BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF033N17

Length=718
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO78194.1|  hypothetical protein CISIN_1g003648mg                   370   3e-122   Citrus sinensis [apfelsine]
ref|XP_009599227.1|  PREDICTED: cullin-4                                379   3e-122   Nicotiana tomentosiformis
ref|NP_001234356.1|  cullin 4                                           376   9e-122   
ref|XP_006361548.1|  PREDICTED: cullin-4-like                           377   1e-121   Solanum tuberosum [potatoes]
ref|XP_009759464.1|  PREDICTED: cullin-4                                376   2e-121   Nicotiana sylvestris
gb|KGN65537.1|  hypothetical protein Csa_1G435820                       368   2e-121   Cucumis sativus [cucumbers]
gb|KDO78193.1|  hypothetical protein CISIN_1g003648mg                   370   7e-121   Citrus sinensis [apfelsine]
ref|XP_008366025.1|  PREDICTED: cullin-4-like                           355   9e-120   
gb|KJB66937.1|  hypothetical protein B456_010G166800                    367   1e-119   Gossypium raimondii
ref|XP_006467460.1|  PREDICTED: cullin-4-like isoform X2                370   2e-119   
gb|KHN46079.1|  Cullin-4                                                369   3e-119   Glycine soja [wild soybean]
ref|XP_006467459.1|  PREDICTED: cullin-4-like isoform X1                370   3e-119   Citrus sinensis [apfelsine]
ref|XP_003524860.1|  PREDICTED: cullin-4-like                           369   4e-119   Glycine max [soybeans]
gb|KHN12460.1|  Cullin-4                                                369   4e-119   Glycine soja [wild soybean]
gb|KHN47328.1|  Cullin-4                                                369   4e-119   Glycine soja [wild soybean]
gb|EYU43260.1|  hypothetical protein MIMGU_mgv1a001310mg                370   6e-119   Erythranthe guttata [common monkey flower]
ref|XP_011085242.1|  PREDICTED: cullin-4                                370   6e-119   
ref|XP_003532695.2|  PREDICTED: cullin-4-like isoform X1                369   6e-119   Glycine max [soybeans]
ref|XP_008225565.1|  PREDICTED: cullin-4                                369   9e-119   Prunus mume [ume]
ref|XP_008444359.1|  PREDICTED: cullin-4                                369   1e-118   Cucumis melo [Oriental melon]
ref|XP_011096567.1|  PREDICTED: cullin-4-like                           369   2e-118   Sesamum indicum [beniseed]
ref|XP_010666663.1|  PREDICTED: cullin-4                                369   2e-118   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007214632.1|  hypothetical protein PRUPE_ppa001433mg             369   2e-118   Prunus persica
gb|KDP37982.1|  hypothetical protein JCGZ_04625                         369   2e-118   Jatropha curcas
gb|KJB68317.1|  hypothetical protein B456_010G238300                    359   4e-118   Gossypium raimondii
gb|KJB66935.1|  hypothetical protein B456_010G166800                    367   5e-118   Gossypium raimondii
ref|XP_003546083.1|  PREDICTED: cullin-4-like                           366   7e-118   Glycine max [soybeans]
gb|KHN06973.1|  Cullin-4                                                366   7e-118   Glycine soja [wild soybean]
ref|XP_011013417.1|  PREDICTED: cullin-4-like                           367   9e-118   Populus euphratica
ref|XP_004149667.1|  PREDICTED: cullin-4-like                           367   1e-117   Cucumis sativus [cucumbers]
ref|XP_006377604.1|  hypothetical protein POPTR_0011s08280g             366   1e-117   Populus trichocarpa [western balsam poplar]
ref|XP_010941311.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4-like      367   1e-117   Elaeis guineensis
ref|XP_007025064.1|  Cullin-4B isoform 1                                366   1e-117   
emb|CBI30911.3|  unnamed protein product                                365   2e-117   Vitis vinifera
ref|XP_010274939.1|  PREDICTED: cullin-4-like                           366   2e-117   Nelumbo nucifera [Indian lotus]
ref|XP_011011308.1|  PREDICTED: cullin-4-like isoform X1                365   2e-117   Populus euphratica
ref|XP_004162809.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4-like      366   3e-117   
ref|XP_008787804.1|  PREDICTED: cullin-4-like isoform X2                366   3e-117   Phoenix dactylifera
gb|KJB68316.1|  hypothetical protein B456_010G238300                    359   3e-117   Gossypium raimondii
ref|XP_007147910.1|  hypothetical protein PHAVU_006G165300g             364   4e-117   Phaseolus vulgaris [French bean]
ref|XP_002270764.2|  PREDICTED: cullin-4                                365   5e-117   Vitis vinifera
ref|XP_010247870.1|  PREDICTED: cullin-4-like isoform X1                365   5e-117   Nelumbo nucifera [Indian lotus]
ref|XP_002305340.2|  hypothetical protein POPTR_0004s14020g             364   7e-117   Populus trichocarpa [western balsam poplar]
ref|XP_011460204.1|  PREDICTED: cullin-4                                364   7e-117   Fragaria vesca subsp. vesca
ref|XP_008371761.1|  PREDICTED: cullin-4                                364   1e-116   
ref|XP_006449704.1|  hypothetical protein CICLE_v10014310mg             355   2e-116   
ref|XP_003593911.1|  Cullin                                             362   2e-116   
ref|XP_003593912.1|  Cullin                                             362   3e-116   Medicago truncatula
ref|XP_006352972.1|  PREDICTED: cullin-4-like                           362   4e-116   Solanum tuberosum [potatoes]
gb|KCW73810.1|  hypothetical protein EUGRSUZ_E02414                     362   4e-116   Eucalyptus grandis [rose gum]
gb|KJB69827.1|  hypothetical protein B456_011G044900                    362   4e-116   Gossypium raimondii
ref|XP_010110959.1|  hypothetical protein L484_021653                   363   6e-116   
ref|XP_010056896.1|  PREDICTED: cullin-4                                362   6e-116   Eucalyptus grandis [rose gum]
ref|XP_009398338.1|  PREDICTED: cullin-4-like                           362   8e-116   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC76292.1|  hypothetical protein OsI_13805                          359   1e-115   Oryza sativa Indica Group [Indian rice]
ref|XP_010923713.1|  PREDICTED: cullin-4-like isoform X2                362   1e-115   Elaeis guineensis
gb|KHG21020.1|  Cullin-4 -like protein                                  360   2e-115   Gossypium arboreum [tree cotton]
gb|KJB68318.1|  hypothetical protein B456_010G238300                    359   3e-115   Gossypium raimondii
gb|KCW73811.1|  hypothetical protein EUGRSUZ_E02414                     360   4e-115   Eucalyptus grandis [rose gum]
ref|XP_008809585.1|  PREDICTED: cullin-4-like                           360   4e-115   
ref|XP_009360892.1|  PREDICTED: cullin-4                                360   5e-115   Pyrus x bretschneideri [bai li]
ref|XP_004981510.1|  PREDICTED: cullin-4-like isoform X2                360   5e-115   Setaria italica
gb|EEE60060.1|  hypothetical protein OsJ_12866                          359   5e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006449701.1|  hypothetical protein CICLE_v10014310mg             355   7e-115   
ref|XP_004233125.1|  PREDICTED: cullin-4                                358   8e-115   Solanum lycopersicum
gb|AAT75245.1|  putative cullin protein                                 359   9e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006650698.1|  PREDICTED: cullin-4-like                           359   1e-114   Oryza brachyantha
ref|XP_010518764.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4-like      358   1e-114   Tarenaya hassleriana [spider flower]
gb|ABF99238.1|  Cullin-4B, putative, expressed                          358   2e-114   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008644442.1|  PREDICTED: cullin-4                                358   3e-114   Zea mays [maize]
ref|XP_002466340.1|  hypothetical protein SORBIDRAFT_01g005920          358   4e-114   Sorghum bicolor [broomcorn]
gb|EMT18857.1|  Cullin-4B                                               356   4e-114   
ref|XP_003558082.1|  PREDICTED: cullin-4                                357   1e-113   Brachypodium distachyon [annual false brome]
dbj|BAK02870.1|  predicted protein                                      356   2e-113   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006449702.1|  hypothetical protein CICLE_v10014310mg             355   3e-113   Citrus clementina [clementine]
emb|CDX77644.1|  BnaC07g18980D                                          353   6e-113   
emb|CDY33461.1|  BnaA06g36120D                                          352   9e-113   Brassica napus [oilseed rape]
ref|XP_004486019.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4-like      353   1e-112   Cicer arietinum [garbanzo]
ref|XP_009101534.1|  PREDICTED: cullin-4-like                           352   2e-112   Brassica rapa
ref|XP_006398308.1|  hypothetical protein EUTSA_v10000782mg             352   2e-112   Eutrema salsugineum [saltwater cress]
ref|XP_009114369.1|  PREDICTED: cullin-4-like                           352   3e-112   Brassica rapa
emb|CDY35152.1|  BnaA09g17890D                                          352   3e-112   Brassica napus [oilseed rape]
emb|CDY03235.1|  BnaC09g19210D                                          352   3e-112   
gb|KFK31486.1|  cullin                                                  351   5e-112   Arabis alpina [alpine rockcress]
ref|XP_002984123.1|  ubiquitin-protein ligase, cullin 4                 350   5e-112   
ref|XP_002972211.1|  ubiquitin-protein ligase, Cullin 4                 350   6e-112   
emb|CAN75926.1|  hypothetical protein VITISV_010491                     351   1e-111   Vitis vinifera
ref|XP_008787803.1|  PREDICTED: cullin-4-like isoform X1                352   1e-111   Phoenix dactylifera
emb|CAC85265.1|  cullin 4                                               348   1e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009408525.1|  PREDICTED: cullin-4-like                           350   4e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_568658.1|  cullin4                                               348   4e-111   Arabidopsis thaliana [mouse-ear cress]
gb|AAM14063.1|  putative cullin                                         348   4e-111   Arabidopsis thaliana [mouse-ear cress]
emb|CDX87735.1|  BnaC02g32140D                                          348   7e-111   
emb|CDY43957.1|  BnaA02g24350D                                          347   8e-111   Brassica napus [oilseed rape]
ref|XP_009128848.1|  PREDICTED: cullin-4                                347   1e-110   Brassica rapa
ref|XP_002863417.1|  hypothetical protein ARALYDRAFT_916814             346   3e-110   Arabidopsis lyrata subsp. lyrata
ref|XP_006281916.1|  hypothetical protein CARUB_v10028121mg             346   3e-110   Capsella rubella
ref|XP_001776334.1|  predicted protein                                  345   5e-110   
ref|XP_010923712.1|  PREDICTED: cullin-4-like isoform X1                348   6e-110   Elaeis guineensis
ref|XP_006414121.1|  hypothetical protein EUTSA_v10024458mg             345   9e-110   Eutrema salsugineum [saltwater cress]
ref|XP_010529158.1|  PREDICTED: cullin-4                                343   8e-109   Tarenaya hassleriana [spider flower]
ref|XP_010441611.1|  PREDICTED: cullin-4                                342   1e-108   Camelina sativa [gold-of-pleasure]
gb|KDO78190.1|  hypothetical protein CISIN_1g003648mg                   341   3e-108   Citrus sinensis [apfelsine]
ref|XP_006585082.1|  PREDICTED: cullin-4-like isoform X2                338   1e-107   Glycine max [soybeans]
gb|KFK28509.1|  cullin 4                                                337   1e-106   Arabis alpina [alpine rockcress]
ref|XP_006836434.1|  hypothetical protein AMTR_s00092p00163840          337   2e-106   Amborella trichopoda
gb|KHG10035.1|  Cullin-4 -like protein                                  335   2e-105   Gossypium arboreum [tree cotton]
ref|XP_001764780.1|  predicted protein                                  323   1e-101   
dbj|BAB08502.1|  cullin                                                 318   3e-101   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA51792.1|  TPA: hypothetical protein ZEAMMB73_094309              297   8e-99    
ref|XP_003584977.2|  PREDICTED: cullin-4B-like                          298   9e-98    
gb|AAC50548.1|  Hs-CUL-4B                                               298   2e-97    Homo sapiens [man]
gb|AAH10347.1|  Cul4b protein                                           298   3e-97    Mus musculus [mouse]
ref|XP_005673911.1|  PREDICTED: cullin-4B                               298   1e-96    
ref|NP_001131505.1|  uncharacterized protein LOC100192843               291   1e-96    
gb|AEB61292.1|  cullin-4A-like protein                                  289   5e-95    Equus caballus [domestic horse]
dbj|BAK62681.1|  cullin-4B                                              298   9e-95    Pan troglodytes
ref|XP_006752398.1|  PREDICTED: LOW QUALITY PROTEIN: cullin 4A          290   6e-94    Leptonychotes weddellii
gb|EAX11876.1|  cullin 4B, isoform CRA_a                                298   2e-93    Homo sapiens [man]
gb|AAH04026.1|  Cul4b protein                                           298   2e-93    Mus musculus [mouse]
ref|XP_009915407.1|  PREDICTED: cullin-4B isoform X2                    298   3e-93    Haliaeetus albicilla
gb|AAB67315.1|  Very similar and perhaps identical to Hs-CUL-4B.;...    298   3e-93    Homo sapiens [man]
ref|NP_001051492.1|  Os03g0786800                                       282   3e-93    
dbj|BAB24020.1|  unnamed protein product                                283   8e-93    Mus musculus [mouse]
ref|XP_009956705.1|  PREDICTED: cullin-4B                               298   9e-93    Leptosomus discolor
ref|XP_004327092.1|  PREDICTED: cullin-4A-like                          283   1e-92    
gb|KFQ15708.1|  Cullin-4B                                               297   1e-92    Leptosomus discolor
ref|XP_010185411.1|  PREDICTED: cullin-4B                               297   2e-92    Mesitornis unicolor
ref|XP_008154342.1|  PREDICTED: cullin-4B isoform X2                    298   2e-92    Eptesicus fuscus
ref|XP_004685824.1|  PREDICTED: cullin-4B isoform X2                    298   2e-92    
gb|KFQ37918.1|  Cullin-4B                                               297   2e-92    Mesitornis unicolor
ref|XP_006877535.1|  PREDICTED: cullin-4B isoform X2                    298   2e-92    Chrysochloris asiatica
pdb|4A0L|E  Chain E, Structure Of Ddb1-Ddb2-Cul4b-Rbx1 Bound To A...    298   2e-92    Homo sapiens [man]
ref|XP_006003900.1|  PREDICTED: cullin-4B                               301   2e-92    Latimeria chalumnae
ref|XP_004022403.1|  PREDICTED: cullin-4B isoform 2                     298   2e-92    
ref|XP_007530425.1|  PREDICTED: cullin-4B isoform X2                    298   2e-92    Erinaceus europaeus [common hedgehog]
ref|XP_004285635.1|  PREDICTED: cullin-4B isoform 2                     298   2e-92    Orcinus orca [Orca]
gb|EAX11877.1|  cullin 4B, isoform CRA_b                                298   2e-92    Homo sapiens [man]
gb|EGW01006.1|  Cullin-4B                                               301   2e-92    Cricetulus griseus [Chinese hamsters]
ref|XP_009196472.1|  PREDICTED: cullin-4B isoform X5                    298   2e-92    Papio anubis [baboon]
ref|XP_005319407.1|  PREDICTED: cullin-4B isoform X2                    298   2e-92    
ref|XP_006885131.1|  PREDICTED: cullin-4B-like isoform X2               298   2e-92    Elephantulus edwardii [Cape long-eared elephant shrew]
pdb|4A0C|C  Chain C, Structure Of The Cand1-Cul4b-Rbx1 Complex          298   2e-92    Mus musculus [mouse]
ref|XP_004379638.1|  PREDICTED: cullin-4B isoform 2                     298   2e-92    Trichechus manatus latirostris
ref|XP_006191372.1|  PREDICTED: cullin-4B-like isoform X1               299   3e-92    Camelus ferus
ref|XP_006191373.1|  PREDICTED: cullin-4B-like isoform X2               299   3e-92    Camelus ferus
ref|XP_010819678.1|  PREDICTED: cullin-4B isoform X5                    299   3e-92    
dbj|BAA31670.2|  KIAA0695 protein                                       299   3e-92    Homo sapiens [man]
gb|AAK16812.1|AF212995_1  cullin CUL4B                                  299   3e-92    Homo sapiens [man]
ref|XP_008271384.1|  PREDICTED: cullin-4B isoform X5                    299   3e-92    Oryctolagus cuniculus [domestic rabbit]
ref|XP_011376545.1|  PREDICTED: cullin-4B isoform X2                    299   3e-92    
ref|NP_001041617.1|  cullin-4B                                          299   3e-92    Felis catus [cat]
ref|XP_005413716.1|  PREDICTED: cullin-4B isoform X4                    299   3e-92    Chinchilla lanigera
gb|KDO78191.1|  hypothetical protein CISIN_1g003648mg                   300   3e-92    Citrus sinensis [apfelsine]
ref|XP_009506519.1|  PREDICTED: cullin-4B                               298   3e-92    Phalacrocorax carbo [common cormorant]
ref|XP_008988097.1|  PREDICTED: cullin-4B isoform X5                    298   4e-92    Callithrix jacchus [common marmoset]
gb|ELK07572.1|  Cullin-4B                                               299   4e-92    Pteropus alecto
gb|KFW96883.1|  Cullin-4B                                               297   5e-92    Phalacrocorax carbo [common cormorant]
ref|XP_008017654.1|  PREDICTED: cullin-4B isoform X7                    298   6e-92    Chlorocebus sabaeus
ref|XP_001510185.3|  PREDICTED: cullin-4B                               298   7e-92    
ref|XP_007647173.1|  PREDICTED: cullin-4B isoform X1                    301   7e-92    Cricetulus griseus [Chinese hamsters]
ref|XP_007610124.1|  PREDICTED: cullin-4B isoform X2                    301   7e-92    
ref|XP_008171287.1|  PREDICTED: cullin-4B isoform X2                    298   7e-92    Chrysemys picta bellii
gb|AAC50547.1|  Hs-CUL-4A                                               288   9e-92    
gb|EAX11878.1|  cullin 4B, isoform CRA_c                                299   1e-91    Homo sapiens [man]
ref|XP_009088610.1|  PREDICTED: cullin-4B                               300   1e-91    Serinus canaria [canary]
ref|XP_010484784.1|  PREDICTED: cullin-4-like                           298   1e-91    Camelina sativa [gold-of-pleasure]
ref|XP_004478393.1|  PREDICTED: cullin-4B                               298   1e-91    
ref|XP_004587715.1|  PREDICTED: cullin-4B                               300   1e-91    Ochotona princeps [southern American pika]
dbj|BAG59294.1|  unnamed protein product                                288   2e-91    Homo sapiens [man]
ref|XP_003774810.1|  PREDICTED: cullin-4B                               300   2e-91    Sarcophilus harrisii
ref|XP_010287736.1|  PREDICTED: cullin-4B                               299   2e-91    Phaethon lepturus
gb|ELK27187.1|  Cullin-4B                                               299   2e-91    Myotis davidii
ref|XP_006082210.1|  PREDICTED: cullin-4B isoform X1                    299   2e-91    Myotis lucifugus
ref|XP_003797087.1|  PREDICTED: cullin-4B-like                          299   2e-91    
ref|XP_005884739.1|  PREDICTED: cullin-4B                               299   2e-91    
ref|XP_006877534.1|  PREDICTED: cullin-4B isoform X1                    299   2e-91    Chrysochloris asiatica
ref|XP_006082211.1|  PREDICTED: cullin-4B isoform X2                    299   2e-91    Myotis lucifugus
ref|XP_008832150.1|  PREDICTED: cullin-4B                               299   2e-91    
ref|XP_006144939.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B          299   2e-91    Tupaia chinensis
ref|XP_002519675.1|  cullin, putative                                   297   2e-91    
gb|KFQ77299.1|  Cullin-4B                                               299   2e-91    Phaethon lepturus
ref|XP_011277734.1|  PREDICTED: cullin-4B isoform X2                    299   2e-91    Felis catus [cat]
ref|XP_006082212.1|  PREDICTED: cullin-4B isoform X3                    299   2e-91    
ref|XP_004713106.1|  PREDICTED: cullin-4B isoform X3                    295   2e-91    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_011277733.1|  PREDICTED: cullin-4B isoform X1                    299   2e-91    Felis catus [cat]
ref|XP_004899937.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B          299   2e-91    
ref|XP_006981625.1|  PREDICTED: cullin-4B isoform X1                    299   2e-91    
ref|XP_008538115.1|  PREDICTED: cullin-4B isoform X1                    299   3e-91    Equus przewalskii [Przewalski horse]
ref|XP_004437389.1|  PREDICTED: cullin-4B                               299   3e-91    
ref|XP_004874659.1|  PREDICTED: cullin-4B isoform X1                    299   3e-91    
gb|EFB16493.1|  hypothetical protein PANDA_011593                       299   3e-91    Ailuropoda melanoleuca
ref|XP_008154341.1|  PREDICTED: cullin-4B isoform X1                    299   3e-91    
ref|XP_008585583.1|  PREDICTED: cullin-4B isoform X1                    299   3e-91    Galeopterus variegatus [Malayan flying lemur]
ref|XP_008271382.1|  PREDICTED: cullin-4B isoform X3                    299   3e-91    Oryctolagus cuniculus [domestic rabbit]
ref|XP_011227402.1|  PREDICTED: cullin-4B isoform X2                    299   3e-91    Ailuropoda melanoleuca
ref|XP_011227401.1|  PREDICTED: cullin-4B isoform X1                    299   3e-91    Ailuropoda melanoleuca
ref|XP_004762117.1|  PREDICTED: cullin-4B isoform X4                    299   3e-91    Mustela putorius furo [black ferret]
ref|XP_001086195.1|  PREDICTED: cullin-4B isoform 1                     299   3e-91    Macaca mulatta [rhesus macaque]
ref|XP_006082213.1|  PREDICTED: cullin-4B isoform X4                    299   3e-91    
ref|XP_005413715.1|  PREDICTED: cullin-4B isoform X3                    299   3e-91    Chinchilla lanigera
ref|XP_005413713.1|  PREDICTED: cullin-4B isoform X1                    299   3e-91    Chinchilla lanigera
ref|XP_008585584.1|  PREDICTED: cullin-4B isoform X2                    299   3e-91    Galeopterus variegatus [Malayan flying lemur]
ref|XP_006981626.1|  PREDICTED: cullin-4B isoform X2                    299   3e-91    
gb|EPQ19199.1|  Cullin-4B                                               300   3e-91    Myotis brandtii
ref|XP_005413714.1|  PREDICTED: cullin-4B isoform X2                    299   3e-91    Chinchilla lanigera
ref|XP_007076303.1|  PREDICTED: cullin-4B isoform X3                    299   3e-91    Panthera tigris altaica
ref|XP_006257551.1|  PREDICTED: cullin-4B isoform X1                    299   3e-91    Rattus norvegicus [brown rat]
ref|XP_004874660.1|  PREDICTED: cullin-4B isoform X2                    298   3e-91    
ref|XP_009196468.1|  PREDICTED: cullin-4B isoform X1                    299   3e-91    Papio anubis [baboon]
ref|XP_007530424.1|  PREDICTED: cullin-4B isoform X1                    299   3e-91    Erinaceus europaeus [common hedgehog]
ref|XP_005319406.1|  PREDICTED: cullin-4B isoform X1                    299   3e-91    Ictidomys tridecemlineatus
emb|CAD97843.1|  hypothetical protein                                   298   3e-91    Homo sapiens [man]
ref|XP_004762116.1|  PREDICTED: cullin-4B isoform X3                    299   3e-91    Mustela putorius furo [black ferret]
ref|XP_004647716.1|  PREDICTED: cullin-4B                               298   3e-91    
ref|XP_004406978.1|  PREDICTED: cullin-4B                               298   3e-91    
ref|XP_008538116.1|  PREDICTED: cullin-4B isoform X2                    298   3e-91    Equus przewalskii [Przewalski horse]
dbj|BAG53936.1|  unnamed protein product                                298   3e-91    Homo sapiens [man]
ref|NP_001073341.1|  cullin-4B isoform 2                                298   3e-91    Homo sapiens [man]
ref|XP_008988095.1|  PREDICTED: cullin-4B isoform X3                    298   3e-91    
dbj|BAC41443.3|  mKIAA0695 protein                                      295   3e-91    Mus musculus [mouse]
ref|XP_006724848.1|  PREDICTED: cullin-4B isoform X3                    298   3e-91    
ref|XP_008070821.1|  PREDICTED: cullin-4B                               298   3e-91    Carlito syrichta
ref|XP_005262538.1|  PREDICTED: cullin-4B isoform X1                    299   4e-91    
ref|XP_007122105.1|  PREDICTED: cullin-4B-like isoform X1               299   4e-91    Physeter catodon
ref|XP_008974985.1|  PREDICTED: cullin-4B isoform X1                    299   4e-91    Pan paniscus [bonobo]
ref|XP_007076301.1|  PREDICTED: cullin-4B isoform X1                    299   4e-91    Panthera tigris altaica
ref|XP_007076302.1|  PREDICTED: cullin-4B isoform X2                    299   4e-91    Panthera tigris altaica
ref|XP_004685823.1|  PREDICTED: cullin-4B isoform X1                    299   4e-91    
