey flower]
gb|KJB50908.1|  hypothetical protein B456_008G209500                    235   2e-75   Gossypium raimondii
ref|XP_008364577.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    235   4e-75   Malus domestica [apple tree]
ref|XP_011042936.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      234   6e-75   Populus euphratica
ref|XP_011073120.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    235   7e-75   Sesamum indicum [beniseed]
ref|XP_011002115.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    233   1e-74   Populus euphratica
ref|XP_010678313.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      233   1e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006436915.1|  hypothetical protein CICLE_v10032815mg             233   2e-74   Citrus clementina [clementine]
ref|XP_002511117.1|  ubiquitin-conjugating enzyme E2-25kD, putative     233   2e-74   Ricinus communis
ref|XP_002318760.1|  ubiquitin-conjugating enzyme family protein        233   2e-74   Populus trichocarpa [western balsam poplar]
gb|KJB50909.1|  hypothetical protein B456_008G209500                    233   3e-74   Gossypium raimondii
gb|ABK92892.1|  unknown                                                 233   4e-74   Populus trichocarpa [western balsam poplar]
ref|XP_009337530.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      232   4e-74   Pyrus x bretschneideri [bai li]
ref|XP_008239533.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      232   4e-74   Prunus mume [ume]
ref|XP_007038089.1|  Ubiquitin-conjugating enzyme 27                    230   2e-73   Theobroma cacao [chocolate]
ref|XP_010093942.1|  Ubiquitin-conjugating enzyme E2 27                 230   3e-73   Morus notabilis
ref|XP_007209522.1|  hypothetical protein PRUPE_ppa010579mg             231   5e-73   
ref|XP_004297507.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      229   1e-72   Fragaria vesca subsp. vesca
ref|XP_010037360.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      229   1e-72   Eucalyptus grandis [rose gum]
ref|XP_008392720.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      228   2e-72   
gb|KHN31276.1|  Ubiquitin-conjugating enzyme E2 27                      227   5e-72   Glycine soja [wild soybean]
gb|AFK44991.1|  unknown                                                 226   1e-71   Lotus japonicus
ref|XP_003602764.1|  Ubiquitin carrier protein                          225   2e-71   
ref|XP_003602765.1|  Ubiquitin carrier protein                          225   4e-71   
gb|KHN23957.1|  Ubiquitin-conjugating enzyme E2 27                      224   5e-71   Glycine soja [wild soybean]
emb|CBI15730.3|  unnamed protein product                                222   1e-70   Vitis vinifera
ref|XP_004501731.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    223   1e-70   Cicer arietinum [garbanzo]
ref|XP_002284366.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      223   1e-70   Vitis vinifera
ref|XP_007137877.1|  hypothetical protein PHAVU_009G163400g             222   3e-70   Phaseolus vulgaris [French bean]
ref|XP_010555576.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      219   8e-69   Tarenaya hassleriana [spider flower]
gb|KHG10228.1|  Ubiquitin-conjugating enzyme E2 27 -like protein        216   2e-67   Gossypium arboreum [tree cotton]
ref|XP_002322290.2|  ubiquitin-conjugating enzyme family protein        214   3e-67   
ref|XP_006282380.1|  hypothetical protein CARUB_v10028678mg             214   5e-67   Capsella rubella
ref|NP_199900.1|  ubiquitin-conjugating enzyme E2 27                    213   9e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865827.1|  ubiquitin-conjugating enzyme 26                    212   3e-66   Arabidopsis lyrata subsp. lyrata
ref|XP_010250584.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      213   4e-66   Nelumbo nucifera [Indian lotus]
gb|KFK26715.1|  hypothetical protein AALP_AA8G283800                    212   5e-66   Arabis alpina [alpine rockcress]
ref|XP_010442437.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      211   1e-65   Camelina sativa [gold-of-pleasure]
ref|XP_006402053.1|  hypothetical protein EUTSA_v10014747mg             209   6e-65   Eutrema salsugineum [saltwater cress]
ref|XP_009132686.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      207   2e-64   Brassica rapa
ref|XP_009385499.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    207   3e-64   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY45812.1|  BnaC03g16350D                                          206   9e-64   Brassica napus [oilseed rape]
ref|NP_001190508.1|  ubiquitin-conjugating enzyme E2 27                 205   3e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010908214.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    203   1e-62   Elaeis guineensis
emb|CDO98671.1|  unnamed protein product                                202   2e-62   Coffea canephora [robusta coffee]
ref|NP_001150323.1|  ubiquitin-conjugating enzyme E2-22 kDa             201   1e-61   Zea mays [maize]
gb|AGY80454.1|  ubiquitin-conjugating enzyme                            200   2e-61   Dendrocalamus latiflorus [sweet bamboo]
ref|NP_001045259.1|  Os01g0925800                                       199   3e-61   
ref|XP_002459014.1|  hypothetical protein SORBIDRAFT_03g044480          199   3e-61   Sorghum bicolor [broomcorn]
ref|XP_006645263.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    199   3e-61   Oryza brachyantha
ref|XP_004971132.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    199   4e-61   Setaria italica
ref|XP_008801125.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      197   2e-60   Phoenix dactylifera
gb|ABK21242.1|  unknown                                                 197   2e-60   Picea sitchensis
ref|XP_003564977.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      197   3e-60   Brachypodium distachyon [annual false brome]
emb|CDM85817.1|  unnamed protein product                                197   3e-60   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006844560.1|  hypothetical protein AMTR_s00016p00186510          195   1e-59   Amborella trichopoda
ref|XP_010908213.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    192   6e-58   Elaeis guineensis
ref|XP_001755212.1|  predicted protein                                  190   1e-57   
gb|EMT06415.1|  Ubiquitin carrier protein E2 27                         182   5e-54   
ref|XP_006374566.1|  hypothetical protein POPTR_0015s11460g             178   1e-53   
ref|XP_002991561.1|  ubiquitin-conjugating enzyme 27, E2                177   1e-52   Selaginella moellendorffii
ref|XP_009032291.1|  hypothetical protein AURANDRAFT_69594              173   6e-51   Aureococcus anophagefferens
ref|XP_002971734.1|  ubiquitin-conjugating enzyme 27, E2                173   8e-51   
ref|XP_002906044.1|  ubiquitin-conjugating enzyme E2, putative          173   8e-51   Phytophthora infestans T30-4
ref|XP_008900048.1|  hypothetical protein, variant                      172   1e-50   Phytophthora parasitica INRA-310
gb|ETP52116.1|  hypothetical protein, variant                           172   1e-50   Phytophthora parasitica P10297
gb|ETO83061.1|  hypothetical protein, variant                           172   1e-50   Phytophthora parasitica P1976
ref|XP_008900047.1|  hypothetical protein PPTG_07524                    172   2e-50   Phytophthora parasitica INRA-310
gb|ETP52115.1|  hypothetical protein F442_02826                         172   2e-50   Phytophthora parasitica P10297
gb|ETO83060.1|  hypothetical protein F444_02862                         172   2e-50   Phytophthora parasitica P1976
gb|ETI54309.1|  hypothetical protein F443_02851                         172   2e-50   Phytophthora parasitica P1569
emb|CCD28097.1|  ubiquitin-conjugating enzyme                           171   4e-50   Plasmopara viticola
ref|XP_001689734.1|  ubiquitin conjugating enzyme                       166   3e-48   Chlamydomonas reinhardtii
emb|CBJ30375.1|  ubiquitin-conjugating enzyme 1                         171   3e-48   Ectocarpus siliculosus
ref|XP_009533974.1|  hypothetical protein PHYSODRAFT_518543             166   5e-48   Phytophthora sojae
gb|EJY66901.1|  Ubiquitin-conjugating enzyme, putative                  164   1e-47   Oxytricha trifallax
ref|XP_004032164.1|  ubiquitin-conjugating enzyme family protein,...    164   2e-47   Ichthyophthirius multifiliis
ref|XP_009533884.1|  hypothetical protein PHYSODRAFT_518528             163   4e-47   Phytophthora sojae
ref|XP_002952512.1|  hypothetical protein VOLCADRAFT_62621              164   4e-47   Volvox carteri f. nagariensis
emb|CDW82190.1|  ubiquitin-conjugating enzyme e2 27-like                162   1e-46   Stylonychia lemnae
ref|XP_666164.1|  ubiquitin-conjugating enzyme                          160   1e-46   Cryptosporidium hominis TU502
ref|XP_009842907.1|  hypothetical protein H257_16240                    162   1e-46   Aphanomyces astaci
ref|XP_005827196.1|  hypothetical protein GUITHDRAFT_154189             160   4e-46   Guillardia theta CCMP2712
ref|XP_625630.1|  Ubc1p like ubiquitin-conjugating enzyme E2 fuse...    160   5e-46   Cryptosporidium parvum Iowa II
ref|XP_002112784.1|  hypothetical protein TRIADDRAFT_24883              160   6e-46   Trichoplax adhaerens
ref|XP_003056945.1|  predicted protein                                  160   8e-46   Micromonas pusilla CCMP1545
ref|XP_003079370.1|  putative ubiquitin conjugating enzyme (ISS)        158   1e-45   
emb|CEF98001.1|  Ubiquitin-conjugating enzyme, active site              159   1e-45   Ostreococcus tauri
ref|XP_001007905.3|  Ubiquitin-conjugating enzyme family protein        159   2e-45   
gb|EAR87660.4|  ubiquitin-conjugating enzyme                            159   2e-45   Tetrahymena thermophila SB210
ref|XP_002184246.1|  ubiquitin-conjugating enzyme 1                     159   2e-45   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_008862080.1|  hypothetical protein H310_00902                    157   8e-45   Aphanomyces invadans
ref|XP_008862082.1|  hypothetical protein H310_00904                    157   1e-44   Aphanomyces invadans
ref|XP_008885554.1|  ubiquitin-conjugating enzyme subfamily protein     156   4e-44   
ref|XP_009519397.1|  hypothetical protein PHYSODRAFT_261502             155   5e-44   Phytophthora sojae
emb|CCF74909.1|  unnamed protein product                                155   8e-44   
ref|XP_002368940.1|  ubiquitin-conjugating enzyme, putative             155   8e-44   
ref|XP_008604446.1|  ubiquitin-conjugating enzyme (huntingtin int...    154   9e-44   Saprolegnia diclina VS20
gb|KDO32440.1|  hypothetical protein SPRG_02917                         154   9e-44   Saprolegnia parasitica CBS 223.65
emb|CCA27209.1|  ubiquitinconjugating enzyme E2 putative                154   2e-43   Albugo laibachii Nc14
ref|XP_008814881.1|  ubiquitin-conjugating enzyme (huntingtin int...    154   2e-43   Plasmodium inui San Antonio 1
emb|CAP33756.2|  Protein CBR-UBC-21                                     154   3e-43   Caenorhabditis briggsae
ref|XP_007514447.1|  predicted protein                                  153   3e-43   Bathycoccus prasinos
emb|CCI11036.1|  unnamed protein product                                153   4e-43   Albugo candida
ref|XP_002295622.1|  ubiquitin-conjugating enzyme                       153   4e-43   Thalassiosira pseudonana CCMP1335
ref|XP_001417769.1|  predicted protein                                  153   4e-43   Ostreococcus lucimarinus CCE9901
ref|XP_002261329.1|  ubiquitin-conjugating enzyme                       153   5e-43   Plasmodium knowlesi strain H
ref|XP_001616347.1|  Ubiquitin-conjugating enzyme family protein        152   8e-43   Plasmodium vivax
ref|XP_001350274.1|  ubiquitin conjugating enzyme, putative             152   9e-43   Plasmodium falciparum 3D7
ref|XP_003884590.1|  putative ubiquitin-conjugating enzyme              155   1e-42   Neospora caninum Liverpool
gb|ETW28294.1|  hypothetical protein PFFCH_04202                        151   2e-42   Plasmodium falciparum FCH/4
gb|KDD72554.1|  ubiquitin-conjugating enzyme                            150   2e-42   Helicosporidium sp. ATCC 50920
ref|XP_002140906.1|  ubiquitin-conjugating enzyme family protein        151   2e-42   Cryptosporidium muris RN66
ref|XP_008624262.1|  ubiquitin-conjugating enzyme (huntingtin int...    150   4e-42   Plasmodium vinckei vinckei
gb|EUD73440.1|  ubiquitin-conjugating enzyme (huntingtin interact...    150   4e-42   Plasmodium vinckei petteri
emb|CDR14128.1|  ubiquitin-conjugating enzyme, putative                 150   5e-42   
ref|XP_004833222.1|  ubiquitin-conjugating enzyme family member p...    150   5e-42   Theileria equi strain WA
ref|XP_954044.1|  ubiquitin conjugating enzyme                          150   5e-42   Theileria annulata
ref|XP_004223168.1|  ubiquitin-conjugating enzyme family protein        150   6e-42   Plasmodium cynomolgi strain B
ref|XP_002168321.2|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    150   7e-42   Hydra vulgaris
gb|AAY52456.1|  ubiquitin conjugating enzyme E2                         149   8e-42   Caenorhabditis remanei
ref|XP_003100903.1|  CRE-UBC-20 protein                                 149   9e-42   Caenorhabditis remanei
ref|XP_004344504.1|  ubiquitin-conjugating enzyme                       150   1e-41   Capsaspora owczarzaki ATCC 30864
ref|XP_001610991.1|  ubiquitin-conjugating enzyme                       149   1e-41   Babesia bovis T2Bo
ref|XP_001631613.1|  predicted protein                                  149   1e-41   Nematostella vectensis
ref|XP_001458160.1|  hypothetical protein                               149   1e-41   Paramecium tetraurelia strain d4-2
ref|XP_006681813.1|  hypothetical protein BATDEDRAFT_91378              149   2e-41   Batrachochytrium dendrobatidis JAM81
ref|XP_009689532.1|  ubiquitin carrier protein                          149   2e-41   Theileria orientalis strain Shintoku
ref|XP_729393.1|  ubiquitin conjugating enzyme                          148   3e-41   Plasmodium yoelii
ref|XP_002640838.1|  C. briggsae CBR-UBC-20 protein                     148   4e-41   Caenorhabditis briggsae
gb|ETO33534.1|  Ubiquitin-conjugating enzyme family protein             147   5e-41   Reticulomyxa filosa
ref|XP_002502493.1|  predicted protein                                  147   5e-41   Micromonas commoda
pdb|2PWQ|A  Chain A, Crystal Structure Of A Putative Ubiquitin Co...    148   5e-41   Plasmodium yoelii
ref|XP_674871.1|  ubiquitin-conjugating enzyme                          147   6e-41   Plasmodium berghei ANKA
ref|XP_005651685.1|  hypothetical protein COCSUDRAFT_52084              147   7e-41   Coccomyxa subellipsoidea C-169
ref|XP_790028.2|  PREDICTED: ubiquitin-conjugating enzyme E2-22 k...    147   8e-41   Strongylocentrotus purpuratus [purple urchin]
ref|XP_005784046.1|  hypothetical protein EMIHUDRAFT_429671             147   9e-41   Emiliania huxleyi CCMP1516
gb|KJB40047.1|  hypothetical protein B456_007G044100                    145   2e-40   Gossypium raimondii
ref|NP_497174.1|  Protein UBC-20                                        145   3e-40   Caenorhabditis elegans [roundworm]
ref|NP_001155723.1|  ubiquitin-conjugating enzyme E2-25kD-like          145   4e-40   Acyrthosiphon pisum
ref|XP_001457111.1|  hypothetical protein                               145   4e-40   Paramecium tetraurelia strain d4-2
gb|ETO29102.1|  Ubiquitin-conjugating enzyme family protein             144   7e-40   Reticulomyxa filosa
ref|XP_002168516.2|  PREDICTED: uncharacterized protein LOC100209390    154   8e-40   Hydra vulgaris
gb|AGN29610.1|  ubiquitin-conjugating enzyme E2- 22kDa-like protein     144   1e-39   Acartia pacifica
emb|CDR94543.1|  ubiquitin-conjugating enzyme, putative                 144   1e-39   Babesia bigemina
gb|AET50656.1|  hypothetical protein                                    144   1e-39   Eimeria tenella
ref|NP_509502.3|  Protein UBC-21                                        144   1e-39   Caenorhabditis elegans [roundworm]
ref|XP_001454736.1|  hypothetical protein                               142   4e-39   Paramecium tetraurelia strain d4-2
gb|KFG62496.1|  ubiquitin-conjugating enzyme subfamily protein          144   5e-39   Toxoplasma gondii RUB
gb|EPT26736.1|  ubiquitin-conjugating enzyme subfamily protein          144   5e-39   Toxoplasma gondii ME49
gb|KFH00285.1|  ubiquitin-conjugating enzyme subfamily protein          143   5e-39   Toxoplasma gondii VAND
gb|EPR60341.1|  ubiquitin-conjugating enzyme subfamily protein          143   6e-39   Toxoplasma gondii GT1
ref|XP_003381856.1|  ubiquitin-conjugating enzyme E2 K                  142   6e-39   Trichinella spiralis
ref|XP_002645395.1|  C. briggsae CBR-UBC-21 protein                     143   8e-39   Caenorhabditis briggsae
gb|KGB38531.1|  Ubiquitin-conjugating enzyme E2 K                       141   1e-38   Schistosoma haematobium
emb|CAX69541.1|  huntingtin interacting protein 2                       141   1e-38   Schistosoma japonicum
ref|XP_003382495.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    141   1e-38   Amphimedon queenslandica
emb|CDJ83787.1|  Ubiquitin-conjugating enzyme and Ubiquitin-assoc...    141   1e-38   Haemonchus contortus [red stomach worm]
gb|KFD55719.1|  hypothetical protein M513_03467                         141   1e-38   Trichuris suis
emb|CDJ85762.1|  Ubiquitin-conjugating enzyme and Ubiquitin-assoc...    141   2e-38   Haemonchus contortus [red stomach worm]
emb|CDJ02906.1|  ubiquitin conjugating enzyme E2 25kD                   141   2e-38   
ref|XP_008470831.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    141   2e-38   
emb|CDS15360.1|  ubiquitin conjugating enzyme E2 25kD                   141   2e-38   Echinococcus granulosus
emb|CCD76999.1|  putative ubiquitin-conjugating enzyme E2-25kD          142   2e-38   Schistosoma mansoni
emb|CEF64077.1|  Ubiquitin-conjugating enzyme E2 K                      140   4e-38   Strongyloides ratti
gb|EUB65074.1|  Ubiquitin-conjugating enzyme                            141   5e-38   Echinococcus granulosus
gb|KIH61984.1|  ubiquitin--protein ligase                               140   6e-38   Ancylostoma duodenale
gb|EYC42200.1|  hypothetical protein Y032_0540g3169                     139   8e-38   Ancylostoma ceylanicum
gb|ETN72541.1|  ubiquitin--protein ligase                               140   2e-37   Necator americanus
ref|XP_002730471.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    138   2e-37   Saccoglossus kowalevskii
gb|EGT47890.1|  hypothetical protein CAEBREN_07248                      138   2e-37   Caenorhabditis brenneri
gb|ERG81184.1|  putative ubiquitin-conjugating enzyme e2 21             138   3e-37   
ref|XP_007413145.1|  hypothetical protein MELLADRAFT_37906              138   3e-37   Melampsora larici-populina 98AG31
gb|EST06461.1|  ubiquitin-protein ligase                                138   4e-37   Kalmanozyma brasiliensis GHG001
gb|ENN73582.1|  hypothetical protein YQE_09830                          137   4e-37   Dendroctonus ponderosae
gb|KFH62915.1|  ubiquitin-conjugating enzyme (huntingtin interact...    139   4e-37   Mortierella verticillata NRRL 6337
ref|XP_766253.1|  ubiquitin conjugating enzyme                          137   5e-37   Theileria parva strain Muguga
gb|EJW79559.1|  ubiquitin carrier protein                               137   5e-37   Wuchereria bancrofti [agent of lymphatic filariasis]
emb|CCF54274.1|  probable UBC1-E2 ubiquitin-conjugating enzyme          138   5e-37   Ustilago hordei
ref|XP_003146009.1|  hypothetical protein LOAG_10437                    137   7e-37   
ref|XP_001900771.1|  Ubiquitin-conjugating enzyme E2-25 kDa             137   8e-37   Brugia malayi [agent of lymphatic filariasis]
ref|XP_011386364.1|  putative E2 ubiquitin-conjugating protein UBC1     137   8e-37   Ustilago maydis 521
dbj|GAA48666.1|  ubiquitin-conjugating enzyme (huntingtin interac...    137   9e-37   Clonorchis sinensis [oriental liver fluke]
ref|XP_009166937.1|  hypothetical protein T265_04038                    137   9e-37   Opisthorchis viverrini [Southeast Asian liver fluke]
dbj|GAC93359.1|  hypothetical protein PHSY_000924                       137   1e-36   Pseudozyma hubeiensis SY62
gb|KHG15935.1|  Ubiquitin-conjugating enzyme E2 27 -like protein        135   1e-36   Gossypium arboreum [tree cotton]
gb|EJT45143.1|  ubiquitin-conjugating enzyme e2-24 kda                  137   1e-36   Trichosporon asahii var. asahii CBS 2479
emb|CDP99145.1|  Protein BM-UBC-20, isoform b                           137   2e-36   
ref|XP_011134132.1|  putative ubiquitin-conjugating enzyme E2           136   2e-36   Gregarina niphandrodes
gb|EGT47553.1|  CBN-UBC-21 protein                                      135   2e-36   Caenorhabditis brenneri
ref|XP_003093392.1|  CRE-UBC-21 protein                                 135   3e-36   Caenorhabditis remanei
ref|XP_009044903.1|  hypothetical protein LOTGIDRAFT_223907             135   3e-36   Lottia gigantea
emb|CDS30261.1|  exosome complex exonuclease RRP42                      135   4e-36   
dbj|GAK62134.1|  ubiquitin-conjugating enzyme e2-24 kda                 135   5e-36   Moesziomyces antarcticus
emb|CCG82392.1|  Ubiquitin-conjugating enzyme E2 1                      135   6e-36   Taphrina deformans PYCC 5710
ref|XP_971328.2|  PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa     134   6e-36   Tribolium castaneum [rust-red flour beetle]
dbj|GAC73762.1|  ubiquitin-protein ligase                               135   6e-36   Moesziomyces antarcticus T-34
emb|CBQ67936.1|  probable UBC1-E2 ubiquitin-conjugating enzyme          135   1e-35   Sporisorium reilianum SRZ2
emb|CDI51448.1|  probable UBC1-E2 ubiquitin-conjugating enzyme          135   1e-35   Melanopsichium pennsylvanicum 4
ref|NP_596239.1|  ubiquitin conjugating enzyme Ubc1 (predicted)         134   1e-35   Schizosaccharomyces pombe
ref|XP_011429616.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    133   2e-35   Crassostrea gigas
gb|KFB42674.1|  ubiquitin-conjugating enzyme E2-25kD                    133   2e-35   Anopheles sinensis
ref|XP_011202431.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    133   3e-35   Bactrocera dorsalis [papaya fruit fly]
ref|XP_002172199.2|  ubiquitin conjugating enzyme Ubc1                  133   4e-35   Schizosaccharomyces japonicus yFS275
ref|XP_011192700.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    132   4e-35   Zeugodacus cucurbitae [melon fruit fly]
dbj|GAA95025.1|  hypothetical protein E5Q_01680                         133   4e-35   Mixia osmundae IAM 14324
ref|XP_005183881.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    132   5e-35   Musca domestica
gb|AAW25929.1|  SJCHGC02302 protein                                     132   6e-35   Schistosoma japonicum
gb|ETN57965.1|  ubiquitin-conjugating enzyme E2-25kD                    132   6e-35   Anopheles darlingi [American malaria mosquito]
gb|ELU15540.1|  hypothetical protein CAPTEDRAFT_150271                  132   7e-35   Capitella teleta
ref|XP_011503723.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    132   8e-35   Ceratosolen solmsi marchali
ref|XP_007881930.1|  hypothetical protein PFL1_06200                    132   8e-35   Anthracocystis flocculosa PF-1
ref|XP_011503721.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    132   9e-35   Ceratosolen solmsi marchali
gb|KIO15436.1|  hypothetical protein M407DRAFT_98351                    132   1e-34   Tulasnella calospora MUT 4182
gb|EPY53947.1|  ubiquitin conjugating enzyme Ubc1                       131   1e-34   Schizosaccharomyces cryophilus OY26
gb|KHN88323.1|  putative ubiquitin-conjugating enzyme E2 21             132   1e-34   Toxocara canis
ref|XP_008211374.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    130   1e-34   
gb|KDQ26171.1|  hypothetical protein PLEOSDRAFT_52152                   131   2e-34   Pleurotus ostreatus PC15
ref|XP_003647259.1|  hypothetical protein Ecym_6038                     130   3e-34   Eremothecium cymbalariae DBVPG#7215
gb|EHJ79025.1|  ubiquitin conjugating enzyme 4                          130   3e-34   
emb|CDR38023.1|  CYFA0S01e20296g1_1                                     130   3e-34   Cyberlindnera fabianii
ref|XP_005109764.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    130   3e-34   Aplysia californica
ref|XP_007002050.1|  hypothetical protein TREMEDRAFT_70845              130   3e-34   Tremella mesenterica DSM 1558
ref|XP_001846293.1|  ubiquitin-conjugating enzyme E2-25kD               130   4e-34   Culex quinquefasciatus
ref|XP_003956037.1|  hypothetical protein KAFR_0B06060                  130   4e-34   Kazachstania africana CBS 2517
ref|XP_007867121.1|  hypothetical protein GLOTRDRAFT_139354             130   5e-34   Gloeophyllum trabeum ATCC 11539
gb|EPX72483.1|  ubiquitin conjugating enzyme Ubc1                       130   6e-34   Schizosaccharomyces octosporus yFS286
emb|CDF87720.1|  BN860_12904g1_1                                        130   6e-34   Zygosaccharomyces bailii CLIB 213
emb|CEP61078.1|  LALA0S02e06238g1_1                                     130   7e-34   Lachancea lanzarotensis
ref|XP_007354446.1|  hypothetical protein AURDEDRAFT_116792             129   7e-34   
ref|XP_007305100.1|  hypothetical protein STEHIDRAFT_98645              130   7e-34   Stereum hirsutum FP-91666 SS1
gb|EJT42692.1|  UBC1-like protein                                       129   7e-34   Saccharomyces kudriavzevii IFO 1802
ref|XP_001644260.1|  hypothetical protein Kpol_1030p10                  129   7e-34   Vanderwaltozyma polyspora DSM 70294
gb|ACO12956.1|  Ubiquitin-conjugating enzyme E2 K                       129   8e-34   Lepeophtheirus salmonis
ref|XP_002432367.1|  ubiquitin-conjugating enzyme E2-22 kDa, puta...    129   8e-34   Pediculus humanus corporis [human body lice]
ref|XP_003396260.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    129   8e-34   Bombus terrestris [large earth bumblebee]
ref|XP_009021235.1|  hypothetical protein HELRODRAFT_185754             129   9e-34   Helobdella robusta
ref|XP_004526147.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    129   1e-33   Ceratitis capitata [medfly]
ref|XP_003396259.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    129   1e-33   Bombus terrestris [large earth bumblebee]
ref|NP_984266.1|  ADR169Cp                                              129   1e-33   Eremothecium gossypii ATCC 10895
gb|EHN03099.1|  Ubc1p                                                   129   1e-33   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|KIJ45921.1|  hypothetical protein M422DRAFT_29567                    129   1e-33   Sphaerobolus stellatus SS14
gb|AGO12645.1|  AaceriADR169Cp                                          129   1e-33   Saccharomycetaceae sp. 'Ashbya aceri'
ref|XP_001347039.1|  Ubiquitin-conjugating enzyme                       129   1e-33   Paramecium tetraurelia strain d4-2
gb|KFM81518.1|  Ubiquitin-conjugating enzyme E2                         129   1e-33   Stegodyphus mimosarum
gb|KIY62972.1|  hypothetical protein CYLTODRAFT_494274                  129   1e-33   Cylindrobasidium torrendii FP15055 ss-10
ref|XP_001731568.1|  hypothetical protein MGL_0836                      128   1e-33   Malassezia globosa CBS 7966
ref|XP_002495821.1|  ZYRO0C03784p                                       129   1e-33   Zygosaccharomyces rouxii
ref|XP_003702104.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    128   1e-33   Megachile rotundata
ref|NP_001108475.1|  ubiquitin conjugating enzyme 4                     128   2e-33   Bombyx mori [silk moth]
ref|XP_009266709.1|  Ubiquitin-conjugating enzyme E2 1                  129   2e-33   Wallemia ichthyophaga EXF-994
ref|XP_007887315.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       128   2e-33   Callorhinchus milii [Australian ghost shark]
emb|CEL56875.1|  ubiquitin-conjugating enzyme (huntingtin interac...    129   2e-33   Rhizoctonia solani AG-1 IB
ref|XP_008549756.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    128   2e-33   Microplitis demolitor
ref|XP_001750086.1|  hypothetical protein                               129   2e-33   Monosiga brevicollis MX1
gb|KIK24253.1|  hypothetical protein PISMIDRAFT_98853                   128   2e-33   Pisolithus microcarpus 441
gb|KDR10179.1|  Ubiquitin-conjugating enzyme E2-22 kDa                  127   3e-33   Zootermopsis nevadensis
ref|XP_004182113.1|  hypothetical protein TBLA_0H03130                  128   3e-33   Tetrapisispora blattae CBS 6284
ref|NP_524010.2|  ubiquitin conjugating enzyme 4, isoform A             127   3e-33   Drosophila melanogaster
ref|XP_001972212.1|  GG15402                                            127   3e-33   Drosophila erecta
ref|NP_001242330.1|  uncharacterized protein LOC100808816               128   3e-33   
ref|XP_445717.1|  hypothetical protein                                  127   4e-33   [Candida] glabrata
emb|CBY38677.1|  unnamed protein product                                127   4e-33   Oikopleura dioica
ref|XP_001648569.1|  AAEL004152-PA                                      127   4e-33   Aedes aegypti
emb|CCK68151.1|  hypothetical protein KNAG_0A04810                      127   5e-33   Kazachstania naganishii CBS 8797
ref|XP_002029925.1|  GM25177                                            127   5e-33   Drosophila sechellia
ref|XP_003674773.1|  hypothetical protein NCAS_0B03150                  127   5e-33   Naumovozyma castellii CBS 4309
ref|XP_002084307.1|  GD14207                                            127   5e-33   
ref|XP_010748915.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       127   6e-33   Larimichthys crocea [croceine croaker]
ref|XP_001956333.1|  GF25155                                            127   6e-33   Drosophila ananassae
emb|CBY13128.1|  unnamed protein product                                127   6e-33   
emb|CAA63424.1|  ubiquitin conjugating enzyme                           127   6e-33   
ref|XP_007369389.1|  hypothetical protein DICSQDRAFT_149491             127   6e-33   
gb|KDQ51574.1|  hypothetical protein JAAARDRAFT_41035                   127   6e-33   
ref|XP_011314079.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    127   6e-33   
ref|XP_003332230.1|  ubiquitin-conjugating enzyme                       129   8e-33   
gb|KIK69992.1|  hypothetical protein GYMLUDRAFT_34400                   127   8e-33   
gb|KIM52727.1|  hypothetical protein SCLCIDRAFT_487418                  127   9e-33   
emb|CDW57227.1|  ubiquitin conjugating enzyme E2 K                      126   9e-33   
gb|KIK41357.1|  hypothetical protein CY34DRAFT_214237                   127   1e-32   
ref|XP_002055124.1|  GJ18969                                            126   1e-32   
pdb|2F4Z|A  Chain A, Toxoplasma Gondii Ubiquitin Conjugating Enzy...    125   1e-32   
ref|XP_002047266.1|  GJ12033                                            126   1e-32   
ref|XP_003687876.1|  hypothetical protein TPHA_0L00850                  126   1e-32   
gb|ABI98680.1|  ubiquitin-conjugating enzyme H1                         126   1e-32   
ref|XP_008044887.1|  hypothetical protein TRAVEDRAFT_175464             126   1e-32   
ref|XP_007851632.1|  ubiquitin-conjugating enzyme e2-24 kda             126   2e-32   
ref|XP_010776321.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       125   2e-32   
ref|XP_002007998.1|  GI13263                                            125   2e-32   
emb|CDO72271.1|  hypothetical protein BN946_scf184970.g123              126   2e-32   
ref|XP_001353067.1|  GA20954                                            125   2e-32   
ref|XP_001984204.1|  GH16318                                            125   2e-32   
ref|XP_001840841.2|  ubiquitin-conjugating enzyme e2-24 kDa             125   2e-32   
ref|XP_002551787.1|  KLTH0A07546p                                       126   2e-32   
ref|XP_006001551.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    125   2e-32   
ref|XP_002062492.1|  GK16629                                            125   2e-32   
ref|XP_006958301.1|  ubiquitin-conjugating enzyme e2-24 kda             125   2e-32   
gb|EMD39899.1|  hypothetical protein CERSUDRAFT_112150                  126   2e-32   
ref|XP_010746956.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       125   2e-32   
gb|EWC74387.1|  hypothetical protein C923_04935                         124   2e-32   
gb|EJU02948.1|  hypothetical protein DACRYDRAFT_94114                   126   2e-32   
gb|KIP07933.1|  hypothetical protein PHLGIDRAFT_105092                  125   3e-32   
gb|EGA75460.1|  Ubc1p                                                   124   3e-32   
ref|XP_004990689.1|  ubiquitin-conjugating enzyme E2-25kD               125   3e-32   
ref|XP_006001552.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    125   3e-32   
gb|KIJ61091.1|  hypothetical protein HYDPIDRAFT_159944                  125   3e-32   
ref|XP_011267901.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    124   3e-32   
gb|KDQ08360.1|  hypothetical protein BOTBODRAFT_139070                  125   3e-32   
ref|XP_003667517.1|  hypothetical protein NDAI_0A01160                  125   3e-32   
gb|EUC63156.1|  UBC1-E2 ubiquitin-conjugating enzyme, putative          125   3e-32   
ref|XP_011350734.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    125   4e-32   
ref|XP_011267900.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    125   4e-32   
ref|XP_011138522.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    125   4e-32   
ref|XP_007271211.1|  hypothetical protein FOMMEDRAFT_23645              125   4e-32   
ref|XP_008410982.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       125   4e-32   
pdb|1FXT|A  Chain A, Structure Of A Conjugating Enzyme-Ubiquitin ...    123   4e-32   
ref|XP_569863.1|  ubiquitin-conjugating enzyme e2-24 kda                125   4e-32   
ref|XP_001383781.2|  hypothetical protein PICST_71285                   125   4e-32   
ref|XP_011053792.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    124   5e-32   
ref|NP_001270748.1|  uncharacterized protein LOC101865827               124   5e-32   
ref|XP_003444801.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    124   5e-32   
ref|XP_006457662.1|  hypothetical protein AGABI2DRAFT_189108            125   5e-32   
gb|EFX77049.1|  hypothetical protein DAPPUDRAFT_305966                  124   5e-32   
gb|KIK93632.1|  hypothetical protein PAXRUDRAFT_502682                  125   5e-32   
ref|XP_008470835.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    124   5e-32   
gb|EAW92949.1|  huntingtin interacting protein 2, isoform CRA_c         123   5e-32   
ref|XP_008315128.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       124   5e-32   
ref|XP_003972207.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    124   5e-32   
ref|NP_001008611.1|  ubiquitin-conjugating enzyme E2 K                  124   5e-32   
ref|XP_009546801.1|  hypothetical protein HETIRDRAFT_434426             125   5e-32   
ref|XP_011104862.1|  ubc1p                                              125   6e-32   
ref|XP_003682521.1|  hypothetical protein TDEL_0F04990                  125   6e-32   
ref|XP_010128803.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   6e-32   
gb|AHY75163.1|  Ubc1p                                                   124   7e-32   
gb|EGA87482.1|  Ubc1p                                                   123   7e-32   
gb|EGA79378.1|  Ubc1p                                                   124   7e-32   
ref|XP_003452184.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    124   7e-32   
gb|AJP37891.1|  Ubc1p                                                   124   7e-32   
gb|KFP39311.1|  Ubiquitin-conjugating enzyme E2 K                       122   8e-32   
ref|NP_001236348.1|  uncharacterized protein LOC100527458               125   8e-32   
ref|NP_010462.3|  E2 ubiquitin-conjugating protein UBC1                 124   8e-32   
ref|XP_008418441.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    123   8e-32   
gb|EGA83452.1|  Ubc1p                                                   124   9e-32   
gb|KIN97703.1|  hypothetical protein M404DRAFT_1005878                  124   1e-31   
gb|KIR48771.1|  ubiquitin-conjugating enzyme (huntingtin interact...    124   1e-31   
ref|XP_006629985.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    124   1e-31   
ref|XP_003193038.1|  ubiquitin-conjugating enzyme e2-24 kDa             124   1e-31   
gb|ACI68198.1|  Ubiquitin-conjugating enzyme E2 K                       123   1e-31   
emb|CCA76039.1|  probable UBC1-E2 ubiquitin-conjugating enzyme          124   1e-31   
gb|KIR56151.1|  ubiquitin-conjugating enzyme (huntingtin interact...    124   1e-31   
gb|ETB60979.1|  hypothetical protein YYC_01935                          122   1e-31   
ref|NP_001005662.1|  ubiquitin-conjugating enzyme E2 K                  123   1e-31   
ref|XP_007768847.1|  hypothetical protein CONPUDRAFT_165646             124   1e-31   
ref|XP_007319170.1|  hypothetical protein SERLADRAFT_469290             124   1e-31   
pdb|1TTE|A  Chain A, The Structure Of A Class Ii Ubiquitin-Conjug...    124   2e-31   
ref|XP_010895757.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    123   2e-31   
ref|NP_001080290.1|  ubiquitin-conjugating enzyme E2K                   123   2e-31   
ref|XP_004065792.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       123   2e-31   
emb|CDQ72603.1|  unnamed protein product                                123   2e-31   
gb|EDK39920.2|  hypothetical protein PGUG_04018                         124   2e-31   
gb|EFB17885.1|  hypothetical protein PANDA_014661                       122   2e-31   
ref|XP_010895758.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    123   2e-31   
gb|EOA93367.1|  Ubiquitin-conjugating enzyme E2 K                       122   2e-31   
ref|XP_005795343.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    123   2e-31   
ref|XP_005435424.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       123   2e-31   
ref|XP_001483289.1|  hypothetical protein PGUG_04018                    123   2e-31   
ref|XP_009671685.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   2e-31   
ref|XP_007379770.1|  hypothetical protein PUNSTDRAFT_81407              123   2e-31   
ref|XP_010296560.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   2e-31   
ref|XP_009572464.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   2e-31   
ref|XP_008015792.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    122   2e-31   
ref|XP_008943746.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   2e-31   
ref|XP_006029301.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   2e-31   
gb|EPS95550.1|  hypothetical protein FOMPIDRAFT_1025740                 123   2e-31   
gb|KFQ28599.1|  Ubiquitin-conjugating enzyme E2 K                       122   2e-31   
ref|XP_009278419.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    122   2e-31   
gb|KFV12100.1|  Ubiquitin-conjugating enzyme E2 K                       122   2e-31   
ref|XP_008168193.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    122   2e-31   
ref|XP_009460100.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   2e-31   
ref|XP_009949865.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   2e-31   
ref|XP_010623421.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   2e-31   
gb|KFQ09011.1|  Ubiquitin-conjugating enzyme E2 K                       122   2e-31   
ref|XP_010287700.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   2e-31   
ref|XP_010192099.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   2e-31   
ref|XP_009639560.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   2e-31   
ref|XP_008490010.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-co...    122   2e-31   
gb|KFQ02982.1|  Ubiquitin-conjugating enzyme E2 K                       122   2e-31   
ref|XP_009564863.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   2e-31   
gb|EDL37747.1|  huntingtin interacting protein 2, isoform CRA_c         122   2e-31   
ref|XP_009883246.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   2e-31   
gb|KFQ54673.1|  Ubiquitin-conjugating enzyme E2 K                       122   2e-31   
ref|XP_010172239.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   2e-31   
ref|XP_007426522.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   2e-31   
gb|KFP28608.1|  Ubiquitin-conjugating enzyme E2 K                       122   2e-31   
ref|XP_010400473.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   2e-31   
gb|KFO99315.1|  Ubiquitin-conjugating enzyme E2 K                       122   2e-31   
ref|NP_776505.1|  ubiquitin-conjugating enzyme E2 K                     122   2e-31   
gb|KIL61916.1|  hypothetical protein M378DRAFT_814229                   123   2e-31   
ref|XP_007066485.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   2e-31   
gb|EMC82958.1|  Ubiquitin-conjugating enzyme E2 K                       122   2e-31   
gb|ETO27438.1|  Ubiquitin-conjugating enzyme family protein             124   2e-31   
ref|XP_010004411.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-co...    122   2e-31   
gb|ELK33603.1|  Ubiquitin-conjugating enzyme E2 K                       122   3e-31   
ref|XP_010224384.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   3e-31   
ref|XP_007548297.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    122   3e-31   
ref|NP_001026711.1|  ubiquitin-conjugating enzyme E2 K                  122   3e-31   
ref|XP_005851370.1|  hypothetical protein CHLNCDRAFT_19318              122   3e-31   
ref|XP_003970413.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    122   3e-31   
ref|XP_006088556.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    122   3e-31   
pdb|1YLA|A  Chain A, Ubiquitin-Conjugating Enzyme E2-25 Kda (Hunt...    122   3e-31   
ref|NP_005330.1|  ubiquitin-conjugating enzyme E2 K isoform 1           122   3e-31   
ref|XP_004608115.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   3e-31   
ref|XP_002745946.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    122   3e-31   
ref|XP_005807812.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    122   3e-31   
ref|XP_003773356.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   3e-31   
pdb|3K9O|A  Chain A, The Crystal Structure Of E2-25k And Ubb+1 Co...    122   3e-31   
gb|EDL37745.1|  huntingtin interacting protein 2, isoform CRA_a         122   3e-31   
dbj|BAA24927.1|  huntingtin interacting protein-2                       122   3e-31   
emb|CCL99533.1|  predicted protein                                      123   3e-31   
gb|EMS22894.1|  ubiquitin-conjugating enzyme (huntingtin interact...    123   3e-31   
ref|XP_010208319.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   3e-31   
ref|XP_008325276.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   3e-31   
ref|XP_009894884.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   3e-31   
ref|XP_007612779.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    122   3e-31   
gb|EAW92950.1|  huntingtin interacting protein 2, isoform CRA_d         122   3e-31   
gb|KII90998.1|  hypothetical protein PLICRDRAFT_697404                  123   3e-31   
ref|XP_008052588.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   3e-31   
ref|XP_005415686.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   3e-31   
ref|XP_004091698.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    122   3e-31   
ref|XP_009933855.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   3e-31   
ref|XP_008639724.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   4e-31   
gb|KIM36530.1|  hypothetical protein M413DRAFT_288264                   122   4e-31   
pdb|3K9P|A  Chain A, The Crystal Structure Of E2-25k And Ubiquiti...    122   4e-31   
ref|XP_008925722.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-co...    123   4e-31   
gb|KIJ98078.1|  hypothetical protein K443DRAFT_221603                   122   4e-31   
ref|XP_010866881.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    122   4e-31   
ref|XP_004658889.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   4e-31   
ref|XP_007178865.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    122   4e-31   
ref|XP_008831468.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   4e-31   
gb|EMP29563.1|  Ubiquitin-conjugating enzyme E2 K                       122   5e-31   
gb|ELK03616.1|  Ubiquitin-conjugating enzyme E2 K                       122   5e-31   
gb|KIM21145.1|  hypothetical protein M408DRAFT_38163                    121   5e-31   
ref|XP_010018397.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   5e-31   
ref|XP_005666658.1|  PREDICTED: UBC1 isoform X1                         122   5e-31   
ref|XP_004905801.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    122   5e-31   
ref|XP_009500658.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   5e-31   
gb|ERE91461.1|  ubiquitin-conjugating enzyme E2 K-like protein          122   6e-31   
ref|XP_004010105.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   6e-31   
gb|KDR77462.1|  hypothetical protein GALMADRAFT_95199                   122   6e-31   
ref|XP_003775119.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    121   6e-31   
ref|XP_004655869.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    121   7e-31   
ref|XP_009068924.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   8e-31   
ref|XP_002189332.2|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   8e-31   
ref|XP_002587797.1|  hypothetical protein BRAFLDRAFT_126583             121   9e-31   
ref|XP_009867862.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   1e-30   
gb|KJA16294.1|  hypothetical protein HYPSUDRAFT_147916                  122   1e-30   
ref|XP_001887589.1|  predicted protein                                  121   1e-30   
ref|XP_005030904.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   1e-30   
ref|XP_008109825.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    122   1e-30   
ref|XP_003033703.1|  hypothetical protein SCHCODRAFT_256390             121   1e-30   
emb|CBK21720.2|  unnamed protein product                                120   1e-30   
ref|XP_006250996.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    121   1e-30   
emb|CDI80327.1|  ubiquitin-conjugating enzyme, putative                 120   1e-30   
emb|CEI97330.1|  Putative Ubiquitin-conjugating enzyme (Huntingti...    119   1e-30   
ref|XP_008699725.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   2e-30   
gb|AFR93785.1|  ubiquitin-conjugating enzyme (huntingtin interact...    121   2e-30   
ref|XP_005501429.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   2e-30   
ref|XP_006759404.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   2e-30   
ref|XP_011398200.1|  Ubiquitin-conjugating enzyme E2 27                 124   2e-30   
gb|EFN60302.1|  Ubiquitin-conjugating enzyme E2-22 kDa                  120   2e-30   
ref|XP_004764077.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    122   2e-30   
gb|EGI65764.1|  Ubiquitin-conjugating enzyme E2-22 kDa                  120   3e-30   
gb|KDE06850.1|  ubiquitin-conjugating enzyme (huntingtin interact...    120   3e-30   
ref|NP_001013500.1|  ubiquitin-conjugating enzyme E2 K-like             119   4e-30   
gb|KIY52476.1|  hypothetical protein FISHEDRAFT_63819                   120   4e-30   
ref|XP_009099698.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   4e-30   
ref|XP_002125172.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    119   4e-30   
gb|EHB01125.1|  Ubiquitin-conjugating enzyme E2 K                       119   4e-30   
gb|KIM83578.1|  hypothetical protein PILCRDRAFT_819209                  120   4e-30   
emb|CEG76944.1|  Putative Ubiquitin-conjugating enzyme (Huntingti...    118   6e-30   
ref|XP_010708613.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K       122   6e-30   
ref|XP_002840834.1|  hypothetical protein                               120   8e-30   
ref|XP_004881753.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    120   8e-30   
ref|XP_005392103.1|  PREDICTED: uncharacterized protein LOC102030130    122   1e-29   
pdb|3E46|A  Chain A, Crystal Structure Of Ubiquitin-Conjugating E...    119   1e-29   
ref|XP_008109824.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    120   1e-29   
ref|XP_004856895.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    118   1e-29   
ref|XP_453031.1|  hypothetical protein                                  119   1e-29   
gb|EHB09971.1|  Ubiquitin-conjugating enzyme E2 K                       117   2e-29   
emb|CEI92459.1|  Putative Ubiquitin-conjugating enzyme (Huntingti...    117   2e-29   
ref|XP_005367825.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...    117   2e-29   



