BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF033K04

Length=783
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008384431.1|  PREDICTED: tubulin alpha-3 chain-like              355   2e-119   
gb|ABR25510.1|  tubulin alpha-1 chain                                   352   2e-118   Oryza sativa Indica Group [Indian rice]
emb|CAD20821.1|  alpha tubulin                                          352   2e-118   Zea mays [maize]
dbj|BAH20267.1|  AT5G19780                                              352   2e-118   Arabidopsis thaliana [mouse-ear cress]
emb|CAL35827.1|  alpha-2 tubulin                                        350   3e-118   Plantago major [cart-track plant]
ref|XP_001777110.1|  predicted protein                                  354   4e-118   
emb|CAD20820.1|  alpha tubulin                                          348   4e-118   Zea mays [maize]
ref|XP_009353129.1|  PREDICTED: tubulin alpha-3 chain-like              357   7e-118   Pyrus x bretschneideri [bai li]
ref|XP_008386829.1|  PREDICTED: tubulin alpha-3 chain-like              357   8e-118   Malus domestica [apple tree]
gb|KDP39691.1|  hypothetical protein JCGZ_02711                         357   8e-118   Jatropha curcas
gb|KJB83378.1|  hypothetical protein B456_013G244600                    354   1e-117   Gossypium raimondii
ref|XP_011034391.1|  PREDICTED: tubulin alpha-3 chain                   356   2e-117   Populus euphratica
gb|AGG37288.1|  alpha-tubulin 6                                         355   2e-117   Salix arbutifolia
ref|XP_009366459.1|  PREDICTED: tubulin alpha-3 chain                   355   2e-117   
ref|XP_002525416.1|  tubulin alpha chain, putative                      355   2e-117   Ricinus communis
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        355   2e-117   Fragaria vesca subsp. vesca
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   355   3e-117   Malus domestica [apple tree]
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   355   3e-117   Pyrus x bretschneideri [bai li]
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   355   4e-117   Malus domestica [apple tree]
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   355   4e-117   Sesamum indicum [beniseed]
gb|AGG37290.1|  alpha-tubulin 8                                         355   4e-117   Salix arbutifolia
ref|XP_007030078.1|  Tubulin alpha-5                                    356   4e-117   
emb|CDP17586.1|  unnamed protein product                                355   5e-117   Coffea canephora [robusta coffee]
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          355   5e-117   Amborella trichopoda
ref|XP_011021469.1|  PREDICTED: tubulin alpha-3 chain-like              355   5e-117   Populus euphratica
ref|XP_002325422.1|  Tubulin alpha-1 chain family protein               355   5e-117   Populus trichocarpa [western balsam poplar]
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                354   6e-117   Erythranthe guttata [common monkey flower]
tpg|DAA63280.1|  TPA: alpha tubulin6                                    350   6e-117   
sp|P33624.1|TBA2_ANEPH  RecName: Full=Tubulin alpha-2 chain             351   6e-117   Anemia phyllitidis
gb|AHJ80821.1|  Tua3                                                    353   6e-117   Eragrostis tef [tef]
tpg|DAA41189.1|  TPA: alpha tubulin5                                    350   7e-117   
ref|XP_002319688.1|  Tubulin alpha-1 chain family protein               354   8e-117   Populus trichocarpa [western balsam poplar]
gb|EYU31677.1|  hypothetical protein MIMGU_mgv1a006281mg                354   8e-117   Erythranthe guttata [common monkey flower]
gb|KCW87067.1|  hypothetical protein EUGRSUZ_B03604                     352   8e-117   Eucalyptus grandis [rose gum]
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              354   1e-116   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008240533.1|  PREDICTED: tubulin alpha-3 chain isoform X1        354   1e-116   Prunus mume [ume]
ref|XP_007204346.1|  hypothetical protein PRUPE_ppa005649mg             354   1e-116   Prunus persica
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             354   1e-116   Capsella rubella
gb|AHZ58481.1|  alpha-tubulin                                           345   1e-116   Syntrichia caninervis
gb|AEG74028.1|  alpha-tubulin                                           353   1e-116   Apopellia endiviifolia (species B)