gb|KFO30994.1|  Cullin-4B                                               298   4e-91    Fukomys damarensis [Damara mole rat]
ref|XP_008988094.1|  PREDICTED: cullin-4B isoform X2                    298   4e-91    Callithrix jacchus [common marmoset]
ref|XP_006724847.1|  PREDICTED: cullin-4B isoform X2                    298   4e-91    
ref|XP_010210224.1|  PREDICTED: cullin-4B                               298   4e-91    Tinamus guttatus
ref|XP_420335.2|  PREDICTED: cullin-4B                                  298   4e-91    Gallus gallus [bantam]
ref|XP_004762114.1|  PREDICTED: cullin-4B isoform X1                    299   4e-91    Mustela putorius furo [black ferret]
ref|XP_006746270.1|  PREDICTED: cullin-4B                               299   4e-91    Leptonychotes weddellii
ref|XP_002720454.2|  PREDICTED: cullin-4B isoform X2                    299   4e-91    Oryctolagus cuniculus [domestic rabbit]
ref|XP_008271383.1|  PREDICTED: cullin-4B isoform X4                    298   4e-91    Oryctolagus cuniculus [domestic rabbit]
ref|XP_008271380.1|  PREDICTED: cullin-4B isoform X1                    299   4e-91    Oryctolagus cuniculus [domestic rabbit]
ref|XP_006767871.1|  PREDICTED: cullin-4B                               298   4e-91    Myotis davidii
ref|XP_864628.3|  PREDICTED: cullin-4B isoform 3                        299   4e-91    
ref|XP_006885130.1|  PREDICTED: cullin-4B-like isoform X1               298   4e-91    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|NP_003579.3|  cullin-4B isoform 1                                   299   4e-91    Homo sapiens [man]
ref|XP_006917880.1|  PREDICTED: cullin-4B                               298   4e-91    
ref|XP_004762115.1|  PREDICTED: cullin-4B isoform X2                    299   4e-91    
ref|XP_007060188.1|  PREDICTED: cullin-4B                               298   4e-91    Chelonia mydas [green seaturtle]
ref|XP_005504485.1|  PREDICTED: cullin-4B                               298   4e-91    Columba livia [carrier pigeon]
ref|XP_005307468.2|  PREDICTED: cullin-4B isoform X1                    298   4e-91    Chrysemys picta bellii
ref|XP_004606393.1|  PREDICTED: cullin-4B isoform X1                    298   4e-91    
ref|XP_006115461.1|  PREDICTED: cullin-4B                               298   4e-91    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_010206238.1|  PREDICTED: cullin-4B                               298   4e-91    Colius striatus
ref|XP_008988096.1|  PREDICTED: cullin-4B isoform X4                    299   4e-91    Callithrix jacchus [common marmoset]
ref|XP_003262326.2|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B is...    299   4e-91    
ref|XP_004606394.1|  PREDICTED: cullin-4B isoform X2                    298   4e-91    Sorex araneus [Eurasian shrew]
ref|NP_001116316.1|  cullin-4B                                          298   4e-91    Danio rerio [leopard danio]
ref|XP_009564621.1|  PREDICTED: cullin-4B                               298   4e-91    Cuculus canorus
ref|XP_003208504.1|  PREDICTED: cullin-4B                               298   4e-91    Meleagris gallopavo [common turkey]
ref|XP_004379637.1|  PREDICTED: cullin-4B isoform 1                     298   4e-91    
ref|XP_008017652.1|  PREDICTED: cullin-4B isoform X5                    299   4e-91    Chlorocebus sabaeus
ref|XP_004285634.1|  PREDICTED: cullin-4B isoform 1                     298   5e-91    Orcinus orca [Orca]
ref|XP_005594545.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B          299   5e-91    
ref|XP_008638702.1|  PREDICTED: cullin-4B                               298   5e-91    Corvus brachyrhynchos
ref|XP_009887578.1|  PREDICTED: cullin-4B                               298   5e-91    Charadrius vociferus
ref|XP_008491853.1|  PREDICTED: cullin-4B                               298   5e-91    Calypte anna
ref|XP_008935860.1|  PREDICTED: cullin-4B                               298   5e-91    Merops nubicus
ref|NP_001100421.1|  cullin-4B                                          300   5e-91    Rattus norvegicus [brown rat]
gb|KFO64284.1|  Cullin-4B                                               298   5e-91    Corvus brachyrhynchos
ref|XP_005241130.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B          298   5e-91    Falco peregrinus [peregrine]
ref|XP_010819677.1|  PREDICTED: cullin-4B isoform X3                    298   5e-91    Bos taurus [bovine]
ref|XP_009670270.1|  PREDICTED: cullin-4B                               298   5e-91    Struthio camelus australis
ref|XP_005022179.1|  PREDICTED: cullin-4B                               298   5e-91    
ref|XP_006260081.1|  PREDICTED: cullin-4B                               298   5e-91    
gb|KFW05399.1|  Cullin-4B                                               298   5e-91    Eurypyga helias
ref|XP_008988093.1|  PREDICTED: cullin-4B isoform X1                    298   5e-91    
ref|XP_007122106.1|  PREDICTED: cullin-4B-like isoform X2               298   5e-91    
ref|XP_006028559.1|  PREDICTED: cullin-4B                               298   5e-91    Alligator sinensis
ref|XP_010627872.1|  PREDICTED: cullin-4B isoform X1                    298   5e-91    Fukomys damarensis [Damara mole rat]
gb|KGL72508.1|  Cullin-4B                                               298   5e-91    Tinamus guttatus
ref|XP_003465638.1|  PREDICTED: cullin-4B                               298   5e-91    
ref|XP_011376543.1|  PREDICTED: cullin-4B isoform X1                    299   5e-91    
ref|XP_005432498.1|  PREDICTED: cullin-4B                               298   5e-91    
ref|XP_006048866.1|  PREDICTED: cullin-4B isoform X3                    298   5e-91    
ref|XP_009915406.1|  PREDICTED: cullin-4B isoform X1                    298   5e-91    
ref|XP_005148357.1|  PREDICTED: cullin-4B                               298   5e-91    
dbj|BAB28222.2|  unnamed protein product                                298   5e-91    
ref|XP_005700400.1|  PREDICTED: cullin-4B isoform X1                    298   5e-91    
ref|XP_009968477.1|  PREDICTED: cullin-4B                               298   5e-91    
ref|XP_010020149.1|  PREDICTED: cullin-4B                               298   5e-91    
ref|XP_009871272.1|  PREDICTED: cullin-4B                               298   5e-91    
ref|XP_009578947.1|  PREDICTED: cullin-4B                               298   5e-91    
ref|XP_009487693.1|  PREDICTED: cullin-4B                               298   5e-91    
ref|XP_009273579.1|  PREDICTED: cullin-4B                               298   5e-91    
ref|XP_010798617.1|  PREDICTED: cullin-4B isoform X1                    298   5e-91    
ref|XP_009073198.1|  PREDICTED: cullin-4B                               298   5e-91    
ref|XP_006048867.1|  PREDICTED: cullin-4B isoform X4                    298   5e-91    
ref|XP_005045907.1|  PREDICTED: cullin-4B                               298   5e-91    
ref|XP_005484500.1|  PREDICTED: cullin-4B                               298   5e-91    
ref|XP_008017651.1|  PREDICTED: cullin-4B isoform X4                    299   5e-91    
ref|XP_006632966.1|  PREDICTED: cullin-4B-like                          297   5e-91    
ref|XP_010627873.1|  PREDICTED: cullin-4B isoform X2                    298   5e-91    
ref|XP_009943501.1|  PREDICTED: cullin-4B                               298   5e-91    
ref|XP_010592962.1|  PREDICTED: cullin-4B isoform X1                    298   5e-91    
ref|XP_002699556.2|  PREDICTED: cullin-4B isoform X4                    298   5e-91    
ref|XP_003414815.1|  PREDICTED: cullin-4B isoform X2                    298   5e-91    
ref|XP_002196531.1|  PREDICTED: cullin-4B                               298   5e-91    
ref|XP_009899852.1|  PREDICTED: cullin-4B                               298   6e-91    
ref|XP_010139394.1|  PREDICTED: cullin-4B                               298   6e-91    
ref|XP_004022402.1|  PREDICTED: cullin-4B isoform 1                     298   6e-91    
ref|XP_010162624.1|  PREDICTED: cullin-4B                               298   6e-91    
ref|XP_010150094.1|  PREDICTED: cullin-4B                               298   6e-91    
gb|KFP00724.1|  Cullin-4B                                               298   6e-91    
ref|XP_006048864.1|  PREDICTED: cullin-4B isoform X1                    298   6e-91    
ref|XP_006215961.1|  PREDICTED: cullin-4B isoform X1                    298   6e-91    
gb|EMC88699.1|  Cullin-4B                                               298   6e-91    
gb|KFW86599.1|  Cullin-4B                                               298   6e-91    
ref|XP_005227530.1|  PREDICTED: cullin-4B isoform X2                    298   6e-91    
ref|XP_009981623.1|  PREDICTED: cullin-4B                               298   6e-91    
ref|XP_006215962.1|  PREDICTED: cullin-4B isoform X2                    298   6e-91    
dbj|BAE36141.1|  unnamed protein product                                298   6e-91    
gb|KFU89258.1|  Cullin-4B                                               298   7e-91    
gb|KFQ18028.1|  Cullin-4B                                               298   7e-91    
gb|KFQ02433.1|  Cullin-4B                                               298   7e-91    
gb|KFO92809.1|  Cullin-4B                                               298   7e-91    
ref|XP_009914151.1|  PREDICTED: cullin-4A isoform X3                    288   7e-91    
gb|KFV93759.1|  Cullin-4B                                               298   7e-91    
gb|KFP90614.1|  Cullin-4B                                               298   7e-91    
gb|KFP57528.1|  Cullin-4B                                               298   7e-91    
gb|KFM04851.1|  Cullin-4B                                               298   7e-91    
ref|XP_011376546.1|  PREDICTED: cullin-4B isoform X3                    298   7e-91    
ref|XP_010592319.1|  PREDICTED: cullin-4A isoform X2                    291   7e-91    
ref|XP_005358493.1|  PREDICTED: cullin-4B                               299   7e-91    
gb|AAR13073.1|  cullin 4B                                               298   7e-91    
ref|XP_008017653.1|  PREDICTED: cullin-4B isoform X6                    298   7e-91    
gb|KFV68186.1|  Cullin-4B                                               298   7e-91    
gb|KFR04226.1|  Cullin-4B                                               298   7e-91    
ref|XP_010073509.1|  PREDICTED: cullin-4B                               297   8e-91    
gb|KFZ62825.1|  Cullin-4B                                               297   8e-91    
gb|KFP13940.1|  Cullin-4B                                               298   8e-91    
gb|KFV04835.1|  Cullin-4B                                               297   8e-91    
gb|ELR59400.1|  Cullin-4B                                               298   8e-91    
gb|KFQ64788.1|  Cullin-4B                                               297   8e-91    
gb|AAH36216.1|  Cullin 4B                                               298   8e-91    
gb|KFV79701.1|  Cullin-4B                                               298   8e-91    
gb|KFV55551.1|  Cullin-4B                                               297   8e-91    
gb|KFQ89647.1|  Cullin-4B                                               297   8e-91    
gb|KFQ56289.1|  Cullin-4B                                               297   8e-91    
gb|KFP38487.1|  Cullin-4B                                               297   8e-91    
gb|KFO06527.1|  Cullin-4B                                               297   8e-91    
ref|XP_009995422.1|  PREDICTED: cullin-4B                               298   8e-91    
ref|NP_001103612.1|  cullin-4B                                          299   8e-91    
ref|XP_003229259.1|  PREDICTED: cullin-4B                               298   9e-91    
gb|KFZ46418.1|  Cullin-4B                                               297   9e-91    
gb|KFV08408.1|  Cullin-4B                                               297   1e-90    
gb|KJB66936.1|  hypothetical protein B456_010G166800                    295   1e-90    
gb|KFP80278.1|  Cullin-4B                                               297   1e-90    
ref|XP_008017649.1|  PREDICTED: cullin-4B isoform X2                    298   1e-90    
ref|XP_008017648.1|  PREDICTED: cullin-4B isoform X1                    298   1e-90    
ref|XP_007436244.1|  PREDICTED: cullin-4B                               297   1e-90    
ref|XP_010592318.1|  PREDICTED: cullin-4A isoform X1                    291   1e-90    
ref|XP_010894664.1|  PREDICTED: cullin-4B isoform X1                    291   2e-90    
gb|KGL96725.1|  Cullin-4B                                               297   2e-90    
ref|XP_010894673.1|  PREDICTED: cullin-4B isoform X2                    291   2e-90    
ref|XP_007507205.1|  PREDICTED: cullin-4B isoform X2                    297   2e-90    
ref|XP_007507204.1|  PREDICTED: cullin-4B isoform X1                    297   2e-90    
dbj|BAA33146.1|  cullin-4A                                              288   2e-90    
ref|XP_003365917.2|  PREDICTED: cullin-4B                               298   2e-90    
gb|AAI67417.1|  Unknown (protein for IMAGE:7555086)                     288   2e-90    
ref|XP_010223965.1|  PREDICTED: cullin-4A                               287   2e-90    
ref|XP_005644988.1|  Cullin-domain-containing protein                   293   2e-90    
ref|XP_007507207.1|  PREDICTED: cullin-4B isoform X4                    296   3e-90    
ref|XP_010962238.1|  PREDICTED: cullin-4B                               296   3e-90    
ref|XP_002504743.1|  predicted protein                                  294   3e-90    
ref|XP_007254497.1|  PREDICTED: cullin-4B-like                          295   3e-90    
ref|XP_004713104.1|  PREDICTED: cullin-4B isoform X1                    296   3e-90    
ref|XP_007507206.1|  PREDICTED: cullin-4B isoform X3                    296   3e-90    
ref|XP_004713105.1|  PREDICTED: cullin-4B isoform X2                    296   3e-90    
ref|XP_010296749.1|  PREDICTED: cullin-4A                               280   3e-90    
dbj|BAC27992.1|  unnamed protein product                                297   4e-90    
ref|XP_007075343.1|  PREDICTED: cullin-4A isoform X2                    289   6e-90    
ref|XP_007075342.1|  PREDICTED: cullin-4A isoform X1                    289   6e-90    
ref|XP_009190538.1|  PREDICTED: cullin-4A isoform X3                    288   6e-90    
ref|XP_005037543.1|  PREDICTED: cullin-4A isoform X4                    289   8e-90    
ref|XP_005037542.1|  PREDICTED: cullin-4A isoform X3                    289   8e-90    
ref|XP_005488058.1|  PREDICTED: cullin-4A                               288   1e-89    
ref|XP_009914149.1|  PREDICTED: cullin-4A isoform X2                    288   1e-89    
ref|XP_005037541.1|  PREDICTED: cullin-4A isoform X2                    289   1e-89    
ref|XP_006803308.1|  PREDICTED: cullin-4B-like                          290   1e-89    
ref|XP_009914148.1|  PREDICTED: cullin-4A isoform X1                    288   1e-89    
ref|XP_010730305.1|  PREDICTED: cullin-4B                               294   1e-89    
gb|KDO33656.1|  hypothetical protein SPRG_01614                         291   2e-89    
ref|XP_005586359.1|  PREDICTED: cullin-4A isoform X2                    288   2e-89    
ref|XP_011215604.1|  PREDICTED: cullin-4A isoform X2                    289   2e-89    
gb|EDM08875.1|  similar to cullin 4A (predicted), isoform CRA_a         283   2e-89    
ref|XP_008707988.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B          293   2e-89    
ref|XP_009644037.1|  PREDICTED: cullin-4A                               290   3e-89    
ref|XP_010894682.1|  PREDICTED: cullin-4B isoform X3                    293   3e-89    
gb|KFP21637.1|  Cullin-4A                                               290   3e-89    
ref|XP_004704475.1|  PREDICTED: cullin-4A                               290   3e-89    
ref|XP_009663765.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A          287   4e-89    
emb|CDQ70188.1|  unnamed protein product                                293   4e-89    
ref|XP_008615934.1|  Cullin 4                                           290   5e-89    
ref|XP_008634084.1|  PREDICTED: cullin-4A                               286   5e-89    
gb|AAI67423.1|  Unknown (protein for IMAGE:7549114)                     284   6e-89    
ref|XP_010392615.1|  PREDICTED: cullin-4A isoform X2                    286   6e-89    
ref|XP_006176792.1|  PREDICTED: cullin-4A isoform X1                    286   6e-89    
ref|XP_005799582.1|  PREDICTED: cullin-4B-like                          292   6e-89    
ref|XP_010358365.1|  PREDICTED: cullin-4A isoform X1                    287   7e-89    
ref|XP_007959169.1|  PREDICTED: cullin-4A isoform X2                    287   7e-89    
gb|EAX09201.1|  cullin 4A                                               287   7e-89    
ref|XP_003279809.1|  PREDICTED: cullin-4A isoform 2                     287   7e-89    
gb|AAP36287.1|  Homo sapiens cullin 4A                                  287   7e-89    
ref|NP_003580.1|  cullin-4A isoform 2                                   287   7e-89    
ref|XP_009988821.1|  PREDICTED: cullin-4A                               288   7e-89    
ref|XP_008955751.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A          287   8e-89    
ref|XP_002930544.1|  PREDICTED: cullin-4A isoform X1                    288   8e-89    
gb|EFB23437.1|  hypothetical protein PANDA_021021                       289   8e-89    
ref|XP_007940575.1|  PREDICTED: cullin-4A                               290   8e-89    
ref|XP_008571150.1|  PREDICTED: cullin-4A                               286   8e-89    
ref|XP_007196817.1|  PREDICTED: cullin-4A                               286   9e-89    
gb|ELK14877.1|  Cullin-4A                                               289   9e-89    
ref|XP_006909411.1|  PREDICTED: cullin-4A                               290   9e-89    
ref|NP_001265443.1|  cullin-4A isoform 3                                287   9e-89    
gb|KJB69828.1|  hypothetical protein B456_011G044900                    290   1e-88    
ref|XP_004450824.1|  PREDICTED: cullin-4A                               288   1e-88    
ref|XP_004383008.1|  PREDICTED: cullin-4A                               289   1e-88    
ref|XP_010392614.1|  PREDICTED: cullin-4A isoform X1                    286   1e-88    
ref|XP_003640577.1|  PREDICTED: cullin-4A isoform X1                    289   1e-88    
ref|XP_007666876.1|  PREDICTED: cullin-4A isoform X2                    286   1e-88    
gb|EHH58721.1|  hypothetical protein EGM_08641                          287   1e-88    
gb|EDL22119.1|  mCG3701, isoform CRA_a                                  283   1e-88    
ref|XP_006449705.1|  hypothetical protein CICLE_v10014310mg             283   1e-88    
ref|XP_849542.3|  PREDICTED: cullin-4A                                  289   1e-88    
ref|XP_005022013.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A          288   1e-88    
ref|XP_003593913.1|  Cullin                                             289   1e-88    
gb|EGW07251.1|  Cullin-4A                                               285   1e-88    
ref|XP_010117727.1|  PREDICTED: cullin-4A                               288   1e-88    
ref|XP_003970600.1|  PREDICTED: cullin-4B-like                          291   2e-88    
ref|XP_008683174.1|  PREDICTED: cullin-4A                               288   2e-88    
ref|XP_009578999.1|  PREDICTED: cullin-4A                               288   2e-88    
ref|XP_005037540.1|  PREDICTED: cullin-4A isoform X1                    289   2e-88    
gb|KFP93822.1|  Cullin-4A                                               288   2e-88    
ref|XP_005884540.1|  PREDICTED: cullin-4A                               288   2e-88    
ref|XP_010086167.1|  PREDICTED: cullin-4A                               288   2e-88    
ref|XP_005516645.1|  PREDICTED: cullin-4A                               289   2e-88    
ref|XP_011279428.1|  PREDICTED: cullin-4A                               288   2e-88    
ref|XP_002742600.2|  PREDICTED: cullin-4A                               286   2e-88    
gb|KFV89189.1|  Cullin-4A                                               288   2e-88    
gb|KFP35944.1|  Cullin-4A                                               288   2e-88    
ref|XP_006851582.1|  PREDICTED: cullin-4A                               289   2e-88    
ref|XP_005969110.1|  PREDICTED: cullin-4A                               288   2e-88    
ref|XP_006102095.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A          288   2e-88    
ref|XP_005420081.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A          288   2e-88    
ref|XP_002808198.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A-like     287   2e-88    
ref|XP_007569758.1|  PREDICTED: cullin-4B                               291   2e-88    
ref|XP_010618232.1|  PREDICTED: cullin-4A isoform X5                    285   2e-88    
gb|ACG69447.2|  cullin 4A isoform 1 (predicted)                         287   2e-88    
gb|KFV05672.1|  Cullin-4A                                               288   2e-88    
ref|XP_008418856.1|  PREDICTED: cullin-4B                               291   2e-88    
gb|KFM05368.1|  Cullin-4A                                               288   2e-88    
gb|KFU89815.1|  Cullin-4A                                               288   3e-88    
ref|XP_008516382.1|  PREDICTED: cullin-4A                               288   3e-88    
ref|XP_007902268.1|  PREDICTED: cullin-4A isoform X1                    288   3e-88    
ref|XP_010764721.1|  PREDICTED: cullin-4B                               290   3e-88    
ref|XP_007902269.1|  PREDICTED: cullin-4A isoform X2                    288   3e-88    
ref|XP_009083710.1|  PREDICTED: cullin-4A                               288   3e-88    
gb|KFW82894.1|  Cullin-4A                                               287   3e-88    
ref|XP_008142137.1|  PREDICTED: cullin-4A                               288   3e-88    
ref|XP_010021433.1|  PREDICTED: cullin-4A                               282   4e-88    
ref|XP_003928309.2|  PREDICTED: cullin-4A                               286   4e-88    
ref|XP_004423239.1|  PREDICTED: cullin-4A                               288   4e-88    
ref|XP_004881821.1|  PREDICTED: cullin-4A isoform X1                    285   4e-88    
ref|XP_007117448.1|  PREDICTED: cullin-4A                               285   4e-88    
ref|XP_007891612.1|  PREDICTED: cullin-4B                               290   4e-88    
ref|XP_010618230.1|  PREDICTED: cullin-4A isoform X3                    285   4e-88    
ref|XP_010618231.1|  PREDICTED: cullin-4A isoform X4                    285   4e-88    
ref|XP_008324704.1|  PREDICTED: cullin-4B                               289   4e-88    
ref|XP_009470947.1|  PREDICTED: cullin-4A                               288   4e-88    
pdb|4A0K|A  Chain A, Structure Of Ddb1-Ddb2-Cul4a-Rbx1 Bound To A...    287   4e-88    
ref|XP_003445252.1|  PREDICTED: cullin-4B                               290   4e-88    
ref|XP_005145983.1|  PREDICTED: cullin-4A                               288   5e-88    
ref|XP_004545810.1|  PREDICTED: cullin-4B-like                          290   5e-88    
ref|XP_004981509.1|  PREDICTED: cullin-4-like isoform X1                289   5e-88    
ref|XP_002824497.1|  PREDICTED: cullin-4A                               288   5e-88    
ref|XP_005307674.1|  PREDICTED: cullin-4A isoform X2                    284   5e-88    
gb|KGL98962.1|  Cullin-4A                                               286   5e-88    
ref|XP_004823542.1|  PREDICTED: cullin-4A                               288   5e-88    
ref|XP_005913219.1|  PREDICTED: cullin-4B-like                          290   6e-88    
ref|XP_004577405.1|  PREDICTED: cullin-4A                               285   6e-88    
ref|XP_003914139.1|  PREDICTED: cullin-4A isoform X2                    287   6e-88    
ref|XP_010618227.1|  PREDICTED: cullin-4A isoform X1                    285   6e-88    
ref|XP_008924491.1|  PREDICTED: cullin-4A                               288   6e-88    
ref|XP_005505503.1|  PREDICTED: cullin-4A                               286   6e-88    
ref|XP_005586358.1|  PREDICTED: cullin-4A isoform X1                    287   6e-88    
dbj|BAD93235.1|  cullin-4A                                              287   6e-88    
ref|XP_007959168.1|  PREDICTED: cullin-4A isoform X1                    287   6e-88    
ref|XP_010726908.1|  PREDICTED: cullin-4A                               287   6e-88    
ref|XP_003800032.1|  PREDICTED: cullin-4A                               287   6e-88    
ref|XP_003279808.1|  PREDICTED: cullin-4A isoform 1                     287   7e-88    
ref|NP_001008895.1|  cullin-4A isoform 1                                287   7e-88    
ref|XP_010618229.1|  PREDICTED: cullin-4A isoform X2                    285   7e-88    