>ref|XP_008464378.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Cucumis melo]
Length=194

 Score =   241 bits (614),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 124/135 (92%), Gaps = 1/135 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKM+FATKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL AP+P
Sbjct  59   PDGYPFEPPKMQFATKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPQP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYLR+YQTF GTARYWTE FAK  SLGV+EKVQKL+EMGFPEAQVRS+LE
Sbjct  119  DDPQDAVVAQQYLRDYQTFAGTARYWTETFAKTSSLGVEEKVQKLMEMGFPEAQVRSSLE  178

Query  146  LVGWDENXALERLCS  102
             VGWDEN ALE+LCS
Sbjct  179  AVGWDENLALEKLCS  193



>ref|XP_004138029.1| PREDICTED: ubiquitin-conjugating enzyme E2 27-like [Cucumis sativus]
 ref|XP_004161363.1| PREDICTED: ubiquitin-conjugating enzyme E2 27-like [Cucumis sativus]
 gb|KGN63451.1| hypothetical protein Csa_1G000740 [Cucumis sativus]
Length=194

 Score =   241 bits (614),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 124/135 (92%), Gaps = 1/135 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKM+FATKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL AP+P
Sbjct  59   PDGYPFEPPKMQFATKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPQP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYLR+YQTF GTARYWTE FAK  SLGV+EKVQKL+EMGFPEAQVRS+LE
Sbjct  119  DDPQDAVVAQQYLRDYQTFAGTARYWTETFAKTSSLGVEEKVQKLMEMGFPEAQVRSSLE  178

Query  146  LVGWDENXALERLCS  102
             VGWDEN ALE+LCS
Sbjct  179  AVGWDENLALEKLCS  193



>gb|KDP22561.1| hypothetical protein JCGZ_26392 [Jatropha curcas]
Length=194

 Score =   240 bits (612),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 125/136 (92%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKM+FATKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL AP+P
Sbjct  59   PDGYPFEPPKMQFATKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPQP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYL++YQTF+GTARYWTE+FAK  SLGV+EKVQKLVEMGFPEAQVRSTLE
Sbjct  119  DDPQDAVVAQQYLKDYQTFVGTARYWTESFAKASSLGVEEKVQKLVEMGFPEAQVRSTLE  178

Query  146  LVGWDENXALERLCSS  99
             VG DEN ALE+LCS 
Sbjct  179  AVGGDENLALEKLCSG  194



>ref|XP_009615553.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Nicotiana tomentosiformis]
 ref|XP_009780316.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Nicotiana sylvestris]
 gb|AHG12636.1| ubiquitin conjugating enzyme [Nicotiana tabacum]
Length=192

 Score =   239 bits (610),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 122/134 (91%), Gaps = 1/134 (1%)
 Frame = -2

Query  500  DGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPD  321
            DGYPFEPPKM+FATKVWH NISSQSGAICLDI KDQWSPALT KTAL SIQALL APEPD
Sbjct  60   DGYPFEPPKMRFATKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSIQALLSAPEPD  119

Query  320  DPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLELV  141
            DPQDAVVAQQYLR++QTF+GTARYWTE FAK +LG +EK+QKLVEMGFPEAQVRSTLE  
Sbjct  120  DPQDAVVAQQYLRDHQTFVGTARYWTETFAK-TLGTEEKIQKLVEMGFPEAQVRSTLEAT  178

Query  140  GWDENXALERLCSS  99
            GWDEN ALE+LCS 
Sbjct  179  GWDENMALEKLCSG  192



>ref|XP_011083414.1| PREDICTED: ubiquitin-conjugating enzyme E2 27-like [Sesamum indicum]
Length=195

 Score =   239 bits (610),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 117/136 (86%), Positives = 124/136 (91%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKM+FATKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL APEP
Sbjct  60   PDGYPFEPPKMRFATKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYLR+YQTF+GTARYWTEAFA   SLGV+EKVQKLVEMGFPEA VRSTLE
Sbjct  120  DDPQDAVVAQQYLRDYQTFVGTARYWTEAFAMISSLGVEEKVQKLVEMGFPEALVRSTLE  179

Query  146  LVGWDENXALERLCSS  99
             VG DEN ALE+LCS+
Sbjct  180  SVGGDENLALEKLCST  195



>ref|XP_011073121.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 isoform X2 [Sesamum 
indicum]
Length=195

 Score =   238 bits (608),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/136 (87%), Positives = 123/136 (90%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKMKFATKVWH NISSQSGAICLDI KDQWSPALT KTAL SIQALL APEP
Sbjct  60   PDGYPFEPPKMKFATKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSIQALLSAPEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA-KPSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYLR+YQTFLGTARYWTEAFA   SLGV+EKVQKLVEMGFPE  VR+TLE
Sbjct  120  DDPQDAVVAQQYLRDYQTFLGTARYWTEAFAMTSSLGVEEKVQKLVEMGFPEDLVRTTLE  179

Query  146  LVGWDENXALERLCSS  99
             VG DEN ALE+LCS+
Sbjct  180  NVGGDENLALEKLCST  195



>gb|ABB87105.1| ubiquitin conjugating enzyme-like [Solanum tuberosum]
Length=194

 Score =   238 bits (606),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 121/135 (90%), Gaps = 1/135 (1%)
 Frame = -2

Query  500  DGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPD  321
            DGYPFEPPKMKFATKVWH NISSQSGAICLDI KDQWSPALT KTAL SIQALL APEPD
Sbjct  60   DGYPFEPPKMKFATKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSIQALLSAPEPD  119

Query  320  DPQDAVVAQQYLREYQTFLGTARYWTEAFAKPS-LGVDEKVQKLVEMGFPEAQVRSTLEL  144
            DPQDAVVAQQYLR++QTF+GTARYWTE FAK S L  DEK+QKLVEMGFPEAQVRSTLE 
Sbjct  120  DPQDAVVAQQYLRDHQTFVGTARYWTETFAKTSTLAADEKIQKLVEMGFPEAQVRSTLEA  179

Query  143  VGWDENXALERLCSS  99
             GWDEN ALE+L SS
Sbjct  180  NGWDENMALEKLLSS  194



>ref|NP_001275389.1| ubiquitin-conjugating enzyme E2 27-like [Solanum tuberosum]
 gb|ABB86282.1| ubiquitin-conjugating protein-like [Solanum tuberosum]
Length=194

 Score =   237 bits (605),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 121/135 (90%), Gaps = 1/135 (1%)
 Frame = -2

Query  500  DGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPD  321
            DGYPFEPPKMKFATKVWH NISSQSGAICLDI KDQWSPALT KTAL SIQALL APEPD
Sbjct  60   DGYPFEPPKMKFATKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSIQALLSAPEPD  119

Query  320  DPQDAVVAQQYLREYQTFLGTARYWTEAFAKPS-LGVDEKVQKLVEMGFPEAQVRSTLEL  144
            DPQDAVVAQQYLR++QTF+GTARYWTE FAK S L  DEK+QKLVEMGFPEAQVRSTLE 
Sbjct  120  DPQDAVVAQQYLRDHQTFVGTARYWTETFAKTSTLAADEKIQKLVEMGFPEAQVRSTLEA  179

Query  143  VGWDENXALERLCSS  99
             GWDEN ALE+L SS
Sbjct  180  NGWDENMALEKLLSS  194



>ref|NP_001233964.1| ubiquitin conjugating enzyme [Solanum lycopersicum]
 emb|CAA58111.1| ubiquitin conjugating enzyme [Solanum lycopersicum]
Length=194

 Score =   237 bits (605),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 121/135 (90%), Gaps = 1/135 (1%)
 Frame = -2

Query  500  DGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPD  321
            DGYPFEPPKMKFATKVWH NISSQSGAICLDI KDQWSPALT KTAL SIQALL APEPD
Sbjct  60   DGYPFEPPKMKFATKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSIQALLSAPEPD  119

Query  320  DPQDAVVAQQYLREYQTFLGTARYWTEAFAKPS-LGVDEKVQKLVEMGFPEAQVRSTLEL  144
            DPQDAVVAQQYLRE+QTF+GTARYWTE FAK S L  D+K+QKLVEMGFPEAQVRSTLE 
Sbjct  120  DPQDAVVAQQYLREHQTFVGTARYWTETFAKTSTLAADDKIQKLVEMGFPEAQVRSTLEA  179

Query  143  VGWDENXALERLCSS  99
             GWDEN ALE+L SS
Sbjct  180  NGWDENMALEKLLSS  194



>gb|EYU32921.1| hypothetical protein MIMGU_mgv1a014267mg [Erythranthe guttata]
Length=195

 Score =   236 bits (602),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKMKFATKVWH N+SSQSGAICLDI KDQWSPALT KTAL S+QALL APEP
Sbjct  60   PDGYPFEPPKMKFATKVWHPNVSSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA-KPSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYLR+YQTF+GTARYWTE+FA   SLG++EKVQKL+EMGFPEAQVRS+LE
Sbjct  120  DDPQDAVVAQQYLRDYQTFVGTARYWTESFAMTSSLGLEEKVQKLMEMGFPEAQVRSSLE  179

Query  146  LVGWDENXALERLCSS  99
              G DEN ALE+LCS+
Sbjct  180  SAGGDENLALEKLCSA  195



>gb|KJB50908.1| hypothetical protein B456_008G209500 [Gossypium raimondii]
Length=194

 Score =   235 bits (600),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 122/136 (90%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKMKF TKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL APEP
Sbjct  59   PDGYPFEPPKMKFVTKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYLREYQTF+GTARYWTE+FAK  SLGV+EKVQ+LVEMGFP+  VRSTLE
Sbjct  119  DDPQDAVVAQQYLREYQTFVGTARYWTESFAKASSLGVEEKVQRLVEMGFPDGLVRSTLE  178

Query  146  LVGWDENXALERLCSS  99
             VG DEN ALE+L SS
Sbjct  179  AVGGDENLALEKLLSS  194



>ref|XP_008364577.1| PREDICTED: ubiquitin-conjugating enzyme E2 27-like [Malus domestica]
Length=195

 Score =   235 bits (599),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 121/136 (89%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPFEPPKM+F TKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL AP+P
Sbjct  60   PDAYPFEPPKMQFTTKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPQP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA-KPSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYL++YQTF+GTARYWTE FA K SLG+DEKVQKLVEMGFPEAQ RSTLE
Sbjct  120  DDPQDAVVAQQYLKDYQTFVGTARYWTETFAKKSSLGIDEKVQKLVEMGFPEAQARSTLE  179

Query  146  LVGWDENXALERLCSS  99
             VG DEN ALE+LCS 
Sbjct  180  AVGGDENLALEKLCSG  195



>ref|XP_011042936.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Populus euphratica]
Length=194

 Score =   234 bits (598),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 121/135 (90%), Gaps = 1/135 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKM+FATKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL APEP
Sbjct  59   PDGYPFEPPKMQFATKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYLR++QTF+GTARYWTE FAK  SLGV+EKVQKLVEMGFPEA  RS LE
Sbjct  119  DDPQDAVVAQQYLRDHQTFVGTARYWTETFAKTSSLGVEEKVQKLVEMGFPEALARSALE  178

Query  146  LVGWDENXALERLCS  102
             VG DEN ALE+LCS
Sbjct  179  SVGGDENSALEKLCS  193



>ref|XP_011073120.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 isoform X1 [Sesamum 
indicum]
Length=228

 Score =   235 bits (600),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 122/135 (90%), Gaps = 1/135 (1%)
 Frame = -2

Query  500  DGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPD  321
            DGYPFEPPKMKFATKVWH NISSQSGAICLDI KDQWSPALT KTAL SIQALL APEPD
Sbjct  94   DGYPFEPPKMKFATKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSIQALLSAPEPD  153

Query  320  DPQDAVVAQQYLREYQTFLGTARYWTEAFA-KPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
            DPQDAVVAQQYLR+YQTFLGTARYWTEAFA   SLGV+EKVQKLVEMGFPE  VR+TLE 
Sbjct  154  DPQDAVVAQQYLRDYQTFLGTARYWTEAFAMTSSLGVEEKVQKLVEMGFPEDLVRTTLEN  213

Query  143  VGWDENXALERLCSS  99
            VG DEN ALE+LCS+
Sbjct  214  VGGDENLALEKLCST  228



>ref|XP_011002115.1| PREDICTED: ubiquitin-conjugating enzyme E2 27-like [Populus euphratica]
Length=194

 Score =   233 bits (595),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 120/136 (88%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKM+FATKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL APEP
Sbjct  59   PDGYPFEPPKMQFATKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYLR+YQTF+GTARYWTE FAK  SLGV+EKVQKLVEMGFPEA  R  LE
Sbjct  119  DDPQDAVVAQQYLRDYQTFVGTARYWTETFAKTSSLGVEEKVQKLVEMGFPEALARGALE  178

Query  146  LVGWDENXALERLCSS  99
             VG DEN ALE+LCS 
Sbjct  179  SVGGDENLALEKLCSG  194



>ref|XP_010678313.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Beta vulgaris 
subsp. vulgaris]
Length=194

 Score =   233 bits (595),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 122/136 (90%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPP MKF TKVWH NISSQSGAICLDI KDQWSPALT KTAL SIQALL AP+P
Sbjct  59   PDGYPFEPPLMKFLTKVWHPNISSQSGAICLDILKDQWSPALTLKTALVSIQALLSAPQP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYL++YQTF+GTARYWTEAFAK  SLG+D KVQ+LVEMGFPEA VRSTLE
Sbjct  119  DDPQDAVVAQQYLQDYQTFVGTARYWTEAFAKTSSLGIDVKVQRLVEMGFPEALVRSTLE  178

Query  146  LVGWDENXALERLCSS  99
            +VG DE  ALE+LCSS
Sbjct  179  VVGGDETLALEKLCSS  194



>ref|XP_006436915.1| hypothetical protein CICLE_v10032815mg [Citrus clementina]
 ref|XP_006485127.1| PREDICTED: ubiquitin-conjugating enzyme E2 27-like [Citrus sinensis]
 gb|ESR50155.1| hypothetical protein CICLE_v10032815mg [Citrus clementina]
 gb|KDO44511.1| hypothetical protein CISIN_1g029412mg [Citrus sinensis]
Length=194

 Score =   233 bits (594),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 122/136 (90%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKM F TKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL AP P
Sbjct  59   PDGYPFEPPKMHFVTKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPAP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYL+++QTFL TARYWTE+FAK  SLGV+EKVQKLVEMGFPE+QVRSTLE
Sbjct  119  DDPQDAVVAQQYLKDHQTFLSTARYWTESFAKTSSLGVEEKVQKLVEMGFPESQVRSTLE  178

Query  146  LVGWDENXALERLCSS  99
            +VG DEN ALE+L SS
Sbjct  179  IVGGDENMALEKLLSS  194



>ref|XP_002511117.1| ubiquitin-conjugating enzyme E2-25kD, putative [Ricinus communis]
 gb|EEF51719.1| ubiquitin-conjugating enzyme E2-25kD, putative [Ricinus communis]
Length=194

 Score =   233 bits (594),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 121/135 (90%), Gaps = 1/135 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKM+FATKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL AP+P
Sbjct  59   PDGYPFEPPKMQFATKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPQP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYL++YQTF+GTARYWTE FAK  SLGV+EKVQKLVEMGFPE  VRSTLE
Sbjct  119  DDPQDAVVAQQYLKDYQTFVGTARYWTETFAKTSSLGVEEKVQKLVEMGFPEGLVRSTLE  178

Query  146  LVGWDENXALERLCS  102
             V  DEN ALE+LCS
Sbjct  179  AVSGDENLALEKLCS  193



>ref|XP_002318760.1| ubiquitin-conjugating enzyme family protein [Populus trichocarpa]
 gb|EEE96980.1| ubiquitin-conjugating enzyme family protein [Populus trichocarpa]
Length=194

 Score =   233 bits (594),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 120/135 (89%), Gaps = 1/135 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKM+FATKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL APEP
Sbjct  59   PDGYPFEPPKMQFATKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYLR+ QTF+GTARYWTE FAK  SLGV+EKVQKLVEMGFPEA  RS LE
Sbjct  119  DDPQDAVVAQQYLRDRQTFVGTARYWTETFAKTSSLGVEEKVQKLVEMGFPEALARSALE  178

Query  146  LVGWDENXALERLCS  102
             VG DEN ALE+LCS
Sbjct  179  SVGGDENSALEKLCS  193



>gb|KJB50909.1| hypothetical protein B456_008G209500 [Gossypium raimondii]
Length=201

 Score =   233 bits (594),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 121/135 (90%), Gaps = 1/135 (1%)
 Frame = -2

Query  500  DGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPD  321
            DGYPFEPPKMKF TKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL APEPD
Sbjct  67   DGYPFEPPKMKFVTKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPEPD  126

Query  320  DPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
            DPQDAVVAQQYLREYQTF+GTARYWTE+FAK  SLGV+EKVQ+LVEMGFP+  VRSTLE 
Sbjct  127  DPQDAVVAQQYLREYQTFVGTARYWTESFAKASSLGVEEKVQRLVEMGFPDGLVRSTLEA  186

Query  143  VGWDENXALERLCSS  99
            VG DEN ALE+L SS
Sbjct  187  VGGDENLALEKLLSS  201



>gb|ABK92892.1| unknown [Populus trichocarpa]
Length=194

 Score =   233 bits (593),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 120/136 (88%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKM+FATKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL APEP
Sbjct  59   PDGYPFEPPKMQFATKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYLR+YQTF+GTARYWTE FAK  SLGV+EKVQKLVEMGFPE+  R  LE
Sbjct  119  DDPQDAVVAQQYLRDYQTFVGTARYWTETFAKTSSLGVEEKVQKLVEMGFPESLARGALE  178

Query  146  LVGWDENXALERLCSS  99
             VG DEN ALE+LCS 
Sbjct  179  SVGGDENLALEKLCSG  194



>ref|XP_009337530.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Pyrus x bretschneideri]
Length=195

 Score =   232 bits (592),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 120/136 (88%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPFEPPKM+F TKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL AP+P
Sbjct  60   PDAYPFEPPKMQFTTKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPQP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA-KPSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYL++YQTF+GTARYWTE FA K SLG+ EKVQKLVEMGFPEAQ RSTLE
Sbjct  120  DDPQDAVVAQQYLKDYQTFVGTARYWTETFAKKSSLGIGEKVQKLVEMGFPEAQARSTLE  179

Query  146  LVGWDENXALERLCSS  99
             VG DEN ALE+LCS 
Sbjct  180  AVGGDENLALEKLCSG  195



>ref|XP_008239533.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Prunus mume]
Length=195

 Score =   232 bits (592),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 120/136 (88%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPFEPPKMKF TKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL AP+P
Sbjct  60   PDAYPFEPPKMKFTTKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPQP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA-KPSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYL++YQTF+GTARYWTE FA K SLG++EKVQKLVEMGFPE Q R+TLE
Sbjct  120  DDPQDAVVAQQYLKDYQTFVGTARYWTETFAKKSSLGIEEKVQKLVEMGFPEGQARTTLE  179

Query  146  LVGWDENXALERLCSS  99
             VG DEN ALE+LCS 
Sbjct  180  AVGGDENLALEKLCSG  195



>ref|XP_007038089.1| Ubiquitin-conjugating enzyme 27 [Theobroma cacao]
 gb|EOY22590.1| Ubiquitin-conjugating enzyme 27 [Theobroma cacao]
Length=194

 Score =   230 bits (587),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 120/136 (88%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKMKF TKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL APEP
Sbjct  59   PDGYPFEPPKMKFVTKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYLREYQTF+GTARYWTE+FAK  SLG++EKVQ+LVEMGF    VRSTLE
Sbjct  119  DDPQDAVVAQQYLREYQTFVGTARYWTESFAKASSLGLEEKVQRLVEMGFAVGLVRSTLE  178

Query  146  LVGWDENXALERLCSS  99
             VG DEN ALE+L SS
Sbjct  179  AVGGDENLALEKLLSS  194



>ref|XP_010093942.1| Ubiquitin-conjugating enzyme E2 27 [Morus notabilis]
 gb|EXB54905.1| Ubiquitin-conjugating enzyme E2 27 [Morus notabilis]
Length=195

 Score =   230 bits (586),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 121/136 (89%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKM+F+TKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL APEP
Sbjct  60   PDGYPFEPPKMQFSTKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVA+QYL++YQTF+ TARYWTE FAK  S G++EKVQKLVEMGFPEAQ R+TLE
Sbjct  120  DDPQDAVVAKQYLKDYQTFISTARYWTETFAKTSSRGIEEKVQKLVEMGFPEAQARTTLE  179

Query  146  LVGWDENXALERLCSS  99
             VG DEN ALE+LCS 
Sbjct  180  SVGGDENLALEKLCSG  195



>ref|XP_007209522.1| hypothetical protein PRUPE_ppa010579mg [Prunus persica]
 gb|EMJ10721.1| hypothetical protein PRUPE_ppa010579mg [Prunus persica]
Length=244

 Score =   231 bits (589),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 120/136 (88%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPFEPPKMKF TKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL AP+P
Sbjct  109  PDAYPFEPPKMKFTTKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPQP  168

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA-KPSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYL++YQTF+GTARYWTE FA K SLG++EKVQKLVEMGFPE Q R+TLE
Sbjct  169  DDPQDAVVAQQYLKDYQTFVGTARYWTETFAKKSSLGIEEKVQKLVEMGFPEGQARTTLE  228

Query  146  LVGWDENXALERLCSS  99
             VG DEN ALE+LCS 
Sbjct  229  AVGGDENLALEKLCSG  244



>ref|XP_004297507.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Fragaria vesca 
subsp. vesca]
Length=195

 Score =   229 bits (583),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 119/136 (88%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPFEPPKM+F TKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL AP+P
Sbjct  60   PDAYPFEPPKMQFTTKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPQP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYLR+YQTF+GTARYWTE+FAK  SLG+DEKV++LVEMGFPE + RS LE
Sbjct  120  DDPQDAVVAQQYLRDYQTFVGTARYWTESFAKSSSLGIDEKVKRLVEMGFPEGRARSALE  179

Query  146  LVGWDENXALERLCSS  99
             VG DEN ALE LCS 
Sbjct  180  TVGGDENLALESLCSG  195



>ref|XP_010037360.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Eucalyptus grandis]
 gb|KCW49068.1| hypothetical protein EUGRSUZ_K02668 [Eucalyptus grandis]
Length=194

 Score =   229 bits (583),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 122/136 (90%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF+PPKM+FATKVWH NISSQSGAICLDI KDQWSPALT KTAL SIQALL APEP
Sbjct  59   PDAYPFQPPKMQFATKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSIQALLSAPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPS-LGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYL++YQTF+GTARYWTE FAK S LGV+EKVQ+LVEMGF E+ VRSTL+
Sbjct  119  DDPQDAVVAQQYLKDYQTFVGTARYWTETFAKTSALGVEEKVQRLVEMGFLESLVRSTLD  178

Query  146  LVGWDENXALERLCSS  99
             VG DEN ALE+LCS+
Sbjct  179  AVGGDENLALEKLCSA  194



>ref|XP_008392720.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Malus domestica]
Length=195

 Score =   228 bits (581),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 118/136 (87%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPFEPPKM+F TKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL AP+P
Sbjct  60   PDAYPFEPPKMQFTTKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPQP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA-KPSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYL++YQTF+GTARYWTE FA K S G+ EKVQKLVEMGFPEAQ RSTLE
Sbjct  120  DDPQDAVVAQQYLKDYQTFVGTARYWTETFAKKSSXGIVEKVQKLVEMGFPEAQARSTLE  179