gb|KHG26159.1|  Tubulin alpha-6 chain                                   353   1e-116   Gossypium arboreum [tree cotton]
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             353   1e-116   Gossypium arboreum [tree cotton]
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   353   1e-116   Populus euphratica
emb|CDY44941.1|  BnaA02g04460D                                          353   1e-116   Brassica napus [oilseed rape]
ref|XP_002303998.1|  alpha-tubulin 2 family protein                     353   2e-116   Populus trichocarpa [western balsam poplar]
gb|ACN40824.1|  unknown                                                 353   2e-116   Picea sitchensis
gb|ABO47741.1|  alpha-tubulin                                           353   2e-116   Gossypium hirsutum [American cotton]
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              353   2e-116   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN06388.1|  Tubulin alpha-3 chain                                   352   2e-116   Glycine soja [wild soybean]
ref|XP_001777081.1|  predicted protein                                  353   2e-116   
ref|XP_010112637.1|  Tubulin alpha-3 chain                              353   2e-116   Morus notabilis
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   353   2e-116   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB83375.1|  hypothetical protein B456_013G244600                    353   2e-116   Gossypium raimondii
ref|XP_006445597.1|  hypothetical protein CICLE_v10015224mg             353   2e-116   Citrus clementina [clementine]
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   353   2e-116   Beta vulgaris subsp. vulgaris [field beet]
emb|CAD26887.1|  alpha-tubulin                                          353   2e-116   Miscanthus sinensis
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              353   2e-116   Prunus mume [ume]
gb|KJB44614.1|  hypothetical protein B456_007G261000                    353   2e-116   Gossypium raimondii
ref|XP_001782790.1|  predicted protein                                  353   2e-116   
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   353   2e-116   Vitis vinifera
ref|XP_011075054.1|  PREDICTED: tubulin alpha-3 chain-like              353   2e-116   Sesamum indicum [beniseed]
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              353   2e-116   Musa acuminata subsp. malaccensis [pisang utan]
gb|AHJ80820.1|  Tua3                                                    351   2e-116   Eragrostis tef [tef]
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             353   2e-116   Prunus persica
gb|ABO47735.1|  alpha-tubulin                                           353   2e-116   Gossypium hirsutum [American cotton]
gb|AGG37284.1|  alpha-tubulin 2                                         353   3e-116   Salix arbutifolia
gb|KHG06861.1|  Tubulin alpha-6 chain                                   353   3e-116   Gossypium arboreum [tree cotton]
gb|KHN47983.1|  Tubulin alpha-3 chain                                   352   3e-116   Glycine soja [wild soybean]
ref|XP_010454260.1|  PREDICTED: tubulin alpha-3 chain-like              353   3e-116   Camelina sativa [gold-of-pleasure]
emb|CDY42294.1|  BnaC02g09000D                                          353   3e-116   Brassica napus [oilseed rape]
ref|XP_010531152.1|  PREDICTED: tubulin alpha-3 chain                   353   3e-116   Tarenaya hassleriana [spider flower]
ref|XP_008804327.1|  PREDICTED: tubulin alpha-1 chain-like              353   3e-116   Phoenix dactylifera
ref|XP_006286795.1|  hypothetical protein CARUB_v10003470mg             353   3e-116   Capsella rubella
emb|CDX88875.1|  BnaA03g07740D                                          352   3e-116   
ref|NP_197478.1|  tubulin alpha-3                                       352   3e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008813089.1|  PREDICTED: tubulin alpha-3 chain                   352   4e-116   Phoenix dactylifera
ref|XP_010257632.1|  PREDICTED: tubulin alpha-3 chain                   352   4e-116   Nelumbo nucifera [Indian lotus]
ref|XP_009126391.1|  PREDICTED: tubulin alpha-3 chain-like              352   4e-116   Brassica rapa
ref|XP_010535933.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    352   4e-116   Tarenaya hassleriana [spider flower]