>gb|KDO78194.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
 gb|KDO78195.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=540

 Score =   370 bits (950),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+A+K SFQDIK+A GIEDKELRR
Sbjct  348  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKDATGIEDKELRR  407

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVEDDD+FVFN+ FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  408  TLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPLYRIKVNAIQMKETVEENTSTTE  467

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  468  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  527

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  528  RDKNNPQIYNYLA  540



>ref|XP_009599227.1| PREDICTED: cullin-4 [Nicotiana tomentosiformis]
Length=821

 Score =   379 bits (972),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 182/193 (94%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTV LMLFN+AEK SFQDIKEA GIEDKELRR
Sbjct  629  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVALMLFNDAEKLSFQDIKEATGIEDKELRR  688

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  689  TLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  748

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  749  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  808

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  809  RDKNNPQIYNYLA  821



>ref|NP_001234356.1| cullin 4 [Solanum lycopersicum]
 gb|ABX09988.1| cullin 4 [Solanum lycopersicum]
Length=785

 Score =   376 bits (966),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 181/193 (94%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAE+PKG+KELAVS FQTVVLMLFN+AE  SFQDIKEA GIEDKELRR
Sbjct  593  LMWQNSLGHCVLKAEYPKGKKELAVSLFQTVVLMLFNDAENLSFQDIKEATGIEDKELRR  652

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  653  TLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  712

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  713  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  772

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  773  RDKNNPQIYNYLA  785



>ref|XP_006361548.1| PREDICTED: cullin-4-like [Solanum tuberosum]
Length=824

 Score =   377 bits (967),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 181/193 (94%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAE+PKG+KELAVS FQTVVLMLFN+AE  SFQDIKEA GIEDKELRR
Sbjct  632  LMWQNSLGHCVLKAEYPKGKKELAVSLFQTVVLMLFNDAENLSFQDIKEATGIEDKELRR  691

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  692  TLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  751

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  752  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  811

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  812  RDKNNPQIYNYLA  824



>ref|XP_009759464.1| PREDICTED: cullin-4 [Nicotiana sylvestris]
Length=821

 Score =   376 bits (966),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 181/193 (94%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTV LMLFN+AEK SFQDIKEA GIEDKELRR
Sbjct  629  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVALMLFNDAEKLSFQDIKEATGIEDKELRR  688

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQKIPKGRDVED+DTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  689  TLQSLACGKVRVLQKIPKGRDVEDEDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  748

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  749  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  808

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  809  RDKNNPQIYNYLA  821



>gb|KGN65537.1| hypothetical protein Csa_1G435820 [Cucumis sativus]
Length=540

 Score =   368 bits (944),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMW NSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+AEK S QDI+E+ GIEDKELRR
Sbjct  348  LMWHNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAEKLSLQDIRESTGIEDKELRR  407

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQKIPKGRDVED+D+FVFND FTAPLYR+KVNAIQMKETVEENTSTTE
Sbjct  408  TLQSLACGKVRVLQKIPKGRDVEDNDSFVFNDGFTAPLYRLKVNAIQMKETVEENTSTTE  467

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  468  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  527

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  528  RDKNNPQIYNYLA  540



>gb|KDO78193.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=662

 Score =   370 bits (951),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+A+K SFQDIK+A GIEDKELRR
Sbjct  470  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKDATGIEDKELRR  529

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVEDDD+FVFN+ FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  530  TLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPLYRIKVNAIQMKETVEENTSTTE  589

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  590  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  649

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  650  RDKNNPQIYNYLA  662



>ref|XP_008366025.1| PREDICTED: cullin-4-like [Malus domestica]
Length=299

 Score =   355 bits (912),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+FPKG+KELAVS FQTVVLMLFN+AEK S +DIK++  IEDKELRR
Sbjct  107  LMWQNSLGHCVLKADFPKGKKELAVSLFQTVVLMLFNDAEKLSLEDIKDSTXIEDKELRR  166

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK PKGRDV+D DTF FND F APLYRIKVNAIQMKETVEENTSTTE
Sbjct  167  TLQSLACGKVRVLQKFPKGRDVDDGDTFTFNDTFIAPLYRIKVNAIQMKETVEENTSTTE  226

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  227  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  286

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  287  RDKNNPQIYNYLA  299



>gb|KJB66937.1| hypothetical protein B456_010G166800 [Gossypium raimondii]
Length=662

 Score =   367 bits (943),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+FPKG+KELAVS FQTVVLMLFN+A+K SFQDIK++ GIEDKELRR
Sbjct  470  LMWQNSLGHCVLKADFPKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKDSTGIEDKELRR  529

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVED+D+F+FND FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  530  TLQSLACGKVRVLQKLPKGRDVEDNDSFIFNDGFTAPLYRIKVNAIQMKETVEENTSTTE  589

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  590  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  649

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  650  RDKNNPQIYNYLA  662



>ref|XP_006467460.1| PREDICTED: cullin-4-like isoform X2 [Citrus sinensis]
Length=783

 Score =   370 bits (949),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+A+K SFQDIK+A GIEDKELRR
Sbjct  591  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKDATGIEDKELRR  650

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVEDDD+FVFN+ FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  651  TLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPLYRIKVNAIQMKETVEENTSTTE  710

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  711  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  770

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  771  RDKNNPQIYNYLA  783



>gb|KHN46079.1| Cullin-4 [Glycine soja]
Length=764

 Score =   369 bits (947),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKGRKELAVS FQTVVLMLFN+AEK S QDIK+A GIEDKELRR
Sbjct  572  LMWQNSLGHCVLKAEFPKGRKELAVSLFQTVVLMLFNDAEKLSLQDIKDATGIEDKELRR  631

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVEDDD FVFND FTAPLYRIKVNAIQ+KETVEENTSTTE
Sbjct  632  TLQSLACGKVRVLQKMPKGRDVEDDDLFVFNDGFTAPLYRIKVNAIQLKETVEENTSTTE  691

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVF DRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  692  RVFHDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  751

Query  176  RDKSNPQIYNYLA  138
            RDKSNPQIYNYLA
Sbjct  752  RDKSNPQIYNYLA  764



>ref|XP_006467459.1| PREDICTED: cullin-4-like isoform X1 [Citrus sinensis]
 gb|KDO78189.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=804

 Score =   370 bits (950),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+A+K SFQDIK+A GIEDKELRR
Sbjct  612  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKDATGIEDKELRR  671

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVEDDD+FVFN+ FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  672  TLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPLYRIKVNAIQMKETVEENTSTTE  731

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  732  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  791

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  792  RDKNNPQIYNYLA  804



>ref|XP_003524860.1| PREDICTED: cullin-4-like [Glycine max]
Length=775

 Score =   369 bits (948),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKGRKELAVS FQTVVLMLFN+AEK S QDIK+A GIEDKELRR
Sbjct  583  LMWQNSLGHCVLKAEFPKGRKELAVSLFQTVVLMLFNDAEKLSLQDIKDATGIEDKELRR  642

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVEDDD FVFND FTAPLYRIKVNAIQ+KETVEENTSTTE
Sbjct  643  TLQSLACGKVRVLQKMPKGRDVEDDDLFVFNDGFTAPLYRIKVNAIQLKETVEENTSTTE  702

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVF DRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  703  RVFHDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  762

Query  176  RDKSNPQIYNYLA  138
            RDKSNPQIYNYLA
Sbjct  763  RDKSNPQIYNYLA  775



>gb|KHN12460.1| Cullin-4 [Glycine soja]
Length=760

 Score =   369 bits (947),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKGRKELAVS FQTVVLMLFN+AEK S QDIK+A GIEDKELRR
Sbjct  568  LMWQNSLGHCVLKAEFPKGRKELAVSLFQTVVLMLFNDAEKLSLQDIKDATGIEDKELRR  627

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
             LQS ACGKVRVLQK+PKGRDVEDDD+FVFND FTAPLYRIKVNAIQ+KETVEENTSTTE
Sbjct  628  ILQSLACGKVRVLQKMPKGRDVEDDDSFVFNDGFTAPLYRIKVNAIQLKETVEENTSTTE  687

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAA+VRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  688  RVFQDRQYQIDAALVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  747

Query  176  RDKSNPQIYNYLA  138
            RDKSNPQIYNYLA
Sbjct  748  RDKSNPQIYNYLA  760



>gb|KHN47328.1| Cullin-4 [Glycine soja]
Length=777

 Score =   369 bits (948),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+AEK SFQDIK++ GIEDKELRR
Sbjct  585  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAEKLSFQDIKDSTGIEDKELRR  644

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVEDDD+FVFN+ FTAPLYRIKVNAIQ+KETVEENTSTTE
Sbjct  645  TLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPLYRIKVNAIQLKETVEENTSTTE  704

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  705  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  764

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  765  RDKNNPQIYNYLA  777



>gb|EYU43260.1| hypothetical protein MIMGU_mgv1a001310mg [Erythranthe guttata]
Length=843

 Score =   370 bits (951),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKGRKELAVS FQTVVLMLFN+A+K SFQDIKE+ GIEDKELRR
Sbjct  651  LMWQNSLGHCVLKAEFPKGRKELAVSLFQTVVLMLFNDAQKLSFQDIKESTGIEDKELRR  710

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVLQK+PKGRDVEDDDTFVFNDQF APLYRIKVNAIQMKET+EENTSTTE
Sbjct  711  TLQSLACGKFRVLQKMPKGRDVEDDDTFVFNDQFAAPLYRIKVNAIQMKETIEENTSTTE  770

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRK+ SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  771  RVFQDRQYQVDAAIVRIMKTRKMLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  830

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQ+YNYLA
Sbjct  831  RDKNNPQVYNYLA  843



>ref|XP_011085242.1| PREDICTED: cullin-4 [Sesamum indicum]
Length=844

 Score =   370 bits (951),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 178/193 (92%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+A+K  FQDIKE+ GIEDKELRR
Sbjct  652  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAQKLGFQDIKESTGIEDKELRR  711

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVLQKIPKGRDVEDDD FVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  712  TLQSLACGKFRVLQKIPKGRDVEDDDFFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  771

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  772  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  831

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  832  RDKNNPQIYNYLA  844



>ref|XP_003532695.2| PREDICTED: cullin-4-like isoform X1 [Glycine max]
Length=769

 Score =   369 bits (946),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKGRKELAVS FQTVVLMLFN+AEK S QDIK+A GIEDKELRR
Sbjct  577  LMWQNSLGHCVLKAEFPKGRKELAVSLFQTVVLMLFNDAEKLSLQDIKDATGIEDKELRR  636

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
             LQS ACGKVRVLQK+PKGRDVEDDD+FVFND FTAPLYRIKVNAIQ+KETVEENTSTTE
Sbjct  637  ILQSLACGKVRVLQKMPKGRDVEDDDSFVFNDGFTAPLYRIKVNAIQLKETVEENTSTTE  696

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAA+VRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  697  RVFQDRQYQIDAALVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  756

Query  176  RDKSNPQIYNYLA  138
            RDKSNPQIYNYLA
Sbjct  757  RDKSNPQIYNYLA  769



>ref|XP_008225565.1| PREDICTED: cullin-4 [Prunus mume]
Length=821

 Score =   369 bits (948),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+AEK S QDIK++ GIEDKELRR
Sbjct  629  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAEKLSLQDIKDSTGIEDKELRR  688

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK PKGRDVEDDDTF FND FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  689  TLQSLACGKVRVLQKFPKGRDVEDDDTFTFNDGFTAPLYRIKVNAIQMKETVEENTSTTE  748

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  749  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  808

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  809  RDKNNPQIYNYLA  821



>ref|XP_008444359.1| PREDICTED: cullin-4 [Cucumis melo]
Length=829

 Score =   369 bits (947),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMW NSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+AEK SFQDI+E+ GIEDKELRR
Sbjct  637  LMWHNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAEKLSFQDIRESTGIEDKELRR  696

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQKIPKGRDVED+D+FVFND FTAPLYR+KVNAIQMKETVEENTSTTE
Sbjct  697  TLQSLACGKVRVLQKIPKGRDVEDNDSFVFNDGFTAPLYRLKVNAIQMKETVEENTSTTE  756

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  757  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  816

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  817  RDKNNPQIYNYLA  829



>ref|XP_011096567.1| PREDICTED: cullin-4-like [Sesamum indicum]
Length=846

 Score =   369 bits (948),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+A+K SFQDIKE+ GIEDKELRR
Sbjct  654  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKESTGIEDKELRR  713

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVLQKIPKGRDVED+D+FVFNDQF APLYR+KVNAIQMKETVEENTSTTE
Sbjct  714  TLQSLACGKFRVLQKIPKGRDVEDEDSFVFNDQFAAPLYRLKVNAIQMKETVEENTSTTE  773

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  774  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  833

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  834  RDKNNPQIYNYLA  846



>ref|XP_010666663.1| PREDICTED: cullin-4 [Beta vulgaris subsp. vulgaris]
Length=825

 Score =   369 bits (947),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+FPKG+KELAVS FQ VVLMLFN+AEK SFQDIK+A GIEDKELRR
Sbjct  633  LMWQNSLGHCVLKADFPKGKKELAVSLFQAVVLMLFNDAEKLSFQDIKDATGIEDKELRR  692

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGR+VEDDD+FVFND F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  693  TLQSLACGKVRVLQKVPKGREVEDDDSFVFNDTFSAPLYRIKVNAIQMKETVEENTSTTE  752

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  753  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  812

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  813  RDKNNPQIYNYLA  825



>ref|XP_007214632.1| hypothetical protein PRUPE_ppa001433mg [Prunus persica]
 gb|EMJ15831.1| hypothetical protein PRUPE_ppa001433mg [Prunus persica]
Length=830

 Score =   369 bits (947),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+AEK S QDIK++ GIEDKELRR
Sbjct  638  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAEKLSLQDIKDSTGIEDKELRR  697

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK PKGRDVEDDDTF FND FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  698  TLQSLACGKVRVLQKFPKGRDVEDDDTFTFNDGFTAPLYRIKVNAIQMKETVEENTSTTE  757

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  758  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  817

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  818  RDKNNPQIYNYLA  830



>gb|KDP37982.1| hypothetical protein JCGZ_04625 [Jatropha curcas]
Length=821

 Score =   369 bits (946),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+A+K SFQDIK+A GIEDKELRR
Sbjct  629  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKDATGIEDKELRR  688

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVEDDD+FVFN+ FTAPLYRIKVNAIQMKETVEENT+TTE
Sbjct  689  TLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPLYRIKVNAIQMKETVEENTNTTE  748

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  749  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  808

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  809  RDKNNPQIYNYLA  821



>gb|KJB68317.1| hypothetical protein B456_010G238300 [Gossypium raimondii]
Length=540

 Score =   359 bits (922),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+F KG+KELAVS FQTVVLMLFN+AEK SFQDIK++  IEDKELRR
Sbjct  348  LMWQNSLGHCVLKADFTKGKKELAVSLFQTVVLMLFNDAEKLSFQDIKDSTAIEDKELRR  407

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGR+VEDDD+FVFN+ F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  408  TLQSLACGKVRVLQKLPKGREVEDDDSFVFNEGFSAPLYRIKVNAIQMKETVEENTSTTE  467

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  468  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  527

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  528  RDKNNPQIYNYLA  540



>gb|KJB66935.1| hypothetical protein B456_010G166800 [Gossypium raimondii]
Length=816

 Score =   367 bits (943),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+FPKG+KELAVS FQTVVLMLFN+A+K SFQDIK++ GIEDKELRR
Sbjct  624  LMWQNSLGHCVLKADFPKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKDSTGIEDKELRR  683

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVED+D+F+FND FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  684  TLQSLACGKVRVLQKLPKGRDVEDNDSFIFNDGFTAPLYRIKVNAIQMKETVEENTSTTE  743

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  744  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  803

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  804  RDKNNPQIYNYLA  816



>ref|XP_003546083.1| PREDICTED: cullin-4-like [Glycine max]
Length=788

 Score =   366 bits (940),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+AEK SFQDIK++ GIE KELRR
Sbjct  596  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAEKLSFQDIKDSTGIEGKELRR  655

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVEDDD+FVFN+ FTAPLYRIKVNAIQ+KETVEENTSTTE
Sbjct  656  TLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPLYRIKVNAIQLKETVEENTSTTE  715

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  716  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  775

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  776  RDKNNPQIYNYLA  788



>gb|KHN06973.1| Cullin-4 [Glycine soja]
Length=788

 Score =   366 bits (940),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+AEK SFQDIK++ GIE KELRR
Sbjct  596  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAEKLSFQDIKDSTGIEGKELRR  655

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVEDDD+FVFN+ FTAPLYRIKVNAIQ+KETVEENTSTTE
Sbjct  656  TLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPLYRIKVNAIQLKETVEENTSTTE  715

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  716  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  775

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  776  RDKNNPQIYNYLA  788



>ref|XP_011013417.1| PREDICTED: cullin-4-like [Populus euphratica]
Length=811

 Score =   367 bits (941),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+A+K SFQDIK++ GIEDKELRR
Sbjct  619  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKDSTGIEDKELRR  678

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVE+DD+FVFN+ FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  679  TLQSLACGKVRVLQKLPKGRDVEEDDSFVFNEGFTAPLYRIKVNAIQMKETVEENTSTTE  738

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  739  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  798

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  799  RDKNNPQIYNYLA  811



>ref|XP_004149667.1| PREDICTED: cullin-4-like [Cucumis sativus]
Length=833

 Score =   367 bits (942),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMW NSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+AEK S QDI+E+ GIEDKELRR
Sbjct  641  LMWHNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAEKLSLQDIRESTGIEDKELRR  700

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQKIPKGRDVED+D+FVFND FTAPLYR+KVNAIQMKETVEENTSTTE
Sbjct  701  TLQSLACGKVRVLQKIPKGRDVEDNDSFVFNDGFTAPLYRLKVNAIQMKETVEENTSTTE  760