Query  146  LVGWDENXALERLCSS  99
              G DEN ALE+LCS 
Sbjct  180  AAGGDENLALEKLCSG  195



>gb|KHN31276.1| Ubiquitin-conjugating enzyme E2 27 [Glycine soja]
Length=192

 Score =   227 bits (578),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 119/133 (89%), Gaps = 1/133 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKMKF TKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL AP+P
Sbjct  59   PDGYPFEPPKMKFKTKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPQP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYL++YQTF+ TARYWTE+FAK  S G+++KVQKLVEMGFPEAQVRS LE
Sbjct  119  DDPQDAVVAQQYLKDYQTFVNTARYWTESFAKESSRGIEDKVQKLVEMGFPEAQVRSILE  178

Query  146  LVGWDENXALERL  108
             VG DEN ALERL
Sbjct  179  AVGGDENLALERL  191



>gb|AFK44991.1| unknown [Lotus japonicus]
Length=193

 Score =   226 bits (576),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 119/133 (89%), Gaps = 1/133 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKM+F TKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL AP+P
Sbjct  60   PDGYPFEPPKMRFTTKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPQP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYL++YQTF+ TARYWTE+FAK  S G+++KVQKLVEMGFPEAQVRS LE
Sbjct  120  DDPQDAVVAQQYLKDYQTFVNTARYWTESFAKVSSRGIEDKVQKLVEMGFPEAQVRSILE  179

Query  146  LVGWDENXALERL  108
             VG DEN ALERL
Sbjct  180  SVGGDENLALERL  192



>ref|XP_003602764.1| Ubiquitin carrier protein [Medicago truncatula]
 gb|AES73015.1| ubiquitin-conjugating enzyme E2, putative [Medicago truncatula]
 gb|AFK47848.1| unknown [Medicago truncatula]
Length=192

 Score =   225 bits (574),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 120/133 (90%), Gaps = 1/133 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKM+F+TKVWH NISSQ+GAICLDI KDQWSPALT KTAL S+QALL AP+P
Sbjct  59   PDGYPFEPPKMRFSTKVWHPNISSQNGAICLDILKDQWSPALTLKTALLSVQALLSAPQP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYL++YQTF+ TARYWTE+FAK  S GV++KVQKLVEMGFPEAQVR+ LE
Sbjct  119  DDPQDAVVAQQYLKDYQTFVNTARYWTESFAKTSSRGVEDKVQKLVEMGFPEAQVRNILE  178

Query  146  LVGWDENXALERL  108
             VG DEN ALERL
Sbjct  179  AVGGDENLALERL  191



>ref|XP_003602765.1| Ubiquitin carrier protein [Medicago truncatula]
 gb|AES73016.1| ubiquitin-conjugating enzyme E2, putative [Medicago truncatula]
Length=216

 Score =   225 bits (574),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 120/133 (90%), Gaps = 1/133 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKM+F+TKVWH NISSQ+GAICLDI KDQWSPALT KTAL S+QALL AP+P
Sbjct  83   PDGYPFEPPKMRFSTKVWHPNISSQNGAICLDILKDQWSPALTLKTALLSVQALLSAPQP  142

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYL++YQTF+ TARYWTE+FAK  S GV++KVQKLVEMGFPEAQVR+ LE
Sbjct  143  DDPQDAVVAQQYLKDYQTFVNTARYWTESFAKTSSRGVEDKVQKLVEMGFPEAQVRNILE  202

Query  146  LVGWDENXALERL  108
             VG DEN ALERL
Sbjct  203  AVGGDENLALERL  215



>gb|KHN23957.1| Ubiquitin-conjugating enzyme E2 27 [Glycine soja]
Length=192

 Score =   224 bits (571),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 119/133 (89%), Gaps = 1/133 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKM+F TKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL AP+P
Sbjct  59   PDGYPFEPPKMQFKTKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPQP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYL++YQTF+ TARYWTE+FAK  S G+++KVQKLVEMGFPEA+VRS LE
Sbjct  119  DDPQDAVVAQQYLKDYQTFVNTARYWTESFAKASSRGIEDKVQKLVEMGFPEARVRSILE  178

Query  146  LVGWDENXALERL  108
             VG DEN ALERL
Sbjct  179  AVGGDENMALERL  191



>emb|CBI15730.3| unnamed protein product [Vitis vinifera]
Length=150

 Score =   222 bits (565),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 118/133 (89%), Gaps = 1/133 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPP+M+FATKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL AP+P
Sbjct  17   PDGYPFEPPRMQFATKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPQP  76

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
            DDPQDAVVAQQYL++YQT++GTARYWTE FA  S G++EKVQKLVEMGFPEA VRSTL  
Sbjct  77   DDPQDAVVAQQYLKDYQTYVGTARYWTENFAS-SRGLEEKVQKLVEMGFPEASVRSTLAA  135

Query  143  VGWDENXALERLC  105
             G DEN ALE+LC
Sbjct  136  FGGDENLALEKLC  148



>ref|XP_004501731.1| PREDICTED: ubiquitin-conjugating enzyme E2 27-like isoform X1 
[Cicer arietinum]
 ref|XP_004501732.1| PREDICTED: ubiquitin-conjugating enzyme E2 27-like isoform X2 
[Cicer arietinum]
Length=192

 Score =   223 bits (569),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 119/133 (89%), Gaps = 1/133 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+GYPFEPPKM+F+TKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL AP+P
Sbjct  59   PEGYPFEPPKMQFSTKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPQP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYL++YQTF+ TARYWTE+FAK  S G++ KVQKLVEMGFPEAQVRS LE
Sbjct  119  DDPQDAVVAQQYLKDYQTFVNTARYWTESFAKTSSRGIEVKVQKLVEMGFPEAQVRSILE  178

Query  146  LVGWDENXALERL  108
             VG DEN ALERL
Sbjct  179  AVGGDENLALERL  191



>ref|XP_002284366.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Vitis vinifera]
Length=192

 Score =   223 bits (568),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 118/133 (89%), Gaps = 1/133 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPP+M+FATKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL AP+P
Sbjct  59   PDGYPFEPPRMQFATKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPQP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
            DDPQDAVVAQQYL++YQT++GTARYWTE FA  S G++EKVQKLVEMGFPEA VRSTL  
Sbjct  119  DDPQDAVVAQQYLKDYQTYVGTARYWTENFAS-SRGLEEKVQKLVEMGFPEASVRSTLAA  177

Query  143  VGWDENXALERLC  105
             G DEN ALE+LC
Sbjct  178  FGGDENLALEKLC  190



>ref|XP_007137877.1| hypothetical protein PHAVU_009G163400g [Phaseolus vulgaris]
 ref|XP_007137878.1| hypothetical protein PHAVU_009G163400g [Phaseolus vulgaris]
 ref|XP_007137879.1| hypothetical protein PHAVU_009G163400g [Phaseolus vulgaris]
 gb|ESW09871.1| hypothetical protein PHAVU_009G163400g [Phaseolus vulgaris]
 gb|ESW09872.1| hypothetical protein PHAVU_009G163400g [Phaseolus vulgaris]
 gb|ESW09873.1| hypothetical protein PHAVU_009G163400g [Phaseolus vulgaris]
Length=192

 Score =   222 bits (566),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 119/133 (89%), Gaps = 1/133 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+GYPFEPPKM+F TKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL AP+P
Sbjct  59   PEGYPFEPPKMQFKTKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPQP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSL-GVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYL++YQTF+ TARYWTE+FAK S  G+++KVQKLVEMGFPEAQVR+ LE
Sbjct  119  DDPQDAVVAQQYLKDYQTFVSTARYWTESFAKASTRGIEDKVQKLVEMGFPEAQVRNILE  178

Query  146  LVGWDENXALERL  108
             VG DEN ALERL
Sbjct  179  AVGGDENLALERL  191



>ref|XP_010555576.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Tarenaya hassleriana]
Length=192

 Score =   219 bits (557),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 117/135 (87%), Gaps = 1/135 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKM+F TKVWH NISSQSGAICLDI KDQWSPALT KTAL SIQALL APEP
Sbjct  59   PDGYPFEPPKMQFTTKVWHPNISSQSGAICLDILKDQWSPALTLKTALVSIQALLSAPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
            +DPQDAVVAQQY++E+QTF+ TARYWTE FAK S  ++EKV +LVEMGF EAQVRS LE 
Sbjct  119  NDPQDAVVAQQYIKEHQTFVTTARYWTETFAKNS-SLEEKVTRLVEMGFGEAQVRSALES  177

Query  143  VGWDENXALERLCSS  99
             G DEN ALE+LCS+
Sbjct  178  AGGDENLALEKLCSA  192



>gb|KHG10228.1| Ubiquitin-conjugating enzyme E2 27 -like protein [Gossypium arboreum]
Length=220

 Score =   216 bits (550),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 121/162 (75%), Gaps = 27/162 (17%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKV-------------------W-------HXNISSQSGAICLDIX  402
            PDGYPFEPPKMKF TK                    W       H NISSQSGAICLDI 
Sbjct  59   PDGYPFEPPKMKFVTKYNVGVIDGAIMTVLKILGLPWKKTAYEEHPNISSQSGAICLDIL  118

Query  401  KDQWSPALTXKTALXSIQALLXAPEPDDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-P  225
            KDQWSPALT KTAL S+QALL APEPDDPQDAVVAQQYLREYQTF+GTARYWTE+FAK  
Sbjct  119  KDQWSPALTLKTALLSVQALLSAPEPDDPQDAVVAQQYLREYQTFIGTARYWTESFAKAS  178

Query  224  SLGVDEKVQKLVEMGFPEAQVRSTLELVGWDENXALERLCSS  99
            SLGV+EKVQ+LVEMGFP+  VRSTLE VG DEN ALE+L SS
Sbjct  179  SLGVEEKVQRLVEMGFPDGLVRSTLEAVGGDENLALEKLLSS  220



>ref|XP_002322290.2| ubiquitin-conjugating enzyme family protein [Populus trichocarpa]
 gb|EEF06417.2| ubiquitin-conjugating enzyme family protein [Populus trichocarpa]
Length=185

 Score =   214 bits (546),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 113/135 (84%), Gaps = 8/135 (6%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKM+FATKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL APEP
Sbjct  59   PDGYPFEPPKMQFATKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
            DDPQDAVVAQQYLR+YQTF+GTAR         SLGV+EKVQKLVEMGFPE+  R  LE 
Sbjct  119  DDPQDAVVAQQYLRDYQTFVGTARS--------SLGVEEKVQKLVEMGFPESLARGALES  170

Query  143  VGWDENXALERLCSS  99
            VG DEN ALE+LCS 
Sbjct  171  VGGDENLALEKLCSG  185



>ref|XP_006282380.1| hypothetical protein CARUB_v10028678mg [Capsella rubella]
 gb|EOA15278.1| hypothetical protein CARUB_v10028678mg [Capsella rubella]
Length=192

 Score =   214 bits (545),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 116/134 (87%), Gaps = 1/134 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+GYPFEPPKM+F+TKVWH NISSQSGAICLDI KDQWSPALT KTAL SIQALL APEP
Sbjct  59   PEGYPFEPPKMQFSTKVWHPNISSQSGAICLDILKDQWSPALTLKTALVSIQALLSAPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
             DPQDAVVA+QY++ YQ F+ TARYWTE+FAK S  ++EKV+KLVEMGF EAQVRS +E 
Sbjct  119  KDPQDAVVAEQYMKNYQVFVSTARYWTESFAKKS-SLEEKVKKLVEMGFGEAQVRSAIES  177

Query  143  VGWDENXALERLCS  102
             G DEN ALE+LCS
Sbjct  178  SGGDENLALEKLCS  191



>ref|NP_199900.1| ubiquitin-conjugating enzyme E2 27 [Arabidopsis thaliana]
 sp|Q9FI61.1|UBC27_ARATH RecName: Full=Ubiquitin-conjugating enzyme E2 27; AltName: Full=Ubiquitin 
carrier protein 27 [Arabidopsis thaliana]
 dbj|BAB08733.1| ubiquitin-conjugating enzyme-like protein [Arabidopsis thaliana]
 gb|AAL38779.1| putative ubiquitin-conjugating enzyme [Arabidopsis thaliana]
 gb|AAM20069.1| putative ubiquitin-conjugating enzyme protein [Arabidopsis thaliana]
 gb|AAY44866.1| ubiquitinating enzyme [Arabidopsis thaliana]
 gb|ABG85247.1| ubiquitin conjugating enzyme [Arabidopsis thaliana]
 gb|AED96003.1| ubiquitin-conjugating enzyme E2 27 [Arabidopsis thaliana]
Length=192

 Score =   213 bits (543),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 116/135 (86%), Gaps = 1/135 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKM+F+TKVWH NISSQSGAICLDI KDQWSPALT KTAL SIQALL APEP
Sbjct  59   PDGYPFEPPKMQFSTKVWHPNISSQSGAICLDILKDQWSPALTLKTALVSIQALLSAPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
             DPQDAVVA+QY++ YQ F+ TARYWTE FAK S  ++EKV++LVEMGF +AQVRS +E 
Sbjct  119  KDPQDAVVAEQYMKNYQVFVSTARYWTETFAKKS-SLEEKVKRLVEMGFGDAQVRSAIES  177

Query  143  VGWDENXALERLCSS  99
             G DEN ALE+LCS+
Sbjct  178  SGGDENLALEKLCSA  192



>ref|XP_002865827.1| ubiquitin-conjugating enzyme 26 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42086.1| ubiquitin-conjugating enzyme 26 [Arabidopsis lyrata subsp. lyrata]
Length=192

 Score =   212 bits (540),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 115/134 (86%), Gaps = 1/134 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+GYPFEPPKM+F+TKVWH NISSQSGAICLDI KDQWSPALT KTAL SIQALL APEP
Sbjct  59   PEGYPFEPPKMQFSTKVWHPNISSQSGAICLDILKDQWSPALTLKTALVSIQALLSAPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
             DPQDAVVA+QY++ YQ F+ TARYWTE FAK S  ++EKV+KLVEMGF +AQVRS +E 
Sbjct  119  KDPQDAVVAEQYMKNYQVFVSTARYWTETFAKNS-SLEEKVRKLVEMGFGDAQVRSAIES  177

Query  143  VGWDENXALERLCS  102
             G DEN ALE+LCS
Sbjct  178  SGGDENLALEKLCS  191



>ref|XP_010250584.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Nelumbo nucifera]
Length=230

 Score =   213 bits (542),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 120/136 (88%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKM+F TKVWH NISSQ+GAICLDI KDQWSPALT KTAL S+QALL APEP
Sbjct  95   PDGYPFEPPKMQFMTKVWHPNISSQNGAICLDILKDQWSPALTLKTALLSLQALLSAPEP  154

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYLR+Y TF+GTARYWTE FAK  S+G +EK+QKLVEMGFPE  VR+TLE
Sbjct  155  DDPQDAVVAQQYLRDYPTFVGTARYWTETFAKRSSIGTEEKIQKLVEMGFPEGLVRTTLE  214

Query  146  LVGWDENXALERLCSS  99
            +VG DEN ALE+LCS 
Sbjct  215  VVGGDENMALEKLCSG  230



>gb|KFK26715.1| hypothetical protein AALP_AA8G283800 [Arabis alpina]
Length=192

 Score =   212 bits (539),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 115/134 (86%), Gaps = 1/134 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+GYPFEPPKM+F+TKVWH NISSQSGAICLD+ KDQWSPALT KTAL SIQALL APEP
Sbjct  59   PEGYPFEPPKMQFSTKVWHPNISSQSGAICLDVLKDQWSPALTLKTALVSIQALLSAPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
             DPQDAVVA+QY++ YQ F+ TARYWTE FAK S  ++EKV++LVEMGF +AQVRS +E 
Sbjct  119  KDPQDAVVAEQYIKNYQVFVSTARYWTETFAKNS-SIEEKVKRLVEMGFGDAQVRSAIES  177

Query  143  VGWDENXALERLCS  102
             G DEN ALE+LCS
Sbjct  178  SGGDENAALEKLCS  191



>ref|XP_010442437.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Camelina sativa]
 ref|XP_010442569.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Camelina sativa]
 ref|XP_010482396.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Camelina sativa]
Length=192

 Score =   211 bits (536),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 115/134 (86%), Gaps = 1/134 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+GYPFEPPKM+F+T+VWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL APEP
Sbjct  59   PEGYPFEPPKMQFSTRVWHPNISSQSGAICLDILKDQWSPALTLKTALVSVQALLSAPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
             DPQDAVVA+QY++ YQ F+ TARYWTE FAK S  ++EKV+KLVEMGF +AQVRS +E 
Sbjct  119  KDPQDAVVAEQYIKNYQVFVSTARYWTETFAKNS-SLEEKVKKLVEMGFGDAQVRSAIES  177

Query  143  VGWDENXALERLCS  102
             G DEN ALE+LCS
Sbjct  178  SGGDENLALEKLCS  191



>ref|XP_006402053.1| hypothetical protein EUTSA_v10014747mg [Eutrema salsugineum]
 gb|ESQ43506.1| hypothetical protein EUTSA_v10014747mg [Eutrema salsugineum]
Length=192

 Score =   209 bits (531),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 114/134 (85%), Gaps = 1/134 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+GYPFEPPKM+F+TKVWH NISSQSGAICLD+ KDQWSPALT KTAL SIQALL  PEP
Sbjct  59   PEGYPFEPPKMQFSTKVWHPNISSQSGAICLDVLKDQWSPALTLKTALVSIQALLSTPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
             DPQDAVVA+QY++ YQ F+ TARYWTE FAK S  ++EKV++LVEMGF +AQVRS +E 
Sbjct  119  KDPQDAVVAEQYIKNYQVFVSTARYWTETFAKNS-SLEEKVKRLVEMGFGDAQVRSAIES  177

Query  143  VGWDENXALERLCS  102
             G DEN ALE+LCS
Sbjct  178  SGGDENLALEKLCS  191



>ref|XP_009132686.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Brassica rapa]
 emb|CDX84883.1| BnaA03g13470D [Brassica napus]
Length=192

 Score =   207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 115/134 (86%), Gaps = 1/134 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+GYPFEPPKM+F+TKVWH NISSQSGAICLD+ KDQWSPALT KTAL S+QALL APEP
Sbjct  59   PEGYPFEPPKMQFSTKVWHPNISSQSGAICLDVLKDQWSPALTLKTALVSVQALLSAPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
             DPQDAVVA+QY++ YQ F+ TARYWT+ FAK S  +++KV++LVEMGF +AQVRS +E 
Sbjct  119  KDPQDAVVAEQYMKNYQVFVSTARYWTQTFAKNS-SLEDKVKRLVEMGFGDAQVRSAIES  177

Query  143  VGWDENXALERLCS  102
             G DEN ALE+LCS
Sbjct  178  SGGDENVALEKLCS  191



>ref|XP_009385499.1| PREDICTED: ubiquitin-conjugating enzyme E2 27-like [Musa acuminata 
subsp. malaccensis]
Length=196

 Score =   207 bits (527),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 119/136 (88%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P GYPFEPPKM+F TKVWH NISSQ+GAICLDI KDQWSPALT KTAL S+QALL APEP
Sbjct  61   PSGYPFEPPKMQFVTKVWHPNISSQNGAICLDILKDQWSPALTLKTALLSLQALLSAPEP  120

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA-KPSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYLR++QTF+ TARYWTEAFA + S+G++EKVQKLVEMGFPE  VR+TLE
Sbjct  121  DDPQDAVVAQQYLRDHQTFMATARYWTEAFARRSSVGIEEKVQKLVEMGFPEDLVRNTLE  180

Query  146  LVGWDENXALERLCSS  99
             V  DEN ALE LCSS
Sbjct  181  SVNGDENQALEMLCSS  196



>emb|CDY45812.1| BnaC03g16350D [Brassica napus]
Length=192

 Score =   206 bits (523),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 114/134 (85%), Gaps = 1/134 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+GYPFEPPKM+F+TKVWH NISSQSGAICLD+ KDQWSPALT KTAL S+QALL APEP
Sbjct  59   PEGYPFEPPKMQFSTKVWHPNISSQSGAICLDVLKDQWSPALTLKTALVSVQALLSAPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
             DPQDAVVA+QY++ YQ F+ TARYWT+ FAK S  +++KV++LVEMGF +AQ RS +E 
Sbjct  119  KDPQDAVVAEQYMKNYQVFVSTARYWTQTFAKNS-SLEDKVKRLVEMGFGDAQARSAIES  177

Query  143  VGWDENXALERLCS  102
             G DEN ALE+LCS
Sbjct  178  SGGDENVALEKLCS  191



>ref|NP_001190508.1| ubiquitin-conjugating enzyme E2 27 [Arabidopsis thaliana]
 gb|AED96004.1| ubiquitin-conjugating enzyme E2 27 [Arabidopsis thaliana]
Length=203

 Score =   205 bits (521),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 116/146 (79%), Gaps = 12/146 (8%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKM+F+TKVWH NISSQSGAICLDI KDQWSPALT KTAL SIQALL APEP
Sbjct  59   PDGYPFEPPKMQFSTKVWHPNISSQSGAICLDILKDQWSPALTLKTALVSIQALLSAPEP  118

Query  323  DDPQDAVVAQQ-----------YLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGF  177
             DPQDAVVA+Q           Y++ YQ F+ TARYWTE FAK S  ++EKV++LVEMGF
Sbjct  119  KDPQDAVVAEQVLLLHHLNHLRYMKNYQVFVSTARYWTETFAKKS-SLEEKVKRLVEMGF  177

Query  176  PEAQVRSTLELVGWDENXALERLCSS  99
             +AQVRS +E  G DEN ALE+LCS+
Sbjct  178  GDAQVRSAIESSGGDENLALEKLCSA  203



>ref|XP_010908214.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 isoform X2 [Elaeis 
guineensis]
Length=195

 Score =   203 bits (517),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 117/136 (86%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P GYPFEPPKM+F TKVWH NISSQ+GAICLDI KDQWSPALT KTAL S+QALL APEP
Sbjct  60   PSGYPFEPPKMQFITKVWHPNISSQNGAICLDILKDQWSPALTLKTALLSLQALLSAPEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYLR+Y TF+ TARYWTE FAK  S+G++EKVQKLVEMGFPE  VR+TLE
Sbjct  120  DDPQDAVVAQQYLRDYPTFVATARYWTEVFAKRTSVGIEEKVQKLVEMGFPEDLVRNTLE  179

Query  146  LVGWDENXALERLCSS  99
             V  DEN ALE+LCS 
Sbjct  180  SVNGDENMALEKLCSG  195



>emb|CDO98671.1| unnamed protein product [Coffea canephora]
Length=192

 Score =   202 bits (515),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 118/135 (87%), Gaps = 1/135 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PDGYPFEPPKM+FATKVWH NISSQSGAICLDI KDQWSPALT KTAL S+QALL AP P
Sbjct  59   PDGYPFEPPKMRFATKVWHPNISSQSGAICLDILKDQWSPALTIKTALLSLQALLSAPAP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
            DDPQDAVVAQQY+++  TF+ TARYWTEAFAK + GV+EKV++L+EMGFPE  VRS LE 
Sbjct  119  DDPQDAVVAQQYIKDQNTFISTARYWTEAFAK-ATGVEEKVKRLIEMGFPEDLVRSILEA  177

Query  143  VGWDENXALERLCSS  99
            VG DEN ALE+LCS+
Sbjct  178  VGGDENLALEKLCSA  192



>ref|NP_001150323.1| ubiquitin-conjugating enzyme E2-22 kDa [Zea mays]
 gb|ACG38646.1| ubiquitin-conjugating enzyme E2-22 kDa [Zea mays]
 gb|AFW84087.1| ubiquitin carrier protein [Zea mays]
Length=197

 Score =   201 bits (510),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 116/137 (85%), Gaps = 1/137 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P GYPFEPPKM+F TKVWH NISSQ+GAICLDI KDQWSPALT KTAL S+QALL +P P
Sbjct  60   PGGYPFEPPKMQFITKVWHPNISSQNGAICLDILKDQWSPALTLKTALLSLQALLSSPAP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKP-SLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYLR+Y TF  TARYWTEAFAK  S G++EKVQKLVEMGFPE QVRS L+
Sbjct  120  DDPQDAVVAQQYLRDYPTFAATARYWTEAFAKSASTGMEEKVQKLVEMGFPEDQVRSALK  179

Query  146  LVGWDENXALERLCSSA  96
             V  DEN ALE+LCS +
Sbjct  180  SVDGDENMALEKLCSGS  196



>gb|AGY80454.1| ubiquitin-conjugating enzyme [Dendrocalamus latiflorus]
Length=196

 Score =   200 bits (508),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 115/136 (85%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P GYPFEPPKM+F TKVWH NISSQ+GAICLDI KDQWSPALT KTAL S+QALL AP P
Sbjct  61   PGGYPFEPPKMQFVTKVWHPNISSQNGAICLDILKDQWSPALTLKTALLSLQALLSAPAP  120

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYLR+Y TF+ TARYWTEAFAK  S G++EKVQKLVEMGFPE  VRS L+
Sbjct  121  DDPQDAVVAQQYLRDYSTFVATARYWTEAFAKCASTGMEEKVQKLVEMGFPEDLVRSALK  180

Query  146  LVGWDENXALERLCSS  99
             V  DEN ALE+LCS 
Sbjct  181  SVNGDENMALEKLCSG  196



>ref|NP_001045259.1| Os01g0925800 [Oryza sativa Japonica Group]
 dbj|BAB89662.1| putative ubiquitin conjugating enzyme [Oryza sativa Japonica 
Group]
 dbj|BAB92885.1| putative ubiquitin conjugating enzyme [Oryza sativa Japonica 
Group]
 dbj|BAF07173.1| Os01g0925800 [Oryza sativa Japonica Group]
 gb|EAY77049.1| hypothetical protein OsI_05005 [Oryza sativa Indica Group]
 gb|EAZ14687.1| hypothetical protein OsJ_04611 [Oryza sativa Japonica Group]
 dbj|BAG93414.1| unnamed protein product [Oryza sativa Japonica Group]
Length=195

 Score =   199 bits (507),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 114/136 (84%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P GYPFEPPKM+F TKVWH NISSQ+GAICLDI KDQWSPALT KTAL S+QALL AP P
Sbjct  60   PGGYPFEPPKMQFITKVWHPNISSQNGAICLDILKDQWSPALTLKTALLSLQALLSAPAP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYLR+Y TF  TARYWTEAFAK  S G++EKVQKLVEMGFPE  VRS L+
Sbjct  120  DDPQDAVVAQQYLRDYSTFSATARYWTEAFAKNSSTGMEEKVQKLVEMGFPEDMVRSVLK  179

Query  146  LVGWDENXALERLCSS  99
             V  DEN ALE+LCS 
Sbjct  180  SVNGDENMALEKLCSG  195



>ref|XP_002459014.1| hypothetical protein SORBIDRAFT_03g044480 [Sorghum bicolor]
 gb|EES04134.1| hypothetical protein SORBIDRAFT_03g044480 [Sorghum bicolor]
Length=195

 Score =   199 bits (507),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 115/136 (85%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P GYPFEPPKM+F TKVWH NISSQ+GAICLDI KDQWSPALT KTAL S+QALL +P P
Sbjct  60   PGGYPFEPPKMQFVTKVWHPNISSQNGAICLDILKDQWSPALTLKTALLSLQALLSSPAP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKP-SLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYLR+Y TF  TARYWTEAFAK  S G++EKVQKLVEMGFPE  VRSTL+
Sbjct  120  DDPQDAVVAQQYLRDYPTFAATARYWTEAFAKSASTGMEEKVQKLVEMGFPEDLVRSTLK  179

Query  146  LVGWDENXALERLCSS  99
             V  DEN ALE+LCS 
Sbjct  180  SVDGDENMALEKLCSG  195



>ref|XP_006645263.1| PREDICTED: ubiquitin-conjugating enzyme E2 27-like [Oryza brachyantha]
Length=195

 Score =   199 bits (507),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 114/136 (84%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P GYPFEPPKM+F TKVWH NISSQ+GAICLDI KDQWSPALT KTAL S+QALL AP P
Sbjct  60   PGGYPFEPPKMQFITKVWHPNISSQNGAICLDILKDQWSPALTLKTALLSLQALLSAPAP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKP-SLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYLR+Y TF  TARYWTEAFAK  S G++EKVQKLVEMGFPE  VRS L+
Sbjct  120  DDPQDAVVAQQYLRDYSTFSATARYWTEAFAKSTSTGMEEKVQKLVEMGFPEDMVRSVLK  179

Query  146  LVGWDENXALERLCSS  99
             V  DEN ALE+LCS 
Sbjct  180  SVNGDENMALEKLCSG  195



>ref|XP_004971132.1| PREDICTED: ubiquitin-conjugating enzyme E2 27-like [Setaria italica]
Length=195

 Score =   199 bits (506),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 115/136 (85%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P GYPFEPPKM+F TKVWH NISSQ+GAICLDI KDQWSPALT KTAL S+QALL +P P
Sbjct  60   PGGYPFEPPKMQFVTKVWHPNISSQNGAICLDILKDQWSPALTLKTALLSLQALLSSPAP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKP-SLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYLR+Y TF  TARYWTEAFAK  S G++EKVQKLVEMGFPE  VRSTL+
Sbjct  120  DDPQDAVVAQQYLRDYPTFAATARYWTEAFAKSASTGMEEKVQKLVEMGFPEDLVRSTLK  179

Query  146  LVGWDENXALERLCSS  99
             V  DEN ALE+LCS 
Sbjct  180  SVDGDENLALEKLCSG  195



>ref|XP_008801125.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Phoenix dactylifera]
Length=196

 Score =   197 bits (502),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 115/133 (86%), Gaps = 1/133 (1%)
 Frame = -2

Query  494  YPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPDDP  315
            YPFEPPKM+F TKVWH NISSQ+GAICLDI KDQWSPALT KTAL S+QALL APEPDDP
Sbjct  64   YPFEPPKMQFITKVWHPNISSQNGAICLDILKDQWSPALTLKTALLSLQALLSAPEPDDP  123

Query  314  QDAVVAQQYLREYQTFLGTARYWTEAFAKPSL-GVDEKVQKLVEMGFPEAQVRSTLELVG  138
            QDAVVAQQYLR+Y TF+ TARYWTEAFAK +L G++EKVQKLVEMGF E  VR+TLE V 
Sbjct  124  QDAVVAQQYLRQYPTFVATARYWTEAFAKRTLVGIEEKVQKLVEMGFSEDLVRNTLESVN  183

Query  137  WDENXALERLCSS  99
             DEN ALE+LCS 
Sbjct  184  GDENLALEKLCSG  196



>gb|ABK21242.1| unknown [Picea sitchensis]
 gb|ADE77183.1| unknown [Picea sitchensis]
Length=195

 Score =   197 bits (501),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 116/136 (85%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPFEPPKM+F TKVWH NISSQ+GAICLDI KDQWSPALT KTAL S+QALL APEP
Sbjct  60   PAAYPFEPPKMQFMTKVWHPNISSQNGAICLDILKDQWSPALTLKTALLSLQALLSAPEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPS-LGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQ+ R+Y T++ TARYWTEAFAK + LG++EKVQKLVEMGFPE  VR+TLE
Sbjct  120  DDPQDAVVAQQFRRDYATYVSTARYWTEAFAKGAYLGMEEKVQKLVEMGFPEDMVRTTLE  179

Query  146  LVGWDENXALERLCSS  99
              G DEN ALE+LCS 
Sbjct  180  QCGGDENMALEKLCSG  195



>ref|XP_003564977.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Brachypodium distachyon]
Length=196

 Score =   197 bits (500),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 113/136 (83%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P GYPFEPPKM+F TKVWH NISSQ+GAICLDI KDQWSPALT KTAL S+QALL  P P
Sbjct  61   PGGYPFEPPKMQFITKVWHPNISSQNGAICLDILKDQWSPALTLKTALLSLQALLSTPAP  120

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKP-SLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYLR+  TFL TARYWTEAFAK  S G++EKVQKLVEMGFPE  VRS L 
Sbjct  121  DDPQDAVVAQQYLRDKSTFLNTARYWTEAFAKSDSTGMEEKVQKLVEMGFPEDMVRSALL  180

Query  146  LVGWDENXALERLCSS  99
             V  DEN ALE+LCSS
Sbjct  181  SVNGDENMALEKLCSS  196



>emb|CDM85817.1| unnamed protein product [Triticum aestivum]
Length=196

 Score =   197 bits (500),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 115/136 (85%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P GYPFEPPKM+F TKVWH NISSQ+GAICLDI KDQWSPALT KTAL S+QALL AP P
Sbjct  61   PGGYPFEPPKMQFITKVWHPNISSQNGAICLDILKDQWSPALTLKTALLSLQALLSAPAP  120

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYLR+  TF+ TARYWTEAFAK  S G++EKVQKLVEMGFPE +VRS L+
Sbjct  121  DDPQDAVVAQQYLRDKATFVSTARYWTEAFAKGDSTGMEEKVQKLVEMGFPEDKVRSALK  180

Query  146  LVGWDENXALERLCSS  99
             V  DEN ALE+LCS 
Sbjct  181  SVNGDENLALEKLCSG  196



>ref|XP_006844560.1| hypothetical protein AMTR_s00016p00186510 [Amborella trichopoda]
 gb|ERN06235.1| hypothetical protein AMTR_s00016p00186510 [Amborella trichopoda]
Length=192

 Score =   195 bits (496),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 114/134 (85%), Gaps = 1/134 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPFEPPKM+F TKVWH NISSQ+GAICLDI KDQWSPALT KTAL S+QALL +P P
Sbjct  59   PASYPFEPPKMQFLTKVWHPNISSQNGAICLDILKDQWSPALTLKTALLSLQALLSSPAP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQY ++Y TF+ TARYWTE FAK  SLG++EKVQKLVEMGFPE+QVR+ LE
Sbjct  119  DDPQDAVVAQQYNQDYPTFVSTARYWTETFAKRSSLGIEEKVQKLVEMGFPESQVRTALE  178

Query  146  LVGWDENXALERLC  105
              G DEN ALE+LC
Sbjct  179  TCGGDENLALEKLC  192



>ref|XP_010908213.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 isoform X1 [Elaeis 
guineensis]
Length=215

 Score =   192 bits (487),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 117/155 (75%), Gaps = 21/155 (14%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVW--------------------HXNISSQSGAICLDIXKDQWSP  384
            P GYPFEPPKM+F TKVW                    H NISSQ+GAICLDI KDQWSP
Sbjct  60   PSGYPFEPPKMQFITKVWLTSTQSTQHTLLSLWSLFVLHPNISSQNGAICLDILKDQWSP  119

Query  383  ALTXKTALXSIQALLXAPEPDDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDE  207
            ALT KTAL S+QALL APEPDDPQDAVVAQQYLR+Y TF+ TARYWTE FAK  S+G++E
Sbjct  120  ALTLKTALLSLQALLSAPEPDDPQDAVVAQQYLRDYPTFVATARYWTEVFAKRTSVGIEE  179

Query  206  KVQKLVEMGFPEAQVRSTLELVGWDENXALERLCS  102
            KVQKLVEMGFPE  VR+TLE V  DEN ALE+LCS
Sbjct  180  KVQKLVEMGFPEDLVRNTLESVNGDENMALEKLCS  214



>ref|XP_001755212.1| predicted protein [Physcomitrella patens]
 gb|EDQ80156.1| predicted protein [Physcomitrella patens]
Length=194

 Score =   190 bits (482),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 110/136 (81%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPFEPPKM+F TKVWH NISSQ+GAICLDI KDQWSPALT KTAL S+QALL  PEP
Sbjct  59   PSAYPFEPPKMQFVTKVWHPNISSQNGAICLDILKDQWSPALTLKTALLSLQALLSTPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVAQQYLR+Y TF+GTARYWTE+FAK  +LG+ EK+ KLVEMGF E   R  LE
Sbjct  119  DDPQDAVVAQQYLRDYATFMGTARYWTESFAKRGALGIKEKLVKLVEMGFSEDTARVALE  178