gb|ABB16994.1|  unknown                                                 353   4e-116   Solanum tuberosum [potatoes]
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   352   4e-116   Brachypodium distachyon [annual false brome]
ref|NP_001242878.1|  uncharacterized protein LOC100806907               352   4e-116   Glycine max [soybeans]
ref|XP_006579487.1|  PREDICTED: tubulin A isoform X1                    352   5e-116   
gb|AGY80453.1|  tubulin                                                 352   5e-116   Dendrocalamus latiflorus [sweet bamboo]
ref|XP_009120857.1|  PREDICTED: tubulin alpha-3 chain                   352   5e-116   Brassica rapa
emb|CAD26886.1|  alpha-tubulin                                          352   5e-116   Miscanthus sinensis
sp|Q43473.1|TBA1_HORVU  RecName: Full=Tubulin alpha-1 chain             352   5e-116   Hordeum vulgare [barley]
gb|ABD92942.1|  alpha tubulin-1D                                        352   5e-116   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001237301.1|  tubulin A                                          352   5e-116   
ref|NP_001105324.1|  tubulin alpha-5 chain                              352   5e-116   Zea mays [maize]
ref|XP_004958110.1|  PREDICTED: tubulin alpha-3 chain-like              352   5e-116   Setaria italica
ref|XP_009126389.1|  PREDICTED: tubulin alpha-3 chain-like              352   5e-116   Brassica rapa
dbj|BAJ06363.1|  alpha-tubulin                                          352   5e-116   Alopecurus aequalis
ref|XP_010934670.1|  PREDICTED: tubulin alpha-3 chain-like              352   5e-116   Elaeis guineensis
emb|CAD26891.1|  alpha-tubulin                                          352   5e-116   Miscanthus floridulus
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    352   5e-116   Eleusine indica [crabgrass]
ref|XP_007159433.1|  hypothetical protein PHAVU_002G237400g             352   5e-116   Phaseolus vulgaris [French bean]
emb|CAD24765.1|  alpha-tubulin                                          352   5e-116   Miscanthus sinensis
ref|NP_001105588.1|  tubulin alpha-6 chain                              352   6e-116   Zea mays [maize]
ref|NP_001060075.1|  Os07g0574800                                       352   6e-116   
gb|AGD80034.1|  alpha-tubulin 1                                         352   6e-116   Hevea brasiliensis [jebe]
ref|XP_010044940.1|  PREDICTED: tubulin alpha-3 chain                   352   6e-116   Eucalyptus grandis [rose gum]
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              352   6e-116   Oryza brachyantha
gb|AGG37286.1|  alpha-tubulin 4                                         352   6e-116   Salix arbutifolia
ref|XP_002532068.1|  tubulin alpha chain, putative                      352   6e-116   Ricinus communis
gb|KCW87065.1|  hypothetical protein EUGRSUZ_B03604                     352   6e-116   Eucalyptus grandis [rose gum]
gb|KJB80786.1|  hypothetical protein B456_013G115100                    352   6e-116   Gossypium raimondii
ref|XP_010420792.1|  PREDICTED: tubulin alpha-3 chain-like              342   7e-116   Camelina sativa [gold-of-pleasure]
ref|XP_006443441.1|  hypothetical protein CICLE_v10020128mg             352   7e-116   Citrus clementina [clementine]
ref|XP_011048194.1|  PREDICTED: tubulin alpha-6 chain-like              352   7e-116   Populus euphratica
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   352   8e-116   Elaeis guineensis
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              352   8e-116   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002297631.1|  alpha-tubulin 2 family protein                     352   8e-116   Populus trichocarpa [western balsam poplar]
gb|ABV55994.1|  alpha-tubulin 6                                         352   8e-116   Populus tremuloides
ref|XP_004504311.1|  PREDICTED: tubulin alpha-3 chain-like              352   8e-116   Cicer arietinum [garbanzo]
ref|XP_003629736.1|  Alpha-tubulin                                      352   8e-116   Medicago truncatula
emb|CAD24767.1|  alpha-tubulin                                          352   9e-116   Miscanthus floridulus
gb|ABR67425.1|  alpha-tubulin 4                                         352   9e-116   Populus tremuloides
ref|XP_009622332.1|  PREDICTED: tubulin alpha-3 chain                   351   1e-115   Nicotiana tomentosiformis
emb|CAD24768.1|  alpha-tubulin                                          351   1e-115   Miscanthus floridulus