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  761  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  820

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  821  RDKNNPQIYNYLA  833



>ref|XP_006377604.1| hypothetical protein POPTR_0011s08280g [Populus trichocarpa]
 gb|ERP55401.1| hypothetical protein POPTR_0011s08280g [Populus trichocarpa]
Length=811

 Score =   366 bits (940),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+A+K SFQDIK++ GIEDKELRR
Sbjct  619  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKDSTGIEDKELRR  678

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVE+DD+FVFN+ FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  679  TLQSLACGKVRVLQKLPKGRDVEEDDSFVFNEGFTAPLYRIKVNAIQMKETVEENTSTTE  738

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  739  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  798

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  799  RDKNNPQIYNYLA  811



>ref|XP_010941311.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4-like [Elaeis guineensis]
Length=846

 Score =   367 bits (942),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG KELAVS FQTVVLMLFN+A+K SFQDIK++ GI+DKELRR
Sbjct  654  LMWQNSLGHCVLKAEFPKGXKELAVSLFQTVVLMLFNDAQKLSFQDIKDSTGIDDKELRR  713

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQKIPKGR+VEDDDTFVFN++F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  714  TLQSLACGKVRVLQKIPKGREVEDDDTFVFNEEFSAPLYRIKVNAIQMKETVEENTSTTE  773

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  774  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  833

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  834  RDKNNPQIYNYLA  846



>ref|XP_007025064.1| Cullin-4B isoform 1 [Theobroma cacao]
 gb|EOY27686.1| Cullin-4B isoform 1 [Theobroma cacao]
Length=819

 Score =   366 bits (940),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+FPKG+KELAVS FQTVVLMLFN+A+K SFQDIK++ GIEDKELRR
Sbjct  627  LMWQNSLGHCVLKADFPKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKDSTGIEDKELRR  686

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVEDDD+FVFN+ FTAPLYR+KVNAIQMKETVEENTSTTE
Sbjct  687  TLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPLYRLKVNAIQMKETVEENTSTTE  746

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  747  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  806

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  807  RDKNNPQIYNYLA  819



>emb|CBI30911.3| unnamed protein product [Vitis vinifera]
Length=802

 Score =   365 bits (938),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+A+K SFQDIK++ GIEDKELRR
Sbjct  610  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKDSTGIEDKELRR  669

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGR+VEDDD+F+FN+ FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  670  TLQSLACGKVRVLQKLPKGREVEDDDSFMFNEGFTAPLYRIKVNAIQMKETVEENTSTTE  729

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  730  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  789

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  790  RDKNNPQIYNYLA  802



>ref|XP_010274939.1| PREDICTED: cullin-4-like [Nelumbo nucifera]
Length=837

 Score =   366 bits (940),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+A+K SFQDIK++ GIEDKELRR
Sbjct  645  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKDSTGIEDKELRR  704

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK PKGRDVEDDD+F+FN++F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  705  TLQSLACGKVRVLQKFPKGRDVEDDDSFLFNEEFSAPLYRIKVNAIQMKETVEENTSTTE  764

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  765  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  824

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  825  RDKNNPQIYNYLA  837



>ref|XP_011011308.1| PREDICTED: cullin-4-like isoform X1 [Populus euphratica]
Length=808

 Score =   365 bits (938),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+A+K  FQDIK++ GIEDKELRR
Sbjct  616  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAQKLGFQDIKDSTGIEDKELRR  675

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVEDDD+FVFN+ F APLYRIKVNAIQMKETVEENTSTTE
Sbjct  676  TLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFAAPLYRIKVNAIQMKETVEENTSTTE  735

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDR+Y E
Sbjct  736  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDRDYLE  795

Query  176  RDKSNPQIYNYLA  138
            RDKSNPQIYNYLA
Sbjct  796  RDKSNPQIYNYLA  808



>ref|XP_004162809.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4-like [Cucumis sativus]
Length=833

 Score =   366 bits (939),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMW NSLGHCVLKAEFPKG KELAVS FQTVVLMLFN+AEK S QDI+E+ GIEDKELRR
Sbjct  641  LMWHNSLGHCVLKAEFPKGXKELAVSLFQTVVLMLFNDAEKLSLQDIRESTGIEDKELRR  700

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQKIPKGRDVED+D+FVFND FTAPLYR+KVNAIQMKETVEENTSTTE
Sbjct  701  TLQSLACGKVRVLQKIPKGRDVEDNDSFVFNDGFTAPLYRLKVNAIQMKETVEENTSTTE  760

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  761  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  820

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  821  RDKNNPQIYNYLA  833



>ref|XP_008787804.1| PREDICTED: cullin-4-like isoform X2 [Phoenix dactylifera]
Length=846

 Score =   366 bits (940),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+A+K SFQDIK++ GI+DKELRR
Sbjct  654  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKDSTGIDDKELRR  713

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQKIPKGR+VEDDDTFVFN++FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  714  TLQSLACGKVRVLQKIPKGREVEDDDTFVFNEEFTAPLYRIKVNAIQMKETVEENTSTTE  773

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRK+ SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  774  RVFQDRQYQVDAAIVRIMKTRKILSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  833

Query  176  RDKSNPQIYNYLA  138
            RDK+N QIYNYLA
Sbjct  834  RDKNNSQIYNYLA  846



>gb|KJB68316.1| hypothetical protein B456_010G238300 [Gossypium raimondii]
Length=614

 Score =   359 bits (922),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+F KG+KELAVS FQTVVLMLFN+AEK SFQDIK++  IEDKELRR
Sbjct  422  LMWQNSLGHCVLKADFTKGKKELAVSLFQTVVLMLFNDAEKLSFQDIKDSTAIEDKELRR  481

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGR+VEDDD+FVFN+ F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  482  TLQSLACGKVRVLQKLPKGREVEDDDSFVFNEGFSAPLYRIKVNAIQMKETVEENTSTTE  541

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  542  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  601

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  602  RDKNNPQIYNYLA  614



>ref|XP_007147910.1| hypothetical protein PHAVU_006G165300g [Phaseolus vulgaris]
 gb|ESW19904.1| hypothetical protein PHAVU_006G165300g [Phaseolus vulgaris]
Length=787

 Score =   364 bits (935),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+AEK SFQDIK++  IEDKELRR
Sbjct  595  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAEKLSFQDIKDSTSIEDKELRR  654

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVEDDD+FVFN+ F APLYRIKVNAIQ+KETVEENTSTTE
Sbjct  655  TLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFAAPLYRIKVNAIQLKETVEENTSTTE  714

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  715  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  774

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  775  RDKNNPQIYNYLA  787



>ref|XP_002270764.2| PREDICTED: cullin-4 [Vitis vinifera]
Length=828

 Score =   365 bits (937),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+A+K SFQDIK++ GIEDKELRR
Sbjct  636  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKDSTGIEDKELRR  695

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGR+VEDDD+F+FN+ FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  696  TLQSLACGKVRVLQKLPKGREVEDDDSFMFNEGFTAPLYRIKVNAIQMKETVEENTSTTE  755

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  756  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  815

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  816  RDKNNPQIYNYLA  828



>ref|XP_010247870.1| PREDICTED: cullin-4-like isoform X1 [Nelumbo nucifera]
Length=827

 Score =   365 bits (937),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+A+K SFQDI+++ GIEDKELRR
Sbjct  635  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAQKLSFQDIRDSTGIEDKELRR  694

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK PKGR+VEDDD FVFN++F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  695  TLQSLACGKVRVLQKSPKGREVEDDDLFVFNEEFSAPLYRIKVNAIQMKETVEENTSTTE  754

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  755  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  814

Query  176  RDKSNPQIYNYLA  138
            RDKSNPQIYNYLA
Sbjct  815  RDKSNPQIYNYLA  827



>ref|XP_002305340.2| hypothetical protein POPTR_0004s14020g [Populus trichocarpa]
 gb|EEE85851.2| hypothetical protein POPTR_0004s14020g [Populus trichocarpa]
Length=813

 Score =   364 bits (935),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+A+K SFQDIK++ GIEDKELRR
Sbjct  621  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKDSTGIEDKELRR  680

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVL K+PKGRDVEDDD+FVFN+ F APLYRIKVNAIQMKETVEENTSTTE
Sbjct  681  TLQSLACGKVRVLLKLPKGRDVEDDDSFVFNEGFAAPLYRIKVNAIQMKETVEENTSTTE  740

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDR+Y E
Sbjct  741  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDRDYLE  800

Query  176  RDKSNPQIYNYLA  138
            RDKSNPQIYNYLA
Sbjct  801  RDKSNPQIYNYLA  813



>ref|XP_011460204.1| PREDICTED: cullin-4 [Fragaria vesca subsp. vesca]
Length=797

 Score =   364 bits (934),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKGRKELAVS FQTVVLMLFN+AEK SFQDIK++  IEDKELRR
Sbjct  605  LMWQNSLGHCVLKAEFPKGRKELAVSLFQTVVLMLFNDAEKLSFQDIKDSTSIEDKELRR  664

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVED+D+F FND FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  665  TLQSLACGKVRVLQKLPKGRDVEDNDSFTFNDTFTAPLYRIKVNAIQMKETVEENTSTTE  724

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMKTRK+ SHT+LI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  725  RVFQDRQYQIDAAIVRIMKTRKLLSHTILITELFQQLKFPIKPADLKKRIESLIDREYLE  784

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQ+YNYLA
Sbjct  785  RDKNNPQVYNYLA  797



>ref|XP_008371761.1| PREDICTED: cullin-4 [Malus domestica]
Length=834

 Score =   364 bits (935),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+AEK S +DIK++ GIEDKELRR
Sbjct  642  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAEKLSLEDIKDSTGIEDKELRR  701

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK PKGRDV+D DTF FND FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  702  TLQSLACGKVRVLQKFPKGRDVDDGDTFTFNDSFTAPLYRIKVNAIQMKETVEENTSTTE  761

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  762  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  821

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  822  RDKNNPQIYNYLA  834



>ref|XP_006449704.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
 gb|ESR62944.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
Length=540

 Score =   355 bits (911),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+A+K SFQDIK+A GIEDKELRR
Sbjct  348  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKDATGIEDKELRR  407

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDV+DDD+FVFN+ FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  408  TLQSLACGKVRVLQKLPKGRDVDDDDSFVFNEGFTAPLYRIKVNAIQMKETVEENTSTTE  467

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  468  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  527

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  528  RDKNNPQIYNYLA  540



>ref|XP_003593911.1| Cullin [Medicago truncatula]
Length=794

 Score =   362 bits (930),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+FPKG+KELAVS FQTVVLM FN+AEK SFQDIK++ GIEDKELRR
Sbjct  602  LMWQNSLGHCVLKADFPKGKKELAVSLFQTVVLMQFNDAEKLSFQDIKDSTGIEDKELRR  661

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVED D+FVFND FTAPLYRIKVNAIQ+KETVEENT+TTE
Sbjct  662  TLQSLACGKVRVLQKMPKGRDVEDYDSFVFNDTFTAPLYRIKVNAIQLKETVEENTNTTE  721

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  722  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  781

Query  176  RDKSNPQIYNYLA  138
            RDKSNPQ+YNYLA
Sbjct  782  RDKSNPQVYNYLA  794



>ref|XP_003593912.1| Cullin [Medicago truncatula]
 gb|AES64163.1| ubiquitin-protein ligase, cullin 4 [Medicago truncatula]
Length=792

 Score =   362 bits (929),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+FPKG+KELAVS FQTVVLM FN+AEK SFQDIK++ GIEDKELRR
Sbjct  600  LMWQNSLGHCVLKADFPKGKKELAVSLFQTVVLMQFNDAEKLSFQDIKDSTGIEDKELRR  659

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVED D+FVFND FTAPLYRIKVNAIQ+KETVEENT+TTE
Sbjct  660  TLQSLACGKVRVLQKMPKGRDVEDYDSFVFNDTFTAPLYRIKVNAIQLKETVEENTNTTE  719

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  720  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  779

Query  176  RDKSNPQIYNYLA  138
            RDKSNPQ+YNYLA
Sbjct  780  RDKSNPQVYNYLA  792



>ref|XP_006352972.1| PREDICTED: cullin-4-like [Solanum tuberosum]
Length=797

 Score =   362 bits (929),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQ VVLMLFN+AEK SF D++EA  IEDKELRR
Sbjct  605  LMWQNSLGHCVLKAEFPKGKKELAVSLFQAVVLMLFNDAEKLSFLDMREATRIEDKELRR  664

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQKIPKGRDVEDDDTFVFNDQFT PLYRIKVNAIQMKETVEENT+TTE
Sbjct  665  TLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTTPLYRIKVNAIQMKETVEENTNTTE  724

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFP+KPADLKKRIESLI+REY E
Sbjct  725  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPVKPADLKKRIESLIEREYLE  784

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQ+YNYLA
Sbjct  785  RDKNNPQVYNYLA  797



>gb|KCW73810.1| hypothetical protein EUGRSUZ_E02414 [Eucalyptus grandis]
Length=801

 Score =   362 bits (929),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQ+SLGHCVLKA+FPKGRKELAVS FQTVVLMLFN+A+K SFQDI+++ GIEDKELRR
Sbjct  609  LMWQSSLGHCVLKADFPKGRKELAVSLFQTVVLMLFNDAQKLSFQDIRDSTGIEDKELRR  668

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVEDDD+F FN+ F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  669  TLQSLACGKVRVLQKVPKGRDVEDDDSFEFNEAFSAPLYRIKVNAIQMKETVEENTSTTE  728

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  729  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  788

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  789  RDKNNPQIYNYLA  801



>gb|KJB69827.1| hypothetical protein B456_011G044900 [Gossypium raimondii]
Length=821

 Score =   362 bits (930),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+F KG+KELAVS FQTVVLMLFN+A+K SFQDIK++ GIEDKELRR
Sbjct  629  LMWQNSLGHCVLKADFSKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKDSTGIEDKELRR  688

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVEDDD+F+FN+ FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  689  TLQSLACGKVRVLQKLPKGRDVEDDDSFIFNEGFTAPLYRIKVNAIQMKETVEENTSTTE  748

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELF+QLKFPIKPADLKKRIESLIDREY E
Sbjct  749  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFEQLKFPIKPADLKKRIESLIDREYLE  808

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  809  RDKNNPQIYNYLA  821



>ref|XP_010110959.1| hypothetical protein L484_021653 [Morus notabilis]
 gb|EXC29345.1| hypothetical protein L484_021653 [Morus notabilis]
Length=862

 Score =   363 bits (932),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+AE+ SF+DIK++ GIEDKELRR
Sbjct  670  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAERLSFEDIKDSTGIEDKELRR  729

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVED+D FVFN+ F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  730  TLQSLACGKVRVLQKLPKGRDVEDNDAFVFNEAFSAPLYRIKVNAIQMKETVEENTSTTE  789

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  790  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  849

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  850  RDKNNPQIYNYLA  862



>ref|XP_010056896.1| PREDICTED: cullin-4 [Eucalyptus grandis]
Length=838

 Score =   362 bits (930),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQ+SLGHCVLKA+FPKGRKELAVS FQTVVLMLFN+A+K SFQDI+++ GIEDKELRR
Sbjct  646  LMWQSSLGHCVLKADFPKGRKELAVSLFQTVVLMLFNDAQKLSFQDIRDSTGIEDKELRR  705

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVEDDD+F FN+ F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  706  TLQSLACGKVRVLQKVPKGRDVEDDDSFEFNEAFSAPLYRIKVNAIQMKETVEENTSTTE  765

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  766  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  825

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  826  RDKNNPQIYNYLA  838



>ref|XP_009398338.1| PREDICTED: cullin-4-like [Musa acuminata subsp. malaccensis]
Length=842

 Score =   362 bits (930),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KEL+VS FQTVVLMLFN+ +K SFQDIK++ GI+DKELRR
Sbjct  650  LMWQNSLGHCVLKAEFPKGKKELSVSLFQTVVLMLFNDTQKLSFQDIKDSTGIDDKELRR  709

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQKIPKGR++EDDD+FVFN++F+APLYR+KVNAIQMKETVEENTSTTE
Sbjct  710  TLQSLACGKVRVLQKIPKGREIEDDDSFVFNEEFSAPLYRLKVNAIQMKETVEENTSTTE  769

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  770  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  829

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  830  RDKNNPQIYNYLA  842



>gb|EEC76292.1| hypothetical protein OsI_13805 [Oryza sativa Indica Group]
Length=744

 Score =   359 bits (921),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQ+VVLMLFN+A+K SF DIKE+ GIEDKELRR
Sbjct  552  LMWQNSLGHCVLKAEFPKGKKELAVSLFQSVVLMLFNDAQKLSFLDIKESTGIEDKELRR  611

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVED D FVFN++F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  612  TLQSLACGKVRVLQKMPKGRDVEDKDEFVFNEEFSAPLYRIKVNAIQMKETVEENTSTTE  671

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRK  SHTLLI ELFQQLKFPIKP+D+KKRIESLIDREY E
Sbjct  672  RVFQDRQYQVDAAIVRIMKTRKTLSHTLLITELFQQLKFPIKPSDIKKRIESLIDREYLE  731

Query  176  RDKSNPQIYNYLA  138
            RD+SNPQIYNYLA
Sbjct  732  RDRSNPQIYNYLA  744



>ref|XP_010923713.1| PREDICTED: cullin-4-like isoform X2 [Elaeis guineensis]
Length=845

 Score =   362 bits (928),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLG CVLKAEFPKG+KELAVS FQTVVLMLFN+ +K SFQDIK++ GI+DKELRR
Sbjct  653  LMWQNSLGQCVLKAEFPKGKKELAVSLFQTVVLMLFNDTQKLSFQDIKDSTGIDDKELRR  712

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQKIPKGR+VEDDD+FVFN++F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  713  TLQSLACGKVRVLQKIPKGREVEDDDSFVFNEEFSAPLYRIKVNAIQMKETVEENTSTTE  772

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  773  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  832

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  833  RDKNNPQIYNYLA  845



>gb|KHG21020.1| Cullin-4 -like protein [Gossypium arboreum]
Length=786

 Score =   360 bits (923),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+F KG+KELAVS FQTVVLMLFN+AEK SFQDIK++  IEDKELRR
Sbjct  594  LMWQNSLGHCVLKADFTKGKKELAVSLFQTVVLMLFNDAEKLSFQDIKDSTAIEDKELRR  653

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGR+VEDDD+FVFN+ F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  654  TLQSLACGKVRVLQKLPKGREVEDDDSFVFNEGFSAPLYRIKVNAIQMKETVEENTSTTE  713

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  714  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  773

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  774  RDKNNPQIYNYLA  786



>gb|KJB68318.1| hypothetical protein B456_010G238300 [Gossypium raimondii]
Length=786

 Score =   359 bits (922),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+F KG+KELAVS FQTVVLMLFN+AEK SFQDIK++  IEDKELRR
Sbjct  594  LMWQNSLGHCVLKADFTKGKKELAVSLFQTVVLMLFNDAEKLSFQDIKDSTAIEDKELRR  653

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGR+VEDDD+FVFN+ F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  654  TLQSLACGKVRVLQKLPKGREVEDDDSFVFNEGFSAPLYRIKVNAIQMKETVEENTSTTE  713

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  714  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  773

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  774  RDKNNPQIYNYLA  786



>gb|KCW73811.1| hypothetical protein EUGRSUZ_E02414 [Eucalyptus grandis]
Length=801

 Score =   360 bits (923),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQ+SLGHCVLKA+FPKGRKELAVS FQ +VLMLFN+A+K SFQDI+++ GIEDKELRR
Sbjct  609  LMWQSSLGHCVLKADFPKGRKELAVSLFQAIVLMLFNDAQKLSFQDIRDSTGIEDKELRR  668

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVEDDD+F FN+ F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  669  TLQSLACGKVRVLQKVPKGRDVEDDDSFEFNEAFSAPLYRIKVNAIQMKETVEENTSTTE  728

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  729  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  788

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  789  RDKNNPQIYNYLA  801



>ref|XP_008809585.1| PREDICTED: cullin-4-like [Phoenix dactylifera]
 ref|XP_008809586.1| PREDICTED: cullin-4-like [Phoenix dactylifera]
Length=841

 Score =   360 bits (925),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLG CVLKAEFPKG+KELAVS FQTVVLMLFN+ +K SFQDIK++ GI+DKELRR
Sbjct  649  LMWQNSLGQCVLKAEFPKGKKELAVSLFQTVVLMLFNDTQKLSFQDIKDSTGIDDKELRR  708

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQKIPKGR+VEDDD FVFN++F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  709  TLQSLACGKVRVLQKIPKGREVEDDDAFVFNEEFSAPLYRIKVNAIQMKETVEENTSTTE  768

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  769  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  828

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  829  RDKNNPQIYNYLA  841



>ref|XP_009360892.1| PREDICTED: cullin-4 [Pyrus x bretschneideri]
Length=831

 Score =   360 bits (924),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+FPKG+KELAVS FQTVVLMLFN+AEK S +DIK++ GIEDKELRR
Sbjct  639  LMWQNSLGHCVLKADFPKGKKELAVSLFQTVVLMLFNDAEKLSLEDIKDSTGIEDKELRR  698

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK PKGRDV+D DTF FND F APLYRIKVNAIQMKETVEENTSTTE
Sbjct  699  TLQSLACGKVRVLQKFPKGRDVDDGDTFTFNDTFIAPLYRIKVNAIQMKETVEENTSTTE  758

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  759  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  818

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  819  RDKNNPQIYNYLA  831



>ref|XP_004981510.1| PREDICTED: cullin-4-like isoform X2 [Setaria italica]
Length=831

 Score =   360 bits (923),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+FPKG+KELAVS FQ+VVLMLFN+A+K SF DIK++ GIEDKELRR
Sbjct  639  LMWQNSLGHCVLKADFPKGKKELAVSLFQSVVLMLFNDAQKLSFLDIKDSTGIEDKELRR  698

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQKIPKGRDVED D FVFN++F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  699  TLQSLACGKVRVLQKIPKGRDVEDKDEFVFNEEFSAPLYRIKVNAIQMKETVEENTSTTE  758

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLIAEL+QQLKFP+KPAD+KKRIESLIDREY E
Sbjct  759  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELYQQLKFPVKPADIKKRIESLIDREYLE  818

Query  176  RDKSNPQIYNYLA  138
            RD+SNPQIYNYLA
Sbjct  819  RDRSNPQIYNYLA  831



>gb|EEE60060.1| hypothetical protein OsJ_12866 [Oryza sativa Japonica Group]
Length=804