Query  146  LVGWDENXALERLCSS  99
              G DEN ALE+LC  
Sbjct  179  NCGGDENAALEKLCGG  194



>gb|EMT06415.1| Ubiquitin carrier protein E2 27 [Aegilops tauschii]
Length=227

 Score =   182 bits (461),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 114/167 (68%), Gaps = 32/167 (19%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P GYPFEPPKM+F TKVWH NISSQ+GAICLDI KDQWSPALT KTAL S+QALL AP P
Sbjct  61   PGGYPFEPPKMQFITKVWHPNISSQNGAICLDILKDQWSPALTLKTALLSLQALLSAPAP  120

Query  323  DDPQDAVVAQQ-------------------------------YLREYQTFLGTARYWTEA  237
            DDPQDAVVAQQ                               YLR+  TF+ TARYWTEA
Sbjct  121  DDPQDAVVAQQLVLDDSLGLILKPSGKFRVVIGLLSVLDNYLYLRDKATFVSTARYWTEA  180

Query  236  FAKP-SLGVDEKVQKLVEMGFPEAQVRSTLELVGWDENXALERLCSS  99
            FAK  S G++EKVQKLVEMGFPE  VRSTL  V  DEN ALE+LCS 
Sbjct  181  FAKSDSTGMEEKVQKLVEMGFPEDMVRSTLLSVNGDENMALEKLCSG  227



>ref|XP_006374566.1| hypothetical protein POPTR_0015s11460g [Populus trichocarpa]
 gb|ERP52363.1| hypothetical protein POPTR_0015s11460g [Populus trichocarpa]
Length=131

 Score =   178 bits (451),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 97/119 (82%), Gaps = 8/119 (7%)
 Frame = -2

Query  458  KVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPDDPQDAVVAQQYLRE  279
            K+ H NISSQSGAICLDI KDQWSPALT KTAL S+QALL APEPDDPQDAVVAQQYLR+
Sbjct  20   KLEHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPEPDDPQDAVVAQQYLRD  79

Query  278  YQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLELVGWDENXALERLCS  102
            YQTF+GTAR         SLGV+EKVQKLVEMGFPE+  R  LE VG DEN ALE+LCS
Sbjct  80   YQTFVGTAR--------SSLGVEEKVQKLVEMGFPESLARGALESVGGDENLALEKLCS  130



>ref|XP_002991561.1| ubiquitin-conjugating enzyme 27, E2 [Selaginella moellendorffii]
 gb|EFJ07315.1| ubiquitin-conjugating enzyme 27, E2 [Selaginella moellendorffii]
Length=193

 Score =   177 bits (450),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 107/135 (79%), Gaps = 1/135 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPFEPPKM+F TKVWH NISSQ+GAICLDI KDQWSPALT KTAL S+QALL  PEP
Sbjct  59   PSAYPFEPPKMQFITKVWHPNISSQNGAICLDILKDQWSPALTLKTALLSLQALLSTPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKVQKLVEMGFPEAQVRSTLE  147
             DPQDAVVA+QYLREY  F  TARYWTE+FAK  SLG++EKV KLVEMGF +    + LE
Sbjct  119  GDPQDAVVAKQYLREYPVFESTARYWTESFAKRSSLGMEEKVAKLVEMGFTDEVATAALE  178

Query  146  LVGWDENXALERLCS  102
              G DEN ALE+L S
Sbjct  179  CCGGDENAALEKLLS  193



>ref|XP_009032291.1| hypothetical protein AURANDRAFT_69594 [Aureococcus anophagefferens]
 gb|EGB12630.1| hypothetical protein AURANDRAFT_69594 [Aureococcus anophagefferens]
Length=196

 Score =   173 bits (439),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 99/138 (72%), Gaps = 2/138 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P GYPFEPPKMKF TK+WH NISSQ+GAICLDI KDQWSPALT KTAL S+QALL +PEP
Sbjct  59   PSGYPFEPPKMKFLTKIWHPNISSQTGAICLDILKDQWSPALTIKTALLSLQALLCSPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKP--SLGVDEKVQKLVEMGFPEAQVRSTL  150
            DDPQDA VAQ YL E  TF  TA++WTE +A+P  +   D  V +LVEMGF   QV   L
Sbjct  119  DDPQDAQVAQMYLNEPDTFKQTAKFWTETYARPKEAGAEDAAVARLVEMGFSREQVVKAL  178

Query  149  ELVGWDENXALERLCSSA  96
                 DEN A+  L S A
Sbjct  179  ADAKGDENEAVTALLSGA  196



>ref|XP_002971734.1| ubiquitin-conjugating enzyme 27, E2 [Selaginella moellendorffii]
 gb|EFJ27483.1| ubiquitin-conjugating enzyme 27, E2 [Selaginella moellendorffii]
Length=195

 Score =   173 bits (438),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 107/137 (78%), Gaps = 3/137 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPFEPPKM+F TKVWH NISSQ+GAICLDI KDQWSPALT KTAL S+QALL  PEP
Sbjct  59   PSAYPFEPPKMQFITKVWHPNISSQNGAICLDILKDQWSPALTLKTALLSLQALLSTPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEK--VQKLVEMGFPEAQVRST  153
             DPQDAVVA+QYLREY  F  TARYWTE+FAK  SLG++EK  V KLVEMGF +    + 
Sbjct  119  GDPQDAVVAKQYLREYPVFESTARYWTESFAKRSSLGMEEKVLVAKLVEMGFTDEVATAA  178

Query  152  LELVGWDENXALERLCS  102
            LE  G DEN ALE+L S
Sbjct  179  LECCGGDENAALEKLLS  195



>ref|XP_002906044.1| ubiquitin-conjugating enzyme E2, putative [Phytophthora infestans 
T30-4]
 gb|EEY67396.1| ubiquitin-conjugating enzyme E2, putative [Phytophthora infestans 
T30-4]
Length=196

 Score =   173 bits (438),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPFEPP+M+F TK+WH NISSQ+GAICLDI KD WSPALT KTAL SIQALL A EP
Sbjct  60   PPKYPFEPPQMRFLTKIWHPNISSQTGAICLDILKDAWSPALTIKTALLSIQALLSAAEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPS-LGVDEKVQKLVEMGFPEAQVRSTLE  147
             DPQDA VA+ YL +++ FL TAR+WTE++AK +  G D  + +L++MGFP  Q ++ L+
Sbjct  120  TDPQDAEVAKMYLHDHEQFLNTARFWTESYAKQTETGDDAALSRLLDMGFPADQAKAALQ  179

Query  146  LVGWDENXALERLCSS  99
                DEN A+E+L SS
Sbjct  180  AANGDENAAIEKLVSS  195



>ref|XP_008900048.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETI54310.1| hypothetical protein, variant [Phytophthora parasitica P1569]
 gb|ETK94162.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL47554.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETM00646.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETM53827.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETN14478.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETP24129.1| hypothetical protein, variant [Phytophthora parasitica CJ01A1]
Length=196

 Score =   172 bits (436),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPFEPP+M+F TK+WH NISSQ+GAICLDI KD WSPALT KTAL SIQALL A EP
Sbjct  60   PPKYPFEPPQMRFLTKIWHPNISSQTGAICLDILKDAWSPALTIKTALLSIQALLSAAEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPS-LGVDEKVQKLVEMGFPEAQVRSTLE  147
             DPQDA VA+ YL +++ FL TAR+WTE++AK +  G D  + +L++MGFP  + ++ L+
Sbjct  120  TDPQDAEVAKMYLHDHEQFLNTARFWTESYAKQTETGDDAALSRLIDMGFPADKAKAALQ  179

Query  146  LVGWDENXALERLCSS  99
                DEN A+E+L SS
Sbjct  180  AANGDENAAIEKLVSS  195



>gb|ETP52116.1| hypothetical protein, variant [Phytophthora parasitica P10297]
Length=196

 Score =   172 bits (436),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPFEPP+M+F TK+WH NISSQ+GAICLDI KD WSPALT KTAL SIQALL A EP
Sbjct  60   PPKYPFEPPQMRFLTKIWHPNISSQTGAICLDILKDAWSPALTIKTALLSIQALLSAAEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPS-LGVDEKVQKLVEMGFPEAQVRSTLE  147
             DPQDA VA+ YL +++ FL TAR+WTE++AK +  G D  + +L++MGFP  + ++ L+
Sbjct  120  TDPQDAEVAKMYLHDHEQFLNTARFWTESYAKQTETGDDAALSRLIDMGFPADKAKAALQ  179

Query  146  LVGWDENXALERLCSS  99
                DEN A+E+L SS
Sbjct  180  AANGDENAAIEKLVSS  195



>gb|ETO83061.1| hypothetical protein, variant [Phytophthora parasitica P1976]
Length=196

 Score =   172 bits (436),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPFEPP+M+F TK+WH NISSQ+GAICLDI KD WSPALT KTAL SIQALL A EP
Sbjct  60   PPKYPFEPPQMRFLTKIWHPNISSQTGAICLDILKDAWSPALTIKTALLSIQALLSAAEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPS-LGVDEKVQKLVEMGFPEAQVRSTLE  147
             DPQDA VA+ YL +++ FL TAR+WTE++AK +  G D  + +L++MGFP  + ++ L+
Sbjct  120  TDPQDAEVAKMYLHDHEQFLNTARFWTESYAKQTETGDDAALSRLIDMGFPADKAKAALQ  179

Query  146  LVGWDENXALERLCSS  99
                DEN A+E+L SS
Sbjct  180  AANGDENAAIEKLVSS  195



>ref|XP_008900047.1| hypothetical protein PPTG_07524 [Phytophthora parasitica INRA-310]
 gb|ETM00645.1| hypothetical protein L917_02649 [Phytophthora parasitica]
 gb|ETN14477.1| hypothetical protein PPTG_07524 [Phytophthora parasitica INRA-310]
Length=217

 Score =   172 bits (437),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPFEPP+M+F TK+WH NISSQ+GAICLDI KD WSPALT KTAL SIQALL A EP
Sbjct  81   PPKYPFEPPQMRFLTKIWHPNISSQTGAICLDILKDAWSPALTIKTALLSIQALLSAAEP  140

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPS-LGVDEKVQKLVEMGFPEAQVRSTLE  147
             DPQDA VA+ YL +++ FL TAR+WTE++AK +  G D  + +L++MGFP  + ++ L+
Sbjct  141  TDPQDAEVAKMYLHDHEQFLNTARFWTESYAKQTETGDDAALSRLIDMGFPADKAKAALQ  200

Query  146  LVGWDENXALERLCSS  99
                DEN A+E+L SS
Sbjct  201  AANGDENAAIEKLVSS  216



>gb|ETP52115.1| hypothetical protein F442_02826 [Phytophthora parasitica P10297]
Length=217

 Score =   172 bits (437),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPFEPP+M+F TK+WH NISSQ+GAICLDI KD WSPALT KTAL SIQALL A EP
Sbjct  81   PPKYPFEPPQMRFLTKIWHPNISSQTGAICLDILKDAWSPALTIKTALLSIQALLSAAEP  140

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPS-LGVDEKVQKLVEMGFPEAQVRSTLE  147
             DPQDA VA+ YL +++ FL TAR+WTE++AK +  G D  + +L++MGFP  + ++ L+
Sbjct  141  TDPQDAEVAKMYLHDHEQFLNTARFWTESYAKQTETGDDAALSRLIDMGFPADKAKAALQ  200

Query  146  LVGWDENXALERLCSS  99
                DEN A+E+L SS
Sbjct  201  AANGDENAAIEKLVSS  216



>gb|ETO83060.1| hypothetical protein F444_02862 [Phytophthora parasitica P1976]
Length=217

 Score =   172 bits (437),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPFEPP+M+F TK+WH NISSQ+GAICLDI KD WSPALT KTAL SIQALL A EP
Sbjct  81   PPKYPFEPPQMRFLTKIWHPNISSQTGAICLDILKDAWSPALTIKTALLSIQALLSAAEP  140

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPS-LGVDEKVQKLVEMGFPEAQVRSTLE  147
             DPQDA VA+ YL +++ FL TAR+WTE++AK +  G D  + +L++MGFP  + ++ L+
Sbjct  141  TDPQDAEVAKMYLHDHEQFLNTARFWTESYAKQTETGDDAALSRLIDMGFPADKAKAALQ  200

Query  146  LVGWDENXALERLCSS  99
                DEN A+E+L SS
Sbjct  201  AANGDENAAIEKLVSS  216



>gb|ETI54309.1| hypothetical protein F443_02851 [Phytophthora parasitica P1569]
 gb|ETK94161.1| hypothetical protein L915_02737 [Phytophthora parasitica]
 gb|ETL47553.1| hypothetical protein L916_02711 [Phytophthora parasitica]
 gb|ETM53826.1| hypothetical protein L914_02731 [Phytophthora parasitica]
 gb|ETP24128.1| hypothetical protein F441_02829 [Phytophthora parasitica CJ01A1]
Length=217

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPFEPP+M+F TK+WH NISSQ+GAICLDI KD WSPALT KTAL SIQALL A EP
Sbjct  81   PPKYPFEPPQMRFLTKIWHPNISSQTGAICLDILKDAWSPALTIKTALLSIQALLSAAEP  140

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPS-LGVDEKVQKLVEMGFPEAQVRSTLE  147
             DPQDA VA+ YL +++ FL TAR+WTE++AK +  G D  + +L++MGFP  + ++ L+
Sbjct  141  TDPQDAEVAKMYLHDHEQFLNTARFWTESYAKQTETGDDAALSRLIDMGFPADKAKAALQ  200

Query  146  LVGWDENXALERLCSS  99
                DEN A+E+L SS
Sbjct  201  AANGDENAAIEKLVSS  216



>emb|CCD28097.1| ubiquitin-conjugating enzyme, partial [Plasmopara viticola]
Length=197

 Score =   171 bits (433),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 100/133 (75%), Gaps = 1/133 (1%)
 Frame = -2

Query  494  YPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPDDP  315
            YPFEPP+M+F TK+WH NISSQ+GAICLDI KD WSPALT KTAL SIQALL A EP DP
Sbjct  64   YPFEPPQMRFLTKIWHPNISSQTGAICLDILKDAWSPALTIKTALLSIQALLSAAEPTDP  123

Query  314  QDAVVAQQYLREYQTFLGTARYWTEAFAKPS-LGVDEKVQKLVEMGFPEAQVRSTLELVG  138
            QDA VA+ YL ++  FL TAR+WTE++AKP   G D  + +L++MGFP  + ++ L+   
Sbjct  124  QDAEVAKMYLNDHTQFLKTARFWTESYAKPKDAGDDAALSRLMDMGFPSEKAKAALQATN  183

Query  137  WDENXALERLCSS  99
             DEN A+E L S+
Sbjct  184  GDENAAIEHLIST  196



>ref|XP_001689734.1| ubiquitin conjugating enzyme [Chlamydomonas reinhardtii]
 gb|EDP09472.1| ubiquitin conjugating enzyme [Chlamydomonas reinhardtii]
Length=194

 Score =   166 bits (420),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 105/132 (80%), Gaps = 1/132 (1%)
 Frame = -2

Query  500  DGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPD  321
            +GYPF PPKM+F  KVWH N+SSQSGAICLDI KDQWSPALT KTAL S+QALL +P+PD
Sbjct  61   NGYPFVPPKMRFINKVWHPNVSSQSGAICLDILKDQWSPALTLKTALLSLQALLSSPQPD  120

Query  320  DPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGV-DEKVQKLVEMGFPEAQVRSTLEL  144
            DPQDAVVA+QY+ +++T+  TA+YWTEAFA P+    +EK+ K+VEMGF  A   S L+ 
Sbjct  121  DPQDAVVAKQYISDHETYKKTAKYWTEAFANPNATAPEEKIAKIVEMGFDRAAAISALQE  180

Query  143  VGWDENXALERL  108
             G DEN ALE+L
Sbjct  181  AGGDENAALEKL  192



>emb|CBJ30375.1| ubiquitin-conjugating enzyme 1 [Ectocarpus siliculosus]
Length=357

 Score =   171 bits (432),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 100/138 (72%), Gaps = 2/138 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P GYPFEPPKMKFATK+WH NISSQ+GAICLDI KDQWSPALT KTAL S+QAL+ +PEP
Sbjct  220  PSGYPFEPPKMKFATKIWHPNISSQTGAICLDILKDQWSPALTIKTALLSLQALMCSPEP  279

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA--KPSLGVDEKVQKLVEMGFPEAQVRSTL  150
            DDPQDA VA  Y     T+  TA++WTE +A  +   G ++ V+++ +MGFPEAQ R  L
Sbjct  280  DDPQDAEVANMYKINRDTYNQTAKFWTETYAQVRDPGGNEDVVRRVCDMGFPEAQARRAL  339

Query  149  ELVGWDENXALERLCSSA  96
                WDE  A+  L S +
Sbjct  340  ASNDWDETAAINTLLSGS  357



>ref|XP_009533974.1| hypothetical protein PHYSODRAFT_518543, partial [Phytophthora 
sojae]
 gb|EGZ11229.1| hypothetical protein PHYSODRAFT_518543 [Phytophthora sojae]
Length=195

 Score =   166 bits (419),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 102/136 (75%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPFEPP+M+F TK+WH NISSQ+GAICLDI KD WSPALT KTAL SIQALL A EP
Sbjct  59   PPKYPFEPPQMRFITKIWHPNISSQTGAICLDILKDAWSPALTIKTALLSIQALLSAAEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPS-LGVDEKVQKLVEMGFPEAQVRSTLE  147
             DPQDA VA+ YL +++ FL TAR+WTE++A+ +  G D  + +L++MGFP  + ++ L 
Sbjct  119  TDPQDAEVAKMYLHDHEQFLSTARFWTESYARQTDTGDDAALSRLIDMGFPADKAKAALL  178

Query  146  LVGWDENXALERLCSS  99
                DEN A+E+L SS
Sbjct  179  AANGDENAAIEKLVSS  194



>gb|EJY66901.1| Ubiquitin-conjugating enzyme, putative [Oxytricha trifallax]
 gb|EJY74558.1| Ubiquitin-conjugating enzyme, putative [Oxytricha trifallax]
Length=195

 Score =   164 bits (416),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPF+PPKM+F TK+WH NISSQ+GAICLDI K++W+PALT +TAL S+QALL APEP
Sbjct  62   PSEYPFKPPKMRFITKIWHPNISSQTGAICLDILKNEWTPALTIRTALISLQALLCAPEP  121

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
            DDPQDA VA+QY  + + +  TA+ WTE FAK    VD+KV+KL+EMGFPE   R  L+ 
Sbjct  122  DDPQDAEVARQYKSDKKLYEYTAKQWTENFAKEQT-VDDKVRKLMEMGFPEDMCRDALQR  180

Query  143  VGWDENXALERL  108
               DEN AL  L
Sbjct  181  YDMDENLALNYL  192



>ref|XP_004032164.1| ubiquitin-conjugating enzyme family protein, putative [Ichthyophthirius 
multifiliis]
 gb|EGR30577.1| ubiquitin-conjugating enzyme family protein, putative [Ichthyophthirius 
multifiliis]
Length=196

 Score =   164 bits (416),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YP++PPKMKF T++WH NISSQ+GAICLDI K++WSPAL+ +TAL S+QAL+ APEP
Sbjct  62   PSEYPYKPPKMKFDTRIWHPNISSQTGAICLDILKNEWSPALSIRTALLSLQALMCAPEP  121

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
            DDPQDAVVAQQY  +   ++ TA+ WT+ +A  +   DEKV+KLVEMGF E Q R  L  
Sbjct  122  DDPQDAVVAQQYKNQKDQYIKTAKEWTKNYANTN-AQDEKVKKLVEMGFEEKQCREALMK  180

Query  143  VGWDENXALERL  108
             GW+E  +L  L
Sbjct  181  FGWEEELSLNYL  192



>ref|XP_009533884.1| hypothetical protein PHYSODRAFT_518528, partial [Phytophthora 
sojae]
 gb|EGZ11139.1| hypothetical protein PHYSODRAFT_518528 [Phytophthora sojae]
Length=195

 Score =   163 bits (413),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 101/136 (74%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPFEPP+M+F TK+WH NISSQ+GAICLDI KD WSPALT KTAL SIQALL A EP
Sbjct  59   PPKYPFEPPQMRFITKIWHPNISSQTGAICLDILKDAWSPALTIKTALLSIQALLSAAEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPS-LGVDEKVQKLVEMGFPEAQVRSTLE  147
             DPQDA VA+ YL +++ FL TAR+WTE++A+ +  G D  + +L++M FP  + ++ L 
Sbjct  119  TDPQDAEVAKMYLHDHEQFLSTARFWTESYARQTDTGDDAALSRLIDMAFPADKAKAALL  178

Query  146  LVGWDENXALERLCSS  99
                DEN A+E+L SS
Sbjct  179  AANGDENAAIEKLVSS  194



>ref|XP_002952512.1| hypothetical protein VOLCADRAFT_62621 [Volvox carteri f. nagariensis]
 gb|EFJ46359.1| hypothetical protein VOLCADRAFT_62621 [Volvox carteri f. nagariensis]
Length=214

 Score =   164 bits (414),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 101/130 (78%), Gaps = 1/130 (1%)
 Frame = -2

Query  494  YPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPDDP  315
            YPF PPKM F TKVWH N+SSQSGAICLDI K+QWSPALT KTAL  +QALL +P+PDDP
Sbjct  81   YPFVPPKMTFLTKVWHPNVSSQSGAICLDILKEQWSPALTLKTALLCLQALLASPQPDDP  140

Query  314  QDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGV-DEKVQKLVEMGFPEAQVRSTLELVG  138
            QDAVVA+QYL +++T+  TARYWTEAFA P     DEKV+++VEMGF  A     L+  G
Sbjct  141  QDAVVAKQYLNDFETYKKTARYWTEAFANPKADAPDEKVERIVEMGFDRAAAIQALQRAG  200

Query  137  WDENXALERL  108
             DEN ALE+L
Sbjct  201  GDENAALEQL  210



>emb|CDW82190.1| ubiquitin-conjugating enzyme e2 27-like [Stylonychia lemnae]
Length=211

 Score =   162 bits (411),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPF+PPKM+F TK+WH NISSQ+GAICLDI K++W+PALT +TAL S+QALL APEP
Sbjct  78   PGEYPFKPPKMRFITKIWHPNISSQTGAICLDILKNEWTPALTIRTALISLQALLCAPEP  137

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
            DDPQDA VA+QY  + + +  TA+ WTE FAK    VD+KV+KL+EMGFPE   +  LE 
Sbjct  138  DDPQDAEVARQYKSDKKLYEYTAKMWTENFAKEQT-VDDKVKKLMEMGFPEDICKEALER  196

Query  143  VGWDENXALERL  108
               DEN AL  L
Sbjct  197  YDNDENLALNFL  208



>ref|XP_666164.1| ubiquitin-conjugating enzyme [Cryptosporidium hominis TU502]
Length=151

 Score =   160 bits (406),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YP+EPPK+KF T++WH NISSQ+GAICLDI KD WSPALT +T + SIQALL +PEP
Sbjct  17   PKEYPYEPPKVKFITRIWHPNISSQTGAICLDILKDAWSPALTLRTVMLSIQALLSSPEP  76

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
            +DPQDA+VA  Y  +YQ ++ TA+ WT+ +AKP+   +E++++ ++MGF    + + LE 
Sbjct  77   NDPQDALVASLYKSDYQEYIETAKSWTQMYAKPT-SKEERIKRFLDMGFNRESIITALER  135

Query  143  VGWDENXALERL  108
              WDEN AL  L
Sbjct  136  NNWDENLALNEL  147



>ref|XP_009842907.1| hypothetical protein H257_16240 [Aphanomyces astaci]
 gb|ETV67650.1| hypothetical protein H257_16240 [Aphanomyces astaci]
Length=194

 Score =   162 bits (409),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 98/137 (72%), Gaps = 3/137 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPFEPPK++F TK+WH NISSQ+GAICLDI KD WSPALT KT L SIQALL A EP
Sbjct  58   PKTYPFEPPKVRFDTKIWHPNISSQTGAICLDILKDAWSPALTIKTTLLSIQALLSAAEP  117

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA--KPSLGVDEKVQKLVEMGFPEAQVRSTL  150
             DPQDA VA+ Y+ +   F  TA +WT+++A  K   G D  VQ+LV+MGFP+ QVR  L
Sbjct  118  TDPQDAEVARMYINDKDRFNNTAAFWTQSYATEKGDAGSD-AVQRLVDMGFPKDQVRQAL  176

Query  149  ELVGWDENXALERLCSS  99
                 DEN A+ERL +S
Sbjct  177  AETKGDENAAVERLLTS  193



>ref|XP_005827196.1| hypothetical protein GUITHDRAFT_154189 [Guillardia theta CCMP2712]
 gb|EKX40216.1| hypothetical protein GUITHDRAFT_154189 [Guillardia theta CCMP2712]
Length=191

 Score =   160 bits (406),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 95/133 (71%), Gaps = 2/133 (2%)
 Frame = -2

Query  494  YPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPDDP  315
            YPFEPPKMKF TK+WH N+SSQ+GAICLDI K +WSPALT KTAL S+QALL APEPDDP
Sbjct  61   YPFEPPKMKFNTKIWHPNVSSQTGAICLDILKKEWSPALTIKTALISVQALLAAPEPDDP  120

Query  314  QDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLELVGW  135
            QDAVVAQ+Y    + F  TA+ WTE +AK   G  E +Q L++MGF E Q +  L     
Sbjct  121  QDAVVAQEYKSSIEKFKATAKLWTERYAKE--GSMESIQPLLDMGFSEEQAKDALLEARG  178

Query  134  DENXALERLCSSA  96
            D   A+E+L S A
Sbjct  179  DVQAAVEKLLSGA  191



>ref|XP_625630.1| Ubc1p like ubiquitin-conjugating enzyme E2 fused to a UBA domain 
(UBC+UBA) [Cryptosporidium parvum Iowa II]
 gb|EAK87733.1| Ubc1p like ubiquitin-conjugating enzyme E2 fused to a UBA domain 
(UBC+UBA) [Cryptosporidium parvum Iowa II]
Length=197

 Score =   160 bits (406),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 98/133 (74%), Gaps = 1/133 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YP+EPPK+KF T++WH NISSQ+GAICLDI KD WSPALT +T + SIQALL +PEP
Sbjct  63   PKEYPYEPPKVKFITRIWHPNISSQTGAICLDILKDAWSPALTLRTVMLSIQALLSSPEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
            +DPQDA+VA  Y  +YQ ++ TA+ WT+ +AKP+   +E++++ ++MGF    + + LE 
Sbjct  123  NDPQDALVASLYKSDYQEYIETAKSWTQMYAKPT-SKEERIKRFLDMGFNRESIITALER  181

Query  143  VGWDENXALERLC  105
              WDEN AL  L 
Sbjct  182  NNWDENLALNELL  194



>ref|XP_002112784.1| hypothetical protein TRIADDRAFT_24883 [Trichoplax adhaerens]
 gb|EDV24894.1| hypothetical protein TRIADDRAFT_24883 [Trichoplax adhaerens]
Length=202

 Score =   160 bits (405),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 93/139 (67%), Gaps = 4/139 (3%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF PPKMKF T++WH NISS +GAICLDI KD W+ ALT +T L S+Q LL A EP
Sbjct  64   PDSYPFNPPKMKFITRIWHPNISSVTGAICLDILKDNWAAALTLRTVLMSLQVLLSAAEP  123

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKP----SLGVDEKVQKLVEMGFPEAQVRS  156
            DDPQDAVVA+QY      F+ TAR+W+EA+AK     +    EKV+KL E GF +   R+
Sbjct  124  DDPQDAVVAKQYNENIHLFMKTARHWSEAYAKARPIKTQDFHEKVRKLSETGFSDDSCRT  183

Query  155  TLELVGWDENXALERLCSS  99
             L   GWDE   +E L  S
Sbjct  184  ALSKSGWDEQRGMETLLDS  202



>ref|XP_003056945.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58590.1| predicted protein [Micromonas pusilla CCMP1545]
Length=191

 Score =   160 bits (404),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = -2

Query  500  DGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPD  321
            + YPFEPPKM+F TKVWH N+SS +GAICLDI K+QWSPAL+ KTA+ S+QALL +PEP 
Sbjct  58   NAYPFEPPKMRFITKVWHPNVSSANGAICLDILKEQWSPALSIKTAMLSLQALLSSPEPS  117

Query  320  DPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLELV  141
            DPQDAVVA+QYL +   F  TA+ WTE  AK     DEK++K  EMGFPE  + + L   
Sbjct  118  DPQDAVVARQYLDDIALFNATAKAWTEEHAKDG-AKDEKMEKFKEMGFPEVDIVNALARA  176

Query  140  GWDENXALERLCSS  99
              DE  ALE L + 
Sbjct  177  AGDEAQALELLLTG  190



>ref|XP_003079370.1| putative ubiquitin conjugating enzyme (ISS) [Ostreococcus tauri]
Length=157

 Score =   158 bits (400),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = -2

Query  494  YPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPDDP  315
            YPFEPPKMKF TKVWH N+SS SGAICLD+ KDQWSPALT KTAL S QALL APEPDDP
Sbjct  26   YPFEPPKMKFLTKVWHPNVSSASGAICLDVLKDQWSPALTLKTALLSCQALLAAPEPDDP  85

Query  314  QDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLELVGW  135
            QDAVVA+ Y  E   F  TA+ WT+ FA      D  V +L+EMGF E+ V   L   G 
Sbjct  86   QDAVVAKMYTSERAKFDETAKEWTKKFATKEQK-DPIVGELMEMGFDESMVLKALTKCGG  144

Query  134  DENXALERLCSSA  96
            D+N ALE L   A
Sbjct  145  DKNRALEELLGGA  157



>emb|CEF98001.1| Ubiquitin-conjugating enzyme, active site [Ostreococcus tauri]
Length=192

 Score =   159 bits (402),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = -2

Query  494  YPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPDDP  315
            YPFEPPKMKF TKVWH N+SS SGAICLD+ KDQWSPALT KTAL S QALL APEPDDP
Sbjct  61   YPFEPPKMKFLTKVWHPNVSSASGAICLDVLKDQWSPALTLKTALLSCQALLAAPEPDDP  120

Query  314  QDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLELVGW  135
            QDAVVA+ Y  E   F  TA+ WT+ FA      D  V +L+EMGF E+ V   L   G 
Sbjct  121  QDAVVAKMYTSERAKFDETAKEWTKKFATKEQK-DPIVGELMEMGFDESMVLKALTKCGG  179

Query  134  DENXALERLCSSA  96
            D+N ALE L   A
Sbjct  180  DKNRALEELLGGA  192



>ref|XP_001007905.3| Ubiquitin-conjugating enzyme family protein [Tetrahymena thermophila]
Length=189

 Score =   159 bits (401),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YP++PPKMKF T++WH NISSQ+GAICLDI K++WSPAL+ +TAL S+QAL+ APEP
Sbjct  55   PNDYPYKPPKMKFDTRIWHPNISSQTGAICLDILKNEWSPALSIRTALLSLQALMCAPEP  114

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
            DDPQDAVVA QY  +   FL  A+ WT+ +A  +   DEK++K V+MGF E   R  L  
Sbjct  115  DDPQDAVVAGQYKSQRDQFLKQAKEWTQNYAN-TKSQDEKIKKFVDMGFDEKTSREVLMK  173

Query  143  VGWDENXALERL  108
             GW+E  AL  L
Sbjct  174  YGWEEENALNHL  185



>gb|EAR87660.4| ubiquitin-conjugating enzyme [Tetrahymena thermophila SB210]
Length=196

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YP++PPKMKF T++WH NISSQ+GAICLDI K++WSPAL+ +TAL S+QAL+ APEP
Sbjct  62   PNDYPYKPPKMKFDTRIWHPNISSQTGAICLDILKNEWSPALSIRTALLSLQALMCAPEP  121

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
            DDPQDAVVA QY  +   FL  A+ WT+ +A  +   DEK++K V+MGF E   R  L  
Sbjct  122  DDPQDAVVAGQYKSQRDQFLKQAKEWTQNYAN-TKSQDEKIKKFVDMGFDEKTSREVLMK  180

Query  143  VGWDENXALERL  108
             GW+E  AL  L
Sbjct  181  YGWEEENALNHL  192



>ref|XP_002184246.1| ubiquitin-conjugating enzyme 1 [Phaeodactylum tricornutum CCAP 
1055/1]
 gb|EEC44424.1| ubiquitin-conjugating enzyme 1 [Phaeodactylum tricornutum CCAP 
1055/1]
Length=197

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 97/136 (71%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPFEPPKMKF TKVWH NISSQ+GAICLDI KDQWSPALT KTAL S+ AL+ +PEP
Sbjct  63   PIEYPFEPPKMKFLTKVWHPNISSQTGAICLDILKDQWSPALTIKTALLSLLALMCSPEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
             DPQDA VA+ Y+   + F  TA++WTE++AKPS   ++ + ++ EMGF     R+ LE 
Sbjct  123  GDPQDAEVAKMYMGNREEFDRTAKFWTESYAKPS-SKEDAISRVCEMGFDRESARNALEK  181

Query  143  VGWDENXALERLCSSA  96
              W+E+ A+  L   A
Sbjct  182  HSWNESAAVNALLGGA  197



>ref|XP_008862080.1| hypothetical protein H310_00902 [Aphanomyces invadans]
 gb|ETW08275.1| hypothetical protein H310_00902 [Aphanomyces invadans]
Length=194

 Score =   157 bits (397),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 97/136 (71%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPFEPPK++F TK+WH NISSQ+GAICLDI KD WSPALT KT L SIQALL A EP
Sbjct  58   PKTYPFEPPKVRFETKIWHPNISSQTGAICLDILKDAWSPALTIKTTLLSIQALLSAAEP  117

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA-KPSLGVDEKVQKLVEMGFPEAQVRSTLE  147
             DPQDA VA+ Y+ + + F  TA +WT+ +A + S    E VQ+L++MGFP+ +V   L 
Sbjct  118  TDPQDAEVARMYIHDKERFNSTAAFWTQTYATEKSENDSEAVQRLMDMGFPKDKVHKALA  177

Query  146  LVGWDENXALERLCSS  99
                DEN A+ERL ++
Sbjct  178  EAKGDENAAVERLLTT  193



>ref|XP_008862082.1| hypothetical protein H310_00904 [Aphanomyces invadans]
 gb|ETW08277.1| hypothetical protein H310_00904 [Aphanomyces invadans]
Length=194

 Score =   157 bits (396),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 96/136 (71%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPFEPPK++F TK+WH NISSQ+GAICLDI KD WSPALT KT L SIQALL A EP
Sbjct  58   PKTYPFEPPKVRFETKIWHPNISSQTGAICLDILKDAWSPALTIKTTLLSIQALLSAAEP  117

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVD-EKVQKLVEMGFPEAQVRSTLE  147
             DPQDA VA+ Y+ + + F  TA +WT+ +A      D E VQ+L++MGFP+ +V   L 
Sbjct  118  TDPQDAEVARMYIHDKERFNSTAAFWTQTYATEKSENDCEAVQRLMDMGFPKDKVHKALA  177

Query  146  LVGWDENXALERLCSS  99
                DEN A+ERL ++
Sbjct  178  EAKGDENAAVERLLTT  193



>ref|XP_008885554.1| ubiquitin-conjugating enzyme subfamily protein [Hammondia hammondi]
 gb|KEP64022.1| ubiquitin-conjugating enzyme subfamily protein [Hammondia hammondi]
Length=215