ref|XP_010528739.1|  PREDICTED: tubulin alpha-6 chain-like              351   1e-115   Tarenaya hassleriana [spider flower]
emb|CAD26890.1|  alpha-tubulin                                          351   1e-115   Miscanthus sinensis subsp. condensatus
gb|AFR42026.1|  alpha-tubulin                                           342   2e-115   Populus trichocarpa [western balsam poplar]
ref|XP_010276368.1|  PREDICTED: tubulin alpha-3 chain-like              351   2e-115   Nelumbo nucifera [Indian lotus]
ref|XP_008449885.1|  PREDICTED: tubulin alpha-3 chain isoform X1        350   2e-115   Cucumis melo [Oriental melon]
gb|AFR42049.1|  alpha-tubulin                                           342   2e-115   Populus fremontii
gb|AFR42020.1|  alpha-tubulin                                           342   2e-115   Populus trichocarpa [western balsam poplar]
gb|AFR42042.1|  alpha-tubulin                                           341   2e-115   Populus fremontii
gb|KJB58759.1|  hypothetical protein B456_009G224800                    347   2e-115   Gossypium raimondii
gb|AFR42035.1|  alpha-tubulin                                           341   2e-115   Populus alba [abele]
ref|XP_004149645.1|  PREDICTED: tubulin alpha-3 chain-like              350   2e-115   Cucumis sativus [cucumbers]
dbj|BAD94893.1|  tubulin alpha-5 chain-like protein                     341   2e-115   Arabidopsis thaliana [mouse-ear cress]
gb|AFR42054.1|  alpha-tubulin                                           341   2e-115   Populus fremontii
gb|AFR42036.1|  alpha-tubulin                                           341   2e-115   Populus alba [abele]
ref|XP_010054663.1|  PREDICTED: tubulin alpha-3 chain-like              350   3e-115   Eucalyptus grandis [rose gum]
gb|AAO63773.2|  alpha-tubulin 2                                         350   3e-115   Populus tremuloides
ref|XP_006433708.1|  hypothetical protein CICLE_v100015522mg            342   3e-115   
emb|CAD26893.1|  alpha-tubulin                                          350   3e-115   Miscanthus floridulus
gb|AFR42047.1|  alpha-tubulin                                           341   3e-115   Populus fremontii
gb|ABO47738.1|  alpha-tubulin                                           350   4e-115   Gossypium hirsutum [American cotton]
gb|AIC33057.1|  tubulin alpha-1 chain                                   350   4e-115   Panax ginseng [Asiatic ginseng]
gb|EYU34085.1|  hypothetical protein MIMGU_mgv1a0196712mg               341   5e-115   Erythranthe guttata [common monkey flower]
ref|XP_007014666.1|  Tubulin alpha-5                                    349   6e-115   Theobroma cacao [chocolate]
gb|AGV54500.1|  tubulin A                                               349   6e-115   Phaseolus vulgaris [French bean]
emb|CAB76917.1|  alpha-tubulin 4                                        343   7e-115   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP14299.1|  unnamed protein product                                349   8e-115   Coffea canephora [robusta coffee]
ref|XP_010693818.1|  PREDICTED: tubulin alpha-3 chain-like              349   9e-115   Beta vulgaris subsp. vulgaris [field beet]
emb|CAJ38386.1|  alpha tubulin                                          342   1e-114   Plantago major [cart-track plant]
gb|AAW57309.1|  alpha-tubulin                                           342   1e-114   Ceratopteris richardii
gb|KIY91712.1|  Tubulin alpha chain                                     342   1e-114   Monoraphidium neglectum
gb|AAW57310.1|  alpha-tubulin                                           342   1e-114   Ceratopteris richardii
ref|XP_010414865.1|  PREDICTED: tubulin alpha-1 chain                   348   1e-114   Camelina sativa [gold-of-pleasure]
gb|KJB32211.1|  hypothetical protein B456_005G229600                    345   1e-114   Gossypium raimondii
gb|AGI78243.1|  alpha tubulin 5                                         340   2e-114   Caragana korshinskii
gb|KHG19627.1|  Tubulin alpha-3/alpha-5 chain -like protein             348   2e-114   Gossypium arboreum [tree cotton]
emb|CAD24766.1|  alpha-tubulin                                          348   2e-114   Miscanthus sinensis
gb|KDP42087.1|  hypothetical protein JCGZ_01875                         348   2e-114   Jatropha curcas
gb|AGV54721.1|  tubulin alpha-3 chain-like protein                      348   2e-114   Phaseolus vulgaris [French bean]