 Score =   359 bits (922),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQ+VVLMLFN+A+K SF DIKE+ GIEDKELRR
Sbjct  612  LMWQNSLGHCVLKAEFPKGKKELAVSLFQSVVLMLFNDAQKLSFLDIKESTGIEDKELRR  671

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVED D FVFN++F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  672  TLQSLACGKVRVLQKMPKGRDVEDKDEFVFNEEFSAPLYRIKVNAIQMKETVEENTSTTE  731

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRK  SHTLLI ELFQQLKFPIKP+D+KKRIESLIDREY E
Sbjct  732  RVFQDRQYQVDAAIVRIMKTRKTLSHTLLITELFQQLKFPIKPSDIKKRIESLIDREYLE  791

Query  176  RDKSNPQIYNYLA  138
            RD+SNPQIYNYLA
Sbjct  792  RDRSNPQIYNYLA  804



>ref|XP_006449701.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
 gb|ESR62941.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
Length=662

 Score =   355 bits (911),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+A+K SFQDIK+A GIEDKELRR
Sbjct  470  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKDATGIEDKELRR  529

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDV+DDD+FVFN+ FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  530  TLQSLACGKVRVLQKLPKGRDVDDDDSFVFNEGFTAPLYRIKVNAIQMKETVEENTSTTE  589

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  590  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  649

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  650  RDKNNPQIYNYLA  662



>ref|XP_004233125.1| PREDICTED: cullin-4 [Solanum lycopersicum]
Length=802

 Score =   358 bits (920),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQ VVLMLFN+AEK SF D+ EA  IEDKELRR
Sbjct  610  LMWQNSLGHCVLKAEFPKGKKELAVSLFQAVVLMLFNDAEKLSFLDMMEATRIEDKELRR  669

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQKIPKGRDVED+DTFVFNDQFT PLYRIKVNAIQMKETVEENT+TTE
Sbjct  670  TLQSLACGKVRVLQKIPKGRDVEDNDTFVFNDQFTTPLYRIKVNAIQMKETVEENTNTTE  729

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFP+KPADLKKRIESLI+REY E
Sbjct  730  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPVKPADLKKRIESLIEREYLE  789

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQ+YNYLA
Sbjct  790  RDKNNPQVYNYLA  802



>gb|AAT75245.1| putative cullin protein [Oryza sativa Japonica Group]
Length=813

 Score =   359 bits (921),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQ+VVLMLFN+A+K SF DIKE+ GIEDKELRR
Sbjct  621  LMWQNSLGHCVLKAEFPKGKKELAVSLFQSVVLMLFNDAQKLSFLDIKESTGIEDKELRR  680

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVED D FVFN++F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  681  TLQSLACGKVRVLQKMPKGRDVEDKDEFVFNEEFSAPLYRIKVNAIQMKETVEENTSTTE  740

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRK  SHTLLI ELFQQLKFPIKP+D+KKRIESLIDREY E
Sbjct  741  RVFQDRQYQVDAAIVRIMKTRKTLSHTLLITELFQQLKFPIKPSDIKKRIESLIDREYLE  800

Query  176  RDKSNPQIYNYLA  138
            RD+SNPQIYNYLA
Sbjct  801  RDRSNPQIYNYLA  813



>ref|XP_006650698.1| PREDICTED: cullin-4-like [Oryza brachyantha]
Length=829

 Score =   359 bits (921),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQ+VVLMLFN+A+K SF DIKE+ GIEDKELRR
Sbjct  637  LMWQNSLGHCVLKAEFPKGKKELAVSLFQSVVLMLFNDAQKLSFLDIKESTGIEDKELRR  696

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVED D FVFN++F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  697  TLQSLACGKVRVLQKMPKGRDVEDKDEFVFNEEFSAPLYRIKVNAIQMKETVEENTSTTE  756

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRK  SHTLLI ELFQQLKFPIKP+D+KKRIESLIDREY E
Sbjct  757  RVFQDRQYQVDAAIVRIMKTRKTLSHTLLITELFQQLKFPIKPSDIKKRIESLIDREYLE  816

Query  176  RDKSNPQIYNYLA  138
            RD+SNPQIYNYLA
Sbjct  817  RDRSNPQIYNYLA  829



>ref|XP_010518764.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4-like [Tarenaya hassleriana]
Length=788

 Score =   358 bits (918),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+FPKG+KELAVS FQ VVLMLFN+A K SFQDIK++  IEDKELRR
Sbjct  596  LMWQNSLGHCVLKADFPKGKKELAVSLFQAVVLMLFNDAHKLSFQDIKDSTSIEDKELRR  655

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVL K+PKGRDVED D FVFND FTAPL+RIKVNAIQMKETVEENTSTTE
Sbjct  656  TLQSLACGKVRVLSKVPKGRDVEDGDEFVFNDGFTAPLFRIKVNAIQMKETVEENTSTTE  715

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  716  RVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  775

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  776  RDKTNPQIYNYLA  788



>gb|ABF99238.1| Cullin-4B, putative, expressed [Oryza sativa Japonica Group]
Length=836

 Score =   358 bits (920),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQ+VVLMLFN+A+K SF DIKE+ GIEDKELRR
Sbjct  644  LMWQNSLGHCVLKAEFPKGKKELAVSLFQSVVLMLFNDAQKLSFLDIKESTGIEDKELRR  703

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVED D FVFN++F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  704  TLQSLACGKVRVLQKMPKGRDVEDKDEFVFNEEFSAPLYRIKVNAIQMKETVEENTSTTE  763

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRK  SHTLLI ELFQQLKFPIKP+D+KKRIESLIDREY E
Sbjct  764  RVFQDRQYQVDAAIVRIMKTRKTLSHTLLITELFQQLKFPIKPSDIKKRIESLIDREYLE  823

Query  176  RDKSNPQIYNYLA  138
            RD+SNPQIYNYLA
Sbjct  824  RDRSNPQIYNYLA  836



>ref|XP_008644442.1| PREDICTED: cullin-4 [Zea mays]
 gb|AFW67428.1| hypothetical protein ZEAMMB73_322823 [Zea mays]
Length=831

 Score =   358 bits (919),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+FPKG+KELAVS FQ+VVLMLFN+A+K SF DIK++ GIEDKELRR
Sbjct  639  LMWQNSLGHCVLKADFPKGKKELAVSLFQSVVLMLFNDAQKLSFIDIKDSTGIEDKELRR  698

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQKIPKGRDVED D FVFN+ F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  699  TLQSLACGKVRVLQKIPKGRDVEDKDEFVFNEDFSAPLYRIKVNAIQMKETVEENTSTTE  758

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI EL+QQLKFP+KPAD+KKRIESLIDREY E
Sbjct  759  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELYQQLKFPVKPADIKKRIESLIDREYLE  818

Query  176  RDKSNPQIYNYLA  138
            RD+SNPQIYNYLA
Sbjct  819  RDRSNPQIYNYLA  831



>ref|XP_002466340.1| hypothetical protein SORBIDRAFT_01g005920 [Sorghum bicolor]
 gb|EER93338.1| hypothetical protein SORBIDRAFT_01g005920 [Sorghum bicolor]
Length=834

 Score =   358 bits (918),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+FPKG+KELAVS FQ+VVLMLFN+A+K SF DIK++ GIEDKELRR
Sbjct  642  LMWQNSLGHCVLKADFPKGKKELAVSLFQSVVLMLFNDAQKLSFLDIKDSTGIEDKELRR  701

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQKIPKGRDVED D FVFN+ F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  702  TLQSLACGKVRVLQKIPKGRDVEDKDEFVFNEDFSAPLYRIKVNAIQMKETVEENTSTTE  761

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI EL+QQLKFP+KPAD+KKRIESLIDREY E
Sbjct  762  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELYQQLKFPVKPADIKKRIESLIDREYLE  821

Query  176  RDKSNPQIYNYLA  138
            RD+SNPQIYNYLA
Sbjct  822  RDRSNPQIYNYLA  834



>gb|EMT18857.1| Cullin-4B [Aegilops tauschii]
Length=758

 Score =   356 bits (913),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLK EFPKGRKELAVS FQ+VVLMLFN+A+K SF DIKE+ GIEDKELRR
Sbjct  566  LMWQNSLGHCVLKVEFPKGRKELAVSLFQSVVLMLFNDAQKLSFVDIKESTGIEDKELRR  625

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK PKGRD++D D FVFN+ F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  626  TLQSLACGKVRVLQKTPKGRDIDDKDEFVFNEDFSAPLYRIKVNAIQMKETVEENTSTTE  685

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRK  SHTLLI ELFQQLKFPIKPAD+KKRIESLIDREY E
Sbjct  686  RVFQDRQYQVDAAIVRIMKTRKTLSHTLLITELFQQLKFPIKPADMKKRIESLIDREYLE  745

Query  176  RDKSNPQIYNYLA  138
            RD+SNPQIYNYLA
Sbjct  746  RDRSNPQIYNYLA  758



>ref|XP_003558082.1| PREDICTED: cullin-4 [Brachypodium distachyon]
Length=830

 Score =   357 bits (915),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLK EFPKGRKEL+VS FQ+VVLMLFN+A+K SF DIK++ GIEDKELRR
Sbjct  638  LMWQNSLGHCVLKVEFPKGRKELSVSLFQSVVLMLFNDAQKLSFLDIKDSTGIEDKELRR  697

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK PKGRDV+D D FVFND+F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  698  TLQSLACGKVRVLQKTPKGRDVDDKDEFVFNDEFSAPLYRIKVNAIQMKETVEENTSTTE  757

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRK  SHTLLI ELFQQLKFPIKPAD+KKRIESLIDREY E
Sbjct  758  RVFQDRQYQVDAAIVRIMKTRKTLSHTLLITELFQQLKFPIKPADMKKRIESLIDREYLE  817

Query  176  RDKSNPQIYNYLA  138
            RD+SNPQIYNYLA
Sbjct  818  RDRSNPQIYNYLA  830



>dbj|BAK02870.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=832

 Score =   356 bits (913),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLK EFPKGRKELAVS FQ+VVLMLFN+A+K SF DIKE+ GIEDKELRR
Sbjct  640  LMWQNSLGHCVLKVEFPKGRKELAVSLFQSVVLMLFNDAQKLSFVDIKESTGIEDKELRR  699

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK PKGRD++D D FVFN+ F+APLYRIKVNAIQMKETVEENTSTTE
Sbjct  700  TLQSLACGKVRVLQKTPKGRDIDDKDEFVFNEDFSAPLYRIKVNAIQMKETVEENTSTTE  759

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRK  SHTLLI ELFQQLKFPIKPAD+KKRIESLIDREY E
Sbjct  760  RVFQDRQYQVDAAIVRIMKTRKTLSHTLLITELFQQLKFPIKPADMKKRIESLIDREYLE  819

Query  176  RDKSNPQIYNYLA  138
            RD+SNPQIYNYLA
Sbjct  820  RDRSNPQIYNYLA  832



>ref|XP_006449702.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
 gb|ESR62942.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
Length=804

 Score =   355 bits (910),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+A+K SFQDIK+A GIEDKELRR
Sbjct  612  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKDATGIEDKELRR  671

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDV+DDD+FVFN+ FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  672  TLQSLACGKVRVLQKLPKGRDVDDDDSFVFNEGFTAPLYRIKVNAIQMKETVEENTSTTE  731

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  732  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  791

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  792  RDKNNPQIYNYLA  804



>emb|CDX77644.1| BnaC07g18980D [Brassica napus]
Length=767

 Score =   353 bits (905),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+F KG+KELAVS FQ VVLMLFN+A K SF+DIK++ GIEDKELRR
Sbjct  575  LMWQNSLGHCVLKADFSKGKKELAVSLFQAVVLMLFNDAMKLSFEDIKDSTGIEDKELRR  634

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK PKGRDV+D D F FND FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  635  TLQSLACGKVRVLQKYPKGRDVQDGDEFDFNDTFTAPLYRIKVNAIQMKETVEENTSTTE  694

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAI+RIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  695  RVFQDRQYQIDAAIIRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  754

Query  176  RDKSNPQIYNYLA  138
            RDKSNPQIYNYLA
Sbjct  755  RDKSNPQIYNYLA  767



>emb|CDY33461.1| BnaA06g36120D [Brassica napus]
Length=761

 Score =   352 bits (904),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA F KG+KELAVS FQ VVLMLFN+A K SF+DIK++ GIEDKELRR
Sbjct  569  LMWQNSLGHCVLKAGFSKGKKELAVSLFQAVVLMLFNDAMKLSFEDIKDSTGIEDKELRR  628

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK PKGRDV+D D F FND FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  629  TLQSLACGKVRVLQKYPKGRDVQDGDEFDFNDTFTAPLYRIKVNAIQMKETVEENTSTTE  688

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  689  RVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  748

Query  176  RDKSNPQIYNYLA  138
            RDKSNPQIYNYLA
Sbjct  749  RDKSNPQIYNYLA  761



>ref|XP_004486019.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4-like [Cicer arietinum]
Length=787

 Score =   353 bits (905),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+FPKG+KELAVS FQTVVLMLFN+AEK SFQD+K++ GIEDKELRR
Sbjct  595  LMWQNSLGHCVLKADFPKGKKELAVSLFQTVVLMLFNDAEKLSFQDMKDSTGIEDKELRR  654

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDV+DDD+FVFND FTAPLYRIKVNAIQ+KETVEENTSTTE
Sbjct  655  TLQSLACGKVRVLQKMPKGRDVDDDDSFVFNDTFTAPLYRIKVNAIQLKETVEENTSTTE  714

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  715  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  774

Query  176  RDKSNPQIYNYLA  138
            RDK NPQ+YNYLA
Sbjct  775  RDKGNPQVYNYLA  787



>ref|XP_009101534.1| PREDICTED: cullin-4-like [Brassica rapa]
Length=783

 Score =   352 bits (904),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA F KG+KELAVS FQ VVLMLFN+A K SF+DIK++ GIEDKELRR
Sbjct  591  LMWQNSLGHCVLKAGFSKGKKELAVSLFQAVVLMLFNDAMKLSFEDIKDSTGIEDKELRR  650

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK PKGRDV+D D F FND FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  651  TLQSLACGKVRVLQKYPKGRDVQDRDEFDFNDTFTAPLYRIKVNAIQMKETVEENTSTTE  710

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  711  RVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  770

Query  176  RDKSNPQIYNYLA  138
            RDKSNPQIYNYLA
Sbjct  771  RDKSNPQIYNYLA  783



>ref|XP_006398308.1| hypothetical protein EUTSA_v10000782mg [Eutrema salsugineum]
 gb|ESQ39761.1| hypothetical protein EUTSA_v10000782mg [Eutrema salsugineum]
Length=793

 Score =   352 bits (904),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+F KG+KELAVS FQ VVLMLFN+A K SF+DIK++ GIEDKELRR
Sbjct  601  LMWQNSLGHCVLKADFSKGKKELAVSLFQAVVLMLFNDAMKLSFEDIKDSTGIEDKELRR  660

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK PKGRDV+D D F FND FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  661  TLQSLACGKVRVLQKYPKGRDVQDGDEFDFNDTFTAPLYRIKVNAIQMKETVEENTSTTE  720

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  721  RVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  780

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  781  RDKNNPQIYNYLA  793



>ref|XP_009114369.1| PREDICTED: cullin-4-like [Brassica rapa]
Length=786

 Score =   352 bits (902),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+F KG+KELAVS FQ VVLMLFN+A K SF+DIK++ GIEDKELRR
Sbjct  594  LMWQNSLGHCVLKADFSKGKKELAVSLFQAVVLMLFNDAMKLSFEDIKDSTGIEDKELRR  653

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK PKGRDV+D D F FND FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  654  TLQSLACGKVRVLQKYPKGRDVQDGDEFDFNDTFTAPLYRIKVNAIQMKETVEENTSTTE  713

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  714  RVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  773

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  774  RDKTNPQIYNYLA  786



>emb|CDY35152.1| BnaA09g17890D [Brassica napus]
Length=786

 Score =   352 bits (902),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+F KG+KELAVS FQ VVLMLFN+A K SF+DIK++ GIEDKELRR
Sbjct  594  LMWQNSLGHCVLKADFSKGKKELAVSLFQAVVLMLFNDAMKLSFEDIKDSTGIEDKELRR  653

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK PKGRDV+D D F FND FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  654  TLQSLACGKVRVLQKYPKGRDVQDGDEFDFNDTFTAPLYRIKVNAIQMKETVEENTSTTE  713

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  714  RVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  773

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  774  RDKTNPQIYNYLA  786



>emb|CDY03235.1| BnaC09g19210D [Brassica napus]
Length=790

 Score =   352 bits (902),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+F KG+KELAVS FQ VVLMLFN+A K SF+DIK++ GIEDKELRR
Sbjct  598  LMWQNSLGHCVLKADFSKGKKELAVSLFQAVVLMLFNDAMKLSFEDIKDSTGIEDKELRR  657

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK PKGRDV+D D F FND FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  658  TLQSLACGKVRVLQKYPKGRDVQDGDEFDFNDTFTAPLYRIKVNAIQMKETVEENTSTTE  717

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  718  RVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  777

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  778  RDKTNPQIYNYLA  790



>gb|KFK31486.1| cullin [Arabis alpina]
Length=793

 Score =   351 bits (901),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLK +F KG+KELAVS FQ VVLMLFN+A K SF+DIK++ GIEDKELRR
Sbjct  601  LMWQNSLGHCVLKTDFSKGKKELAVSLFQAVVLMLFNDATKLSFEDIKDSTGIEDKELRR  660

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK+RVLQK PKGRDV+D D F FND FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  661  TLQSLACGKIRVLQKYPKGRDVQDGDEFDFNDSFTAPLYRIKVNAIQMKETVEENTSTTE  720

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  721  RVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  780

Query  176  RDKSNPQIYNYLA  138
            RDKSNPQIYNYLA
Sbjct  781  RDKSNPQIYNYLA  793



>ref|XP_002984123.1| ubiquitin-protein ligase, cullin 4 [Selaginella moellendorffii]
 gb|EFJ14633.1| ubiquitin-protein ligase, cullin 4 [Selaginella moellendorffii]
Length=766

 Score =   350 bits (899),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG++EL+VS FQTVVLMLFN++ + SFQDIK++ GIEDKELRR
Sbjct  574  LMWQNSLGHCVLKAEFPKGKRELSVSLFQTVVLMLFNDSLRLSFQDIKDSTGIEDKELRR  633

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVR+LQK PKGR+VEDDD F FN+ FTAPL+RIKVNAIQ+KETVEEN STTE
Sbjct  634  TLQSLACGKVRILQKQPKGREVEDDDVFTFNEDFTAPLFRIKVNAIQLKETVEENASTTE  693

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  694  RVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  753

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQ+YNYLA
Sbjct  754  RDKNNPQVYNYLA  766



>ref|XP_002972211.1| ubiquitin-protein ligase, Cullin 4 [Selaginella moellendorffii]
 gb|EFJ26297.1| ubiquitin-protein ligase, Cullin 4 [Selaginella moellendorffii]
Length=766

 Score =   350 bits (899),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG++EL+VS FQTVVLMLFN++ + SFQDIK++ GIEDKELRR
Sbjct  574  LMWQNSLGHCVLKAEFPKGKRELSVSLFQTVVLMLFNDSLRLSFQDIKDSTGIEDKELRR  633

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVR+LQK PKGR+VEDDD F FN+ FTAPL+RIKVNAIQ+KETVEEN STTE
Sbjct  634  TLQSLACGKVRILQKQPKGREVEDDDVFTFNEDFTAPLFRIKVNAIQLKETVEENASTTE  693

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  694  RVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  753

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQ+YNYLA
Sbjct  754  RDKNNPQVYNYLA  766



>emb|CAN75926.1| hypothetical protein VITISV_010491 [Vitis vinifera]
Length=806

 Score =   351 bits (900),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 172/198 (87%), Positives = 184/198 (93%), Gaps = 6/198 (3%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+A+K SFQDIK++ GIEDKELRR
Sbjct  610  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKDSTGIEDKELRR  669

Query  536  TLQSXACGKVRVLQKIPKG-----RDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEEN  372
            TLQS ACGKVRVLQK+ +G     R+VEDDD+F+FN+ FTAPLYRIKVNAIQMKETVEEN
Sbjct  670  TLQSLACGKVRVLQKV-RGYGRNWREVEDDDSFMFNEGFTAPLYRIKVNAIQMKETVEEN  728

Query  371  TSTTERVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLID  192
            TSTTERVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLID
Sbjct  729  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLID  788

Query  191  REYXERDKSNPQIYNYLA  138
            REY ERDK+NPQIYNYLA
Sbjct  789  REYLERDKNNPQIYNYLA  806



>ref|XP_008787803.1| PREDICTED: cullin-4-like isoform X1 [Phoenix dactylifera]
Length=871

 Score =   352 bits (903),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 174/218 (80%), Positives = 185/218 (85%), Gaps = 25/218 (11%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+A+K SFQDIK++ GI+DKELRR
Sbjct  654  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKDSTGIDDKELRR  713

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIK------------------  411
            TLQS ACGKVRVLQKIPKGR+VEDDDTFVFN++FTAPLYRIK                  
Sbjct  714  TLQSLACGKVRVLQKIPKGREVEDDDTFVFNEEFTAPLYRIKVSSPLFKSVLWNFKRAAR  773

Query  410  -------VNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQ  252
                   VNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRK+ SHTLLI ELFQ
Sbjct  774  ANISCYQVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKILSHTLLITELFQ  833

Query  251  QLKFPIKPADLKKRIESLIDREYXERDKSNPQIYNYLA  138
            QLKFPIKPADLKKRIESLIDREY ERDK+N QIYNYLA
Sbjct  834  QLKFPIKPADLKKRIESLIDREYLERDKNNSQIYNYLA  871



>emb|CAC85265.1| cullin 4 [Arabidopsis thaliana]
Length=742

 Score =   348 bits (894),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+F KG+KELAVS FQ VVLMLFN+A K SF+DIK++  IEDKELRR
Sbjct  550  LMWQNSLGHCVLKADFSKGKKELAVSLFQAVVLMLFNDAMKLSFEDIKDSTSIEDKELRR  609

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK PKGRDVED D F FND+F APLYRIKVNAIQMKETVEENTSTTE
Sbjct  610  TLQSLACGKVRVLQKNPKGRDVEDGDEFEFNDEFAAPLYRIKVNAIQMKETVEENTSTTE  669

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  670  RVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  729

Query  176  RDKSNPQIYNYLA  138
            R+KSNPQIYNYLA
Sbjct  730  REKSNPQIYNYLA  742



>ref|XP_009408525.1| PREDICTED: cullin-4-like [Musa acuminata subsp. malaccensis]
Length=847