 Score =   156 bits (395),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YP+ PPKMKF TK+WH NISSQ+GAICLDI K +WSPALT +TAL SIQA+L  P P
Sbjct  80   PPDYPYNPPKMKFVTKIWHPNISSQTGAICLDILKHEWSPALTIRTALLSIQAMLADPVP  139

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSL-GVDEKVQKLVEMGFPEAQVRSTLE  147
             DPQDA VA+  +  +  F+ TA+ WTE FAK +    D+KV+KL EMGF E QVR  L 
Sbjct  140  TDPQDAEVAKMMIENHPLFVQTAKLWTETFAKEAQDSHDDKVRKLTEMGFAEDQVREALR  199

Query  146  LVGWDENXALERLC  105
               WDE  AL  L 
Sbjct  200  KHDWDETLALNSLV  213



>ref|XP_009519397.1| hypothetical protein PHYSODRAFT_261502, partial [Phytophthora 
sojae]
 gb|EGZ24109.1| hypothetical protein PHYSODRAFT_261502 [Phytophthora sojae]
Length=178

 Score =   155 bits (391),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPFEPP+M+F TK+WH NISSQ+GAICLDI KD WSPALT KTAL SIQALL A EP
Sbjct  60   PPKYPFEPPQMRFITKIWHPNISSQTGAICLDILKDAWSPALTIKTALLSIQALLSAAEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPS-LGVDEKVQKLVEMGFPEAQVRSTL  150
             DPQDA VA+ YL +++ FL TAR+WTE++A+ +  G D  + +L++MGFP  + ++ L
Sbjct  120  TDPQDAEVAKMYLHDHEQFLSTARFWTESYARQTDTGDDAALSRLIDMGFPADKAKAAL  178



>emb|CCF74909.1| unnamed protein product [Babesia microti strain RI]
Length=208

 Score =   155 bits (392),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 95/144 (66%), Gaps = 8/144 (6%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YP+ PPK+KF TK+WH NISS++GAICLDI K++WSPALT +T L SIQALL APEP
Sbjct  65   PEDYPYNPPKIKFLTKIWHPNISSETGAICLDILKNEWSPALTIRTVLISIQALLSAPEP  124

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA-KPSLGVDEKV-------QKLVEMGFPEA  168
            DDPQDA VA+ YLR+ + F  TAR W + FA K     D+KV        K+VE+GF   
Sbjct  125  DDPQDAEVAKMYLRDIKEFENTARLWVKTFARKNDEQHDDKVGKYLKQINKIVEIGFTRE  184

Query  167  QVRSTLELVGWDENXALERLCSSA  96
            Q    L +  WDE  AL  L  S 
Sbjct  185  QAEKALSVNNWDETIALNYLLEST  208



>ref|XP_002368940.1| ubiquitin-conjugating enzyme, putative [Toxoplasma gondii ME49]
Length=215

 Score =   155 bits (392),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YP+ PPKMKF TK+WH NISSQ+GAICLDI K +WSPALT +TAL SIQA+L  P P
Sbjct  80   PPDYPYNPPKMKFVTKIWHPNISSQTGAICLDILKHEWSPALTIRTALLSIQAMLADPVP  139

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDE-KVQKLVEMGFPEAQVRSTLE  147
             DPQDA VA+  +  +  F+ TA+ WTE FAK +    E KV+KL EMGF E QVR  L 
Sbjct  140  TDPQDAEVAKMMIENHPLFVQTAKLWTETFAKEAQDSHEDKVRKLTEMGFAEDQVREALR  199

Query  146  LVGWDENXALERLC  105
               WDE  AL  L 
Sbjct  200  RHDWDETLALNSLV  213



>ref|XP_008604446.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Saprolegnia diclina VS20]
 gb|EQC41877.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Saprolegnia diclina VS20]
Length=195

 Score =   154 bits (390),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 93/135 (69%), Gaps = 0/135 (0%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPFEPPK++F TKVWH N+SSQ+GAICLD+ KD WSPALT KT L SIQALL A EP
Sbjct  60   PKTYPFEPPKVRFETKVWHPNVSSQTGAICLDVLKDAWSPALTIKTTLLSIQALLSAAEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
             DPQDA VA+ Y+ +   F  TA +WTE++A       E V +L +MGFP+  V+  L  
Sbjct  120  TDPQDAEVAKMYINDKARFDSTAAFWTESYAMGKDSESEAVTRLCDMGFPKDLVKRALAE  179

Query  143  VGWDENXALERLCSS  99
               DEN A+E+L +S
Sbjct  180  TKGDENAAVEKLLTS  194



>gb|KDO32440.1| hypothetical protein SPRG_02917 [Saprolegnia parasitica CBS 223.65]
Length=195

 Score =   154 bits (390),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 93/135 (69%), Gaps = 0/135 (0%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPFEPPK++F TKVWH N+SSQ+GAICLD+ KD WSPALT KT L SIQALL A EP
Sbjct  60   PKTYPFEPPKVRFETKVWHPNVSSQTGAICLDVLKDAWSPALTIKTTLLSIQALLSAAEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
             DPQDA VA+ Y+ +   F  TA +WTE++A       E V +L +MGFP+  V+  L  
Sbjct  120  TDPQDAEVAKMYINDKARFDSTAAFWTESYAMGKDSESEAVTRLCDMGFPKDLVKRALAE  179

Query  143  VGWDENXALERLCSS  99
               DEN A+E+L +S
Sbjct  180  TKGDENAAVEKLLTS  194



>emb|CCA27209.1| ubiquitinconjugating enzyme E2 putative [Albugo laibachii Nc14]
Length=196

 Score =   154 bits (388),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPF PP M+F TK+WH NISSQ+GAICLDI KDQWSPALT KTAL SI ALL A EP
Sbjct  59   PSTYPFAPPTMQFTTKIWHPNISSQTGAICLDILKDQWSPALTIKTALLSILALLSAAEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSL--GVDEKVQKLVEMGFPEAQVRSTL  150
            DDPQDA VA+ YL +Y+ F+ TAR+WTE+FAK S    +   +++LV+MGFP  Q  + L
Sbjct  119  DDPQDAEVARMYLNDYERFVSTARFWTESFAKESTSSAMQASIERLVDMGFPSDQAMTAL  178

Query  149  ELVGWDENXALERLCSS  99
                 DEN A+E+L  S
Sbjct  179  ASCQGDENAAVEKLLGS  195



>ref|XP_008814881.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Plasmodium inui San Antonio 1]
 gb|EUD68651.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Plasmodium inui San Antonio 1]
Length=202

 Score =   154 bits (388),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 95/138 (69%), Gaps = 2/138 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YP+ PPK+KF TK+WH NISSQ+GAICLD+ K++WSPALT +TAL SIQALL  P+P
Sbjct  65   PNDYPYNPPKIKFNTKIWHPNISSQTGAICLDVLKNEWSPALTIRTALLSIQALLSDPQP  124

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA-KPSLGVDEK-VQKLVEMGFPEAQVRSTL  150
            DDPQDA VA+ Y   Y  FL TA  WT+ FA +P L   E  ++K+ EMGF E Q +  L
Sbjct  125  DDPQDAEVAKMYKENYSLFLKTASMWTKTFATRPKLEPREVIIKKITEMGFTEDQAKKAL  184

Query  149  ELVGWDENXALERLCSSA  96
                W+E  AL  L  ++
Sbjct  185  INADWNETLALNTLLENS  202



>emb|CAP33756.2| Protein CBR-UBC-21 [Caenorhabditis briggsae]
Length=200

 Score =   154 bits (388),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 90/134 (67%), Gaps = 4/134 (3%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPFEPPK+KF T+VWH N+SSQ+GAICLDI KD+W+ +LT +T L SIQA++ APEP
Sbjct  63   PDQYPFEPPKVKFVTRVWHPNVSSQTGAICLDILKDKWAASLTLRTVLLSIQAMMCAPEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVD----EKVQKLVEMGFPEAQVRS  156
             DPQDAVVA+QY+  Y  F  TA YWT  FA     VD    +KV +LVEMG  E +   
Sbjct  123  SDPQDAVVAKQYISNYPMFKATATYWTSVFADSKREVDKDFQKKVNRLVEMGIREGEAIG  182

Query  155  TLELVGWDENXALE  114
             L    W    A++
Sbjct  183  VLSCNNWKLEKAVQ  196



>ref|XP_007514447.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15884.1| predicted protein [Bathycoccus prasinos]
Length=195

 Score =   153 bits (387),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 93/137 (68%), Gaps = 4/137 (3%)
 Frame = -2

Query  500  DGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPD  321
            + YPFEPPKMKF TKVWH N+SSQSGAICLD+ KDQW+PALT KTAL S+QALL A EPD
Sbjct  58   NSYPFEPPKMKFLTKVWHPNVSSQSGAICLDVLKDQWTPALTIKTALLSVQALLAAAEPD  117

Query  320  DPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGV----DEKVQKLVEMGFPEAQVRST  153
            DPQDAVVA+ Y+     F   A+ WTE +AK    V    D KV KL+EMGF E      
Sbjct  118  DPQDAVVAKMYVSNRAQFDLQAKEWTEKYAKEGQKVEAAKDPKVVKLMEMGFGEQDAERA  177

Query  152  LELVGWDENXALERLCS  102
            L    +++  ALE L +
Sbjct  178  LVKCNFNQEEALEYLLA  194



>emb|CCI11036.1| unnamed protein product [Albugo candida]
Length=196

 Score =   153 bits (386),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 98/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPF PP M+F TK+WH NISSQ+GAICLDI KDQWSPALT KTAL SI ALL A EP
Sbjct  59   PSTYPFAPPTMQFTTKIWHPNISSQTGAICLDILKDQWSPALTIKTALLSILALLSAAEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK--PSLGVDEKVQKLVEMGFPEAQVRSTL  150
            +DPQDA VA+ YL +Y  F+ TAR+WTE+FAK   S  + E + +LV+MGFP  QV   L
Sbjct  119  NDPQDAEVARMYLNDYDRFVSTARFWTESFAKECTSSAMQESIDRLVDMGFPSDQVMRAL  178

Query  149  ELVGWDENXALERLCSS  99
                 DEN A+E+L  S
Sbjct  179  ASCEGDENAAVEKLLGS  195



>ref|XP_002295622.1| ubiquitin-conjugating enzyme [Thalassiosira pseudonana CCMP1335]
 gb|ACI64339.1| ubiquitin-conjugating enzyme [Thalassiosira pseudonana CCMP1335]
Length=202

 Score =   153 bits (387),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 89/135 (66%), Gaps = 3/135 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPFEPPKMKF TK+WH N+SSQ+GAICLDI KDQWSPALT KTA+ S+QALL +PEP
Sbjct  65   PKQYPFEPPKMKFETKIWHPNVSSQTGAICLDILKDQWSPALTIKTAMLSLQALLCSPEP  124

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK---PSLGVDEKVQKLVEMGFPEAQVRST  153
             DPQDA VA+ YL     F  TA+YWTE +A         D  + K+ EMGF     R  
Sbjct  125  SDPQDAQVARMYLDNKAEFDRTAKYWTEMYATIDGEKKREDAAIDKVCEMGFDRESARKA  184

Query  152  LELVGWDENXALERL  108
            LE   WDE  A+  L
Sbjct  185  LEKHKWDEGAAVNDL  199



>ref|XP_001417769.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96062.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=192

 Score =   153 bits (386),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = -2

Query  494  YPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPDDP  315
            YPFEPPKMKF TKVWH N+SSQ+GAICLD+ KDQWSPALT KTAL S QALL APEPDDP
Sbjct  61   YPFEPPKMKFLTKVWHPNVSSQTGAICLDVLKDQWSPALTLKTALLSCQALLAAPEPDDP  120

Query  314  QDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLELVGW  135
            QDA VAQ Y      F  TAR WT+ +A      D  V +L+EMGF E  V   L   G 
Sbjct  121  QDAQVAQMYTERRGEFDETARTWTKKYATEDQK-DPVVGELMEMGFSEGAVLKALTKCGG  179

Query  134  DENXALERLCSSA  96
            +++ A+E L   A
Sbjct  180  NKDRAVEELLGGA  192



>ref|XP_002261329.1| ubiquitin-conjugating enzyme [Plasmodium knowlesi strain H]
 emb|CAQ40734.1| ubiquitin-conjugating enzyme, putative [Plasmodium knowlesi strain 
H]
Length=202

 Score =   153 bits (386),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 95/138 (69%), Gaps = 2/138 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YP+ PPK+KF TK+WH NISSQ+GAICLD+ K++WSPALT +TAL SIQALL  P+P
Sbjct  65   PNDYPYNPPKIKFNTKIWHPNISSQTGAICLDVLKNEWSPALTIRTALLSIQALLSDPQP  124

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEK-VQKLVEMGFPEAQVRSTL  150
            DDPQDA VA+ Y   Y  FL TA  WT+ FA  P L   E  ++K+ EMGF E Q ++ L
Sbjct  125  DDPQDAEVAKMYKENYSLFLKTASVWTKTFATGPKLEPREVIIKKITEMGFTEDQAKNAL  184

Query  149  ELVGWDENXALERLCSSA  96
                W+E  AL  L  ++
Sbjct  185  INADWNETLALNTLLENS  202



>ref|XP_001616347.1| Ubiquitin-conjugating enzyme family protein [Plasmodium vivax 
Sal-1]
 gb|EDL46620.1| Ubiquitin-conjugating enzyme family protein [Plasmodium vivax]
Length=202

 Score =   152 bits (385),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 94/138 (68%), Gaps = 2/138 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YP+ PPK+KF TK+WH NISSQ+GAICLD+ K++WSPALT +TAL SIQALL  P+P
Sbjct  65   PNDYPYNPPKIKFNTKIWHPNISSQTGAICLDVLKNEWSPALTIRTALLSIQALLSDPQP  124

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEK-VQKLVEMGFPEAQVRSTL  150
            DDPQDA VA+ Y   Y  FL TA  WT+ FA  P L   E  ++K+ EMGF E Q +  L
Sbjct  125  DDPQDAEVAKMYKENYSLFLKTASVWTKTFATGPKLEPREVIIKKITEMGFTEDQAKKAL  184

Query  149  ELVGWDENXALERLCSSA  96
                W+E  AL  L  ++
Sbjct  185  IKADWNETLALNTLLENS  202



>ref|XP_001350274.1| ubiquitin conjugating enzyme, putative [Plasmodium falciparum 
3D7]
 emb|CAD52683.1| ubiquitin conjugating enzyme, putative [Plasmodium falciparum 
3D7]
 gb|ETW16595.1| hypothetical protein PFFVO_04456 [Plasmodium falciparum Vietnam 
Oak-Knoll (FVO)]
 gb|ETW34518.1| hypothetical protein PFTANZ_04780 [Plasmodium falciparum Tanzania 
(2000708)]
 gb|ETW40714.1| hypothetical protein PFNF135_05018 [Plasmodium falciparum NF135/5.C10]
 gb|ETW47338.1| hypothetical protein PFMALIP_04687 [Plasmodium falciparum MaliPS096_E11]
 gb|ETW55716.1| hypothetical protein PFUGPA_02478 [Plasmodium falciparum Palo 
Alto/Uganda]
 gb|ETW59325.1| hypothetical protein PFMC_04802 [Plasmodium falciparum CAMP/Malaysia]
 gb|EUR65258.1| hypothetical protein PFBG_04874 [Plasmodium falciparum 7G8]
 gb|EUT80266.1| hypothetical protein PFAG_04908 [Plasmodium falciparum Santa 
Lucia]
 emb|CDO66344.1| ubiquitin conjugating enzyme, putative [Plasmodium reichenowi]
Length=202

 Score =   152 bits (384),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 94/138 (68%), Gaps = 2/138 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YP+ PPK+KF TK+WH NISSQ+GAICLD+ K++WSPALT +TAL SIQALL  P+P
Sbjct  65   PNDYPYNPPKIKFNTKIWHPNISSQTGAICLDVLKNEWSPALTIRTALLSIQALLSDPQP  124

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEK-VQKLVEMGFPEAQVRSTL  150
            DDPQDA VA+ Y   Y  +L TA  WT+ FA  P L   E  ++K+ EMGF E Q +  L
Sbjct  125  DDPQDAEVAKMYKENYSLYLKTASVWTKTFATVPKLEPREDIIKKITEMGFSEDQAKKAL  184

Query  149  ELVGWDENXALERLCSSA  96
                W+E  AL  L  ++
Sbjct  185  IKANWNETLALNTLLENS  202



>ref|XP_003884590.1| putative ubiquitin-conjugating enzyme [Neospora caninum Liverpool]
 emb|CBZ54560.1| putative ubiquitin-conjugating enzyme [Neospora caninum Liverpool]
Length=293

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 91/137 (66%), Gaps = 1/137 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YP+ PPKMKF TK+WH NISSQ+GAICLDI K +WSPALT +TAL SIQA+L  P P
Sbjct  83   PPDYPYNPPKMKFVTKIWHPNISSQTGAICLDILKHEWSPALTIRTALLSIQAMLADPVP  142

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDE-KVQKLVEMGFPEAQVRSTLE  147
             DPQDA VA+  +  +  F+ TA+ WTE FAK +    E KV+KL EMGF E Q R  L 
Sbjct  143  TDPQDAEVAKMMMENHPLFVKTAKLWTETFAKEAQDSQEDKVRKLTEMGFAEDQAREALR  202

Query  146  LVGWDENXALERLCSSA  96
               WDE  AL  L   +
Sbjct  203  KHDWDETMALNSLVEGS  219



>gb|ETW28294.1| hypothetical protein PFFCH_04202 [Plasmodium falciparum FCH/4]
Length=196

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 94/138 (68%), Gaps = 2/138 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YP+ PPK+KF TK+WH NISSQ+GAICLD+ K++WSPALT +TAL SIQALL  P+P
Sbjct  59   PNDYPYNPPKIKFNTKIWHPNISSQTGAICLDVLKNEWSPALTIRTALLSIQALLSDPQP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEK-VQKLVEMGFPEAQVRSTL  150
            DDPQDA VA+ Y   Y  +L TA  WT+ FA  P L   E  ++K+ EMGF E Q +  L
Sbjct  119  DDPQDAEVAKMYKENYSLYLKTASVWTKTFATVPKLEPREDIIKKITEMGFSEDQAKKAL  178

Query  149  ELVGWDENXALERLCSSA  96
                W+E  AL  L  ++
Sbjct  179  IKANWNETLALNTLLENS  196



>gb|KDD72554.1| ubiquitin-conjugating enzyme [Helicosporidium sp. ATCC 50920]
Length=165

 Score =   150 bits (379),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 95/131 (73%), Gaps = 0/131 (0%)
 Frame = -2

Query  500  DGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPD  321
            D YPF PPKMKF TKVWH NISS SGAICLDI KDQWSP LT KTAL S+QALL +P+PD
Sbjct  33   DQYPFVPPKMKFLTKVWHPNISSASGAICLDILKDQWSPVLTLKTALLSLQALLSSPQPD  92

Query  320  DPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLELV  141
            DPQDAVVA+QYL   + F  TARYW E FA    G + K+++LV+MGF    VR  LE  
Sbjct  93   DPQDAVVARQYLSSPEEFRQTARYWAENFALQRDGTEAKIERLVDMGFGTEAVRKALERY  152

Query  140  GWDENXALERL  108
            G DE  A++ L
Sbjct  153  GGDEAAAMDAL  163



>ref|XP_002140906.1| ubiquitin-conjugating enzyme family protein [Cryptosporidium 
muris RN66]
 gb|EEA06557.1| ubiquitin-conjugating enzyme family protein [Cryptosporidium 
muris RN66]
Length=199

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 90/132 (68%), Gaps = 3/132 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YP+EPPK++F T++WH NISSQ+GAICLDI KD WSPALT +T L SIQALL APEP
Sbjct  69   PSEYPYEPPKVRFITRIWHPNISSQTGAICLDILKDAWSPALTLRTVLLSIQALLSAPEP  128

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
            DDPQDA VA  Y   +  ++ TA+ WT  FA      D+K+++L++MGF +  V   L  
Sbjct  129  DDPQDAQVASLYKSNFNEYINTAKSWTIMFASSK---DQKIRRLLDMGFSKDNVTEALIR  185

Query  143  VGWDENXALERL  108
              WDE  AL  L
Sbjct  186  NKWDETQALNDL  197



>ref|XP_008624262.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Plasmodium vinckei vinckei]
 gb|KEG02552.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Plasmodium vinckei vinckei]
Length=202

 Score =   150 bits (380),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 93/138 (67%), Gaps = 2/138 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YP+ PPK+KF TK+WH NISSQ+GAICLD+ K++WSPALT +TAL SIQALL  P+P
Sbjct  65   PNDYPYNPPKIKFVTKIWHPNISSQTGAICLDVLKNEWSPALTIRTALLSIQALLSDPQP  124

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKV--QKLVEMGFPEAQVRSTL  150
            DDPQDA VA+ Y   +  FL TA  WT+ FA        +V  +K+ EMGF E Q ++ L
Sbjct  125  DDPQDAEVAKMYKENHSLFLKTASVWTKTFATAPKEESHEVIIKKITEMGFTEDQAKNAL  184

Query  149  ELVGWDENXALERLCSSA  96
                W+E  AL  L  ++
Sbjct  185  IKANWNETLALNTLLENS  202



>gb|EUD73440.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Plasmodium vinckei petteri]
Length=202

 Score =   150 bits (380),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 93/138 (67%), Gaps = 2/138 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YP+ PPK+KF TK+WH NISSQ+GAICLD+ K++WSPALT +TAL SIQALL  P+P
Sbjct  65   PNDYPYNPPKIKFVTKIWHPNISSQTGAICLDVLKNEWSPALTIRTALLSIQALLSDPQP  124

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKV--QKLVEMGFPEAQVRSTL  150
            DDPQDA VA+ Y   +  FL TA  WT+ FA        +V  +K+ EMGF E Q ++ L
Sbjct  125  DDPQDAEVAKMYKENHSLFLKTASVWTKTFATAPKEESHEVIIKKITEMGFTEDQAKNAL  184

Query  149  ELVGWDENXALERLCSSA  96
                W+E  AL  L  ++
Sbjct  185  IKANWNETLALNTLLENS  202



>emb|CDR14128.1| ubiquitin-conjugating enzyme, putative [Plasmodium chabaudi chabaudi]
Length=202

 Score =   150 bits (380),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 93/138 (67%), Gaps = 2/138 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YP+ PPK+KF TK+WH NISSQ+GAICLD+ K++WSPALT +TAL SIQALL  P+P
Sbjct  65   PNDYPYNPPKIKFVTKIWHPNISSQTGAICLDVLKNEWSPALTIRTALLSIQALLSDPQP  124

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKV--QKLVEMGFPEAQVRSTL  150
            DDPQDA VA+ Y   +  FL TA  WT+ FA        +V  +K+ EMGF E Q ++ L
Sbjct  125  DDPQDAEVAKMYKENHSLFLKTASVWTKTFATAPKEESHEVIIKKITEMGFTEDQAKNAL  184

Query  149  ELVGWDENXALERLCSSA  96
                W+E  AL  L  ++
Sbjct  185  IKANWNETLALNTLLENS  202



>ref|XP_004833222.1| ubiquitin-conjugating enzyme family member protein [Babesia equi]
 gb|EKX73770.1| ubiquitin-conjugating enzyme family member protein [Babesia equi 
strain WA]
Length=197

 Score =   150 bits (379),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 87/136 (64%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YP+ PP +KF TK+WH NISS++GAICLDI K++WSPALT +TAL SIQALL APEP
Sbjct  62   PRDYPYSPPMIKFDTKIWHPNISSETGAICLDILKNEWSPALTIRTALISIQALLSAPEP  121

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDE-KVQKLVEMGFPEAQVRSTLE  147
            DDPQDA VA  Y R Y  F  TA+ WT  FAK      E K+  L EMG         LE
Sbjct  122  DDPQDAQVAGMYKRNYDEFARTAKLWTTTFAKDINETKEGKISMLTEMGIERDIAVKALE  181

Query  146  LVGWDENXALERLCSS  99
              GWD   A+ RL  S
Sbjct  182  ANGWDTTVAINRLLDS  197



>ref|XP_954044.1| ubiquitin conjugating enzyme [Theileria annulata]
 emb|CAI73367.1| ubiquitin conjugating enzyme, putative [Theileria annulata]
Length=197

 Score =   150 bits (379),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YP+ PP +KF TK+WH NISS++GAICLDI K +WSPALT +TAL SIQALL APEP
Sbjct  62   PEDYPYSPPAIKFETKIWHPNISSETGAICLDILKSEWSPALTIRTALISIQALLSAPEP  121

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDE-KVQKLVEMGFPEAQVRSTLE  147
            DDPQDA VA  Y R YQ F  TA+ WT  FA+      E K+  L+E+G         LE
Sbjct  122  DDPQDAQVANMYKRNYQEFENTAKLWTSTFARSRDESREGKISLLLEIGIDRESAVRALE  181

Query  146  LVGWDENXALERL  108
              GWD   A+ RL
Sbjct  182  ENGWDTTVAINRL  194



>ref|XP_004223168.1| ubiquitin-conjugating enzyme family protein [Plasmodium cynomolgi 
strain B]
 dbj|GAB67221.1| ubiquitin-conjugating enzyme family protein [Plasmodium cynomolgi 
strain B]
Length=219

 Score =   150 bits (380),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 93/155 (60%), Gaps = 19/155 (12%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YP+ PPKMKF TK+WH NISSQ+GAICLD+ K++WSPALT +TAL SIQALL  P+P
Sbjct  65   PNDYPYNPPKMKFNTKIWHPNISSQTGAICLDVLKNEWSPALTIRTALLSIQALLSDPQP  124

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-------------------PSLGVDEKV  201
            DDPQDA VA+ Y   Y  FL TA  WT+ FA                      L  D  +
Sbjct  125  DDPQDAEVAKMYKENYSLFLKTASVWTKTFATGPKLEPREVIVIRNSKTEDAILSTDFLI  184

Query  200  QKLVEMGFPEAQVRSTLELVGWDENXALERLCSSA  96
            +K+ EMGF E Q +  L    W+E  AL  L  ++
Sbjct  185  KKITEMGFTEDQAKKALMKADWNETLALNTLLENS  219



>ref|XP_002168321.2| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like [Hydra 
vulgaris]
Length=202

 Score =   150 bits (379),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 95/136 (70%), Gaps = 4/136 (3%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK+KF TK+WH NISS +GAICLD+ KDQW+ A+T +T L SIQ+LL +PEP
Sbjct  64   PETYPFNPPKIKFLTKIWHPNISSVTGAICLDVLKDQWAAAMTLRTVLLSIQSLLASPEP  123

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDE----KVQKLVEMGFPEAQVRS  156
            DDPQDAVVAQQY  +++ FL TA++WT  +A  S  +D     K+Q+L++MGF +     
Sbjct  124  DDPQDAVVAQQYKEQHEVFLKTAKHWTITYANGSNELDNDCQMKLQQLLDMGFDKESSMI  183

Query  155  TLELVGWDENXALERL  108
             L   GW    A+E L
Sbjct  184  ALSTHGWLIEKAVEAL  199



>gb|AAY52456.1| ubiquitin conjugating enzyme E2 [Caenorhabditis remanei]
Length=195

 Score =   149 bits (377),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 90/132 (68%), Gaps = 4/132 (3%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF PP +KFATK+WH N+SSQ+G ICLDI KDQW+ +LT +T L SIQAL+  PEP
Sbjct  58   PDQYPFSPPNVKFATKIWHPNVSSQTGVICLDILKDQWAASLTLRTVLLSIQALMCTPEP  117

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVD----EKVQKLVEMGFPEAQVRS  156
             DPQDAVVA+QY+ + Q F  TA +WT  FAK S+ V+     +V KL +MG  E +  S
Sbjct  118  KDPQDAVVAKQYMDKPQVFKSTAEFWTLKFAKGSVPVNVDYQSRVDKLKDMGVREEEAIS  177

Query  155  TLELVGWDENXA  120
             L    WD N A
Sbjct  178  VLSCNNWDLNRA  189



>ref|XP_003100903.1| CRE-UBC-20 protein [Caenorhabditis remanei]
 gb|EFP08430.1| CRE-UBC-20 protein [Caenorhabditis remanei]
Length=200

 Score =   149 bits (377),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 90/132 (68%), Gaps = 4/132 (3%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF PP +KFATK+WH N+SSQ+G ICLDI KDQW+ +LT +T L SIQAL+  PEP
Sbjct  63   PDQYPFSPPNVKFATKIWHPNVSSQTGVICLDILKDQWAASLTLRTVLLSIQALMCTPEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVD----EKVQKLVEMGFPEAQVRS  156
             DPQDAVVA+QY+ + Q F  TA +WT  FAK S+ V+     +V KL +MG  E +  S
Sbjct  123  KDPQDAVVAKQYMDKPQVFKSTAEFWTLKFAKGSVPVNVDYQSRVDKLKDMGVREEEAIS  182

Query  155  TLELVGWDENXA  120
             L    WD N A
Sbjct  183  VLSCNNWDLNRA  194



>ref|XP_004344504.1| ubiquitin-conjugating enzyme [Capsaspora owczarzaki ATCC 30864]
 gb|KJE96580.1| ubiquitin-conjugating enzyme [Capsaspora owczarzaki ATCC 30864]
Length=220

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPF PP +KF TKVWH N+SSQ+G ICLDI KDQW+ A+T +T + SIQAL+  PEP
Sbjct  86   PQNYPFNPPIVKFETKVWHPNVSSQTGVICLDILKDQWAAAMTLRTVMLSIQALMSTPEP  145

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDE-KVQKLVEMGFPEAQVRSTLE  147
            DDPQDAVVA QY    + +  TA+YWT+ +A+P +  D+ K+++L++MGF EA+ ++ L 
Sbjct  146  DDPQDAVVANQYRSNREEYNRTAKYWTDVYARPGVSEDDVKIKQLMDMGFDEAKCKTALA  205

Query  146  LVGWDENXALERL  108
                +   A+E L
Sbjct  206  KAKGNVEQAIEHL  218



>ref|XP_001610991.1| ubiquitin-conjugating enzyme [Babesia bovis T2Bo]
 gb|EDO07423.1| ubiquitin-conjugating enzyme, putative [Babesia bovis]
Length=197

 Score =   149 bits (377),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 90/136 (66%), Gaps = 1/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YP+ PPK++F TK+WH NISS++GAICLDI K++WSPALT +TAL SIQAL+  PEP
Sbjct  59   PDDYPYNPPKIRFETKIWHPNISSETGAICLDILKNEWSPALTLRTALLSIQALMSTPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDE-KVQKLVEMGFPEAQVRSTLE  147
            DDPQDA VA  Y R Y  F  TA+ WT  FA+      E K+  L+E+G  + +    LE
Sbjct  119  DDPQDAEVATMYQRNYDEFERTAKLWTATFAQNRGETREGKLNTLLEIGIDKGKAIQALE  178

Query  146  LVGWDENXALERLCSS  99
              GWD   A+ R+   
Sbjct  179  SCGWDTTVAINRIIDG  194



>ref|XP_001631613.1| predicted protein [Nematostella vectensis]
 gb|EDO39550.1| predicted protein [Nematostella vectensis]
Length=201

 Score =   149 bits (376),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 96/139 (69%), Gaps = 4/139 (3%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK+KF TK+WH NISS +GAICLDI KDQW+ A+T +T + SIQALL +PEP
Sbjct  63   PETYPFNPPKVKFTTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVMLSIQALLASPEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA-KPSLG---VDEKVQKLVEMGFPEAQVRS  156
            DDPQDAVVA+Q+      +L TAR+W +  A   S G    +EK+++L++MGF E Q R 
Sbjct  123  DDPQDAVVARQFKENRSAYLLTARHWAQVHAGAKSQGHNECEEKIRQLMDMGFAENQSRV  182

Query  155  TLELVGWDENXALERLCSS  99
             L    W+   A+E L +S
Sbjct  183  ALSSHSWNVERAVESLFNS  201



>ref|XP_001458160.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK90763.1| unnamed protein product [Paramecium tetraurelia]
Length=197

 Score =   149 bits (376),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YP++PPKMKF T++WH NISSQ+GAICLDI KD+WSPAL+ +TAL S+QALL  P+P
Sbjct  64   PQEYPYKPPKMKFDTRIWHPNISSQTGAICLDILKDEWSPALSIRTALLSLQALLCDPQP  123

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
            D PQDAVVA QY  +   F+ TA+ WT+ +A  +   +EKVQ LV +GF   +VR  L  
Sbjct  124  DSPQDAVVANQYKTQKDLFVKTAKEWTQNYASKN-KQEEKVQNLVNLGFEVGKVREALLR  182

Query  143  VGWDENXALERL  108
             G+DE  A   L
Sbjct  183  FGYDEEQAANFL  194



>ref|XP_006681813.1| hypothetical protein BATDEDRAFT_91378 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77716.1| hypothetical protein BATDEDRAFT_91378 [Batrachochytrium dendrobatidis 
JAM81]
Length=203

 Score =   149 bits (375),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 96/144 (67%), Gaps = 9/144 (6%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF+PPKM F T ++H NISSQ+GAICLDI KD W+P LT KTAL S+Q+LL  P+P
Sbjct  58   PDEYPFKPPKMVFDTPIYHPNISSQTGAICLDILKDAWTPVLTLKTALISLQSLLCEPQP  117

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSL--------GVDEK-VQKLVEMGFPE  171
            DDPQDA VA+ YL +   F  TARYWT+A+A            G++++ +Q+LVEMGF  
Sbjct  118  DDPQDAQVAKHYLSDRAGFDNTARYWTKAYASADTVSVVNEEAGLNQQTIQRLVEMGFER  177

Query  170  AQVRSTLELVGWDENXALERLCSS  99
              V   L+    DEN ALE + S 
Sbjct  178  QTVVRALKQTDGDENQALEVILSG  201



>ref|XP_009689532.1| ubiquitin carrier protein [Theileria orientalis strain Shintoku]
 dbj|BAM39231.1| ubiquitin carrier protein [Theileria orientalis strain Shintoku]
Length=208

 Score =   149 bits (375),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 95/147 (65%), Gaps = 12/147 (8%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YP+ PP +KF TK+WH NISS++GAICLDI K++WSPALT +TAL SIQALL APEP
Sbjct  62   PEDYPYSPPVIKFETKIWHPNISSETGAICLDILKNEWSPALTIRTALLSIQALLSAPEP  121

Query  323  DDPQDAVVAQQYLREYQTFLGTARY-----------WTEAFAKPSLGVDE-KVQKLVEMG  180
            DDPQDA+VA+ Y R+Y+ F  TA+Y           WT  FA+      E K++ L+E+G
Sbjct  122  DDPQDAMVAKMYKRDYEEFERTAKYVTIVFSRITRLWTSTFARDDNESKEGKIKTLLEIG  181

Query  179  FPEAQVRSTLELVGWDENXALERLCSS  99
                     LE  GWD   AL RL  S
Sbjct  182  IERDLAVKALEENGWDTTVALNRLLDS  208



>ref|XP_729393.1| ubiquitin conjugating enzyme [Plasmodium yoelii yoelii 17XNL]
 gb|EAA20958.1| ubiquitin conjugating enzyme [Plasmodium yoelii yoelii]
 emb|CDU19028.1| ubiquitin-conjugating enzyme, putative [Plasmodium yoelii]
 emb|CDZ13311.1| ubiquitin-conjugating enzyme, putative [Plasmodium yoelii]
Length=202