ref|XP_007161955.1|  hypothetical protein PHAVU_001G111700g             347   3e-114   Phaseolus vulgaris [French bean]
gb|KHN46768.1|  Tubulin alpha-3 chain                                   347   3e-114   Glycine soja [wild soybean]
ref|XP_004252814.1|  PREDICTED: tubulin alpha-2 chain-like              339   4e-114   Solanum lycopersicum
gb|AHJ80819.1|  Tua1                                                    340   4e-114   Eragrostis tef [tef]
ref|XP_008464962.1|  PREDICTED: tubulin alpha-3 chain-like              347   4e-114   Cucumis melo [Oriental melon]
ref|XP_004141134.1|  PREDICTED: tubulin alpha-3 chain-like              347   4e-114   Cucumis sativus [cucumbers]
ref|XP_004493170.1|  PREDICTED: tubulin alpha-3 chain-like              347   4e-114   
gb|ABD92943.1|  alpha tubulin-1B                                        347   4e-114   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003624633.1|  Alpha-tubulin                                      347   5e-114   Medicago truncatula
gb|AHM93474.1|  alpha-tubulin                                           343   5e-114   Camellia chekiangoleosa
gb|ABE01246.1|  alpha tubulin                                           347   6e-114   Camellia sinensis [black tea]
dbj|BAH19954.1|  AT1G50010                                              339   7e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006301274.1|  hypothetical protein CARUB_v10021674mg             347   8e-114   Capsella rubella
ref|XP_003554022.1|  PREDICTED: tubulin alpha-6 chain-like              347   8e-114   Glycine max [soybeans]
gb|KDO81349.1|  hypothetical protein CISIN_1g013037mg                   343   1e-113   Citrus sinensis [apfelsine]
gb|AGV54497.1|  tubulin alpha-3 chain-like protein                      346   1e-113   Phaseolus vulgaris [French bean]
emb|CAD26892.1|  alpha-tubulin                                          346   1e-113   Miscanthus floridulus
emb|CAD26888.1|  alpha-tubulin                                          346   1e-113   Miscanthus transmorrisonensis
gb|KJB58756.1|  hypothetical protein B456_009G224800                    345   1e-113   Gossypium raimondii
dbj|BAF01952.1|  putative tubulin alpha-2/alpha-4 chain                 337   1e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011078787.1|  PREDICTED: tubulin alpha-1 chain-like              345   2e-113   Sesamum indicum [beniseed]
gb|KGN48654.1|  hypothetical protein Csa_6G497050                       344   2e-113   Cucumis sativus [cucumbers]
emb|CAA52158.1|  alpha tubulin                                          338   2e-113   Zea mays [maize]
gb|AAW57306.1|  alpha-tubulin                                           338   3e-113   Ceratopteris richardii
ref|XP_008621874.1|  tubulin alpha                                      338   3e-113   Saprolegnia diclina VS20
gb|KHG20487.1|  Tubulin alpha chain                                     345   4e-113   Gossypium arboreum [tree cotton]
gb|AAW57305.1|  alpha-tubulin                                           339   6e-113   Ceratopteris richardii
ref|NP_176654.1|  tubulin alpha-1 chain                                 344   6e-113   Arabidopsis thaliana [mouse-ear cress]
gb|AAX96763.1|  Tubulin/FtsZ family, GTPase domain, putative            340   6e-113   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009131752.1|  PREDICTED: tubulin alpha-3 chain-like              344   6e-113   Brassica rapa
gb|ABR25378.1|  tubulin alpha 3 chain                                   335   6e-113   Oryza sativa Indica Group [Indian rice]
gb|EYU20672.1|  hypothetical protein MIMGU_mgv1a004180mg                347   6e-113   Erythranthe guttata [common monkey flower]
gb|EKF29047.1|  epsilon tubulin, putative                               337   6e-113   Trypanosoma cruzi marinkellei
gb|EPS62716.1|  alpha-tubulin                                           342   7e-113   Genlisea aurea
gb|ADW83724.1|  alpha-tubulin                                           343   7e-113   Musa acuminata AAA Group [Cavendish banana]
gb|AAO46127.1|  alpha-tubulin                                           337   7e-113   Streblomastix strix
gb|KDO49533.1|  hypothetical protein CISIN_1g013062mg                   343   7e-113   Citrus sinensis [apfelsine]
gb|EKF28172.1|  epsilon tubulin, putative                               337   8e-113   Trypanosoma cruzi marinkellei