 Score =   350 bits (898),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQ+SLGHCVLKAEFP+G+KEL+VS FQ VVLMLFN+ ++ S QDIK++ GI+D+ELRR
Sbjct  655  LMWQSSLGHCVLKAEFPRGKKELSVSLFQAVVLMLFNDTQRLSLQDIKDSTGIDDRELRR  714

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQKIPKGR++ED+D+FVFN++FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  715  TLQSLACGKVRVLQKIPKGREIEDEDSFVFNEEFTAPLYRIKVNAIQMKETVEENTSTTE  774

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKP DLKKRIESLIDREY +
Sbjct  775  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPVDLKKRIESLIDREYLD  834

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  835  RDKNNPQIYNYLA  847



>ref|NP_568658.1| cullin4 [Arabidopsis thaliana]
 sp|Q8LGH4.1|CUL4_ARATH RecName: Full=Cullin-4; Short=AtCUL4 [Arabidopsis thaliana]
 gb|AAM60859.1| cullin [Arabidopsis thaliana]
 gb|AED95353.1| cullin4 [Arabidopsis thaliana]
Length=792

 Score =   348 bits (894),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+F KG+KELAVS FQ VVLMLFN+A K SF+DIK++  IEDKELRR
Sbjct  600  LMWQNSLGHCVLKADFSKGKKELAVSLFQAVVLMLFNDAMKLSFEDIKDSTSIEDKELRR  659

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK PKGRDVED D F FND+F APLYRIKVNAIQMKETVEENTSTTE
Sbjct  660  TLQSLACGKVRVLQKNPKGRDVEDGDEFEFNDEFAAPLYRIKVNAIQMKETVEENTSTTE  719

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  720  RVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  779

Query  176  RDKSNPQIYNYLA  138
            R+KSNPQIYNYLA
Sbjct  780  REKSNPQIYNYLA  792



>gb|AAM14063.1| putative cullin [Arabidopsis thaliana]
Length=792

 Score =   348 bits (894),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+F KG+KELAVS FQ VVLMLFN+A K SF+DIK++  IEDKELRR
Sbjct  600  LMWQNSLGHCVLKADFSKGKKELAVSLFQAVVLMLFNDAMKLSFEDIKDSTSIEDKELRR  659

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK PKGRDVED D F FND+F APLYRIKVNAIQMKETVEENTSTTE
Sbjct  660  TLQSLACGKVRVLQKNPKGRDVEDGDEFEFNDEFAAPLYRIKVNAIQMKETVEENTSTTE  719

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  720  RVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  779

Query  176  RDKSNPQIYNYLA  138
            R+KSNPQIYNYLA
Sbjct  780  REKSNPQIYNYLA  792



>emb|CDX87735.1| BnaC02g32140D [Brassica napus]
Length=780

 Score =   348 bits (892),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+F K +KELAVS FQ VVLMLFN+A K SF+DIK++ GIEDKELRR
Sbjct  588  LMWQNSLGHCVLKADFTKAKKELAVSLFQAVVLMLFNDAMKLSFEDIKDSTGIEDKELRR  647

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVR+L K PKGRDV+D D F FND FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  648  TLQSLACGKVRILHKYPKGRDVQDGDEFDFNDTFTAPLYRIKVNAIQMKETVEENTSTTE  707

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  708  RVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  767

Query  176  RDKSNPQIYNYLA  138
            RDKSNPQIYNYLA
Sbjct  768  RDKSNPQIYNYLA  780



>emb|CDY43957.1| BnaA02g24350D [Brassica napus]
Length=776

 Score =   347 bits (891),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+F K +KELAVS FQ VVLMLFN+A K SF+DIK++ GIEDKELRR
Sbjct  584  LMWQNSLGHCVLKADFTKAKKELAVSLFQAVVLMLFNDAMKLSFEDIKDSTGIEDKELRR  643

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVR+L K PKGRDV+D D F FND FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  644  TLQSLACGKVRILHKYPKGRDVQDGDEFDFNDTFTAPLYRIKVNAIQMKETVEENTSTTE  703

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  704  RVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  763

Query  176  RDKSNPQIYNYLA  138
            RDKSNPQIYNYLA
Sbjct  764  RDKSNPQIYNYLA  776



>ref|XP_009128848.1| PREDICTED: cullin-4 [Brassica rapa]
Length=785

 Score =   347 bits (891),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+F K +KELAVS FQ VVLMLFN+A K SF+DIK++ GIEDKELRR
Sbjct  593  LMWQNSLGHCVLKADFTKAKKELAVSLFQAVVLMLFNDAMKLSFEDIKDSTGIEDKELRR  652

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVR+L K PKGRDV+D D F FND FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  653  TLQSLACGKVRILHKYPKGRDVQDGDEFDFNDTFTAPLYRIKVNAIQMKETVEENTSTTE  712

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  713  RVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  772

Query  176  RDKSNPQIYNYLA  138
            RDKSNPQIYNYLA
Sbjct  773  RDKSNPQIYNYLA  785



>ref|XP_002863417.1| hypothetical protein ARALYDRAFT_916814 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39676.1| hypothetical protein ARALYDRAFT_916814 [Arabidopsis lyrata subsp. 
lyrata]
Length=791

 Score =   346 bits (888),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+F +G+KELAVS FQ VVLMLFN+A K SF+DIK++  IEDKELRR
Sbjct  599  LMWQNSLGHCVLKADFSRGKKELAVSLFQAVVLMLFNDAMKLSFEDIKDSTSIEDKELRR  658

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK PKGRDVED D F FND F APLYRIKVNAIQMKETVEENTSTTE
Sbjct  659  TLQSLACGKVRVLQKNPKGRDVEDGDEFEFNDDFAAPLYRIKVNAIQMKETVEENTSTTE  718

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  719  RVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  778

Query  176  RDKSNPQIYNYLA  138
            R+KSNPQIYNYLA
Sbjct  779  REKSNPQIYNYLA  791



>ref|XP_006281916.1| hypothetical protein CARUB_v10028121mg [Capsella rubella]
 gb|EOA14814.1| hypothetical protein CARUB_v10028121mg [Capsella rubella]
Length=791

 Score =   346 bits (888),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+F KG+KELAVS FQ VVLMLFN+A K SF+DIK++  IEDKELRR
Sbjct  599  LMWQNSLGHCVLKADFSKGKKELAVSLFQAVVLMLFNDAMKLSFEDIKDSTSIEDKELRR  658

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK PKGRDV+D D F FND F APLYRIKVNAIQMKETVEENTSTTE
Sbjct  659  TLQSLACGKVRVLQKHPKGRDVDDGDEFEFNDDFAAPLYRIKVNAIQMKETVEENTSTTE  718

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  719  RVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  778

Query  176  RDKSNPQIYNYLA  138
            R+KSNPQIYNYLA
Sbjct  779  REKSNPQIYNYLA  791



>ref|XP_001776334.1| predicted protein [Physcomitrella patens]
 gb|EDQ58833.1| predicted protein [Physcomitrella patens]
Length=768

 Score =   345 bits (885),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA FPKG+KEL+VS FQTVVLMLFN+A+  SFQ+IK+   IEDKELRR
Sbjct  576  LMWQNSLGHCVLKANFPKGKKELSVSLFQTVVLMLFNDAQSQSFQEIKDTTAIEDKELRR  635

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVL K PKGR+VEDDD FVFN+ F APL+RIKVNAIQ+KETVEENTSTTE
Sbjct  636  TLQSLACGKVRVLNKQPKGREVEDDDIFVFNEDFVAPLFRIKVNAIQLKETVEENTSTTE  695

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  696  RVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  755

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  756  RDKANPQIYNYLA  768



>ref|XP_010923712.1| PREDICTED: cullin-4-like isoform X1 [Elaeis guineensis]
Length=870

 Score =   348 bits (892),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 172/218 (79%), Positives = 184/218 (84%), Gaps = 25/218 (11%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLG CVLKAEFPKG+KELAVS FQTVVLMLFN+ +K SFQDIK++ GI+DKELRR
Sbjct  653  LMWQNSLGQCVLKAEFPKGKKELAVSLFQTVVLMLFNDTQKLSFQDIKDSTGIDDKELRR  712

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIK------------------  411
            TLQS ACGKVRVLQKIPKGR+VEDDD+FVFN++F+APLYRIK                  
Sbjct  713  TLQSLACGKVRVLQKIPKGREVEDDDSFVFNEEFSAPLYRIKVRFSLLKSVLWNFKHVTR  772

Query  410  -------VNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQ  252
                   VNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQ
Sbjct  773  ANMSCYQVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQ  832

Query  251  QLKFPIKPADLKKRIESLIDREYXERDKSNPQIYNYLA  138
            QLKFPIKPADLKKRIESLIDREY ERDK+NPQIYNYLA
Sbjct  833  QLKFPIKPADLKKRIESLIDREYLERDKNNPQIYNYLA  870



>ref|XP_006414121.1| hypothetical protein EUTSA_v10024458mg [Eutrema salsugineum]
 gb|ESQ55574.1| hypothetical protein EUTSA_v10024458mg [Eutrema salsugineum]
Length=789

 Score =   345 bits (885),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNS GHCVLKAEFPKGRKELAVS FQ VVLMLFN+A+K SF+DIK++  IEDKELRR
Sbjct  597  LMWQNSSGHCVLKAEFPKGRKELAVSLFQAVVLMLFNDAQKLSFEDIKDSTNIEDKELRR  656

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK+RVL K+PKG+DVED D FVFN+ FTA LYRIKVNAIQMKETVEEN STTE
Sbjct  657  TLQSLACGKIRVLVKVPKGKDVEDGDEFVFNEDFTASLYRIKVNAIQMKETVEENASTTE  716

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            +VF DRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  717  KVFHDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  776

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  777  RDKNNPQIYNYLA  789



>ref|XP_010529158.1| PREDICTED: cullin-4 [Tarenaya hassleriana]
Length=788

 Score =   343 bits (879),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+FPKG+KELAVS FQ VVLMLFN+A+K SFQDIK++ GIEDKELRR
Sbjct  596  LMWQNSLGHCVLKADFPKGKKELAVSLFQAVVLMLFNDAQKLSFQDIKDSTGIEDKELRR  655

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVL K+PKGRDV D D FVFN+ FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  656  TLQSLACGKVRVLLKVPKGRDVGDGDEFVFNEGFTAPLYRIKVNAIQMKETVEENTSTTE  715

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            R  Q RQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLI+R+Y E
Sbjct  716  RGRQFRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIERDYLE  775

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  776  RDKNNPQIYNYLA  788



>ref|XP_010441611.1| PREDICTED: cullin-4 [Camelina sativa]
Length=791

 Score =   342 bits (878),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+F +G+KELAVS FQ VVLMLFN+A K SF+DIK++  IEDKELRR
Sbjct  599  LMWQNSLGHCVLKADFSRGKKELAVSLFQAVVLMLFNDAMKLSFEDIKDSTSIEDKELRR  658

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVL K PKGRDV+D D F FND F APLYRIKVNAIQMKETVEENTSTTE
Sbjct  659  TLQSLACGKVRVLLKHPKGRDVDDGDEFEFNDDFAAPLYRIKVNAIQMKETVEENTSTTE  718

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  719  RVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  778

Query  176  RDKSNPQIYNYLA  138
            R+KSNPQIYNYLA
Sbjct  779  REKSNPQIYNYLA  791



>gb|KDO78190.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=792

 Score =   341 bits (875),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 173/193 (90%), Gaps = 12/193 (6%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQ             SFQDIK+A GIEDKELRR
Sbjct  612  LMWQNSLGHCVLKAEFPKGKKELAVSLFQ------------LSFQDIKDATGIEDKELRR  659

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVEDDD+FVFN+ FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  660  TLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPLYRIKVNAIQMKETVEENTSTTE  719

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  720  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  779

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  780  RDKNNPQIYNYLA  792



>ref|XP_006585082.1| PREDICTED: cullin-4-like isoform X2 [Glycine max]
Length=757

 Score =   338 bits (868),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 171/193 (89%), Gaps = 12/193 (6%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKGRKELAVS FQ             S QDIK+A GIEDKELRR
Sbjct  577  LMWQNSLGHCVLKAEFPKGRKELAVSLFQ------------LSLQDIKDATGIEDKELRR  624

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
             LQS ACGKVRVLQK+PKGRDVEDDD+FVFND FTAPLYRIKVNAIQ+KETVEENTSTTE
Sbjct  625  ILQSLACGKVRVLQKMPKGRDVEDDDSFVFNDGFTAPLYRIKVNAIQLKETVEENTSTTE  684

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAA+VRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  685  RVFQDRQYQIDAALVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  744

Query  176  RDKSNPQIYNYLA  138
            RDKSNPQIYNYLA
Sbjct  745  RDKSNPQIYNYLA  757



>gb|KFK28509.1| cullin 4 [Arabis alpina]
Length=782

 Score =   337 bits (864),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNS GHCVLK EFPKGRKELAVS FQ VVLMLFN+A+K SF+DIK+A  IE+KELRR
Sbjct  590  LMWQNSSGHCVLKTEFPKGRKELAVSLFQAVVLMLFNDAQKLSFEDIKDATNIEEKELRR  649

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVL K PKG+DVED D FVFND F+  LYRIKVNAIQMKETVEEN STTE
Sbjct  650  TLQSLACGKVRVLLKEPKGKDVEDGDEFVFNDGFSHSLYRIKVNAIQMKETVEENASTTE  709

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            +VF DRQYQ+DAAIVRIMKTRK+ SHTLLI ELFQQLKFPIKPADLKKRIESLI REY E
Sbjct  710  KVFHDRQYQIDAAIVRIMKTRKILSHTLLITELFQQLKFPIKPADLKKRIESLIQREYLE  769

Query  176  RDKSNPQIYNYLA  138
            RDKSNPQIYNYLA
Sbjct  770  RDKSNPQIYNYLA  782



>ref|XP_006836434.1| hypothetical protein AMTR_s00092p00163840 [Amborella trichopoda]
 gb|ERM99287.1| hypothetical protein AMTR_s00092p00163840 [Amborella trichopoda]
Length=822

 Score =   337 bits (865),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+  K SFQDIK+A  IEDKELRR
Sbjct  630  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDTSKLSFQDIKDATCIEDKELRR  689

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVED+D+F+FN++F+APLYR+KVNAIQMKETVEENT+TTE
Sbjct  690  TLQSLACGKVRVLQKLPKGRDVEDEDSFLFNEEFSAPLYRLKVNAIQMKETVEENTTTTE  749

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  750  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  809

Query  176  RDKSNPQIYNYLA  138
            RDKSNPQIYNYLA
Sbjct  810  RDKSNPQIYNYLA  822



>gb|KHG10035.1| Cullin-4 -like protein [Gossypium arboreum]
Length=823

 Score =   335 bits (858),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+FPKG+KELAVS FQTVVLMLFN+A+K SFQDIK++ GIEDKELRR
Sbjct  624  LMWQNSLGHCVLKADFPKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKDSTGIEDKELRR  683

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVEDDD+F+FN+ FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  684  TLQSLACGKVRVLQKLPKGRDVEDDDSFIFNEGFTAPLYRIKVNAIQMKETVEENTSTTE  743

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDRE  186
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELF+QLKFPIKPADLKKRIESLIDRE
Sbjct  744  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFEQLKFPIKPADLKKRIESLIDRE  800



>ref|XP_001764780.1| predicted protein [Physcomitrella patens]
 gb|EDQ70479.1| predicted protein [Physcomitrella patens]
Length=745

 Score =   323 bits (828),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA FPKG+KEL+VS FQT+VLMLFN+A+  +F DIK+   IEDKELRR
Sbjct  553  LMWQNSLGHCVLKANFPKGKKELSVSLFQTLVLMLFNDAQSLTFHDIKDTSAIEDKELRR  612

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK+RVL KIPKGR+VED+DTFVFN+ F APL+RIKVNAIQ+KETVEENT+TTE
Sbjct  613  TLQSLACGKIRVLNKIPKGREVEDEDTFVFNEDFVAPLFRIKVNAIQLKETVEENTTTTE  672

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY E
Sbjct  673  RVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLE  732

Query  176  RDKSNPQIYNYLA  138
            RDK+NPQIYNYLA
Sbjct  733  RDKANPQIYNYLA  745



>dbj|BAB08502.1| cullin [Arabidopsis thaliana]
Length=617

 Score =   318 bits (816),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 168/196 (86%), Gaps = 3/196 (2%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF---QDIKEAIGIEDKE  546
            LMWQNSLGHCVLKA+F KG+KELAVS FQ   +         SF   +DIK++  IEDKE
Sbjct  422  LMWQNSLGHCVLKADFSKGKKELAVSLFQVSQIFFPPPPLLSSFLSSRDIKDSTSIEDKE  481

Query  545  LRRTLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTS  366
            LRRTLQS ACGKVRVLQK PKGRDVED D F FND+F APLYRIKVNAIQMKETVEENTS
Sbjct  482  LRRTLQSLACGKVRVLQKNPKGRDVEDGDEFEFNDEFAAPLYRIKVNAIQMKETVEENTS  541

Query  365  TTERVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDRE  186
            TTERVFQDRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDRE
Sbjct  542  TTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDRE  601

Query  185  YXERDKSNPQIYNYLA  138
            Y ER+KSNPQIYNYLA
Sbjct  602  YLEREKSNPQIYNYLA  617



>tpg|DAA51792.1| TPA: hypothetical protein ZEAMMB73_094309, partial [Zea mays]
Length=164

 Score =   297 bits (760),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -3

Query  629  TVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSXACGKVRVLQKIPKGRDVEDDDTFV  450
            +VVLMLFN+A+K SF DIK++ GIEDKELRRTLQS ACGKVRVLQKIPKGRDVED D FV
Sbjct  1    SVVLMLFNDAQKLSFLDIKDSTGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDKDDFV  60

Query  449  FNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVXSHTLL  270
            FN+ F+APLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKV SHTLL
Sbjct  61   FNEDFSAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLL  120

Query  269  IAELFQQLKFPIKPADLKKRIESLIDREYXERDKSNPQIYNYLA  138
            I EL+QQLKFP+KPAD+KKRIESLIDREY ERD+SNPQIYNYLA
Sbjct  121  ITELYQQLKFPVKPADIKKRIESLIDREYLERDRSNPQIYNYLA  164



>ref|XP_003584977.2| PREDICTED: cullin-4B-like [Bos taurus]
Length=248

 Score =   298 bits (762),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  56   LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  115

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  116  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  175

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  176  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  235

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  236  RDKENPNQYNYIA  248



>gb|AAC50548.1| Hs-CUL-4B, partial [Homo sapiens]
Length=288

 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  96   LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  155

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  156  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  215

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  216  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  275

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  276  RDKENPNQYNYIA  288



>gb|AAH10347.1| Cul4b protein [Mus musculus]
Length=285

 Score =   298 bits (762),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK A GIED ELRR
Sbjct  93   LQWQSTLGHCVLKAEFKEGKKELQVSLFQTMVLLMFNEGEEFSLEEIKHATGIEDGELRR  152

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  153  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  212

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  213  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  272

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  273  RDKENPNQYNYIA  285



>ref|XP_005673911.1| PREDICTED: cullin-4B, partial [Sus scrofa]
Length=349

 Score =   298 bits (764),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  157  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  216

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  217  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  276

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  277  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  336

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  337  RDKENPNQYNYIA  349



>ref|NP_001131505.1| uncharacterized protein LOC100192843 [Zea mays]
 gb|ACF79942.1| unknown [Zea mays]
Length=160

 Score =   291 bits (745),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -3

Query  617  MLFNEAEKFSFQDIKEAIGIEDKELRRTLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQ  438
            MLFN+A+K SF DIK++ GIEDKELRRTLQS ACGKVRVLQKIPKGRDVED D FVFN+ 
Sbjct  1    MLFNDAQKLSFLDIKDSTGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDKDDFVFNED  60

Query  437  FTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAEL  258
            F+APLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKV SHTLLI EL
Sbjct  61   FSAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITEL  120

Query  257  FQQLKFPIKPADLKKRIESLIDREYXERDKSNPQIYNYLA  138
            +QQLKFP+KPAD+KKRIESLIDREY ERD+SNPQIYNYLA
Sbjct  121  YQQLKFPVKPADIKKRIESLIDREYLERDRSNPQIYNYLA  160



>gb|AEB61292.1| cullin-4A-like protein, partial [Equus caballus]
Length=210

 Score =   289 bits (740),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ +LGH VLKAEF +G+KE  VS FQT+VL++FNE ++FSF++IK A GIED ELRR
Sbjct  18   LQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLLMFNEGDEFSFEEIKTATGIEDSELRR  77

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG++VED D F+FN +F   L+RIK+N IQMKETVEE  STTE
Sbjct  78   TLQSLACGKARVLIKSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTE  137

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK   H LL++EL+ QLKFP+KP DLKKRIESLIDR+Y E
Sbjct  138  RVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYME  197

Query  176  RDKSNPQIYNYLA  138
            RDK NP  Y+Y+A
Sbjct  198  RDKDNPNQYHYVA  210



>dbj|BAK62681.1| cullin-4B [Pan troglodytes]
Length=509

 Score =   298 bits (764),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  317  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  376

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  377  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  436

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  437  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  496

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  497  RDKENPNQYNYIA  509



>ref|XP_006752398.1| PREDICTED: LOW QUALITY PROTEIN: cullin 4A [Leptonychotes weddellii]
Length=326

 Score =   290 bits (743),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 157/193 (81%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ +LGH VLKAEF +G+KE  VS FQT+VL++FNE + FSF++IK A GIED ELRR
Sbjct  134  LQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRR  193

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG++VED DTF FN +F   L+RIK+N IQMKETVEE  STTE
Sbjct  194  TLQSLACGKARVLLKSPKGKEVEDGDTFTFNGEFKHKLFRIKINQIQMKETVEEQVSTTE  253

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK   H LL++EL+ QLKFP+KP DLKKRIESLIDR+Y E
Sbjct  254  RVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYME  313

Query  176  RDKSNPQIYNYLA  138
            RDK NP  Y+Y+A
Sbjct  314  RDKDNPNQYHYVA  326



>gb|EAX11876.1| cullin 4B, isoform CRA_a [Homo sapiens]
Length=614

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  422  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  481

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  482  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  541

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  542  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  601

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  602  RDKENPNQYNYIA  614



>gb|AAH04026.1| Cul4b protein [Mus musculus]
Length=614

 Score =   298 bits (763),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK A GIED ELRR
Sbjct  422  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTMVLLMFNEGEEFSLEEIKHATGIEDGELRR  481