 Score =   148 bits (374),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 95/141 (67%), Gaps = 8/141 (6%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YP+ PPK+KF TK+WH NISSQ+GAICLD+ K++WSPALT +TAL SIQALL  P+P
Sbjct  65   PNDYPYNPPKIKFVTKIWHPNISSQTGAICLDVLKNEWSPALTIRTALLSIQALLSDPQP  124

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEK-----VQKLVEMGFPEAQVR  159
            DDPQDA VA+ Y   +  F+ TA  WT+ FA    G  E+     ++K+ EMGF E Q +
Sbjct  125  DDPQDAEVAKMYKENHALFVKTASVWTKTFAT---GPKEEPREVIIKKITEMGFSEDQAK  181

Query  158  STLELVGWDENXALERLCSSA  96
            + L    W+E  AL  L  ++
Sbjct  182  NALIKANWNETLALNTLLENS  202



>ref|XP_002640838.1| C. briggsae CBR-UBC-20 protein [Caenorhabditis briggsae]
 emb|CAP33901.1| Protein CBR-UBC-20 [Caenorhabditis briggsae]
Length=200

 Score =   148 bits (373),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 89/132 (67%), Gaps = 4/132 (3%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF PP +KFATK+WH N+SSQ+G ICLDI KDQW+ +LT +T L SIQAL+   EP
Sbjct  63   PDQYPFSPPSVKFATKIWHPNVSSQTGVICLDILKDQWAASLTLRTVLLSIQALMCTAEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVD----EKVQKLVEMGFPEAQVRS  156
             DPQDAVVA+QY+ + Q F  TA YWT  FAK +L V+     +V KL +MG  E +  S
Sbjct  123  KDPQDAVVAKQYMDKPQVFKATAEYWTLKFAKGTLPVNADYQARVDKLKDMGVREEEAIS  182

Query  155  TLELVGWDENXA  120
             L    WD N A
Sbjct  183  VLSCNNWDLNRA  194



>gb|ETO33534.1| Ubiquitin-conjugating enzyme family protein [Reticulomyxa filosa]
Length=194

 Score =   147 bits (372),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 91/135 (67%), Gaps = 3/135 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF PPK  F T+VWH NISSQ+GAICLDI KDQWSPA+T +T L S+QALL  PEP
Sbjct  58   PDQYPFAPPKCTFNTRVWHPNISSQTGAICLDILKDQWSPAMTIRTVLLSLQALLCTPEP  117

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDE---KVQKLVEMGFPEAQVRST  153
            DDPQDA VA+QY    + F   A  WT+ +AK  L +DE   K++K++E+G      R+ 
Sbjct  118  DDPQDAQVAKQYKTSPKEFAKQAAEWTQKYAKEGLKIDEQEQKIKKIMELGVKRDHARAE  177

Query  152  LELVGWDENXALERL  108
            L   GWD + A + +
Sbjct  178  LVKHGWDADAAADSI  192



>ref|XP_002502493.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63751.1| predicted protein [Micromonas sp. RCC299]
Length=191

 Score =   147 bits (372),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 96/133 (72%), Gaps = 1/133 (1%)
 Frame = -2

Query  500  DGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPD  321
            + YPFE PKM+F TKVWH N+SS +GAICLDI KDQWSPAL+ KTA+ S+QALL  PEP+
Sbjct  58   NSYPFEAPKMRFITKVWHPNVSSANGAICLDILKDQWSPALSIKTAMLSLQALLSTPEPN  117

Query  320  DPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLELV  141
            DPQDAVVA+QYL  Y+ F+  A+ WT  +A  +   DEK +KL EMGF EA VR+ L   
Sbjct  118  DPQDAVVARQYLDSYEEFVKHAKEWTAKYASENR-KDEKEEKLKEMGFGEAAVRNALSRA  176

Query  140  GWDENXALERLCS  102
              DE  ALE L +
Sbjct  177  AGDEQQALELLLT  189



>pdb|2PWQ|A Chain A, Crystal Structure Of A Putative Ubiquitin Conjugating 
Enzyme From Plasmodium Yoelii
Length=216

 Score =   148 bits (374),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 95/141 (67%), Gaps = 8/141 (6%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YP+ PPK+KF TK+WH NISSQ+GAICLD+ K++WSPALT +TAL SIQALL  P+P
Sbjct  79   PNDYPYNPPKIKFVTKIWHPNISSQTGAICLDVLKNEWSPALTIRTALLSIQALLSDPQP  138

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEK-----VQKLVEMGFPEAQVR  159
            DDPQDA VA+ Y   +  F+ TA  WT+ FA    G  E+     ++K+ EMGF E Q +
Sbjct  139  DDPQDAEVAKMYKENHALFVKTASVWTKTFAT---GPKEEPREVIIKKITEMGFSEDQAK  195

Query  158  STLELVGWDENXALERLCSSA  96
            + L    W+E  AL  L  ++
Sbjct  196  NALIKANWNETLALNTLLENS  216



>ref|XP_674871.1| ubiquitin-conjugating enzyme [Plasmodium berghei strain ANKA]
 emb|CAH99505.1| ubiquitin-conjugating enzyme, putative [Plasmodium berghei]
 emb|CDS48751.1| ubiquitin-conjugating enzyme, putative [Plasmodium berghei ANKA]
Length=202

 Score =   147 bits (372),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 93/138 (67%), Gaps = 2/138 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YP+ PPK+KF TK+WH NISSQ+GAICLD+ K++WSPALT +TAL SIQALL  P+P
Sbjct  65   PNDYPYNPPKIKFVTKIWHPNISSQTGAICLDVLKNEWSPALTIRTALLSIQALLSDPQP  124

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKV--QKLVEMGFPEAQVRSTL  150
            DDPQDA VA+ Y   +  F+ TA  WT+ FA        +V  +K+ EMGF E Q ++ L
Sbjct  125  DDPQDAEVAKMYKENHALFVKTASVWTKTFATAPKEEPREVIIKKITEMGFSEDQAKNAL  184

Query  149  ELVGWDENXALERLCSSA  96
                W+E  AL  L  ++
Sbjct  185  IKANWNETLALNTLLENS  202



>ref|XP_005651685.1| hypothetical protein COCSUDRAFT_52084 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27141.1| hypothetical protein COCSUDRAFT_52084 [Coccomyxa subellipsoidea 
C-169]
Length=195

 Score =   147 bits (371),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 97/136 (71%), Gaps = 2/136 (1%)
 Frame = -2

Query  500  DGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPD  321
            D YPF PPKM+F +KVWH N+SS +GAICLDI KDQWSPALT KTAL S+QALL +P+PD
Sbjct  59   DQYPFVPPKMRFRSKVWHPNVSSANGAICLDILKDQWSPALTLKTALLSLQALLSSPQPD  118

Query  320  DPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGV--DEKVQKLVEMGFPEAQVRSTLE  147
            DPQDAVVA+QYL +  TF  TAR WTE FA  S     DEKV +L +MGF +      L+
Sbjct  119  DPQDAVVARQYLTDNATFQRTARMWTENFAHRSQAATEDEKVLRLADMGFTKEAASVALQ  178

Query  146  LVGWDENXALERLCSS  99
                DEN ALE L ++
Sbjct  179  SAHGDENAALELLLTA  194



>ref|XP_790028.2| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like [Strongylocentrotus 
purpuratus]
Length=199

 Score =   147 bits (371),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 95/137 (69%), Gaps = 3/137 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PP++KF TK+WH NISS +GAICLDI KDQW+ A+T +T L S+QALL   EP
Sbjct  63   PETYPFNPPQVKFVTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLADAEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLG---VDEKVQKLVEMGFPEAQVRST  153
            DDPQDAVVA+QY  ++  ++ TA++WT  +A  +     +++KV+++VEMGF E   R  
Sbjct  123  DDPQDAVVAKQYKDDHDEYIRTAKHWTTVYAGGNTKNQELEQKVKQIVEMGFEETCAREA  182

Query  152  LELVGWDENXALERLCS  102
            L    WD   A+E L S
Sbjct  183  LSSSCWDVAKAIENLMS  199



>ref|XP_005784046.1| hypothetical protein EMIHUDRAFT_429671 [Emiliania huxleyi CCMP1516]
 gb|EOD31617.1| hypothetical protein EMIHUDRAFT_429671 [Emiliania huxleyi CCMP1516]
Length=197

 Score =   147 bits (371),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 95/132 (72%), Gaps = 0/132 (0%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPF PPKMKF T+VWH N+SSQSGAICLDI K++WSPALT +TAL S+QALL APEP
Sbjct  62   PSDYPFVPPKMKFRTRVWHPNVSSQSGAICLDILKNEWSPALTIRTALISLQALLSAPEP  121

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
            DDPQDA VA+QY  + Q F   A++WTE +A  S    + + ++VEMGFPE Q R+ L+ 
Sbjct  122  DDPQDAEVAKQYKDQQQAFQQKAKFWTETYAVESKCEADTIAEMVEMGFPEEQCRNALKA  181

Query  143  VGWDENXALERL  108
               ++  A+  L
Sbjct  182  AAGNKEAAVAAL  193



>gb|KJB40047.1| hypothetical protein B456_007G044100 [Gossypium raimondii]
Length=173

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 82/102 (80%), Gaps = 1/102 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YP+EPP+MKF TK+WH NISSQSGA+CLDI KDQWS  +  KTAL S+QALL APE 
Sbjct  59   PGAYPYEPPRMKFITKIWHPNISSQSGAMCLDILKDQWSRGVRLKTALPSVQALLSAPEL  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKV  201
             DPQDA+VA+QY+ +YQTF+ TAR WTE FA+  SLGV+EK 
Sbjct  119  RDPQDALVARQYICKYQTFIDTARSWTENFARVSSLGVEEKT  160



>ref|NP_497174.1| Protein UBC-20 [Caenorhabditis elegans]
 emb|CCD70929.1| UBC-20 [Caenorhabditis elegans]
Length=199

 Score =   145 bits (367),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 87/131 (66%), Gaps = 3/131 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF PP +KF+TK+WH N+SSQ+G ICLDI KDQW+ +LT +T L SIQAL+  PEP
Sbjct  63   PDQYPFSPPNVKFSTKIWHPNVSSQTGVICLDILKDQWAASLTLRTVLLSIQALMCTPEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSL---GVDEKVQKLVEMGFPEAQVRST  153
             DPQDAVVA+QY+ +   F  TA YWT  FAK ++   G    V KL +MG  E +  S 
Sbjct  123  KDPQDAVVAKQYMEKPAVFKATAEYWTTKFAKGAVKNAGYQALVDKLKDMGVREEEAVSV  182

Query  152  LELVGWDENXA  120
            L    WD N +
Sbjct  183  LSCNNWDINRS  193



>ref|NP_001155723.1| ubiquitin-conjugating enzyme E2-25kD-like [Acyrthosiphon pisum]
 dbj|BAH71888.1| ACYPI007620 [Acyrthosiphon pisum]
Length=199

 Score =   145 bits (366),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 90/137 (66%), Gaps = 3/137 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK++F TK+WH NISS +GAICLDI KDQW+ A+T +T L S+QAL+ A EP
Sbjct  63   PETYPFNPPKVRFMTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA---KPSLGVDEKVQKLVEMGFPEAQVRST  153
            DDPQDAVVA+QY    + F  TA +WT  +A     +   D K+Q+L++MG    Q R  
Sbjct  123  DDPQDAVVAKQYKEYPEIFAKTASHWTNVYAGGPNKNSEFDTKIQRLIDMGIERDQARGA  182

Query  152  LELVGWDENXALERLCS  102
            L    WD   A E+L S
Sbjct  183  LSTYNWDLERATEQLFS  199



>ref|XP_001457111.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK89714.1| unnamed protein product [Paramecium tetraurelia]
Length=197

 Score =   145 bits (366),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = -2

Query  500  DGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPD  321
            + YP++PPKMKF T++WH NISSQ+GAICLDI KDQWSPAL+ +TAL S+QAL   P+PD
Sbjct  65   NDYPYKPPKMKFDTRIWHPNISSQTGAICLDILKDQWSPALSIRTALLSLQALFCDPQPD  124

Query  320  DPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLELV  141
             PQDAVVA QY      F+ TA+ WT  +A  +   +EKV  LV++GF E +V+  L   
Sbjct  125  SPQDAVVANQYKSNKDLFVKTAKEWTLNYASKN-KQNEKVSNLVQLGFDEQKVKEALIRF  183

Query  140  GWDENXALERL  108
            G+DE  A   L
Sbjct  184  GYDEEQAANFL  194



>gb|ETO29102.1| Ubiquitin-conjugating enzyme family protein [Reticulomyxa filosa]
Length=194

 Score =   144 bits (364),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 90/135 (67%), Gaps = 3/135 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF PPK  F T+VWH NISSQ+GAICLDI KDQWSPA+T +T L S+QALL  PEP
Sbjct  58   PDQYPFSPPKCTFNTRVWHPNISSQTGAICLDILKDQWSPAMTIRTVLLSLQALLCTPEP  117

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDE---KVQKLVEMGFPEAQVRST  153
            DDPQDA VA+QY    + F   A  WT+ +AK  L VDE   K++K++E+G      R+ 
Sbjct  118  DDPQDAQVAKQYKSNPKEFAKQAAEWTKQYAKEGLKVDEQEQKIKKIMELGVKRDIARAE  177

Query  152  LELVGWDENXALERL  108
            L    WD + A + +
Sbjct  178  LVKHNWDTDAAADSI  192



>ref|XP_002168516.2| PREDICTED: uncharacterized protein LOC100209390 [Hydra vulgaris]
Length=909

 Score =   154 bits (388),  Expect = 8e-40, Method: Composition-based stats.
 Identities = 71/133 (53%), Positives = 93/133 (70%), Gaps = 4/133 (3%)
 Frame = -2

Query  494  YPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPDDP  315
            YPF PPK+KF TK+WH NISS +GAICLD+ KDQW+ A+T +T L SIQ+LL +PEPDDP
Sbjct  67   YPFHPPKIKFLTKIWHPNISSVTGAICLDVLKDQWAAAMTLRTVLLSIQSLLASPEPDDP  126

Query  314  QDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDE----KVQKLVEMGFPEAQVRSTLE  147
            QDAVVAQQY  +++ FL TA++WT  +A  S  +D     K+Q+L++MGF +      L 
Sbjct  127  QDAVVAQQYKEQHEVFLKTAKHWTITYANGSNELDNDCQMKLQQLLDMGFDKENSTIALS  186

Query  146  LVGWDENXALERL  108
              GW    A+E L
Sbjct  187  THGWLIEKAVEAL  199



>gb|AGN29610.1| ubiquitin-conjugating enzyme E2- 22kDa-like protein [Acartia 
pacifica]
Length=199

 Score =   144 bits (364),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF PPK++F TK+WH NISS +GAICLDI KDQW+ A+T +T L SIQALL APEP
Sbjct  63   PDTYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSIQALLAAPEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSL---GVDEKVQKLVEMGFPEAQVRST  153
             DPQDAVVA+QY    Q F  TA++W   +A  S      D+ + +L +MG  E   R  
Sbjct  123  SDPQDAVVARQYQENQQIFRETAQHWASVYAGSSYKNPAFDKMLSQLKDMGVEETAARVA  182

Query  152  LELVGWDENXALERL  108
            L    WD   A E+L
Sbjct  183  LSSCAWDLQKATEQL  197



>emb|CDR94543.1| ubiquitin-conjugating enzyme, putative [Babesia bigemina]
Length=195

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 87/137 (64%), Gaps = 1/137 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YP+ PPK+ F TK+WH NISS++GAICLDI K++WSPALT +TAL SIQAL+ APEP
Sbjct  59   PQDYPYSPPKIHFETKIWHPNISSETGAICLDILKNEWSPALTIRTALLSIQALMSAPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDE-KVQKLVEMGFPEAQVRSTLE  147
            DDPQDA VA  Y R Y+ F  TA+ WT  FA       E KV +L+EMG         L 
Sbjct  119  DDPQDAEVASMYRRNYEEFARTAKLWTVNFANNRGDTREGKVDRLLEMGIDRETAIKALA  178

Query  146  LVGWDENXALERLCSSA  96
               WD   A+ R+   +
Sbjct  179  DNRWDVTVAINRIIDGS  195



>gb|AET50656.1| hypothetical protein [Eimeria tenella]
 emb|CDJ38754.1| ubiquitin-conjugating enzyme, putative [Eimeria tenella]
 emb|CDJ65918.1| ubiquitin-conjugating enzyme, putative [Eimeria necatrix]
Length=202

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YP+ PPK+ F TKVWH N+SSQ+GAICLDI K +WSPAL+ +TAL SIQA+L  P P
Sbjct  68   PSDYPYNPPKINFVTKVWHPNVSSQTGAICLDILKHEWSPALSIRTALLSIQAMLADPVP  127

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSL-GVDEKVQKLVEMGFPEAQVRSTLE  147
             DPQDA VA+  +     F  TAR+WTE FA  S    ++KV+KL +MGF +   R+ L 
Sbjct  128  TDPQDAEVAKMLIENPDLFQKTARHWTETFAMNSTESQEDKVKKLADMGFDKETARTALM  187

Query  146  LVGWDENXALERL  108
               WDE  AL  L
Sbjct  188  NANWDETSALNSL  200



>ref|NP_509502.3| Protein UBC-21 [Caenorhabditis elegans]
 sp|P52484.3|UBC21_CAEEL RecName: Full=Probable ubiquitin-conjugating enzyme E2 21; AltName: 
Full=Ubiquitin carrier protein 21; AltName: Full=Ubiquitin-protein 
ligase 21 [Caenorhabditis elegans]
 emb|CCD63324.1| UBC-21 [Caenorhabditis elegans]
Length=214

 Score =   144 bits (364),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 87/134 (65%), Gaps = 4/134 (3%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPFEPPK KF T++WH NISSQ+G ICLDI KD+W+ +LT +T L S+QA+L +PEP
Sbjct  77   PEHYPFEPPKAKFVTRIWHPNISSQTGTICLDILKDKWTASLTLRTVLLSLQAMLCSPEP  136

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGV----DEKVQKLVEMGFPEAQVRS  156
             DPQDAVVA+Q++  Y  F  TA YWT  FA     V    + KV +L+EMG  E +   
Sbjct  137  SDPQDAVVAKQFINNYPMFTATAVYWTSYFANSKKDVEPDFNRKVGRLIEMGIRETEAIV  196

Query  155  TLELVGWDENXALE  114
             L    W    AL+
Sbjct  197  YLSCNNWKLEQALQ  210



>ref|XP_001454736.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK87339.1| unnamed protein product [Paramecium tetraurelia]
Length=197

 Score =   142 bits (359),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 88/125 (70%), Gaps = 1/125 (1%)
 Frame = -2

Query  494  YPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPDDP  315
            YP++PPKMKF T++WH NISSQ+GAICLDI KD+WSPAL+ +TAL S+QALL  P+PD P
Sbjct  67   YPYKPPKMKFDTRIWHPNISSQTGAICLDILKDEWSPALSIRTALLSLQALLCDPQPDSP  126

Query  314  QDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLELVGW  135
            QDAVVA QY    + F  TA+ WT  +A  +   DEK+  LV +G  E +V+  L   G+
Sbjct  127  QDAVVANQYKTNRELFTKTAKEWTLNYASKN-KQDEKIANLVALGLEEQKVKEALLRFGY  185

Query  134  DENXA  120
            DE  A
Sbjct  186  DEEQA  190



>gb|KFG62496.1| ubiquitin-conjugating enzyme subfamily protein [Toxoplasma gondii 
RUB]
Length=231

 Score =   144 bits (362),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 84/116 (72%), Gaps = 1/116 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YP+ PPKMKF TK+WH NISSQ+GAICLDI K +WSPALT +TAL SIQA+L  P P
Sbjct  80   PPDYPYNPPKMKFVTKIWHPNISSQTGAICLDILKHEWSPALTIRTALLSIQAMLADPVP  139

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDE-KVQKLVEMGFPEAQVR  159
             DPQDA VA+  +  +  F+ TA+ WTE FAK +    E KV+KL EMGF E QVR
Sbjct  140  TDPQDAEVAKMMIENHPLFVQTAKLWTETFAKEAQDSHEDKVRKLTEMGFAEDQVR  195



>gb|EPT26736.1| ubiquitin-conjugating enzyme subfamily protein [Toxoplasma gondii 
ME49]
 gb|KFG31494.1| ubiquitin-conjugating enzyme subfamily protein [Toxoplasma gondii 
GAB2-2007-GAL-DOM2]
Length=231

 Score =   144 bits (362),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 84/116 (72%), Gaps = 1/116 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YP+ PPKMKF TK+WH NISSQ+GAICLDI K +WSPALT +TAL SIQA+L  P P
Sbjct  80   PPDYPYNPPKMKFVTKIWHPNISSQTGAICLDILKHEWSPALTIRTALLSIQAMLADPVP  139

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDE-KVQKLVEMGFPEAQVR  159
             DPQDA VA+  +  +  F+ TA+ WTE FAK +    E KV+KL EMGF E QVR
Sbjct  140  TDPQDAEVAKMMIENHPLFVQTAKLWTETFAKEAQDSHEDKVRKLTEMGFAEDQVR  195



>gb|KFH00285.1| ubiquitin-conjugating enzyme subfamily protein [Toxoplasma gondii 
VAND]
Length=231

 Score =   143 bits (361),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 84/116 (72%), Gaps = 1/116 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YP+ PPKMKF TK+WH NISSQ+GAICLDI K +WSPALT +TAL SIQA+L  P P
Sbjct  80   PPDYPYNPPKMKFVTKIWHPNISSQTGAICLDILKHEWSPALTIRTALLSIQAMLADPVP  139

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDE-KVQKLVEMGFPEAQVR  159
             DPQDA VA+  +  +  F+ TA+ WTE FAK +    E KV+KL EMGF E QVR
Sbjct  140  TDPQDAEVAKMMIENHPLFVQTAKLWTETFAKEAQDSHEDKVRKLTEMGFAEDQVR  195



>gb|EPR60341.1| ubiquitin-conjugating enzyme subfamily protein [Toxoplasma gondii 
GT1]
 gb|ESS30913.1| ubiquitin-conjugating enzyme subfamily protein [Toxoplasma gondii 
VEG]
 gb|KFG35055.1| ubiquitin-conjugating enzyme subfamily protein [Toxoplasma gondii 
FOU]
 gb|KFG37261.1| ubiquitin-conjugating enzyme subfamily protein [Toxoplasma gondii 
p89]
 gb|KFH02116.1| ubiquitin-conjugating enzyme subfamily protein [Toxoplasma gondii 
MAS]
Length=231

 Score =   143 bits (361),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 84/116 (72%), Gaps = 1/116 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YP+ PPKMKF TK+WH NISSQ+GAICLDI K +WSPALT +TAL SIQA+L  P P
Sbjct  80   PPDYPYNPPKMKFVTKIWHPNISSQTGAICLDILKHEWSPALTIRTALLSIQAMLADPVP  139

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDE-KVQKLVEMGFPEAQVR  159
             DPQDA VA+  +  +  F+ TA+ WTE FAK +    E KV+KL EMGF E QVR
Sbjct  140  TDPQDAEVAKMMIENHPLFVQTAKLWTETFAKEAQDSHEDKVRKLTEMGFAEDQVR  195



>ref|XP_003381856.1| ubiquitin-conjugating enzyme E2 K [Trichinella spiralis]
 gb|EFV62090.1| ubiquitin-conjugating enzyme E2 K [Trichinella spiralis]
Length=192

 Score =   142 bits (358),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 92/138 (67%), Gaps = 4/138 (3%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK+KF T++WH NISS +GAICLD+ KDQW+ +LT +T L SIQALL APEP
Sbjct  55   PETYPFTPPKVKFLTRIWHPNISSATGAICLDVLKDQWAASLTLRTVLLSIQALLGAPEP  114

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGV----DEKVQKLVEMGFPEAQVRS  156
             DPQDAVVA+Q +     +  TARYW   +A  S  +    ++KVQK+V+MG  +    +
Sbjct  115  RDPQDAVVAKQMMEAPSIYAETARYWATIYAGSSNAIPEDMNKKVQKIVDMGMSKDDAIT  174

Query  155  TLELVGWDENXALERLCS  102
             L    WD + A+E L S
Sbjct  175  ALSHSRWDVSQAIEYLFS  192



>ref|XP_002645395.1| C. briggsae CBR-UBC-21 protein [Caenorhabditis briggsae]
Length=228

 Score =   143 bits (360),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 87/134 (65%), Gaps = 17/134 (13%)
 Frame = -2

Query  503  PDGYPFEPPKMK-------------FATKVWHXNISSQSGAICLDIXKDQWSPALTXKTA  363
            PD YPFEPPK+K             F T+VWH N+SSQ+GAICLDI KD+W+ +LT +T 
Sbjct  64   PDQYPFEPPKVKTILSLRGKLLIVKFVTRVWHPNVSSQTGAICLDILKDKWAASLTLRTV  123

Query  362  LXSIQALLXAPEPDDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVD----EKVQK  195
            L SIQA++ APEP DPQDAVVA+QY+  Y  F  TA YWT  FA     VD    +KV +
Sbjct  124  LLSIQAMMCAPEPSDPQDAVVAKQYISNYPMFKATATYWTSVFADSKREVDKDFQKKVNR  183

Query  194  LVEMGFPEAQVRST  153
            LVEMG  E  ++ T
Sbjct  184  LVEMGIREVTIQYT  197



>gb|KGB38531.1| Ubiquitin-conjugating enzyme E2 K [Schistosoma haematobium]
Length=199

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 87/136 (64%), Gaps = 5/136 (4%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK+KF TK+WH NISS +G ICLD+ KDQW+ A++ +T L SIQALL +PEP
Sbjct  63   PENYPFVPPKVKFITKIWHPNISSATGVICLDVLKDQWAAAMSLRTILLSIQALLASPEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVD----EKVQKLVEMGFPEAQVRS  156
            DDPQDAVVA QY      F  TAR+W   +A    G D    + V KLV+MGF E +   
Sbjct  123  DDPQDAVVANQYKSSIDAFNRTARHWAGIYAN-GPGCDPHCVDLVDKLVQMGFDEHEACR  181

Query  155  TLELVGWDENXALERL  108
             L +  WD   A E L
Sbjct  182  ALSMKNWDLAMATEHL  197



>emb|CAX69541.1| huntingtin interacting protein 2 [Schistosoma japonicum]
Length=199

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 87/136 (64%), Gaps = 5/136 (4%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK+KF TK+WH NISS +G ICLD+ KDQW+ A++ +T L SIQALL +PEP
Sbjct  63   PENYPFVPPKVKFITKIWHPNISSATGVICLDVLKDQWAAAMSLRTILLSIQALLASPEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVD----EKVQKLVEMGFPEAQVRS  156
            DDPQDAVVA QY      F  TAR+W   +A    G D    + V KLV+MGF E +   
Sbjct  123  DDPQDAVVANQYKSSIDAFNRTARHWAGIYAN-GPGCDPQCVDLVDKLVQMGFDEHEACR  181

Query  155  TLELVGWDENXALERL  108
             L +  WD   A E L
Sbjct  182  ALSMKNWDLAMATEHL  197



>ref|XP_003382495.1| PREDICTED: ubiquitin-conjugating enzyme E2 K-like [Amphimedon 
queenslandica]
Length=202

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 90/137 (66%), Gaps = 5/137 (4%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF PPK+KF TK+WH NISS +GAICLDI KDQW+ A+T +T L SIQALL A EP
Sbjct  64   PDTYPFNPPKVKFVTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSIQALLQAAEP  123

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDE-----KVQKLVEMGFPEAQVR  159
            DDPQDAVVA+QY  + + +  TA++W + +A      D+     K+  L++MG  E + R
Sbjct  124  DDPQDAVVAKQYKGDPELYRKTAKHWAQTYAGAPKTTDDAEISAKIDTLLQMGITETKAR  183

Query  158  STLELVGWDENXALERL  108
              L    W+   A++ L
Sbjct  184  EALSTHSWNLEAAVDSL  200



>emb|CDJ83787.1| Ubiquitin-conjugating enzyme and Ubiquitin-associated translation 
elongation factor EF1B domain containing protein [Haemonchus 
contortus]
Length=200

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 89/138 (64%), Gaps = 4/138 (3%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF PPK+KF TK+WH NISSQ+G ICLDI KDQW+ +LT +T L SIQAL+ +PEP
Sbjct  63   PDSYPFTPPKIKFLTKIWHPNISSQTGTICLDILKDQWAASLTLRTVLLSIQALMCSPEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSL----GVDEKVQKLVEMGFPEAQVRS  156
             DPQDAVVA+QY+     F  TA YWT  +AK          E+V+KL +MG  E +  S
Sbjct  123  KDPQDAVVAKQYMSNPGLFKETAVYWTIKYAKGKAEENPHYKERVEKLRDMGVAEDEAIS  182

Query  155  TLELVGWDENXALERLCS  102
             L    WD   A + + S
Sbjct  183  VLSCNNWDLAKATDYIFS  200



>gb|KFD55719.1| hypothetical protein M513_03467 [Trichuris suis]
 gb|KFD67594.1| hypothetical protein M514_03467 [Trichuris suis]
Length=200

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 92/138 (67%), Gaps = 4/138 (3%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK++F T++WH NISS +GA+CLD+ KDQW+ +LT +T L SIQ LL  PEP
Sbjct  63   PEMYPFHPPKVRFITRIWHPNISSVTGAVCLDVLKDQWAASLTLRTVLLSIQVLLGCPEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGV----DEKVQKLVEMGFPEAQVRS  156
            +DPQDAVVA+Q + E Q F  TAR+W + +AK    V    D+KV+ + EMG  +    +
Sbjct  123  NDPQDAVVARQMIEEPQLFRETARFWAKTYAKSPCQVSPEYDKKVRSITEMGVAQDTAIA  182

Query  155  TLELVGWDENXALERLCS  102
             L    WD + A++ L S
Sbjct  183  ALSQCRWDVSSAIDHLFS  200



>emb|CDJ85762.1| Ubiquitin-conjugating enzyme and Ubiquitin-associated translation 
elongation factor EF1B domain containing protein [Haemonchus 
contortus]
Length=200

 Score =   141 bits (356),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 89/138 (64%), Gaps = 4/138 (3%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF PPK+KF TK+WH NISSQ+G ICLDI KDQW+ +LT +T L SIQAL+ +PEP
Sbjct  63   PDSYPFTPPKIKFLTKIWHPNISSQTGTICLDILKDQWAASLTLRTVLLSIQALMCSPEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSL----GVDEKVQKLVEMGFPEAQVRS  156
             DPQDAVVA+QY+     F  TA YWT  +AK          E+V+KL +MG  E +  S
Sbjct  123  KDPQDAVVAKQYMSNPGLFKETAIYWTIKYAKGKAEENPHYKERVEKLRDMGVAEDEAIS  182

Query  155  TLELVGWDENXALERLCS  102
             L    WD   A + + S
Sbjct  183  VLSCNNWDLAKATDYIFS  200



>emb|CDJ02906.1| ubiquitin conjugating enzyme E2 25kD [Echinococcus multilocularis]
 emb|CDS40188.1| ubiquitin conjugating enzyme E2 25kD [Echinococcus multilocularis]
Length=201

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 91/135 (67%), Gaps = 3/135 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK+KF TK+WH NISS +G ICLDI KDQW+ A++ +T L SIQALL +PEP
Sbjct  65   PETYPFLPPKVKFLTKIWHPNISSATGVICLDILKDQWAAAMSLRTMLLSIQALLASPEP  124

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVD--EKVQKLVEMGFPEAQVRST  153
            DDPQDAVVA+Q+      F  TA++W   +A  PS   D   KV+KL++MGF E+  R+ 
Sbjct  125  DDPQDAVVAKQFKSNRNAFNITAKHWASIYANGPSRQPDCEAKVEKLMQMGFSESDSRAA  184

Query  152  LELVGWDENXALERL  108
            L    WD   A E L
Sbjct  185  LSSKDWDIPMAAEFL  199



>ref|XP_008470831.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa [Diaphorina 
citri]
Length=199

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 88/135 (65%), Gaps = 3/135 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK+KF TK+WH NISS +GAICLDI KDQW+ A+T +T L S+QAL+ A EP
Sbjct  63   PETYPFNPPKVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA-KPSLG--VDEKVQKLVEMGFPEAQVRST  153
            DDPQDAVVA+QY    + F  TAR+WT  +A  PS     D K+Q+L +MG      R  
Sbjct  123  DDPQDAVVAKQYKENPEMFTLTARHWTNVYAGGPSKNPDFDSKIQRLTDMGVMSHDARVA  182

Query  152  LELVGWDENXALERL  108
            L    W+   A E +
Sbjct  183  LSTYNWELERATEAI  197



>emb|CDS15360.1| ubiquitin conjugating enzyme E2 25kD [Echinococcus granulosus]
Length=201

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 91/135 (67%), Gaps = 3/135 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK+KF TK+WH NISS +G ICLDI KDQW+ A++ +T L SIQALL +PEP
Sbjct  65   PETYPFLPPKVKFLTKIWHPNISSATGVICLDILKDQWAAAMSLRTMLLSIQALLASPEP  124

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVD--EKVQKLVEMGFPEAQVRST  153
            DDPQDAVVA+Q+      F  TA++W   +A  PS   D   KV+KL++MGF E+  R+ 
Sbjct  125  DDPQDAVVAKQFKSNRNAFNITAKHWASIYANGPSRQPDCEAKVEKLMQMGFSESDSRAA  184

Query  152  LELVGWDENXALERL  108
            L    WD   A E L
Sbjct  185  LSSKDWDIPMAAEFL  199



>emb|CCD76999.1| putative ubiquitin-conjugating enzyme E2-25kD [Schistosoma mansoni]
Length=225

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 87/136 (64%), Gaps = 5/136 (4%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK+KF TK+WH NISS +G ICLD+ KDQW+ A++ +T L SIQALL +PEP
Sbjct  89   PENYPFVPPKVKFITKIWHPNISSATGVICLDVLKDQWAAAMSLRTILLSIQALLASPEP  148

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVD----EKVQKLVEMGFPEAQVRS  156
            DDPQDAVVA QY      F  TAR+W   +A    G D    + V KLV+MGF E +   
Sbjct  149  DDPQDAVVANQYKSSIDAFNRTARHWAGIYANGP-GCDPHCVDLVDKLVQMGFDEHEACR  207

Query  155  TLELVGWDENXALERL  108
             L +  WD   A E L
Sbjct  208  ALSMKNWDLAMATEHL  223



>emb|CEF64077.1| Ubiquitin-conjugating enzyme E2 K [Strongyloides ratti]
Length=200

 Score =   140 bits (353),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 91/134 (68%), Gaps = 4/134 (3%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPF+PPK+ F+TK+WH N+SSQ+G ICLDI KDQW+ +LT +T L S+QALL  PEP
Sbjct  63   PSEYPFKPPKVVFSTKIWHPNVSSQTGVICLDILKDQWAASLTLRTVLLSVQALLTIPEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDE----KVQKLVEMGFPEAQVRS  156
             +PQDAVVA+QY+++ + F  TA++W + +      +DE    KV KL++MG  +    S
Sbjct  123  TNPQDAVVAKQYMQDKEMFNITAKFWAQHYGNAPGQIDEEMQKKVSKLIDMGVEDDTAIS  182

Query  155  TLELVGWDENXALE  114
            TL    WD   A+E
Sbjct  183  TLSSKNWDLAAAIE  196



>gb|EUB65074.1| Ubiquitin-conjugating enzyme [Echinococcus granulosus]
Length=238