emb|CCD11782.1|  unnamed protein product                                337   8e-113   Trypanosoma congolense IL3000
gb|AIX10773.1|  alpha tubulin                                           344   8e-113   Panax notoginseng [san-qi]
ref|XP_002959708.1|  alpha tubulin                                      337   9e-113   Volvox carteri f. nagariensis
ref|XP_003608582.1|  Tubulin alpha-5 chain                              344   9e-113   Medicago truncatula
ref|XP_007515802.1|  alpha-tubulin                                      342   1e-112   Bathycoccus prasinos
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                342   1e-112   Erythranthe guttata [common monkey flower]
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             343   1e-112   Citrus clementina [clementine]
gb|ABL61201.1|  alpha-tubulin                                           338   1e-112   Oxymonadida environmental sample
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   343   1e-112   Populus euphratica
ref|XP_010093625.1|  Tubulin alpha chain                                343   1e-112   Morus notabilis
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                343   1e-112   Elaeis guineensis
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                343   1e-112   Vitis vinifera
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                343   1e-112   Nelumbo nucifera [Indian lotus]
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                343   1e-112   Phoenix dactylifera
ref|XP_001764722.1|  predicted protein                                  343   1e-112   
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                343   1e-112   Phoenix dactylifera
emb|CBH08953.1|  alpha tubulin, (fragment)                              334   1e-112   Trypanosoma brucei gambiense DAL972
emb|CAN62392.1|  hypothetical protein VITISV_016172                     343   1e-112   Vitis vinifera
ref|NP_001289660.1|  tubulin alpha chain-like                           343   1e-112   Eucalyptus grandis [rose gum]
ref|XP_002886753.1|  alpha-1 tubulin                                    343   1e-112   Arabidopsis lyrata subsp. lyrata
ref|XP_007032501.1|  Tubulin alpha-2 chain                              343   1e-112   
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              343   1e-112   Cucumis sativus [cucumbers]
gb|ABR26150.1|  tubulin alpha-3 chain                                   334   1e-112   Oryza sativa Indica Group [Indian rice]
ref|XP_002677064.1|  alpha-tubulin                                      334   1e-112   Naegleria gruberi strain NEG-M
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     343   1e-112   Phoenix dactylifera
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        343   1e-112   Cucumis melo [Oriental melon]
gb|ACN40181.1|  unknown                                                 343   1e-112   Picea sitchensis
ref|XP_002517492.1|  tubulin alpha chain, putative                      343   1e-112   Ricinus communis
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     343   1e-112   Vitis vinifera
ref|XP_002510010.1|  tubulin alpha chain, putative                      343   1e-112   Ricinus communis
gb|ABX57816.1|  alpha tubulin                                           343   1e-112   Picea wilsonii
gb|AAV92352.1|  alpha tubulin 1                                         343   1e-112   Pseudotsuga menziesii var. menziesii
gb|KJB29387.1|  hypothetical protein B456_005G097800                    343   2e-112   Gossypium raimondii
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     343   2e-112   Nelumbo nucifera [Indian lotus]
gb|KHG18997.1|  Tubulin alpha chain                                     343   2e-112   Gossypium arboreum [tree cotton]
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             343   2e-112   Prunus persica
gb|ABO47739.1|  alpha-tubulin                                           343   2e-112   Gossypium hirsutum [American cotton]
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             343   2e-112   Selaginella moellendorffii
gb|AIX10966.1|  tubulin                                                 343   2e-112   Ornithogalum longebracteatum [sea-onion]
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 343   2e-112   Populus trichocarpa [western balsam poplar]