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  482  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  541

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  542  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  601

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  602  RDKENPNQYNYIA  614



>ref|XP_009915407.1| PREDICTED: cullin-4B isoform X2 [Haliaeetus albicilla]
 ref|XP_010567269.1| PREDICTED: cullin-4B isoform X2 [Haliaeetus leucocephalus]
Length=614

 Score =   298 bits (762),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  422  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  481

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+DVED D F  ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  482  TLQSLACGKARVLTKSPKGKDVEDGDKFTCNDDFRHKLFRIKINQIQMKETVEEQASTTE  541

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  542  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  601

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  602  RDKENPNQYNYIA  614



>gb|AAB67315.1| Very similar and perhaps identical to Hs-CUL-4B.; 80-100% similarity 
to partial sequence U58091 (PID:g1381150) [Homo sapiens]
Length=652

 Score =   298 bits (764),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  460  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  519

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  520  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  579

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  580  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  639

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  640  RDKENPNQYNYIA  652



>ref|NP_001051492.1| Os03g0786800 [Oryza sativa Japonica Group]
 dbj|BAF13406.1| Os03g0786800, partial [Oryza sativa Japonica Group]
Length=155

 Score =   282 bits (722),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -3

Query  602  AEKFSFQDIKEAIGIEDKELRRTLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPL  423
            A+K SF DIKE+ GIEDKELRRTLQS ACGKVRVLQK+PKGRDVED D FVFN++F+APL
Sbjct  1    AQKLSFLDIKESTGIEDKELRRTLQSLACGKVRVLQKMPKGRDVEDKDEFVFNEEFSAPL  60

Query  422  YRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLK  243
            YRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRK  SHTLLI ELFQQLK
Sbjct  61   YRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKTLSHTLLITELFQQLK  120

Query  242  FPIKPADLKKRIESLIDREYXERDKSNPQIYNYLA  138
            FPIKP+D+KKRIESLIDREY ERD+SNPQIYNYLA
Sbjct  121  FPIKPSDIKKRIESLIDREYLERDRSNPQIYNYLA  155



>dbj|BAB24020.1| unnamed protein product [Mus musculus]
Length=205

 Score =   283 bits (725),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 156/193 (81%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ +LGH VLKA+F +G+KE  VS FQT+VL++FNE + FSF++IK A GIED ELRR
Sbjct  13   LQWQTTLGHAVLKADFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRR  72

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG++VED D F+FN  F   L+RIK+N IQMKETVEE  STTE
Sbjct  73   TLQSLACGKARVLIKSPKGKEVEDGDKFIFNADFKHKLFRIKINQIQMKETVEEQVSTTE  132

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK   H LL++EL+ QLKFP+KP DLKKRIESLIDR+Y E
Sbjct  133  RVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYME  192

Query  176  RDKSNPQIYNYLA  138
            RDK +P  Y+Y+A
Sbjct  193  RDKDSPNQYHYVA  205



>ref|XP_009956705.1| PREDICTED: cullin-4B, partial [Leptosomus discolor]
Length=671

 Score =   298 bits (762),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  479  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  538

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+DVED D F  ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  539  TLQSLACGKARVLTKSPKGKDVEDGDKFTCNDDFRHKLFRIKINQIQMKETVEEQASTTE  598

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  599  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  658

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  659  RDKENPNQYNYIA  671



>ref|XP_004327092.1| PREDICTED: cullin-4A-like, partial [Tursiops truncatus]
Length=213

 Score =   283 bits (725),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 155/193 (80%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ +LGH VLKAEF +G+KEL VS  QT+VL++FNE + FSF+DIK A GIE  ELRR
Sbjct  21   LQWQTTLGHAVLKAEFKEGKKELQVSLLQTLVLLMFNEGDGFSFEDIKMATGIEGSELRR  80

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACG+ RVL K P+GR+VED D FVFN +F   L+RIK+N IQMKETVEE  STTE
Sbjct  81   TLQSLACGRARVLIKSPRGREVEDGDRFVFNGEFKHKLFRIKINQIQMKETVEEQASTTE  140

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK   H LL++EL+ QLKFP+KP DLKKRIESLIDR+Y E
Sbjct  141  RVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYME  200

Query  176  RDKSNPQIYNYLA  138
            RD+ +P  Y Y+A
Sbjct  201  RDQDSPNQYRYVA  213



>gb|KFQ15708.1| Cullin-4B, partial [Leptosomus discolor]
Length=663

 Score =   297 bits (761),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  471  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  530

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+DVED D F  ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  531  TLQSLACGKARVLTKSPKGKDVEDGDKFTCNDDFRHKLFRIKINQIQMKETVEEQASTTE  590

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  591  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  650

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  651  RDKENPNQYNYIA  663



>ref|XP_010185411.1| PREDICTED: cullin-4B, partial [Mesitornis unicolor]
Length=671

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  479  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  538

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+DVED D F  ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  539  TLQSLACGKARVLTKSPKGKDVEDGDKFTCNDDFRHKLFRIKINQIQMKETVEEQASTTE  598

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  599  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  658

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  659  RDKENPNQYNYIA  671



>ref|XP_008154342.1| PREDICTED: cullin-4B isoform X2 [Eptesicus fuscus]
Length=717

 Score =   298 bits (764),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  525  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  584

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  585  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  644

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  645  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  704

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  705  RDKENPNQYNYIA  717



>ref|XP_004685824.1| PREDICTED: cullin-4B isoform X2 [Condylura cristata]
Length=717

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  525  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  584

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  585  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  644

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  645  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  704

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  705  RDKENPNQYNYIA  717



>gb|KFQ37918.1| Cullin-4B, partial [Mesitornis unicolor]
Length=672

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  480  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  539

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+DVED D F  ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  540  TLQSLACGKARVLTKSPKGKDVEDGDKFTCNDDFRHKLFRIKINQIQMKETVEEQASTTE  599

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  600  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  659

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  660  RDKENPNQYNYIA  672



>ref|XP_006877535.1| PREDICTED: cullin-4B isoform X2 [Chrysochloris asiatica]
Length=717

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  525  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  584

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  585  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  644

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  645  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  704

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  705  RDKENPNQYNYIA  717



>pdb|4A0L|E Chain E, Structure Of Ddb1-Ddb2-Cul4b-Rbx1 Bound To A 12 Bp Abasic 
Site Containing Dna-Duplex
 pdb|4A0L|H Chain H, Structure Of Ddb1-Ddb2-Cul4b-Rbx1 Bound To A 12 Bp Abasic 
Site Containing Dna-Duplex
Length=726

 Score =   298 bits (764),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  534  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  593

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  594  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  653

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  654  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  713

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  714  RDKENPNQYNYIA  726



>ref|XP_006003900.1| PREDICTED: cullin-4B [Latimeria chalumnae]
Length=845

 Score =   301 bits (770),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  653  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  712

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+DVED D F  ND F   L+RIK+N IQMKETVEE TSTTE
Sbjct  713  TLQSLACGKARVLTKTPKGKDVEDGDKFTCNDDFKHKLFRIKINQIQMKETVEEQTSTTE  772

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  773  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  832

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  833  RDKENPNQYNYVA  845



>ref|XP_004022403.1| PREDICTED: cullin-4B isoform 2 [Ovis aries]
 ref|XP_005891590.1| PREDICTED: cullin-4B isoform X3 [Bos mutus]
 ref|XP_005954003.1| PREDICTED: cullin-4B-like isoform X3 [Pantholops hodgsonii]
 ref|XP_006191374.1| PREDICTED: cullin-4B-like isoform X3 [Camelus ferus]
 ref|XP_006215963.1| PREDICTED: cullin-4B isoform X3 [Vicugna pacos]
 ref|XP_008017655.1| PREDICTED: cullin-4B isoform X8 [Chlorocebus sabaeus]
 ref|XP_008988098.1| PREDICTED: cullin-4B isoform X6 [Callithrix jacchus]
 ref|XP_009196474.1| PREDICTED: cullin-4B isoform X7 [Papio anubis]
 ref|XP_009437859.1| PREDICTED: cullin-4B isoform X4 [Pan troglodytes]
Length=717

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  525  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  584

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  585  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  644

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  645  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  704

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  705  RDKENPNQYNYIA  717



>ref|XP_007530425.1| PREDICTED: cullin-4B isoform X2 [Erinaceus europaeus]
Length=717

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  525  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  584

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  585  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  644

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  645  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  704

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  705  RDKENPNQYNYIA  717



>ref|XP_004285635.1| PREDICTED: cullin-4B isoform 2 [Orcinus orca]
 ref|XP_004325657.1| PREDICTED: cullin-4B-like isoform 2 [Tursiops truncatus]
 ref|XP_007464487.1| PREDICTED: cullin-4B isoform X2 [Lipotes vexillifer]
Length=717

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  525  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  584

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  585  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  644

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  645  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  704

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  705  RDKENPNQYNYIA  717



>gb|EAX11877.1| cullin 4B, isoform CRA_b [Homo sapiens]
 dbj|BAH12944.1| unnamed protein product [Homo sapiens]
Length=717

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  525  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  584

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  585  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  644

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  645  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  704

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  705  RDKENPNQYNYIA  717



>gb|EGW01006.1| Cullin-4B [Cricetulus griseus]
Length=834

 Score =   301 bits (770),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS +DIK+A GIED ELRR
Sbjct  642  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEDIKQATGIEDGELRR  701

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  702  TLQSLACGKARVLTKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  761

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  762  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  821

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  822  RDKENPNQYNYIA  834



>ref|XP_009196472.1| PREDICTED: cullin-4B isoform X5 [Papio anubis]
 ref|XP_009437857.1| PREDICTED: cullin-4B isoform X3 [Pan troglodytes]
Length=719

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  527  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  586

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  587  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  646

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  647  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  706

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  707  RDKENPNQYNYIA  719



>ref|XP_005319407.1| PREDICTED: cullin-4B isoform X2 [Ictidomys tridecemlineatus]
Length=717

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  525  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  584

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  585  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  644

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  645  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  704

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  705  RDKENPNQYNYIA  717



>ref|XP_006885131.1| PREDICTED: cullin-4B-like isoform X2 [Elephantulus edwardii]
Length=717

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  525  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  584

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  585  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  644

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  645  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  704

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  705  RDKENPNQYNYIA  717



>pdb|4A0C|C Chain C, Structure Of The Cand1-Cul4b-Rbx1 Complex
 pdb|4A0C|E Chain E, Structure Of The Cand1-Cul4b-Rbx1 Complex
Length=741

 Score =   298 bits (764),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  549  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  608

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  609  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  668

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  669  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  728

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  729  RDKENPNQYNYIA  741



>ref|XP_004379638.1| PREDICTED: cullin-4B isoform 2 [Trichechus manatus latirostris]
Length=717

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  525  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  584

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  585  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  644

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  645  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  704

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  705  RDKENPNQYNYIA  717



>ref|XP_006191372.1| PREDICTED: cullin-4B-like isoform X1 [Camelus ferus]
 ref|XP_009437855.1| PREDICTED: cullin-4B isoform X1 [Pan troglodytes]
 ref|XP_010340010.1| PREDICTED: cullin-4B isoform X3 [Saimiri boliviensis boliviensis]
Length=782

 Score =   299 bits (766),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  590  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  649

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  650  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  709

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  710  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  769

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  770  RDKENPNQYNYIA  782



>ref|XP_006191373.1| PREDICTED: cullin-4B-like isoform X2 [Camelus ferus]
 ref|XP_009437856.1| PREDICTED: cullin-4B isoform X2 [Pan troglodytes]
Length=780

 Score =   299 bits (766),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  588  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  647

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  648  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  707

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  708  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  767

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  768  RDKENPNQYNYIA  780



>ref|XP_010819678.1| PREDICTED: cullin-4B isoform X5 [Bos taurus]
Length=781

 Score =   299 bits (766),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  589  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  648

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  649  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  708

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  709  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  768

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  769  RDKENPNQYNYIA  781



>dbj|BAA31670.2| KIAA0695 protein [Homo sapiens]
Length=781

 Score =   299 bits (766),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  589  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  648

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  649  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  708

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  709  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  768

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  769  RDKENPNQYNYIA  781



>gb|AAK16812.1|AF212995_1 cullin CUL4B [Homo sapiens]
Length=782

 Score =   299 bits (766),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  590  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  649

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  650  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  709

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  710  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  769

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  770  RDKENPNQYNYIA  782



>ref|XP_008271384.1| PREDICTED: cullin-4B isoform X5 [Oryctolagus cuniculus]
Length=781

 Score =   299 bits (766),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  589  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  648

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  649  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  708

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  709  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  768

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  769  RDKENPNQYNYIA  781



>ref|XP_011376545.1| PREDICTED: cullin-4B isoform X2 [Pteropus vampyrus]
Length=782

 Score =   299 bits (766),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  590  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  649

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  650  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  709

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  710  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  769

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  770  RDKENPNQYNYIA  782



>ref|NP_001041617.1| cullin-4B [Felis catus]
 gb|ABC59460.1| CUL4BX [Felis catus]
Length=782

 Score =   299 bits (766),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  590  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  649

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  650  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  709

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  710  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  769

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  770  RDKENPNQYNYIA  782



>ref|XP_005413716.1| PREDICTED: cullin-4B isoform X4 [Chinchilla lanigera]
Length=781

 Score =   299 bits (766),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  589  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  648

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  649  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  708

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  709  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  768

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  769  RDKENPNQYNYIA  781



>gb|KDO78191.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=805

 Score =   300 bits (767),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEFPKG+KELAVS FQTVVLMLFN+A+K SFQDIK+A GIEDKELRR
Sbjct  612  LMWQNSLGHCVLKAEFPKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKDATGIEDKELRR  671

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVEDDD+FVFN+ FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  672  TLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPLYRIKVNAIQMKETVEENTSTTE  731

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPI  234
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQ+  P+
Sbjct  732  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQVLPPV  772



>ref|XP_009506519.1| PREDICTED: cullin-4B, partial [Phalacrocorax carbo]
Length=719

 Score =   298 bits (762),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  527  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  586

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+DVED D F  ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  587  TLQSLACGKARVLTKSPKGKDVEDGDKFTCNDDFRHKLFRIKINQIQMKETVEEQASTTE  646

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  647  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  706

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  707  RDKENPNQYNYIA  719



>ref|XP_008988097.1| PREDICTED: cullin-4B isoform X5 [Callithrix jacchus]
Length=738

 Score =   298 bits (763),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  546  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  605

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  606  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  665

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  666  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  725

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  726  RDKENPNQYNYIA  738



>gb|ELK07572.1| Cullin-4B [Pteropus alecto]
Length=788

 Score =   299 bits (765),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  596  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  655

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  656  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  715

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  716  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  775

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  776  RDKENPNQYNYIA  788



>gb|KFW96883.1| Cullin-4B, partial [Phalacrocorax carbo]
Length=716

 Score =   297 bits (760),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  524  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  583

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+DVED D F  ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  584  TLQSLACGKARVLTKSPKGKDVEDGDKFTCNDDFRHKLFRIKINQIQMKETVEEQASTTE  643

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  644  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  703

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  704  RDKENPNQYNYIA  716



>ref|XP_008017654.1| PREDICTED: cullin-4B isoform X7 [Chlorocebus sabaeus]
Length=758

 Score =   298 bits (762),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  566  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  625

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  626  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  685

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  686  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  745

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  746  RDKENPNQYNYIA  758



>ref|XP_001510185.3| PREDICTED: cullin-4B [Ornithorhynchus anatinus]
Length=779

 Score =   298 bits (763),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  587  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  646

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+DVED D F  ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  647  TLQSLACGKARVLTKNPKGKDVEDGDKFTCNDDFRHKLFRIKINQIQMKETVEEQASTTE  706

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  707  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  766

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  767  RDKENPNQYNYIA  779



>ref|XP_007647173.1| PREDICTED: cullin-4B isoform X1 [Cricetulus griseus]
Length=905

 Score =   301 bits (770),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS +DIK+A GIED ELRR
Sbjct  713  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEDIKQATGIEDGELRR  772

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  773  TLQSLACGKARVLTKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  832

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  833  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  892

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  893  RDKENPNQYNYIA  905



>ref|XP_007610124.1| PREDICTED: cullin-4B isoform X2 [Cricetulus griseus]
Length=911

 Score =   301 bits (770),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS +DIK+A GIED ELRR
Sbjct  719  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEDIKQATGIEDGELRR  778

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  779  TLQSLACGKARVLTKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  838

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  839  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  898

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  899  RDKENPNQYNYIA  911



>ref|XP_008171287.1| PREDICTED: cullin-4B isoform X2 [Chrysemys picta bellii]
Length=780

 Score =   298 bits (763),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  588  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  647

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+DVED D F  ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  648  TLQSLACGKARVLTKSPKGKDVEDGDKFTCNDDFRHKLFRIKINQIQMKETVEEQASTTE  707

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  708  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  767

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  768  RDKENPNQYNYIA  780



>gb|AAC50547.1| Hs-CUL-4A, partial [Homo sapiens]
Length=421

 Score =   288 bits (737),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 157/193 (81%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ +LGH VLKAEF +G+KE  VS FQT+VL++FNE + FSF++IK A GIED ELRR
Sbjct  229  LQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRR  288

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG++VED D F+FN +F   L+RIK+N IQMKETVEE  STTE
Sbjct  289  TLQSLACGKARVLIKSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTE  348

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK   H LL++EL+ QLKFP+KP DLKKRIESLIDR+Y E
Sbjct  349  RVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYME  408

Query  176  RDKSNPQIYNYLA  138
            RDK NP  Y+Y+A
Sbjct  409  RDKDNPNQYHYVA  421



>gb|EAX11878.1| cullin 4B, isoform CRA_c [Homo sapiens]
Length=843

 Score =   299 bits (765),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  651  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  710

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  711  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  770

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  771  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  830

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  831  RDKENPNQYNYIA  843



>ref|XP_009088610.1| PREDICTED: cullin-4B [Serinus canaria]
Length=887

 Score =   300 bits (767),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS +DIK+A GIED ELRR
Sbjct  695  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEDIKQATGIEDGELRR  754

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+DVED D F  ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  755  TLQSLACGKARVLTKSPKGKDVEDGDKFTCNDDFRHKLFRIKINQIQMKETVEEQASTTE  814

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  815  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  874

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  875  RDKENPNQYNYIA  887



>ref|XP_010484784.1| PREDICTED: cullin-4-like [Camelina sativa]
Length=784

 Score =   298 bits (762),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 164/194 (85%), Gaps = 10/194 (5%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKA+F +G+KELAVS FQ VVLMLFN+A K SF+DIK++ GIEDKELRR
Sbjct  600  LMWQNSLGHCVLKADFSRGKKELAVSLFQAVVLMLFNDAMKLSFEDIKDSTGIEDKELRR  659

Query  536  TLQSXACGKVRVLQKI-PKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTT  360
            TLQS ACGKVRVL K+ PK           FN    + +  ++VNAIQMKETVEENTSTT
Sbjct  660  TLQSLACGKVRVLLKVRPKSP---------FNXPILSFVSCVQVNAIQMKETVEENTSTT  710

Query  359  ERVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYX  180
            ERVFQDRQYQ+DAAIVRIMKTRKV SHTLLI ELFQQLKFPIKPADLKKRIESLIDREY 
Sbjct  711  ERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYL  770

Query  179  ERDKSNPQIYNYLA  138
            ER+KSNPQIYNYLA
Sbjct  771  EREKSNPQIYNYLA  784



>ref|XP_004478393.1| PREDICTED: cullin-4B [Dasypus novemcinctus]
Length=831

 Score =   298 bits (764),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  639  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  698

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  699  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  758

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  759  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  818

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  819  RDKENPNQYNYIA  831



>ref|XP_004587715.1| PREDICTED: cullin-4B [Ochotona princeps]
Length=895

 Score =   300 bits (767),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  703  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  762

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+DVED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  763  TLQSLACGKARVLAKNPKGKDVEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  822

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  823  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  882

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  883  RDKENPNQYNYIA  895



>dbj|BAG59294.1| unnamed protein product [Homo sapiens]
Length=438

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 157/193 (81%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ +LGH VLKAEF +G+KE  VS FQT+VL++FNE + FSF++IK A GIED ELRR
Sbjct  246  LQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRR  305

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG++VED D F+FN +F   L+RIK+N IQMKETVEE  STTE
Sbjct  306  TLQSLACGKARVLIKSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTE  365

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK   H LL++EL+ QLKFP+KP DLKKRIESLIDR+Y E
Sbjct  366  RVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYME  425

Query  176  RDKSNPQIYNYLA  138
            RDK NP  Y+Y+A
Sbjct  426  RDKDNPNQYHYVA  438



>ref|XP_003774810.1| PREDICTED: cullin-4B [Sarcophilus harrisii]
Length=902

 Score =   300 bits (767),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +GRKEL VS FQT+VL++FNE E+FS +DIK+A GIED ELRR
Sbjct  710  LQWQSTLGHCVLKAEFKEGRKELQVSLFQTLVLLMFNEGEEFSLEDIKQATGIEDGELRR  769

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+DVED D F  ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  770  TLQSLACGKARVLTKNPKGKDVEDGDKFTCNDDFRHKLFRIKINQIQMKETVEEQASTTE  829

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK   H LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  830  RVFQDRQYQIDAAIVRIMKMRKALGHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  889

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  890  RDKENPNQYNYIA  902



>ref|XP_010287736.1| PREDICTED: cullin-4B [Phaethon lepturus]
Length=887

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +GRKEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  695  LQWQSTLGHCVLKAEFKEGRKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  754

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+DVED D F  ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  755  TLQSLACGKARVLTKSPKGKDVEDGDKFTCNDDFRHKLFRIKINQIQMKETVEEQASTTE  814

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  815  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  874

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  875  RDKENPNQYNYIA  887



>gb|ELK27187.1| Cullin-4B, partial [Myotis davidii]
Length=896

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  704  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  763

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  764  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  823

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  824  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  883

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  884  RDKENPNQYNYIA  896



>ref|XP_006082210.1| PREDICTED: cullin-4B isoform X1 [Myotis lucifugus]
Length=903

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  711  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  770

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  771  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  830

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  831  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  890

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  891  RDKENPNQYNYIA  903



>ref|XP_003797087.1| PREDICTED: cullin-4B-like [Otolemur garnettii]
Length=879

 Score =   299 bits (765),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  687  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  746

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  747  TLQSLACGKARVLSKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  806

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  807  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  866

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  867  RDKENPNQYNYIA  879



>ref|XP_005884739.1| PREDICTED: cullin-4B [Myotis brandtii]
Length=900

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  708  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  767