 Score =   141 bits (355),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 91/135 (67%), Gaps = 3/135 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK+KF TK+WH NISS +G ICLDI KDQW+ A++ +T L SIQALL +PEP
Sbjct  102  PETYPFLPPKVKFLTKIWHPNISSATGVICLDILKDQWAAAMSLRTMLLSIQALLASPEP  161

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVD--EKVQKLVEMGFPEAQVRST  153
            DDPQDAVVA+Q+      F  TA++W   +A  PS   D   KV+KL++MGF E+  R+ 
Sbjct  162  DDPQDAVVAKQFKSNRNAFNITAKHWASIYANGPSRQPDCEAKVEKLMQMGFSESDSRAA  221

Query  152  LELVGWDENXALERL  108
            L    WD   A E L
Sbjct  222  LSSKDWDIPMAAEFL  236



>gb|KIH61984.1| ubiquitin--protein ligase [Ancylostoma duodenale]
Length=200

 Score =   140 bits (352),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 90/138 (65%), Gaps = 4/138 (3%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF PPK+KF TK+WH NISSQ+G ICLDI KDQW+ +LT +T L SIQAL+ +PEP
Sbjct  63   PDTYPFTPPKIKFLTKIWHPNISSQTGTICLDILKDQWAASLTLRTVLLSIQALMCSPEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVD----EKVQKLVEMGFPEAQVRS  156
             DPQDAVVA+QY+     F  TA +WT  +AK     +    E+V+KL +MG  E +  S
Sbjct  123  KDPQDAVVAKQYMSNPALFKETAIFWTIKYAKGKAEENPHYRERVEKLRDMGVTEDEAIS  182

Query  155  TLELVGWDENXALERLCS  102
             L    WD   A + + S
Sbjct  183  VLNCNNWDLAKATDYIFS  200



>gb|EYC42200.1| hypothetical protein Y032_0540g3169 [Ancylostoma ceylanicum]
Length=200

 Score =   139 bits (351),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 90/138 (65%), Gaps = 4/138 (3%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF PPK+KF TK+WH NISSQ+G ICLDI KDQW+ +LT +T L SIQAL+ +PEP
Sbjct  63   PDTYPFTPPKIKFLTKIWHPNISSQTGTICLDILKDQWAASLTLRTVLLSIQALMCSPEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVD----EKVQKLVEMGFPEAQVRS  156
             DPQDAVVA+QY+     F  TA +WT  +AK     +    E+V+KL +MG  E +  S
Sbjct  123  KDPQDAVVAKQYMSNPALFKETAIFWTIKYAKGKAEENPHYRERVEKLRDMGVTEDEAIS  182

Query  155  TLELVGWDENXALERLCS  102
             L    WD   A + + S
Sbjct  183  VLSCNNWDLAKATDYIFS  200



>gb|ETN72541.1| ubiquitin--protein ligase [Necator americanus]
Length=264

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 86/128 (67%), Gaps = 4/128 (3%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF PPK+KF TK+WH NISSQ+G ICLDI KDQW+ +LT +T L SIQAL+ +PEP
Sbjct  63   PDTYPFTPPKIKFLTKIWHPNISSQTGTICLDILKDQWAASLTLRTVLLSIQALMCSPEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK----PSLGVDEKVQKLVEMGFPEAQVRS  156
             DPQDAVVA+QY+     F  TA +WT  +AK     +    E+V+KL +MG  E +  S
Sbjct  123  KDPQDAVVAKQYMANPTLFKETAIFWTIKYAKGKAEENCQYRERVEKLRDMGVTEDEAIS  182

Query  155  TLELVGWD  132
             L    WD
Sbjct  183  VLSCNNWD  190



>ref|XP_002730471.1| PREDICTED: ubiquitin-conjugating enzyme E2 K-like [Saccoglossus 
kowalevskii]
Length=199

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 94/137 (69%), Gaps = 3/137 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK++F TK+WH NISS++GAICLDI KDQW+ A+T +T L S+QALL A EP
Sbjct  63   PETYPFNPPKVRFVTKIWHPNISSKTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSL---GVDEKVQKLVEMGFPEAQVRST  153
            DDPQDAVVA+QY  + Q F  TAR+W + +A+      G   KV +LV+MGF E   R  
Sbjct  123  DDPQDAVVAKQYKEDPQAFEDTARHWAQVYAQAPCNNPGCSAKVNQLVDMGFTETASREA  182

Query  152  LELVGWDENXALERLCS  102
            L +  WD   A+E L S
Sbjct  183  LSMHSWDVEKAVEYLMS  199



>gb|EGT47890.1| hypothetical protein CAEBREN_07248 [Caenorhabditis brenneri]
Length=205

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 89/137 (65%), Gaps = 9/137 (7%)
 Frame = -2

Query  503  PDGYPFEPPK-----MKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALL  339
            P+ YPF PP      +KF TK+WH N+SSQ+G ICLDI KDQW+ +LT +T L SIQAL+
Sbjct  63   PEAYPFSPPNASLEAVKFTTKIWHPNVSSQTGVICLDILKDQWAASLTLRTVLLSIQALM  122

Query  338  XAPEPDDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVD----EKVQKLVEMGFPE  171
             +PEP DPQDAVVA+QY+ + Q F  TA +WT  FA  ++ V+     +V KL +MG  E
Sbjct  123  CSPEPKDPQDAVVAKQYMDKPQVFKDTAAFWTLKFANGTVPVNAEYQNRVDKLKDMGVRE  182

Query  170  AQVRSTLELVGWDENXA  120
             +  S L    WD N A
Sbjct  183  EEAISVLSCNNWDLNRA  199



>gb|ERG81184.1| putative ubiquitin-conjugating enzyme e2 21 [Ascaris suum]
Length=200

 Score =   138 bits (348),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 88/134 (66%), Gaps = 4/134 (3%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF+PP  KF TK+WH NISSQ+G ICLDI K+QW+ +LT +T L SIQALL  PEP
Sbjct  63   PDEYPFQPPVCKFITKIWHPNISSQTGTICLDILKEQWAASLTLRTVLLSIQALLTLPEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDE----KVQKLVEMGFPEAQVRS  156
             DPQDAVVA+Q+L     F  TA++W + +A  S   DE    KV KLV+MG  + Q  S
Sbjct  123  KDPQDAVVARQFLDSPALFNRTAKFWAQHYANASGPKDEELWKKVDKLVDMGVSQDQAIS  182

Query  155  TLELVGWDENXALE  114
             L    WD + A +
Sbjct  183  ALSCNQWDLSKATD  196



>ref|XP_007413145.1| hypothetical protein MELLADRAFT_37906 [Melampsora larici-populina 
98AG31]
 gb|EGG03698.1| hypothetical protein MELLADRAFT_37906 [Melampsora larici-populina 
98AG31]
Length=215

 Score =   138 bits (348),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 87/130 (67%), Gaps = 1/130 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPFEP KMKF TKV+H N+SSQSGAICLDI KD WSP LT KT L S+Q+LL +PEP
Sbjct  60   PDRYPFEPLKMKFITKVYHPNVSSQSGAICLDILKDAWSPVLTLKTTLVSLQSLLCSPEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
            +DPQDA VA+ YL +  TF  TARYWTE +AK +        ++   G   A V+   E 
Sbjct  120  NDPQDAEVAKVYLTDRATFERTARYWTETYAKGTKPSSSSSNEIALAGLNPAYVQQ-FET  178

Query  143  VGWDENXALE  114
            +G+  +  +E
Sbjct  179  MGFQRHQIIE  188



>gb|EST06461.1| ubiquitin-protein ligase [Pseudozyma brasiliensis GHG001]
Length=227

 Score =   138 bits (348),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 92/149 (62%), Gaps = 26/149 (17%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+GYPF+P KMKF T+V+H NISSQSGAICLDI KDQWSP LT K+ L S+++LL +PEP
Sbjct  60   PEGYPFQPIKMKFITRVYHPNISSQSGAICLDILKDQWSPVLTLKSTLMSLRSLLCSPEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-------PSLGVD---------------  210
            +DPQDA VA+ YLR+   F  TARYWTE +A        P+  V+               
Sbjct  120  NDPQDAEVAKHYLRDKDDFEKTARYWTEIYANGSESAQPPAKAVNNAGKTDDKADPILLA  179

Query  209  ----EKVQKLVEMGFPEAQVRSTLELVGW  135
                E V + V MGF  ++V   L+ + +
Sbjct  180  GLKREHVDQFVNMGFESSKVIEVLKKLNY  208



>gb|ENN73582.1| hypothetical protein YQE_09830, partial [Dendroctonus ponderosae]
 gb|ERL85603.1| hypothetical protein D910_03022 [Dendroctonus ponderosae]
Length=199

 Score =   137 bits (346),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 96/137 (70%), Gaps = 3/137 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK++F TK+WH NISS +GAICLDI KDQW+ A+T +T L S+QALL A EP
Sbjct  63   PETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLSAAEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA-KPSLGV--DEKVQKLVEMGFPEAQVRST  153
            DDPQDAVVA+QY    + F  TA++WT A+A  PS+    D+K+++LV+MG  E Q R  
Sbjct  123  DDPQDAVVARQYKDNLEMFKLTAKHWTNAYAGGPSINTECDDKIKRLVDMGIEEHQARVA  182

Query  152  LELVGWDENXALERLCS  102
            L    WD   A E+L S
Sbjct  183  LSSYNWDLERATEQLFS  199



>gb|KFH62915.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Mortierella verticillata NRRL 6337]
Length=235

 Score =   139 bits (349),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 94/173 (54%), Gaps = 42/173 (24%)
 Frame = -2

Query  500  DGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPD  321
            D YPF+PPK+KF TKV+H N+SSQ+G ICLDI K QWSP LT  + L S+Q+LL  PEP+
Sbjct  60   DNYPFQPPKVKFDTKVYHPNVSSQTGVICLDILKQQWSPVLTISSTLLSVQSLLCTPEPN  119

Query  320  DPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLG-----------VD------------  210
            DPQDA VA QYL +++ F  TAR+WTE +AKP  G           +D            
Sbjct  120  DPQDAQVASQYLNDHKAFEETARFWTECYAKPETGDFNLNGQLYGSIDSNNNSGSLLSSQ  179

Query  209  -------------------EKVQKLVEMGFPEAQVRSTLELVGWDENXALERL  108
                               +KVQ+LV+MGF     R+ L    W    ALE L
Sbjct  180  TGAKPSVEPVLTAEEIEKRKKVQELVDMGFDANMARTALIKTKWVTEAALETL  232



>ref|XP_766253.1| ubiquitin conjugating enzyme [Theileria parva strain Muguga]
 gb|EAN33970.1| ubiquitin conjugating enzyme, putative [Theileria parva]
Length=177

 Score =   137 bits (344),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 79/110 (72%), Gaps = 1/110 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YP+ PP +KF TK+WH NISS++GAICLDI K +WSPALT +TAL SIQALL APEP
Sbjct  60   PEDYPYSPPVIKFETKIWHPNISSETGAICLDILKSEWSPALTIRTALISIQALLSAPEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDE-KVQKLVEMGF  177
            DDPQDA VA  Y R Y+ F  TA+ WT  FA+      E K+  L+E+G 
Sbjct  120  DDPQDAQVANMYKRNYKEFENTAKLWTSTFARSRDESREGKINLLLEIGI  169



>gb|EJW79559.1| ubiquitin carrier protein [Wuchereria bancrofti]
Length=201

 Score =   137 bits (346),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 88/134 (66%), Gaps = 4/134 (3%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF+PP  KF TK+WH NISSQ+G ICLDI K+QW+ +LT +T L SIQALL  PEP
Sbjct  64   PDEYPFQPPVCKFITKIWHPNISSQTGTICLDILKEQWAASLTLRTVLLSIQALLTLPEP  123

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDE----KVQKLVEMGFPEAQVRS  156
            +DPQDAVVA+QY+   Q +  TAR+W + +AK     D+    K+ KL +MG  +    S
Sbjct  124  NDPQDAVVARQYMDNAQLYKRTARFWAQHYAKAEGKRDDEFWNKIDKLKDMGVKQEDAIS  183

Query  155  TLELVGWDENXALE  114
             L    WD + A +
Sbjct  184  ALSCNWWDLSRATD  197



>emb|CCF54274.1| probable UBC1-E2 ubiquitin-conjugating enzyme [Ustilago hordei]
Length=222

 Score =   138 bits (347),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 92/140 (66%), Gaps = 9/140 (6%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+GYPF+P KMKF T+V+H NISSQSGAICLDI KDQWSP LT K+ L S+++LL +PEP
Sbjct  60   PEGYPFQPIKMKFITRVYHPNISSQSGAICLDILKDQWSPVLTLKSTLMSLRSLLCSPEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-------PSLG-VDEKVQKLVEMGFPEA  168
            +DPQDA VA+ YLR+   F  TAR WTE +A        PS G  D+K   ++  G  + 
Sbjct  120  NDPQDAEVAKHYLRDKNDFEKTARNWTEIYANGSESAQPPSKGQTDDKADPILLAGLKKE  179

Query  167  QVRSTLELVGWDENXALERL  108
             V     + G++ N  +E L
Sbjct  180  HVDQFANM-GFESNKVIEVL  198



>ref|XP_003146009.1| hypothetical protein LOAG_10437 [Loa loa]
 gb|EFO18058.1| hypothetical protein LOAG_10437 [Loa loa]
Length=201

 Score =   137 bits (345),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 88/134 (66%), Gaps = 4/134 (3%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF+PP  KF TK+WH NISSQ+G ICLDI K+QW+ +LT +T L SIQALL  PEP
Sbjct  64   PDEYPFQPPICKFITKIWHPNISSQTGTICLDILKEQWAASLTLRTVLLSIQALLTLPEP  123

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDE----KVQKLVEMGFPEAQVRS  156
            +DPQDAVVA+QY+   Q +  TAR+W + +AK     D+    K+ KL +MG  +    S
Sbjct  124  NDPQDAVVARQYMDNAQLYKRTARFWAQHYAKAEGKRDDEFWNKIDKLKDMGVKQEDAIS  183

Query  155  TLELVGWDENXALE  114
             L    WD + A +
Sbjct  184  ALSCNWWDLSRATD  197



>ref|XP_001900771.1| Ubiquitin-conjugating enzyme E2-25 kDa [Brugia malayi]
Length=221

 Score =   137 bits (346),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 88/134 (66%), Gaps = 4/134 (3%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF+PP  KF TK+WH NISSQ+G ICLDI K+QW+ +LT +T L SIQALL  PEP
Sbjct  64   PDEYPFQPPVCKFITKIWHPNISSQTGTICLDILKEQWAASLTLRTVLLSIQALLTLPEP  123

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDE----KVQKLVEMGFPEAQVRS  156
            +DPQDAVVA+QY+   Q +  TAR+W + +AK     D+    K+ KL +MG  +    S
Sbjct  124  NDPQDAVVARQYMDNAQLYKRTARFWAQHYAKAEGKRDDEFWNKIDKLKDMGVKQEDAIS  183

Query  155  TLELVGWDENXALE  114
             L    WD + A +
Sbjct  184  ALSCNWWDLSRATD  197



>ref|XP_011386364.1| putative E2 ubiquitin-conjugating protein UBC1 [Ustilago maydis 
521]
 gb|KIS72103.1| putative E2 ubiquitin-conjugating protein UBC1 [Ustilago maydis 
521]
Length=227

 Score =   137 bits (346),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+GYPF+P KMKF T+V+H NISSQSGAICLDI KDQWSP LT K+ L S+++LL +PEP
Sbjct  60   PEGYPFQPIKMKFITRVYHPNISSQSGAICLDILKDQWSPVLTLKSTLMSLRSLLCSPEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPS  222
            +DPQDA VA+ YLR+   F  TARYWTE +A  S
Sbjct  120  NDPQDAEVAKHYLRDKNDFEKTARYWTEIYANGS  153



>dbj|GAA48666.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Clonorchis sinensis]
Length=199

 Score =   137 bits (344),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 84/135 (62%), Gaps = 3/135 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPF PPK+KF T++WH NISS +G ICLD+ KDQW+ A++ +T L SIQALL +PEP
Sbjct  63   PSNYPFVPPKVKFLTRIWHPNISSATGVICLDVLKDQWAAAMSLRTVLLSIQALLASPEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLG---VDEKVQKLVEMGFPEAQVRST  153
            DDPQDAVVA QY      F  TA+YW   +A         +  V +LV MGF E + R  
Sbjct  123  DDPQDAVVANQYKSCPAAFDRTAQYWAAIYAGGPFKDSECNSLVDQLVSMGFDEHESRCA  182

Query  152  LELVGWDENXALERL  108
            L +  WD   A E L
Sbjct  183  LSMKNWDLPQATEHL  197



>ref|XP_009166937.1| hypothetical protein T265_04038 [Opisthorchis viverrini]
 gb|KER29288.1| hypothetical protein T265_04038 [Opisthorchis viverrini]
Length=199

 Score =   137 bits (344),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 84/135 (62%), Gaps = 3/135 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPF PPK+KF T++WH NISS +G ICLD+ KDQW+ A++ +T L SIQALL +PEP
Sbjct  63   PSNYPFVPPKVKFLTRIWHPNISSATGVICLDVLKDQWAAAMSLRTVLLSIQALLASPEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLG---VDEKVQKLVEMGFPEAQVRST  153
            DDPQDAVVA QY      F  TA+YW   +A         +  V +LV MGF E + R  
Sbjct  123  DDPQDAVVANQYKSCPAAFDRTAQYWAAIYAGGPFKDTECNSLVDQLVSMGFDEHESRCA  182

Query  152  LELVGWDENXALERL  108
            L +  WD   A E L
Sbjct  183  LSMKNWDLPQATEHL  197



>dbj|GAC93359.1| hypothetical protein PHSY_000924 [Pseudozyma hubeiensis SY62]
Length=235

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+GYPF+P KMKF T+V+H NISSQSGAICLDI KDQWSP LT K+ L S+++LL +PEP
Sbjct  60   PEGYPFQPIKMKFITRVYHPNISSQSGAICLDILKDQWSPVLTLKSTLMSLRSLLCSPEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPS  222
            +DPQDA VA+ YLR+   F  TARYWTE +A  S
Sbjct  120  NDPQDAEVAKHYLRDRDDFEKTARYWTEIYANGS  153



>gb|KHG15935.1| Ubiquitin-conjugating enzyme E2 27 -like protein [Gossypium arboreum]
Length=165

 Score =   135 bits (340),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 79/102 (77%), Gaps = 7/102 (7%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YP+EPP+M       H NISSQSGA+CLDI KDQWSPA+  KTAL S+QALL APE 
Sbjct  59   PGAYPYEPPRMT------HPNISSQSGAMCLDILKDQWSPAVRLKTALLSVQALLSAPEL  112

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSLGVDEKV  201
             DPQDA+VA+QY+ EYQTF+ TAR WTE FA+ PSLGV+EK 
Sbjct  113  RDPQDALVARQYICEYQTFIDTARSWTENFARVPSLGVEEKT  154



>gb|EJT45143.1| ubiquitin-conjugating enzyme e2-24 kda [Trichosporon asahii var. 
asahii CBS 2479]
 gb|EKD00541.1| ubiquitin-conjugating enzyme e2-24 kda [Trichosporon asahii var. 
asahii CBS 8904]
Length=217

 Score =   137 bits (344),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 95/156 (61%), Gaps = 24/156 (15%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPFEP KMKF TKV+H NISS SGAICLDI KD+WSP LT K+ L S+Q+LL +PEP
Sbjct  60   PDAYPFEPVKMKFITKVYHPNISSASGAICLDILKDKWSPVLTLKSTLISLQSLLCSPEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKP---SLGVD-------------EKVQKL  192
            +DPQDA VA+ +L    +F  TAR+W +A+A+      G D             E V K 
Sbjct  120  NDPQDAEVAKHFLASRDSFNATARHWAQAYAQAPGKKSGKDGAASDAELAGLSEESVSKF  179

Query  191  VEMGFPEAQVRSTLELVGW--------DENXALERL  108
             +MGF   +V +TL+ + +        +EN  +E L
Sbjct  180  ADMGFERPKVIATLKRLNYRGNNVSNINENTVIEEL  215



>emb|CDP99145.1| Protein BM-UBC-20, isoform b [Brugia malayi]
Length=249

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 88/134 (66%), Gaps = 4/134 (3%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF+PP  KF TK+WH NISSQ+G ICLDI K+QW+ +LT +T L SIQALL  PEP
Sbjct  112  PDEYPFQPPVCKFITKIWHPNISSQTGTICLDILKEQWAASLTLRTVLLSIQALLTLPEP  171

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDE----KVQKLVEMGFPEAQVRS  156
            +DPQDAVVA+QY+   Q +  TAR+W + +AK     D+    K+ KL +MG  +    S
Sbjct  172  NDPQDAVVARQYMDNAQLYKRTARFWAQHYAKAEGKRDDEFWNKIDKLKDMGVKQEDAIS  231

Query  155  TLELVGWDENXALE  114
             L    WD + A +
Sbjct  232  ALSCNWWDLSRATD  245



>ref|XP_011134132.1| putative ubiquitin-conjugating enzyme E2 [Gregarina niphandrodes]
 gb|EZG44712.1| putative ubiquitin-conjugating enzyme E2 [Gregarina niphandrodes]
Length=202

 Score =   136 bits (342),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 87/129 (67%), Gaps = 1/129 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YP+ PPKMKF T+VWH N+SSQ+GAICLDI K++WSPALT +TAL S++ALL APEP
Sbjct  66   PEEYPYVPPKMKFDTRVWHPNVSSQTGAICLDILKNEWSPALTIRTALLSVEALLAAPEP  125

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAF-AKPSLGVDEKVQKLVEMGFPEAQVRSTLE  147
            DDPQDA VA       +     AR W + + A  +   + KV+ LV+MG P  + R+ L+
Sbjct  126  DDPQDAEVANLCKNHPEQHAAKARQWRDTYAADKNWPYEAKVKNLVDMGIPADRARAALQ  185

Query  146  LVGWDENXA  120
               WD N A
Sbjct  186  KQNWDVNAA  194



>gb|EGT47553.1| CBN-UBC-21 protein [Caenorhabditis brenneri]
Length=188

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 81/116 (70%), Gaps = 4/116 (3%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPFEPPK KF T++WH NISSQ+GAICLDI KD+W+ +LT +T L SIQA+L A EP
Sbjct  52   PDQYPFEPPKAKFVTRIWHPNISSQTGAICLDILKDKWAASLTLRTVLLSIQAMLCAAEP  111

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVD----EKVQKLVEMGFPEA  168
             DPQDAVVA+QYL     F  TA +WT  FA      +    +KV ++VEMG  EA
Sbjct  112  SDPQDAVVAKQYLSNQAMFKTTATFWTAYFAGSKKEKEPEYVKKVGRIVEMGVREA  167



>ref|XP_003093392.1| CRE-UBC-21 protein [Caenorhabditis remanei]
 gb|EFO94210.1| CRE-UBC-21 protein [Caenorhabditis remanei]
Length=206

 Score =   135 bits (341),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 85/128 (66%), Gaps = 5/128 (4%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF PPK++F +++WH NISSQ+G ICLDI KD+W+ +LT +T L SIQA++ +PE 
Sbjct  63   PDQYPFAPPKVRFVSRIWHPNISSQTGVICLDILKDKWAASLTIRTVLLSIQAMMCSPEA  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVD----EKVQKLVEMGFPEAQVRS  156
             DPQDAVVA+QY+  +  F  TA+YW   FA+    VD    EKV  L EMG  E  + S
Sbjct  123  SDPQDAVVARQYITNFDMFKATAKYWAAYFAQSKKDVDQIYREKVFLLKEMGINEVPIES  182

Query  155  -TLELVGW  135
               E V W
Sbjct  183  RNYESVIW  190



>ref|XP_009044903.1| hypothetical protein LOTGIDRAFT_223907 [Lottia gigantea]
 gb|ESP04417.1| hypothetical protein LOTGIDRAFT_223907 [Lottia gigantea]
Length=199

 Score =   135 bits (340),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 90/137 (66%), Gaps = 3/137 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PP +KF TK+WH NISS +GAICLDI KDQW+ A+T +T L S+QALL A EP
Sbjct  63   PETYPFNPPIVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA---KPSLGVDEKVQKLVEMGFPEAQVRST  153
            DDPQDAVVAQQY   Y  F  TA++WT  +A   K    +D K+  L  MGF E Q R+ 
Sbjct  123  DDPQDAVVAQQYKENYSIFEKTAKHWTAVYAGGPKSCPELDSKITSLKNMGFDENQARAA  182

Query  152  LELVGWDENXALERLCS  102
            L   GWD   A E L +
Sbjct  183  LSSKGWDIERATEYLIN  199



>emb|CDS30261.1| exosome complex exonuclease RRP42 [Hymenolepis microstoma]
Length=200

 Score =   135 bits (339),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 88/136 (65%), Gaps = 4/136 (3%)
 Frame = -2

Query  503  PDGYPFEPPKM-KFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPE  327
            PD YPF PPK+ KF T+VWH NISS +G ICLDI KDQW+ A++ +T L SIQALL +PE
Sbjct  63   PDNYPFMPPKVVKFLTRVWHPNISSSTGVICLDILKDQWAAAMSLRTMLLSIQALLDSPE  122

Query  326  PDDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-PSL--GVDEKVQKLVEMGFPEAQVRS  156
            PDDPQDAVVA Q+      F  TA++W   +A  P+     D KV+KL +MGF E Q  S
Sbjct  123  PDDPQDAVVALQFKSNPDIFNITAKHWASIYAHGPNRQPDCDAKVEKLKQMGFSEDQAIS  182

Query  155  TLELVGWDENXALERL  108
             L    WD   A E L
Sbjct  183  ALSSKNWDIPKAAEYL  198



>dbj|GAK62134.1| ubiquitin-conjugating enzyme e2-24 kda [Pseudozyma antarctica]
Length=227

 Score =   135 bits (341),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 91/149 (61%), Gaps = 26/149 (17%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+GYPF+P KMKF T+V+H NISSQSGAICLDI KDQWSP LT K+ L S+++LL +PEP
Sbjct  60   PEGYPFQPIKMKFITRVYHPNISSQSGAICLDILKDQWSPVLTLKSTLMSLRSLLCSPEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAF------AKPSLGVD----------------  210
            +DPQDA VA+ Y R+   F  TARYWTE +      A+P  G +                
Sbjct  120  NDPQDAEVAKHYRRDKDDFEKTARYWTEIYANGSESAQPPSGANGKTAQADDKADPILLA  179

Query  209  ----EKVQKLVEMGFPEAQVRSTLELVGW  135
                E V + V MGF  ++V   L+ + +
Sbjct  180  GLKKEHVDQFVNMGFESSKVIEVLKKLNY  208



>emb|CCG82392.1| Ubiquitin-conjugating enzyme E2 1 [Taphrina deformans PYCC 5710]
Length=219

 Score =   135 bits (340),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 92/148 (62%), Gaps = 16/148 (11%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPKMKF TK++H NISSQ+GAICLDI K+QWSP LT K+AL S+Q++L  P+P
Sbjct  59   PNDYPFRPPKMKFDTKIYHPNISSQTGAICLDILKEQWSPVLTIKSALVSLQSMLNDPQP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPS---------------LGVDEK-VQKL  192
            +DPQDA VA  YL++  +F  TARYWT+ +A                   G D   VQ+ 
Sbjct  119  NDPQDAEVASHYLKDRASFDKTARYWTQQYASGGAASEAGGGVQDPIEMYGFDRSFVQQF  178

Query  191  VEMGFPEAQVRSTLELVGWDENXALERL  108
             +MGFP+ +V   L  +   +    +RL
Sbjct  179  YDMGFPQERVIEVLRRLQVKKQADCDRL  206



>ref|XP_971328.2| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa [Tribolium 
castaneum]
 gb|EFA00574.1| hypothetical protein TcasGA2_TC003444 [Tribolium castaneum]
Length=199

 Score =   134 bits (338),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 94/137 (69%), Gaps = 3/137 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK++F TK+WH NISS +GAICLDI KDQW+ A+T +T L S+QALL A EP
Sbjct  63   PETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLSAAEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA-KPSLG--VDEKVQKLVEMGFPEAQVRST  153
            DDPQDAVVA+Q+    + F  TAR+WT  +A  P +    D+K+++LV+MG  E Q R  
Sbjct  123  DDPQDAVVAKQFKENIEMFQMTARHWTNVYAGGPHVNKECDDKIKRLVDMGVEEHQARVA  182

Query  152  LELVGWDENXALERLCS  102
            L    WD   A E+L S
Sbjct  183  LSSYNWDIERATEQLFS  199



>dbj|GAC73762.1| ubiquitin-protein ligase [Pseudozyma antarctica T-34]
 gb|ETS63765.1| hypothetical protein PaG_02083 [Pseudozyma aphidis DSM 70725]
Length=227

 Score =   135 bits (340),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 91/145 (63%), Gaps = 14/145 (10%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+GYPF+P KMKF T+V+H NISSQSGAICLDI KDQWSP LT K+ L S+++LL +PEP
Sbjct  60   PEGYPFQPIKMKFITRVYHPNISSQSGAICLDILKDQWSPVLTLKSTLMSLRSLLCSPEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLG-------------VDEKVQKLVEM  183
            +DPQDA VA+ Y R+   F  TARYWTE +A  S                D+K   ++  
Sbjct  120  NDPQDAEVAKHYRRDKDDFEKTARYWTEIYANGSESAQPPSGANGKTAQADDKADPILLA  179

Query  182  GFPEAQVRSTLELVGWDENXALERL  108
            G  +  V   + + G++ N  +E L
Sbjct  180  GLKKEHVDQFVNM-GFESNKVIEVL  203



>emb|CBQ67936.1| probable UBC1-E2 ubiquitin-conjugating enzyme [Sporisorium reilianum 
SRZ2]
Length=227

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 91/149 (61%), Gaps = 26/149 (17%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+GYPF+P KMKF T+V+H NISSQSGAICLDI KDQWSP LT K+ L S+++LL +PEP
Sbjct  60   PEGYPFQPIKMKFITRVYHPNISSQSGAICLDILKDQWSPVLTLKSTLMSLRSLLCSPEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPS------------LG-VDEK-------  204
            +DPQDA VA  Y R+   F  TARYWTE +A  S            +G  DEK       
Sbjct  120  NDPQDAQVASHYKRDRDDFEKTARYWTEIYANGSESAQPPANAQSKVGQTDEKADPILLA  179

Query  203  ------VQKLVEMGFPEAQVRSTLELVGW  135
                  V + V MGF  ++V   L+ + +
Sbjct  180  GLKREHVDQFVNMGFESSKVIEVLKKLNY  208



>emb|CDI51448.1| probable UBC1-E2 ubiquitin-conjugating enzyme [Melanopsichium 
pennsylvanicum 4]
Length=227

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 92/145 (63%), Gaps = 14/145 (10%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+GYPF+P KMKF T+V+H NISSQSGAICLDI KDQWSP LT K+ L S+++LL +PEP
Sbjct  60   PEGYPFQPIKMKFITRVYHPNISSQSGAICLDILKDQWSPVLTLKSTLMSLRSLLCSPEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK-------PSLG------VDEKVQKLVEM  183
            +DPQDA VA+ YLR+   F  TA YWTE +A        P+ G       D+K   ++  
Sbjct  120  NDPQDAEVAKHYLRDKADFEKTATYWTEIYANGSESAQPPANGQNKTGKTDDKADPVLLA  179

Query  182  GFPEAQVRSTLELVGWDENXALERL  108
            G     V   + + G++ N  +E L
Sbjct  180  GLKREHVDQFVNM-GFESNKVIEVL  203



>ref|NP_596239.1| ubiquitin conjugating enzyme Ubc1 (predicted) [Schizosaccharomyces 
pombe 972h-]
 sp|O74810.2|UBC1_SCHPO RecName: Full=Ubiquitin-conjugating enzyme E2 1; AltName: Full=Ubiquitin 
carrier protein 1; AltName: Full=Ubiquitin-protein 
ligase 1 [Schizosaccharomyces pombe 972h-]
 emb|CAA21178.2| ubiquitin conjugating enzyme Ubc1 (predicted) [Schizosaccharomyces 
pombe]
Length=217

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 83/123 (67%), Gaps = 1/123 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPF PPKM F TK++H N+SSQ+GAICLDI KDQWSP  T K+AL S+Q+LL  PEP
Sbjct  60   PIDYPFRPPKMNFDTKIYHPNVSSQTGAICLDILKDQWSPVYTMKSALISLQSLLCTPEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
             +PQDA VAQ YL+ YQ F+ TAR WT ++A    GVD   +   E G  +  + + L+ 
Sbjct  120  SNPQDAQVAQVYLQNYQQFVRTAREWTSSYAAAPAGVDLDAEN-TEFGGIDPNIITNLQQ  178

Query  143  VGW  135
             G+
Sbjct  179  FGF  181



>ref|XP_011429616.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like [Crassostrea 
gigas]
 gb|EKC28471.1| Ubiquitin-conjugating enzyme E2-22 kDa [Crassostrea gigas]
Length=199

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 93/137 (68%), Gaps = 3/137 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK+KF TK+WH NISS +GAICLDI KDQW+ A+T +T L S+QALL A EP
Sbjct  63   PETYPFNPPKVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA---KPSLGVDEKVQKLVEMGFPEAQVRST  153
            DDPQDAVVA+QY    + F  TAR+WT A+A   +    ++ K+Q+++ MGF E + R  
Sbjct  123  DDPQDAVVAKQYKENNEIFKKTARHWTYAYAGGPQREYDIEAKIQQVMSMGFDEHKSRVA  182

Query  152  LELVGWDENXALERLCS  102
            L    WD   A E L S
Sbjct  183  LSSHNWDIERATEFLLS  199



>gb|KFB42674.1| ubiquitin-conjugating enzyme E2-25kD [Anopheles sinensis]
Length=199

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 92/137 (67%), Gaps = 3/137 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK+KF TK+WH NISS +GAICLDI KD W+ A+T +T L S+QALL A EP
Sbjct  63   PETYPFNPPKVKFMTKIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA---KPSLGVDEKVQKLVEMGFPEAQVRST  153
            DDPQDAVVA QY   ++ F+ TA++WT  +A     +   D+KVQ+L +MG PE   R+ 
Sbjct  123  DDPQDAVVATQYKDNHEMFILTAKHWTNVYAGGPAANADFDQKVQRLRDMGIPEYDARAA  182

Query  152  LELVGWDENXALERLCS  102
            L    W    A E+L S
Sbjct  183  LSRHNWHLERASEQLFS  199



>ref|XP_011202431.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa [Bactrocera 
dorsalis]
Length=199

 Score =   133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 90/137 (66%), Gaps = 3/137 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK++F TK+WH NISS +GAICLDI KD W+ A+T +T L S+QALL A EP
Sbjct  63   PETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA---KPSLGVDEKVQKLVEMGFPEAQVRST  153
            DDPQDAVVA QY  +YQ FL TA++WT  +A         D K+Q+L +MG  E   R+ 
Sbjct  123  DDPQDAVVAYQYKDKYQLFLMTAKHWTNIYAGGPHKFTECDSKIQRLKDMGIDEHDARAV  182

Query  152  LELVGWDENXALERLCS  102
            L    WD   A E L S
Sbjct  183  LSKENWDLEKATENLFS  199



>ref|XP_002172199.2| ubiquitin conjugating enzyme Ubc1 [Schizosaccharomyces japonicus 
yFS275]
 gb|EEB05906.2| ubiquitin conjugating enzyme Ubc1 [Schizosaccharomyces japonicus 
yFS275]
Length=213