gb|ABK92520.1|  unknown                                                 343   2e-112   Populus trichocarpa [western balsam poplar]
ref|XP_002522104.1|  tubulin alpha chain, putative                      343   2e-112   Ricinus communis
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     343   2e-112   Vitis vinifera
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         343   2e-112   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           343   2e-112   Betula pendula [white birch]
ref|XP_007018369.1|  Tubulin alpha-2 chain                              343   2e-112   Theobroma cacao [chocolate]
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   343   2e-112   Nelumbo nucifera [Indian lotus]
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    343   2e-112   Citrus sinensis [apfelsine]
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             343   2e-112   Citrus clementina [clementine]
gb|KHN08201.1|  Tubulin alpha chain                                     343   2e-112   Glycine soja [wild soybean]
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    343   2e-112   Gossypium hirsutum [American cotton]
gb|ABL61216.1|  alpha-tubulin                                           338   2e-112   Oxymonadida environmental sample
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        343   2e-112   Glycine max [soybeans]
emb|CBH08958.1|  alpha tubulin, (fragment)                              338   2e-112   Trypanosoma brucei gambiense DAL972
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                343   2e-112   Tarenaya hassleriana [spider flower]
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                343   2e-112   Tarenaya hassleriana [spider flower]
gb|AID52921.1|  tubulin alpha chain                                     343   2e-112   Carthamus tinctorius
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                343   2e-112   Prunus dulcis [sweet almond]
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                343   2e-112   Elaeis guineensis
gb|ABQ59633.1|  alpha-tubulin 3                                         343   2e-112   Populus tremuloides
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     343   2e-112   Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     343   2e-112   Pyrus x bretschneideri [bai li]
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                343   2e-112   Nelumbo nucifera [Indian lotus]
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         343   2e-112   Jatropha curcas
ref|XP_010099392.1|  Tubulin alpha chain                                343   2e-112   
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          343   2e-112   Tarenaya hassleriana [spider flower]
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                343   2e-112   Pyrus x bretschneideri [bai li]
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     343   2e-112   Cucumis melo [Oriental melon]
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                343   2e-112   Cucumis sativus [cucumbers]
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                343   2e-112   Elaeis guineensis
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     343   2e-112   Eucalyptus grandis [rose gum]
gb|AGG37285.1|  alpha-tubulin 3                                         343   2e-112   Salix arbutifolia
gb|AFW67749.1|  alpha tubulin4                                          338   2e-112   
gb|AAB36609.1|  alpha-tubulin                                           340   2e-112   Eucalyptus globulus subsp. bicostata
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          343   2e-112   Malus domestica [apple tree]
gb|ABO47736.1|  alpha-tubulin                                           343   2e-112   Gossypium hirsutum [American cotton]
ref|XP_007042689.1|  Tubulin alpha-2 chain                              343   2e-112   Theobroma cacao [chocolate]
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                343   2e-112   Cicer arietinum [garbanzo]
ref|XP_003603670.1|  Tubulin alpha-7 chain                              343   2e-112   Medicago truncatula
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         343   2e-112   Jatropha curcas
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             343   2e-112   Populus trichocarpa [western balsam poplar]
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   343   2e-112   Fragaria vesca subsp. vesca