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  768  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  827

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  828  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  887

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  888  RDKENPNQYNYIA  900



>ref|XP_006877534.1| PREDICTED: cullin-4B isoform X1 [Chrysochloris asiatica]
Length=898

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  706  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  765

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  766  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  825

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  826  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  885

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  886  RDKENPNQYNYIA  898



>ref|XP_006082211.1| PREDICTED: cullin-4B isoform X2 [Myotis lucifugus]
Length=901

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  709  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  768

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  769  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  828

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  829  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  888

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  889  RDKENPNQYNYIA  901



>ref|XP_008832150.1| PREDICTED: cullin-4B [Nannospalax galili]
Length=894

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  702  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  761

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  762  TLQSLACGKARVLSKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  821

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  822  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  881

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  882  RDKENPNQYNYIA  894



>ref|XP_006144939.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4B [Tupaia chinensis]
Length=895

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +GRKEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  703  LQWQSTLGHCVLKAEFKEGRKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  762

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  763  TLQSLACGKARVLAKNPKGKDIEDGDKFIXNDDFRHKLFRIKINQIQMKETVEEQASTTE  822

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  823  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  882

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  883  RDKENPNQYNYIA  895



>ref|XP_002519675.1| cullin, putative [Ricinus communis]
 gb|EEF42648.1| cullin, putative [Ricinus communis]
Length=807

 Score =   297 bits (761),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 152/162 (94%), Gaps = 1/162 (1%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            LMWQNSLGHCVLKAEF KG+KELAVS FQTVVLMLFN+A+K SFQDIK+A GIEDKELRR
Sbjct  638  LMWQNSLGHCVLKAEFSKGKKELAVSLFQTVVLMLFNDAQKLSFQDIKDATGIEDKELRR  697

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGKVRVLQK+PKGRDVEDDD+FVFN+ FTAPLYRIKVNAIQMKETVEENTSTTE
Sbjct  698  TLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPLYRIKVNAIQMKETVEENTSTTE  757

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLK-FPI  234
            RVFQDRQYQVDAAIVRIMKTRKV SHTLLI ELFQQ K FP+
Sbjct  758  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQAKCFPL  799



>gb|KFQ77299.1| Cullin-4B [Phaethon lepturus]
Length=887

 Score =   299 bits (765),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +GRKEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  695  LQWQSTLGHCVLKAEFKEGRKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  754

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+DVED D F  ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  755  TLQSLACGKARVLTKSPKGKDVEDGDKFTCNDDFRHKLFRIKINQIQMKETVEEQASTTE  814

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  815  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  874

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  875  RDKENPNQYNYIA  887



>ref|XP_011277734.1| PREDICTED: cullin-4B isoform X2 [Felis catus]
Length=899

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  707  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  766

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  767  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  826

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  827  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  886

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  887  RDKENPNQYNYIA  899



>ref|XP_006082212.1| PREDICTED: cullin-4B isoform X3 [Myotis lucifugus]
Length=898

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  706  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  765

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  766  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  825

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  826  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  885

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  886  RDKENPNQYNYIA  898



>ref|XP_004713106.1| PREDICTED: cullin-4B isoform X3 [Echinops telfairi]
Length=717

 Score =   295 bits (756),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKA+F +G+KEL VS FQT+VL++FNE ++FS ++IK+A GIED ELRR
Sbjct  525  LQWQSTLGHCVLKADFKEGKKELQVSLFQTLVLLMFNEGDEFSLEEIKQATGIEDGELRR  584

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  585  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFRHKLFRIKINQIQMKETVEEQASTTE  644

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  645  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  704

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  705  RDKENPNQYNYIA  717



>ref|XP_011277733.1| PREDICTED: cullin-4B isoform X1 [Felis catus]
Length=901

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  709  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  768

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  769  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  828

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  829  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  888

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  889  RDKENPNQYNYIA  901



>ref|XP_004899937.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4B [Heterocephalus glaber]
Length=905

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  713  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  772

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  773  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  832

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  833  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  892

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  893  RDKENPNQYNYIA  905



>ref|XP_006981625.1| PREDICTED: cullin-4B isoform X1 [Peromyscus maniculatus bairdii]
Length=901

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  709  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  768

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  769  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  828

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  829  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  888

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  889  RDKENPNQYNYIA  901



>ref|XP_008538115.1| PREDICTED: cullin-4B isoform X1 [Equus przewalskii]
Length=891

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  699  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  758

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  759  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  818

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  819  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  878

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  879  RDKENPNQYNYIA  891



>ref|XP_004437389.1| PREDICTED: cullin-4B [Ceratotherium simum simum]
Length=889

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  697  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  756

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  757  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  816

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  817  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  876

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  877  RDKENPNQYNYIA  889



>ref|XP_004874659.1| PREDICTED: cullin-4B isoform X1 [Heterocephalus glaber]
Length=893

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  701  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  760

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  761  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  820

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  821  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  880

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  881  RDKENPNQYNYIA  893



>gb|EFB16493.1| hypothetical protein PANDA_011593 [Ailuropoda melanoleuca]
Length=891

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  699  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  758

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  759  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  818

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  819  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  878

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  879  RDKENPNQYNYIA  891



>ref|XP_008154341.1| PREDICTED: cullin-4B isoform X1 [Eptesicus fuscus]
Length=914

 Score =   299 bits (766),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  722  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  781

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  782  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  841

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  842  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  901

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  902  RDKENPNQYNYIA  914



>ref|XP_008585583.1| PREDICTED: cullin-4B isoform X1 [Galeopterus variegatus]
Length=895

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  703  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  762

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  763  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  822

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  823  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  882

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  883  RDKENPNQYNYIA  895



>ref|XP_008271382.1| PREDICTED: cullin-4B isoform X3 [Oryctolagus cuniculus]
Length=902

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  710  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  769

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  770  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  829

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  830  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  889

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  890  RDKENPNQYNYIA  902



>ref|XP_011227402.1| PREDICTED: cullin-4B isoform X2 [Ailuropoda melanoleuca]
Length=900

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  708  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  767

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  768  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  827

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  828  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  887

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  888  RDKENPNQYNYIA  900



>ref|XP_011227401.1| PREDICTED: cullin-4B isoform X1 [Ailuropoda melanoleuca]
Length=902

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  710  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  769

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  770  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  829

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  830  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  889

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  890  RDKENPNQYNYIA  902



>ref|XP_004762117.1| PREDICTED: cullin-4B isoform X4 [Mustela putorius furo]
 ref|XP_004816696.1| PREDICTED: cullin-4B isoform X4 [Mustela putorius furo]
Length=902

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  710  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  769

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  770  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  829

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  830  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  889

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  890  RDKENPNQYNYIA  902



>ref|XP_001086195.1| PREDICTED: cullin-4B isoform 1 [Macaca mulatta]
 ref|XP_009196469.1| PREDICTED: cullin-4B isoform X2 [Papio anubis]
 gb|EHH31046.1| hypothetical protein EGK_20888 [Macaca mulatta]
 gb|EHH61197.1| hypothetical protein EGM_19145 [Macaca fascicularis]
Length=913

 Score =   299 bits (766),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  721  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  780

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  781  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  840

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  841  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  900

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  901  RDKENPNQYNYIA  913



>ref|XP_006082213.1| PREDICTED: cullin-4B isoform X4 [Myotis lucifugus]
Length=896

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  704  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  763

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  764  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  823

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  824  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  883

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  884  RDKENPNQYNYIA  896



>ref|XP_005413715.1| PREDICTED: cullin-4B isoform X3 [Chinchilla lanigera]
Length=901

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  709  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  768

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  769  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  828

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  829  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  888

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  889  RDKENPNQYNYIA  901



>ref|XP_005413713.1| PREDICTED: cullin-4B isoform X1 [Chinchilla lanigera]
Length=912

 Score =   299 bits (766),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  720  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  779

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  780  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  839

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  840  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  899

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  900  RDKENPNQYNYIA  912



>ref|XP_008585584.1| PREDICTED: cullin-4B isoform X2 [Galeopterus variegatus]
Length=893

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  701  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  760

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  761  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  820

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  821  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  880

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  881  RDKENPNQYNYIA  893



>ref|XP_006981626.1| PREDICTED: cullin-4B isoform X2 [Peromyscus maniculatus bairdii]
Length=894

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  702  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  761

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  762  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  821

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  822  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  881

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  882  RDKENPNQYNYIA  894



>gb|EPQ19199.1| Cullin-4B [Myotis brandtii]
Length=947

 Score =   300 bits (767),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  755  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  814

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  815  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  874

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  875  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  934

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  935  RDKENPNQYNYIA  947



>ref|XP_005413714.1| PREDICTED: cullin-4B isoform X2 [Chinchilla lanigera]
Length=910

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  718  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  777

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  778  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  837

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  838  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  897

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  898  RDKENPNQYNYIA  910



>ref|XP_007076303.1| PREDICTED: cullin-4B isoform X3 [Panthera tigris altaica]
Length=896

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  704  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  763

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  764  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  823

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  824  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  883

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  884  RDKENPNQYNYIA  896



>ref|XP_006257551.1| PREDICTED: cullin-4B isoform X1 [Rattus norvegicus]
Length=909

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  717  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  776

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  777  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  836

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  837  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  896

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  897  RDKENPNQYNYIA  909



>ref|XP_004874660.1| PREDICTED: cullin-4B isoform X2 [Heterocephalus glaber]
Length=891

 Score =   298 bits (764),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  699  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  758

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  759  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  818

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  819  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  878

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  879  RDKENPNQYNYIA  891



>ref|XP_009196468.1| PREDICTED: cullin-4B isoform X1 [Papio anubis]
Length=915

 Score =   299 bits (766),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  723  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  782

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  783  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  842

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  843  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  902

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  903  RDKENPNQYNYIA  915



>ref|XP_007530424.1| PREDICTED: cullin-4B isoform X1 [Erinaceus europaeus]
Length=895

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  703  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  762

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  763  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  822

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  823  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  882

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  883  RDKENPNQYNYIA  895



>ref|XP_005319406.1| PREDICTED: cullin-4B isoform X1 [Ictidomys tridecemlineatus]
Length=902

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  710  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  769

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  770  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  829

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  830  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  889

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  890  RDKENPNQYNYIA  902



>emb|CAD97843.1| hypothetical protein [Homo sapiens]
Length=895

 Score =   298 bits (764),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  703  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  762

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  763  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  822

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  823  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  882

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  883  RDKENPNQYNYIA  895



>ref|XP_004762116.1| PREDICTED: cullin-4B isoform X3 [Mustela putorius furo]
 ref|XP_004816695.1| PREDICTED: cullin-4B isoform X3 [Mustela putorius furo]
Length=911

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  719  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  778

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  779  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  838

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  839  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  898

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  899  RDKENPNQYNYIA  911



>ref|XP_004647716.1| PREDICTED: cullin-4B [Octodon degus]
Length=895

 Score =   298 bits (764),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  703  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  762

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  763  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  822

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  823  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  882

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  883  RDKENPNQYNYIA  895



>ref|XP_004406978.1| PREDICTED: cullin-4B [Odobenus rosmarus divergens]
Length=895

 Score =   298 bits (764),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  703  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  762

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  763  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  822

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  823  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  882

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  883  RDKENPNQYNYIA  895



>ref|XP_008538116.1| PREDICTED: cullin-4B isoform X2 [Equus przewalskii]
Length=889

 Score =   298 bits (764),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  697  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  756

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  757  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  816

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  817  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  876

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  877  RDKENPNQYNYIA  889



>dbj|BAG53936.1| unnamed protein product [Homo sapiens]
Length=895

 Score =   298 bits (764),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  703  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  762

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  763  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  822

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  823  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  882

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  883  RDKENPNQYNYIA  895



>ref|NP_001073341.1| cullin-4B isoform 2 [Homo sapiens]
Length=895

 Score =   298 bits (764),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  703  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  762

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  763  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  822

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  823  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  882

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  883  RDKENPNQYNYIA  895



>ref|XP_008988095.1| PREDICTED: cullin-4B isoform X3 [Callithrix jacchus]
 ref|XP_010340009.1| PREDICTED: cullin-4B isoform X2 [Saimiri boliviensis boliviensis]
Length=895

 Score =   298 bits (764),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  703  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  762

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  763  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  822

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  823  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  882

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  883  RDKENPNQYNYIA  895



>dbj|BAC41443.3| mKIAA0695 protein [Mus musculus]
Length=737

 Score =   295 bits (756),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK A GIED ELRR
Sbjct  545  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTMVLLMFNEGEEFSLEEIKHATGIEDGELRR  604

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  605  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  664

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  665  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  724

Query  176  RDKSNPQIYNYLA  138
            RDK NP   NY+A
Sbjct  725  RDKENPNQSNYIA  737



>ref|XP_006724848.1| PREDICTED: cullin-4B isoform X3 [Homo sapiens]
 ref|XP_008974987.1| PREDICTED: cullin-4B isoform X3 [Pan paniscus]
 ref|XP_009196473.1| PREDICTED: cullin-4B isoform X6 [Papio anubis]
 ref|XP_010353042.1| PREDICTED: cullin-4B isoform X2 [Rhinopithecus roxellana]
 gb|EAX11880.1| cullin 4B, isoform CRA_e [Homo sapiens]
Length=900

 Score =   298 bits (764),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  708  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  767

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  768  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  827

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  828  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  887

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  888  RDKENPNQYNYIA  900



>ref|XP_008070821.1| PREDICTED: cullin-4B [Tarsius syrichta]
Length=896

 Score =   298 bits (764),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  704  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  763

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  764  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  823

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  824  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  883

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  884  RDKENPNQYNYIA  896



>ref|XP_005262538.1| PREDICTED: cullin-4B isoform X1 [Homo sapiens]
Length=915

 Score =   299 bits (765),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  723  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  782

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  783  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  842

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  843  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  902

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  903  RDKENPNQYNYIA  915



>ref|XP_007122105.1| PREDICTED: cullin-4B-like isoform X1 [Physeter catodon]
Length=905

 Score =   299 bits (765),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  713  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  772

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  773  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  832

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  833  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  892

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  893  RDKENPNQYNYIA  905



>ref|XP_008974985.1| PREDICTED: cullin-4B isoform X1 [Pan paniscus]
Length=913

 Score =   299 bits (765),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  721  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  780

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  781  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  840

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  841  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  900

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  901  RDKENPNQYNYIA  913



>ref|XP_007076301.1| PREDICTED: cullin-4B isoform X1 [Panthera tigris altaica]
Length=907

 Score =   299 bits (765),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  715  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  774

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  775  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  834

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  835  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  894

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  895  RDKENPNQYNYIA  907



>ref|XP_007076302.1| PREDICTED: cullin-4B isoform X2 [Panthera tigris altaica]
Length=905

 Score =   299 bits (765),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  713  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  772

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  773  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  832

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  833  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  892

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  893  RDKENPNQYNYIA  905



>ref|XP_004685823.1| PREDICTED: cullin-4B isoform X1 [Condylura cristata]
Length=912

 Score =   299 bits (765),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  720  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  779

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  780  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  839

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  840  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  899

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  900  RDKENPNQYNYIA  912



>gb|KFO30994.1| Cullin-4B [Fukomys damarensis]
Length=881

 Score =   298 bits (763),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  689  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  748

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  749  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  808

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  809  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  868

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  869  RDKENPNQYNYIA  881



>ref|XP_008988094.1| PREDICTED: cullin-4B isoform X2 [Callithrix jacchus]
 ref|XP_010340008.1| PREDICTED: cullin-4B isoform X1 [Saimiri boliviensis boliviensis]
Length=902

 Score =   298 bits (764),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  710  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  769

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  770  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  829

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  830  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  889

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  890  RDKENPNQYNYIA  902



>ref|XP_006724847.1| PREDICTED: cullin-4B isoform X2 [Homo sapiens]
 ref|XP_008974986.1| PREDICTED: cullin-4B isoform X2 [Pan paniscus]
 ref|XP_009196471.1| PREDICTED: cullin-4B isoform X4 [Papio anubis]
 ref|XP_010353041.1| PREDICTED: cullin-4B isoform X1 [Rhinopithecus roxellana]
Length=902

 Score =   298 bits (764),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  710  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  769

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  770  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  829

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  830  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  889

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  890  RDKENPNQYNYIA  902



>ref|XP_010210224.1| PREDICTED: cullin-4B [Tinamus guttatus]
Length=883

 Score =   298 bits (764),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  691  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  750

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+DVED D F  ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  751  TLQSLACGKARVLTKSPKGKDVEDGDKFTCNDDFRHKLFRIKINQIQMKETVEEQASTTE  810

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  811  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  870

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  871  RDKENPNQYNYIA  883



>ref|XP_420335.2| PREDICTED: cullin-4B [Gallus gallus]
Length=883

 Score =   298 bits (764),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  691  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  750

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+DVED D F  ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  751  TLQSLACGKARVLTKSPKGKDVEDGDKFTCNDDFRHKLFRIKINQIQMKETVEEQASTTE  810

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  811  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  870

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  871  RDKENPNQYNYIA  883



>ref|XP_004762114.1| PREDICTED: cullin-4B isoform X1 [Mustela putorius furo]
 ref|XP_004816693.1| PREDICTED: cullin-4B isoform X1 [Mustela putorius furo]
Length=913

 Score =   299 bits (765),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  721  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  780

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  781  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  840

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  841  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  900

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  901  RDKENPNQYNYIA  913



>ref|XP_006746270.1| PREDICTED: cullin-4B [Leptonychotes weddellii]
Length=912

 Score =   299 bits (765),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  720  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  779

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  780  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  839

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  840  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  899

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  900  RDKENPNQYNYIA  912



>ref|XP_002720454.2| PREDICTED: cullin-4B isoform X2 [Oryctolagus cuniculus]
Length=910

 Score =   299 bits (765),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  718  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  777

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  778  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  837

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  838  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  897

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  898  RDKENPNQYNYIA  910



>ref|XP_008271383.1| PREDICTED: cullin-4B isoform X4 [Oryctolagus cuniculus]
Length=901

 Score =   298 bits (764),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  709  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  768

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  769  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  828

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  829  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  888

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  889  RDKENPNQYNYIA  901



>ref|XP_008271380.1| PREDICTED: cullin-4B isoform X1 [Oryctolagus cuniculus]
 ref|XP_008271381.1| PREDICTED: cullin-4B isoform X1 [Oryctolagus cuniculus]
Length=912

 Score =   299 bits (765),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  720  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  779

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  780  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  839

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  840  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  899

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  900  RDKENPNQYNYIA  912



>ref|XP_006767871.1| PREDICTED: cullin-4B [Myotis davidii]
Length=894

 Score =   298 bits (764),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  702  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  761

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  762  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  821

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  822  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  881

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  882  RDKENPNQYNYIA  894



>ref|XP_864628.3| PREDICTED: cullin-4B isoform 3 [Canis lupus familiaris]
Length=912

 Score =   299 bits (765),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  720  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  779

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  780  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  839

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  840  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  899

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  900  RDKENPNQYNYIA  912



>ref|XP_006885130.1| PREDICTED: cullin-4B-like isoform X1 [Elephantulus edwardii]
Length=895

 Score =   298 bits (764),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  703  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  762

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  763  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  822

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  823  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  882

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  883  RDKENPNQYNYIA  895



>ref|NP_003579.3| cullin-4B isoform 1 [Homo sapiens]
 sp|Q13620.4|CUL4B_HUMAN RecName: Full=Cullin-4B; Short=CUL-4B [Homo sapiens]
 dbj|BAG37520.1| unnamed protein product [Homo sapiens]
Length=913

 Score =   299 bits (765),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  721  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  780

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  781  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  840

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  841  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  900

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  901  RDKENPNQYNYIA  913



>ref|XP_006917880.1| PREDICTED: cullin-4B [Pteropus alecto]
Length=896

 Score =   298 bits (764),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  704  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  763

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  764  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  823

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  824  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  883

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  884  RDKENPNQYNYIA  896



>ref|XP_004762115.1| PREDICTED: cullin-4B isoform X2 [Mustela putorius furo]
 ref|XP_004816694.1| PREDICTED: cullin-4B isoform X2 [Mustela putorius furo]
Length=913

 Score =   299 bits (765),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  721  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  780

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  781  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  840

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  841  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  900

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  901  RDKENPNQYNYIA  913



>ref|XP_007060188.1| PREDICTED: cullin-4B [Chelonia mydas]
Length=883

 Score =   298 bits (763),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  691  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  750

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+DVED D F  ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  751  TLQSLACGKARVLTKSPKGKDVEDGDKFTCNDDFRHKLFRIKINQIQMKETVEEQASTTE  810

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  811  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  870

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  871  RDKENPNQYNYIA  883



>ref|XP_005504485.1| PREDICTED: cullin-4B [Columba livia]
Length=887

 Score =   298 bits (763),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  695  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  754

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+DVED D F  ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  755  TLQSLACGKARVLSKSPKGKDVEDGDKFTCNDDFRHKLFRIKINQIQMKETVEEQASTTE  814

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  815  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  874

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  875  RDKENPNQYNYIA  887



>ref|XP_005307468.2| PREDICTED: cullin-4B isoform X1 [Chrysemys picta bellii]
Length=883

 Score =   298 bits (763),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  691  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  750

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+DVED D F  ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  751  TLQSLACGKARVLTKSPKGKDVEDGDKFTCNDDFRHKLFRIKINQIQMKETVEEQASTTE  810

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  811  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  870

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  871  RDKENPNQYNYIA  883



>ref|XP_004606393.1| PREDICTED: cullin-4B isoform X1 [Sorex araneus]
Length=894

 Score =   298 bits (764),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  702  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  761

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  762  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE  821

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  822  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  881

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  882  RDKENPNQYNYIA  894



>ref|XP_006115461.1| PREDICTED: cullin-4B [Pelodiscus sinensis]
Length=882

 Score =   298 bits (763),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  716  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR  537
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct  690  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR  749

Query  536  TLQSXACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE  357
            TLQS ACGK RVL K PKG+DVED D F  ND F   L+RIK+N IQMKETVEE  STTE
Sbjct  750  TLQSLACGKARVLTKSPKGKDVEDGDKFTCNDDFRHKLFRIKINQIQMKETVEEQASTTE  809

Query  356  RVFQDRQYQVDAAIVRIMKTRKVXSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYXE  177
            RVFQDRQYQ+DAAIVRIMK RK  SH LL++E++ QLKFP+KPADLKKRIESLIDR+Y E
Sbjct  810  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME  869

Query  176  RDKSNPQIYNYLA  138
            RDK NP  YNY+A
Sbjct  870  RDKENPNQYNYIA  882



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410