 Score =   133 bits (334),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 91/140 (65%), Gaps = 9/140 (6%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPF PP +KF T+V+H NISSQ+GAICLDI KDQWSP  T K+AL S+Q+LL  PEP
Sbjct  61   PIDYPFRPPIVKFDTRVYHPNISSQTGAICLDILKDQWSPVYTIKSALISLQSLLCTPEP  120

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK--------PSLGVDEK-VQKLVEMGFPE  171
            ++PQDA VA  YL+++  F+ TAR WT  +A          + G+D+  V ++V +GFP 
Sbjct  121  NNPQDAQVAGVYLKDHPKFVETAREWTRTYANAGEPKDAAAAAGIDKHLVDEIVALGFPS  180

Query  170  AQVRSTLELVGWDENXALER  111
             +V   L+ +G      LE+
Sbjct  181  DKVVGVLQKLGVHNKDELEK  200



>ref|XP_011192700.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa [Bactrocera 
cucurbitae]
Length=199

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 90/137 (66%), Gaps = 3/137 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK++F TK+WH NISS +GAICLDI KD W+ A+T +T L S+QALL A EP
Sbjct  63   PETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA---KPSLGVDEKVQKLVEMGFPEAQVRST  153
            DDPQDAVVA QY  +YQ FL TA++WT  +A         D K+Q+L +MG  E   R+ 
Sbjct  123  DDPQDAVVAYQYKDKYQLFLMTAKHWTNIYAGGPHKFTECDTKIQRLKDMGIDEHDARAV  182

Query  152  LELVGWDENXALERLCS  102
            L    WD   A E L S
Sbjct  183  LSKENWDLEKATESLFS  199



>dbj|GAA95025.1| hypothetical protein E5Q_01680 [Mixia osmundae IAM 14324]
 gb|KEI36197.1| hypothetical protein L969DRAFT_91194 [Mixia osmundae IAM 14324]
 gb|KEI38165.1| hypothetical protein L969DRAFT_89413 [Mixia osmundae IAM 14324]
Length=238

 Score =   133 bits (335),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 92/150 (61%), Gaps = 22/150 (15%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPF+P KMKF TK +H N+SSQSGAICLDI KD W+P LT KTAL S+Q+LL +PEP
Sbjct  75   PPTYPFQPLKMKFITKTYHPNVSSQSGAICLDILKDAWTPVLTLKTALVSLQSLLCSPEP  134

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAF------AKPSLGVD----------------  210
            +DPQDA VA+ +L + + F  TA+YWT  +      AK  LG D                
Sbjct  135  NDPQDAEVAKVFLTDRKQFDDTAKYWTTVYAGGDRAAKSKLGPDGKPVALDEIQLNGLSH  194

Query  209  EKVQKLVEMGFPEAQVRSTLELVGWDENXA  120
            E V++ V+MGF + +V  TL  V +  N A
Sbjct  195  EHVKQFVDMGFEQTRVIQTLAKVNYRGNNA  224



>ref|XP_005183881.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa [Musca domestica]
Length=200

 Score =   132 bits (332),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 90/137 (66%), Gaps = 3/137 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK++F TK+WH NISS +GAICLDI KD W+ A+T +T L S+QALL A EP
Sbjct  64   PETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEP  123

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA---KPSLGVDEKVQKLVEMGFPEAQVRST  153
            DDPQDAVVA QY  +YQ F+ TAR+WT  +A         D K+Q+L +MG  E   R+ 
Sbjct  124  DDPQDAVVAYQYKDKYQLFVMTARHWTNVYAGGPHKYPDCDAKIQRLKDMGIDEHDARAV  183

Query  152  LELVGWDENXALERLCS  102
            L    WD   A E L S
Sbjct  184  LSKENWDLEKATESLFS  200



>gb|AAW25929.1| SJCHGC02302 protein [Schistosoma japonicum]
Length=193

 Score =   132 bits (331),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 79/115 (69%), Gaps = 5/115 (4%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK+KF TK+WH NISS +G ICLD+ KDQW+ A++ +T L SIQALL +PEP
Sbjct  63   PENYPFVPPKVKFITKIWHPNISSATGVICLDVLKDQWAAAMSLRTILLSIQALLASPEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVD----EKVQKLVEMGFPE  171
            DDPQDAVVA QY      F  TAR+W   +A    G D    + V KLV+MGF E
Sbjct  123  DDPQDAVVANQYKSSIDAFNRTARHWAGIYAN-GPGCDPQCVDLVDKLVQMGFDE  176



>gb|ETN57965.1| ubiquitin-conjugating enzyme E2-25kD [Anopheles darlingi]
Length=199

 Score =   132 bits (331),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 92/137 (67%), Gaps = 3/137 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK+KF TK+WH NISS +GAICLDI KD W+ A+T +T L S+QALL A EP
Sbjct  63   PETYPFNPPKVKFMTKIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK---PSLGVDEKVQKLVEMGFPEAQVRST  153
            DDPQDAVVA QY   ++ F+ TA++W  A+A     ++  D+KVQ+L +MG  E   R+ 
Sbjct  123  DDPQDAVVATQYKENHEMFILTAKHWANAYAGGPFANVDFDQKVQRLRDMGISEHDARAA  182

Query  152  LELVGWDENXALERLCS  102
            L    W    A E+L S
Sbjct  183  LSRHNWHLERASEQLFS  199



>gb|ELU15540.1| hypothetical protein CAPTEDRAFT_150271 [Capitella teleta]
Length=199

 Score =   132 bits (331),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 90/137 (66%), Gaps = 3/137 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK++F TK+WH NISS +GAICLDI KDQW+ A+T +T L S+QALL APEP
Sbjct  63   PETYPFNPPKVQFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAPEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLG---VDEKVQKLVEMGFPEAQVRST  153
            DDPQDAVVA+QY      F  TAR+W   +A        +D+KV +L  MGF E + R  
Sbjct  123  DDPQDAVVARQYKETSDIFSQTARHWASNYASAPHREPVMDDKVAQLKNMGFDEHKARVA  182

Query  152  LELVGWDENXALERLCS  102
            L    WD   A+E + S
Sbjct  183  LSTHNWDIEQAMENILS  199



>ref|XP_011503723.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa isoform X2 
[Ceratosolen solmsi marchali]
Length=200

 Score =   132 bits (331),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 94/137 (69%), Gaps = 3/137 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK++F TK+WH NISS +GAICLDI KDQW+ A+T +T L S+QALL A EP
Sbjct  64   PETYPFNPPKVRFITKIWHPNISSITGAICLDILKDQWAAAMTLRTVLLSLQALLSAAEP  123

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA-KPSL--GVDEKVQKLVEMGFPEAQVRST  153
            DDPQDAVVA+QY  + + F  TA++WT  +A  PS    +DEK+++L +MG  E   R  
Sbjct  124  DDPQDAVVAKQYKEQPEMFHQTAKHWTSVYAGGPSKMPELDEKIKRLTDMGIEEHNARDA  183

Query  152  LELVGWDENXALERLCS  102
            L    WD   A E+L S
Sbjct  184  LSSYNWDLERATEQLFS  200



>ref|XP_007881930.1| hypothetical protein PFL1_06200 [Pseudozyma flocculosa PF-1]
 gb|EPQ26265.1| hypothetical protein PFL1_06200 [Pseudozyma flocculosa PF-1]
Length=228

 Score =   132 bits (333),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 85/149 (57%), Gaps = 27/149 (18%)
 Frame = -2

Query  500  DGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPD  321
            +GYPF+PPKMKF TKV+H NISS SGAICLDI KDQWSP LT K+ L S+++LL +PEP 
Sbjct  61   EGYPFQPPKMKFITKVYHPNISSASGAICLDILKDQWSPVLTLKSTLMSLRSLLCSPEPS  120

Query  320  DPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVD-----------------------  210
            DPQDA VA+ Y+ +   F  TARYWTE +A  S                           
Sbjct  121  DPQDAEVAKHYMSDKADFEKTARYWTEIYANGSESARPPETTSAGPKAASAKQEDPALVA  180

Query  209  ----EKVQKLVEMGFPEAQVRSTLELVGW  135
                E V + V MGF   QV   L+ + +
Sbjct  181  GLKLEHVAQFVNMGFERGQVIEVLKKLNY  209



>ref|XP_011503721.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa isoform X1 
[Ceratosolen solmsi marchali]
 ref|XP_011503722.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa isoform X1 
[Ceratosolen solmsi marchali]
Length=206

 Score =   132 bits (331),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 94/137 (69%), Gaps = 3/137 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK++F TK+WH NISS +GAICLDI KDQW+ A+T +T L S+QALL A EP
Sbjct  70   PETYPFNPPKVRFITKIWHPNISSITGAICLDILKDQWAAAMTLRTVLLSLQALLSAAEP  129

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA-KPSL--GVDEKVQKLVEMGFPEAQVRST  153
            DDPQDAVVA+QY  + + F  TA++WT  +A  PS    +DEK+++L +MG  E   R  
Sbjct  130  DDPQDAVVAKQYKEQPEMFHQTAKHWTSVYAGGPSKMPELDEKIKRLTDMGIEEHNARDA  189

Query  152  LELVGWDENXALERLCS  102
            L    WD   A E+L S
Sbjct  190  LSSYNWDLERATEQLFS  206



>gb|KIO15436.1| hypothetical protein M407DRAFT_98351 [Tulasnella calospora MUT 
4182]
Length=217

 Score =   132 bits (331),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 88/135 (65%), Gaps = 4/135 (3%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF+P KMKF TKV+H N+SS SGAICLDI KD WSP LT K+ L S+Q+LL +PEP
Sbjct  60   PDSYPFQPVKMKFLTKVYHPNVSSASGAICLDILKDAWSPVLTLKSTLISLQSLLCSPEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK---PSLGVDEKVQKLVEMGFPEAQVRST  153
            +DPQDA VA+ Y+    +F  TARYWTE +A       G  E+  ++   G  +A V   
Sbjct  120  NDPQDAEVAKHYMTSRSSFNDTARYWTEIYAGGPPAKAGSSEQKDEVAIAGLEKAHV-DQ  178

Query  152  LELVGWDENXALERL  108
             E +G++ +  ++ L
Sbjct  179  FEALGFERSKVIDVL  193



>gb|EPY53947.1| ubiquitin conjugating enzyme Ubc1 [Schizosaccharomyces cryophilus 
OY26]
Length=218

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPF PPKMKF TK++H NISSQ+GAICLDI KDQWSP  T K+AL S+Q+LL  PEP
Sbjct  61   PIDYPFRPPKMKFDTKIYHPNISSQTGAICLDILKDQWSPVYTVKSALISLQSLLCTPEP  120

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
             +PQDA VAQ YL+ Y+ F+ TA+ W   +A+P   ++ +       G  + ++   L+ 
Sbjct  121  SNPQDAQVAQVYLQNYEQFIHTAKEWVRLYAQPPSFINVEEASDAYNGI-DPKIIQNLKN  179

Query  143  VGWDENXALERL  108
             G+D+N  ++ L
Sbjct  180  FGFDQNVIIQAL  191



>gb|KHN88323.1| putative ubiquitin-conjugating enzyme E2 21, partial [Toxocara 
canis]
Length=242

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 90/138 (65%), Gaps = 5/138 (4%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF+PP  KF T++WH NISSQ+G ICLDI K+QW+ +LT +T L SIQALL  PEP
Sbjct  68   PDEYPFQPPVCKFITRIWHPNISSQTGTICLDILKEQWAASLTLRTVLLSIQALLTLPEP  127

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDE----KVQKLVEMGFPEAQVRS  156
            +DPQDAVVA+Q+L     F  TA++W + +A  S   DE    KV KLV+MG  +   + 
Sbjct  128  NDPQDAVVAKQFLDSPALFNRTAKFWAQHYANASGPKDEELWKKVDKLVDMGVSQMSDKK  187

Query  155  TLELVGWDENXALERLCS  102
               +   DE+  L+  C+
Sbjct  188  DCPM-SKDESKKLKPCCA  204



>ref|XP_008211374.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa [Nasonia vitripennis]
Length=181

 Score =   130 bits (328),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 93/137 (68%), Gaps = 3/137 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK++F TK+WH NISS +GAICLDI KDQW+ A+T +T L S+QALL A EP
Sbjct  45   PETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLSAAEP  104

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA-KPSL--GVDEKVQKLVEMGFPEAQVRST  153
            DDPQDAVVA+QY    + F  TA++WT  +A  PS    +DEK+++L +MG  E   R  
Sbjct  105  DDPQDAVVAKQYKEHPEMFRQTAKHWTSVYAGGPSKMPELDEKIRRLTDMGIEEHNARVA  164

Query  152  LELVGWDENXALERLCS  102
            L    WD   A E+L S
Sbjct  165  LSSYNWDLERATEQLFS  181



>gb|KDQ26171.1| hypothetical protein PLEOSDRAFT_52152 [Pleurotus ostreatus PC15]
Length=217

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 86/143 (60%), Gaps = 17/143 (12%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF+P KMKF TKV+H N+SS SGAICLDI KD WSP LT K+ L S+Q+LL +PEP
Sbjct  59   PESYPFQPVKMKFITKVYHPNVSSASGAICLDILKDAWSPVLTLKSTLISLQSLLCSPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEK-----------------VQK  195
            +DPQDA VA+ Y+    +F  TA YWT  +A      D K                 V +
Sbjct  119  NDPQDAEVAKHYMTSKASFEETATYWTHIYAGGPGSKDAKQLNSGDDVAIAGLEHTHVDR  178

Query  194  LVEMGFPEAQVRSTLELVGWDEN  126
             VE+GFP+A+V   L  + +  N
Sbjct  179  FVELGFPKAKVVDALRRLNYRGN  201



>ref|XP_003647259.1| hypothetical protein Ecym_6038 [Eremothecium cymbalariae DBVPG#7215]
 gb|AET40442.1| hypothetical protein Ecym_6038 [Eremothecium cymbalariae DBVPG#7215]
Length=211

 Score =   130 bits (328),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 84/129 (65%), Gaps = 10/129 (8%)
 Frame = -2

Query  494  YPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEPDDP  315
            YPF+PPKM+F TKV+H NISS +GAICLDI K+ WSP LT KT+L S+QALL +PEP+DP
Sbjct  62   YPFKPPKMQFDTKVYHPNISSVTGAICLDILKNSWSPVLTLKTSLISLQALLQSPEPNDP  121

Query  314  QDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQ----------KLVEMGFPEAQ  165
            QDA VA+ YL +  +F  TA  WT+ +A    G DE+ Q           +V  GF + +
Sbjct  122  QDAEVAKHYLSDRSSFDKTAALWTKTYASGETGNDEEAQLYGIDKSLVDSMVNQGFSKDK  181

Query  164  VRSTLELVG  138
            V   L  +G
Sbjct  182  VVEVLRRLG  190



>gb|EHJ79025.1| ubiquitin conjugating enzyme 4 [Danaus plexippus]
Length=199

 Score =   130 bits (327),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 92/137 (67%), Gaps = 3/137 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK++F TK+WH N+SS +GAICLDI KDQW+ ALT +T L S+QALL A EP
Sbjct  63   PETYPFNPPKIRFVTKIWHPNVSSVTGAICLDILKDQWAAALTLRTVLLSLQALLSAAEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGV---DEKVQKLVEMGFPEAQVRST  153
            +DPQDAVVA+QY    Q F  TAR+WT  +A     +   ++KVQ+L++MG  E   R  
Sbjct  123  NDPQDAVVAKQYKENPQLFHMTARHWTNVYAGGPASIVEFNQKVQRLLDMGVDEHDARVA  182

Query  152  LELVGWDENXALERLCS  102
            L    W+   A E+L S
Sbjct  183  LSTYDWELERATEQLFS  199



>emb|CDR38023.1| CYFA0S01e20296g1_1 [Cyberlindnera fabianii]
Length=213

 Score =   130 bits (328),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 90/152 (59%), Gaps = 19/152 (13%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF+PP MKF TKV+H NISS +GAICLDI KD W+P LT K++L S+Q+L  +PEP
Sbjct  59   PNEYPFKPPIMKFDTKVYHPNISSVTGAICLDILKDAWTPILTLKSSLISLQSLFQSPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPS----------LGVDEK-VQKLVEMGF  177
            +DPQDA VA+ Y+ +   F  TA+YWT+ +A  +           G+DE  V     MGF
Sbjct  119  NDPQDAEVAKHYISDRDGFNKTAKYWTQTYASDASTKDVNDAQLYGIDESTVSNFENMGF  178

Query  176  PEAQVRSTLELVGWD--------ENXALERLC  105
            P  +V   L  +G          EN  +E L 
Sbjct  179  PRDKVIEVLRRLGLKKVESEPRTENKVIEELL  210



>ref|XP_005109764.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like [Aplysia 
californica]
Length=199

 Score =   130 bits (327),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 90/137 (66%), Gaps = 3/137 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PP++KF TK+WH NISS +GAICLDI KDQW+ A+T +T L S+QALL A EP
Sbjct  63   PETYPFNPPQVKFVTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA---KPSLGVDEKVQKLVEMGFPEAQVRST  153
            DDPQDAVVAQQ+      F  TAR+WT A+A   K    ++EKV  +  MGF E + R  
Sbjct  123  DDPQDAVVAQQFKENNPIFQRTARHWTCAYAGGPKSDKELEEKVVSMKNMGFDEHKARVA  182

Query  152  LELVGWDENXALERLCS  102
            L    WD   A E L S
Sbjct  183  LSTKDWDVTRAAEYLIS  199



>ref|XP_007002050.1| hypothetical protein TREMEDRAFT_70845 [Tremella mesenterica DSM 
1558]
 gb|EIW72887.1| hypothetical protein TREMEDRAFT_70845 [Tremella mesenterica DSM 
1558]
Length=219

 Score =   130 bits (328),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 88/144 (61%), Gaps = 18/144 (13%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF+P KMKF TKV+H NISS SGAICLDI KD WSP LT K+ L S+Q+LL  P P
Sbjct  60   PDAYPFQPVKMKFITKVYHPNISSASGAICLDILKDAWSPVLTLKSTLISLQSLLCDPVP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKP----------SLGVD--------EKVQ  198
            +DPQDA VA+ +L + Q+F  TA++W +A+A+            +  D        E V+
Sbjct  120  NDPQDAEVAKHFLTDRQSFNATAKHWAQAYAQAPARKQAQVSGKVATDAEMAGLSEESVK  179

Query  197  KLVEMGFPEAQVRSTLELVGWDEN  126
               EMGFP  +V   L+ + +  N
Sbjct  180  GFTEMGFPREKVIQVLKRLNYRGN  203



>ref|XP_001846293.1| ubiquitin-conjugating enzyme E2-25kD [Culex quinquefasciatus]
 gb|EDS43211.1| ubiquitin-conjugating enzyme E2-25kD [Culex quinquefasciatus]
Length=199

 Score =   130 bits (326),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 93/137 (68%), Gaps = 3/137 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK+KF TK+WH NISS +GAICLDI KD W+ A+T +T L S+QALL A EP
Sbjct  63   PETYPFNPPKVKFITKIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAK---PSLGVDEKVQKLVEMGFPEAQVRST  153
            DDPQDAVVA QY   ++ F+ TA++WT A+A     +   D+KVQ+L +MG  + + R+ 
Sbjct  123  DDPQDAVVATQYKDNHEMFILTAKHWTNAYAGGPCRNADFDQKVQRLRDMGVEDYEARAA  182

Query  152  LELVGWDENXALERLCS  102
            L    W    A E+L S
Sbjct  183  LSRHNWHLERASEQLFS  199



>ref|XP_003956037.1| hypothetical protein KAFR_0B06060 [Kazachstania africana CBS 
2517]
 emb|CCF56902.1| hypothetical protein KAFR_0B06060 [Kazachstania africana CBS 
2517]
Length=213

 Score =   130 bits (327),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 95/150 (63%), Gaps = 17/150 (11%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPF+PP+MKF TKV+H NISS +GAICLDI K+ WSP +T K+AL S+QALL +PEP
Sbjct  59   PMEYPFKPPQMKFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLG---VDEK---------VQKLVEMG  180
            +DPQDA VAQ YLR+ ++F  TA  WT+ +A  + G   VDE          V++    G
Sbjct  119  NDPQDAEVAQHYLRDRESFNKTAALWTKLYASAAYGDKEVDEAELYGINSDVVEEFESQG  178

Query  179  FPEAQVRSTLELVGW-----DENXALERLC  105
            F ++++   L  +G      ++N  + R+ 
Sbjct  179  FEKSKIIEVLRRLGIKSLDPNDNATINRII  208



>ref|XP_007867121.1| hypothetical protein GLOTRDRAFT_139354 [Gloeophyllum trabeum 
ATCC 11539]
 gb|EPQ54899.1| hypothetical protein GLOTRDRAFT_139354 [Gloeophyllum trabeum 
ATCC 11539]
Length=221

 Score =   130 bits (327),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF+P KMKF TKV+H N+SS SGAICLDI KDQWSP LT K+ L S+Q+LL +PEP
Sbjct  59   PDSYPFQPLKMKFITKVYHPNVSSASGAICLDILKDQWSPVLTLKSTLISLQSLLCSPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA  231
            DDPQDA VA+ Y+    +F  TARYWT  +A
Sbjct  119  DDPQDAEVAKHYMTSRSSFEETARYWTHIYA  149



>gb|EPX72483.1| ubiquitin conjugating enzyme Ubc1 [Schizosaccharomyces octosporus 
yFS286]
Length=239

 Score =   130 bits (328),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 87/132 (66%), Gaps = 1/132 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPF PPKMKF TK++H NISSQ+GAICLDI KDQWSP  T K+AL S+Q+LL  PEP
Sbjct  82   PIDYPFRPPKMKFDTKIYHPNISSQTGAICLDILKDQWSPVYTVKSALISLQSLLCTPEP  141

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKLVEMGFPEAQVRSTLEL  144
             +PQDA VAQ Y+  +  F+ TA+ W   +A+P   +D + +     G  + +V  +L+ 
Sbjct  142  SNPQDAQVAQVYIENHDQFIKTAKEWVRLYAQPPAFIDVEEEGDSYNGI-DPKVVQSLQN  200

Query  143  VGWDENXALERL  108
             G+D+N  +  L
Sbjct  201  FGFDQNVIVSAL  212



>emb|CDF87720.1| BN860_12904g1_1 [Zygosaccharomyces bailii CLIB 213]
 emb|CDH09849.1| Ubiquitin-conjugating enzyme E2 1 [Zygosaccharomyces bailii ISA1307]
 emb|CDH09528.1| Ubiquitin-conjugating enzyme E2 1 [Zygosaccharomyces bailii ISA1307]
Length=216

 Score =   130 bits (326),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 88/137 (64%), Gaps = 15/137 (11%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPF+PPKMKF TKV+H NISS +GAICLDI K+ WSP +T K+AL S+QALL +PEP
Sbjct  59   PMEYPFKPPKMKFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPS--------------LGVDEKVQKLVE  186
            +DPQDA VAQ YLR+ ++F  TA  WT+ +A P+               G+D  + K  E
Sbjct  119  NDPQDAEVAQHYLRDKESFNKTAALWTKLYASPTGSLPTEREVDEVKLYGIDPNLVKEFE  178

Query  185  -MGFPEAQVRSTLELVG  138
              GF + ++   L  +G
Sbjct  179  SQGFEKVKIVEVLRRLG  195



>emb|CEP61078.1| LALA0S02e06238g1_1 [Lachancea lanzarotensis]
Length=216

 Score =   130 bits (326),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 89/137 (65%), Gaps = 15/137 (11%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPF+PPKMKF TKV+H N+SS +GAICLDI K+ WSP +T K+AL S+QALL +PEP
Sbjct  59   PMEYPFKPPKMKFDTKVYHPNVSSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA-------------KPSL-GVDEK-VQKLV  189
            +DPQDA VAQ Y+R+ ++F  TA  WT+ +A             + SL G+D   V + V
Sbjct  119  NDPQDAEVAQHYIRDRESFNNTAALWTKMYAPMNSDSDSQQIVDQASLYGIDSGLVNQFV  178

Query  188  EMGFPEAQVRSTLELVG  138
              GF E ++   L  +G
Sbjct  179  SQGFTEEKIVEVLRRLG  195



>ref|XP_007354446.1| hypothetical protein AURDEDRAFT_116792 [Auricularia delicata 
TFB-10046 SS5]
 gb|EJD37495.1| hypothetical protein AURDEDRAFT_116792 [Auricularia delicata 
TFB-10046 SS5]
Length=212

 Score =   129 bits (325),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 88/134 (66%), Gaps = 11/134 (8%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPF+P KMKF TKV+H N+SS SGAICLDI KD WSP LT K+ L S+Q+LL +PEP
Sbjct  60   PPTYPFQPVKMKFITKVYHPNVSSASGAICLDILKDAWSPVLTLKSTLISLQSLLCSPEP  119

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA----KPS------LGVDE-KVQKLVEMGF  177
            +DPQDA VA+ YL   ++F  TARYWT+ +A    KP        G+++  V + + MGF
Sbjct  120  NDPQDAEVAKHYLTSRESFNDTARYWTQLYAGAPGKPKHDPAAMAGIEKAHVDRFIGMGF  179

Query  176  PEAQVRSTLELVGW  135
              ++V   L  + +
Sbjct  180  EASKVVDVLRRLNY  193



>ref|XP_007305100.1| hypothetical protein STEHIDRAFT_98645 [Stereum hirsutum FP-91666 
SS1]
 gb|EIM86256.1| hypothetical protein STEHIDRAFT_98645 [Stereum hirsutum FP-91666 
SS1]
Length=224

 Score =   130 bits (326),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            PD YPF+P KMKF TKV+H N+SS SGAICLDI KD WSP LT K+ L S+Q+LL +PEP
Sbjct  59   PDSYPFQPVKMKFITKVYHPNVSSASGAICLDILKDAWSPVLTLKSTLISLQSLLCSPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQKL  192
            +DPQDA VA+ Y+    +F  TARYWT+ +A    G +  + +L
Sbjct  119  NDPQDAEVAKHYMTSRSSFEDTARYWTQVYAGGGGGRNVNIGEL  162



>gb|EJT42692.1| UBC1-like protein [Saccharomyces kudriavzevii IFO 1802]
Length=215

 Score =   129 bits (325),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 88/136 (65%), Gaps = 14/136 (10%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPF+PPKM+F TKV+H NISS +GAICLDI K+ WSP +T K+AL S+QALL +PEP
Sbjct  59   PMEYPFKPPKMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSL-------------GVDEK-VQKLVE  186
            +DPQDA VAQ YLR+ ++F  TA  WT  +A  S+             G+D   +++   
Sbjct  119  NDPQDAEVAQHYLRDRESFNKTAALWTRLYASESINGQKSSVEESDLYGIDHDLIEEFES  178

Query  185  MGFPEAQVRSTLELVG  138
             GF +A++   L  +G
Sbjct  179  QGFDKAKIVEVLRRLG  194



>ref|XP_001644260.1| hypothetical protein Kpol_1030p10 [Vanderwaltozyma polyspora 
DSM 70294]
 gb|EDO16402.1| hypothetical protein Kpol_1030p10 [Vanderwaltozyma polyspora 
DSM 70294]
Length=215

 Score =   129 bits (325),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 88/136 (65%), Gaps = 14/136 (10%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPF+PPKMKF TKV+H NISS +GAICLDI K+ WSP +T K+AL S+QALL +PEP
Sbjct  59   PMEYPFKPPKMKFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWT-------EAFAKPSL------GVDEK-VQKLVE  186
            +DPQDA VAQ YLR+ ++F  TA  WT       E  A P++      G+D   VQ+ V 
Sbjct  119  NDPQDAEVAQHYLRDRESFNKTATLWTTLYAEGGEEVANPNVDEAALYGIDPTVVQEFVA  178

Query  185  MGFPEAQVRSTLELVG  138
             GF + ++      +G
Sbjct  179  QGFEKTKIVEVFRRMG  194



>gb|ACO12956.1| Ubiquitin-conjugating enzyme E2 K [Lepeophtheirus salmonis]
Length=200

 Score =   129 bits (324),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 91/137 (66%), Gaps = 3/137 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK++F TK+WH NISS +GAICLDI KDQW+ A+T +T L S+QALL APEP
Sbjct  64   PESYPFMPPKVRFVTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLQAPEP  123

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA---KPSLGVDEKVQKLVEMGFPEAQVRST  153
            DDP DAVVA+QY    +TF  TAR+W   FA     +   D  +++L EMG  E + R  
Sbjct  124  DDPLDAVVAKQYSDTPETFRKTARHWASVFAGAKDSNSEFDSLLRQLQEMGVDETKARVA  183

Query  152  LELVGWDENXALERLCS  102
            L    WD + A E+L S
Sbjct  184  LSSCSWDLHKATEQLFS  200



>ref|XP_002432367.1| ubiquitin-conjugating enzyme E2-22 kDa, putative [Pediculus humanus 
corporis]
 gb|EEB19629.1| ubiquitin-conjugating enzyme E2-22 kDa, putative [Pediculus humanus 
corporis]
Length=198

 Score =   129 bits (324),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 92/136 (68%), Gaps = 2/136 (1%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK+KF TK+WH NISS +GAICLDI KDQW+ A+T +T L S+QALL A EP
Sbjct  63   PETYPFNPPKVKFMTKIWHPNISSATGAICLDILKDQWAAAMTLRTVLLSLQALLSAAEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLG--VDEKVQKLVEMGFPEAQVRSTL  150
            D+PQDAVVA+QY +  + F  TA++WT  +A P      + K+++L +MG  E + R  L
Sbjct  123  DNPQDAVVAKQYKKFPELFTETAKHWTFVYAGPHKHSEFESKIKRLCDMGVEEHRARVAL  182

Query  149  ELVGWDENXALERLCS  102
                WD   A E+L S
Sbjct  183  STYNWDLEQATEQLFS  198



>ref|XP_003396260.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like isoform 
2 [Bombus terrestris]
Length=187

 Score =   129 bits (323),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 92/139 (66%), Gaps = 7/139 (5%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK++F TK+WH NISS +GAICLDI KDQW+ A+T +T L S+QALL A EP
Sbjct  51   PETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLSAAEP  110

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA-----KPSLGVDEKVQKLVEMGFPEAQVR  159
            DDPQDAVVA+QY    + F  TA++WT  +A      P L  D+K+++L +MG  E   R
Sbjct  111  DDPQDAVVARQYKEHPEMFRQTAKHWTYVYAGGPAKMPDL--DDKIRRLTDMGIEEHNAR  168

Query  158  STLELVGWDENXALERLCS  102
              L    WD   A E+L S
Sbjct  169  VALSSYNWDLERATEQLFS  187



>ref|XP_009021235.1| hypothetical protein HELRODRAFT_185754 [Helobdella robusta]
 gb|ESO00598.1| hypothetical protein HELRODRAFT_185754 [Helobdella robusta]
Length=199

 Score =   129 bits (324),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 91/137 (66%), Gaps = 3/137 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK++F TK+WH NISS +GAICLDI KDQW+ A+T +T L S+QALL A EP
Sbjct  63   PETYPFNPPKVQFTTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLSAAEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA---KPSLGVDEKVQKLVEMGFPEAQVRST  153
            DDPQDAVVA+Q+      F  TAR+W   +A   K    +++KV++L  MGF E + R+ 
Sbjct  123  DDPQDAVVAKQFKESPDIFKKTARHWANVYAGGPKREYDLEQKVEQLKTMGFEEHRARAA  182

Query  152  LELVGWDENXALERLCS  102
            L    W    A+E L S
Sbjct  183  LSTHNWMTERAMEHLLS  199



>ref|XP_004526147.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like [Ceratitis 
capitata]
Length=199

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 89/137 (65%), Gaps = 3/137 (2%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK++F TK+WH NISS +GAICLDI KD W+ A+T +T L S+QALL A EP
Sbjct  63   PETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA---KPSLGVDEKVQKLVEMGFPEAQVRST  153
            DDPQDAVVA QY  +Y  FL TA++WT  +A         D K+Q+L +MG  E   R+ 
Sbjct  123  DDPQDAVVAYQYKDKYPLFLMTAKHWTNVYAGGPHKFTECDLKIQRLKDMGIDEHDARAV  182

Query  152  LELVGWDENXALERLCS  102
            L    WD   A E L S
Sbjct  183  LSKENWDLEKATESLFS  199



>ref|XP_003396259.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like isoform 
1 [Bombus terrestris]
 ref|XP_003487714.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like [Bombus 
impatiens]
 ref|XP_003690517.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like [Apis 
florea]
 ref|XP_006557460.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like [Apis 
mellifera]
 ref|XP_006617010.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like [Apis 
dorsata]
Length=199

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 92/139 (66%), Gaps = 7/139 (5%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P+ YPF PPK++F TK+WH NISS +GAICLDI KDQW+ A+T +T L S+QALL A EP
Sbjct  63   PETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLSAAEP  122

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFA-----KPSLGVDEKVQKLVEMGFPEAQVR  159
            DDPQDAVVA+QY    + F  TA++WT  +A      P L  D+K+++L +MG  E   R
Sbjct  123  DDPQDAVVARQYKEHPEMFRQTAKHWTYVYAGGPAKMPDL--DDKIRRLTDMGIEEHNAR  180

Query  158  STLELVGWDENXALERLCS  102
              L    WD   A E+L S
Sbjct  181  VALSSYNWDLERATEQLFS  199



>ref|NP_984266.1| ADR169Cp [Ashbya gossypii ATCC 10895]
 gb|AAS52090.1| ADR169Cp [Ashbya gossypii ATCC 10895]
 gb|AEY96389.1| FADR169Cp [Ashbya gossypii FDAG1]
Length=211

 Score =   129 bits (324),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 84/132 (64%), Gaps = 10/132 (8%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPF+PPKM+F TKV+H NISS +GAICLDI K+ WSP LT KT+L S+QALL +PEP
Sbjct  59   PLEYPFKPPKMQFDTKVYHPNISSVTGAICLDILKNSWSPVLTLKTSLISLQALLQSPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSLGVDEKVQ----------KLVEMGFP  174
            +DPQDA VA+ YL +  +F  TA  WT+ +A    G DE+ Q           LV  GF 
Sbjct  119  NDPQDAEVAKHYLSDRASFDRTAALWTKTYASGQTGNDEEAQLYGIDKGLVDTLVAQGFE  178

Query  173  EAQVRSTLELVG  138
              +V   L  +G
Sbjct  179  REKVVQALRRLG  190



>gb|EHN03099.1| Ubc1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
Length=215

 Score =   129 bits (324),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 88/136 (65%), Gaps = 14/136 (10%)
 Frame = -2

Query  503  PDGYPFEPPKMKFATKVWHXNISSQSGAICLDIXKDQWSPALTXKTALXSIQALLXAPEP  324
            P  YPF+PPKM+F TKV+H NISS +GAICLDI K+ WSP +T K+AL S+QALL +PEP
Sbjct  59   PMEYPFKPPKMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEP  118

Query  323  DDPQDAVVAQQYLREYQTFLGTARYWTEAFAKPSL-------------GVDEK-VQKLVE  186
            +DPQDA VAQ YLR+ ++F  TA  WT  +A  S+             G+D   +++   
Sbjct  119  NDPQDAEVAQHYLRDRESFNKTAALWTRLYASESVNGQKSSVEESDLYGIDHDLIEEFES  178

Query  185  MGFPEAQVRSTLELVG  138
             GF +A++   L  +G
Sbjct  179  QGFDKAKIVEVLRRLG  194



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562345909905