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             343   2e-112   Prunus persica
gb|AGG37283.1|  alpha-tubulin 1                                         343   2e-112   
gb|ABO47740.1|  alpha-tubulin                                           343   2e-112   
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              343   2e-112   
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             343   2e-112   
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               343   2e-112   
gb|AAD11425.1|  alpha tubulin                                           340   2e-112   
gb|ABO47742.1|  alpha-tubulin                                           343   3e-112   
gb|AEQ75493.1|  alpha-tubulin                                           342   3e-112   
gb|ABL61212.1|  alpha-tubulin                                           338   3e-112   
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             343   3e-112   
ref|XP_002324047.2|  hypothetical protein POPTR_0017s11740g             343   3e-112   
gb|ABL61224.1|  alpha-tubulin                                           338   3e-112   
ref|XP_011398411.1|  Tubulin alpha chain                                340   3e-112   
gb|ABL61215.1|  alpha-tubulin                                           338   3e-112   
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   342   3e-112   
gb|ACK76232.1|  alpha-tubulin                                           342   3e-112   
gb|AEW46684.1|  beta-tubulin                                            342   3e-112   
gb|AGG37289.1|  alpha-tubulin 7                                         342   4e-112   
gb|KDO81348.1|  hypothetical protein CISIN_1g013037mg                   342   4e-112   
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     342   4e-112   
gb|AFW67748.1|  alpha tubulin4                                          339   4e-112   
dbj|BAJ06364.1|  alpha-tubulin                                          342   4e-112   
ref|XP_003558668.1|  PREDICTED: tubulin alpha-2 chain-like              342   4e-112   
emb|CAM58978.1|  alpha tubulin 5                                        335   4e-112   
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   342   4e-112   
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              342   4e-112   
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    342   4e-112   
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                342   4e-112   
gb|AAO46130.1|  alpha-tubulin                                           335   4e-112   
ref|XP_007047652.1|  Tubulin alpha-2 chain                              344   4e-112   
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     342   4e-112   
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        342   4e-112   
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             342   4e-112   
gb|AEE98361.1|  alpha-tubulin                                           335   4e-112   
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             342   5e-112   
gb|ADJ00012.1|  tubulin alpha chain                                     334   5e-112   
gb|ABD92937.1|  alpha tubulin-4A                                        342   5e-112   
gb|ABD92936.1|  alpha tubulin-4D                                        342   5e-112   
ref|XP_005851144.1|  alpha-tubulin                                      342   5e-112   
emb|CAB77671.1|  alpha-tubulin                                          342   5e-112   
ref|XP_010104543.1|  Tubulin alpha chain                                342   5e-112   
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             342   5e-112   
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   342   5e-112   
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             342   5e-112   
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                342   6e-112   
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   342   6e-112   
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          342   6e-112   
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             342   6e-112   
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    342   6e-112   
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              342   6e-112   
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     342   6e-112   
gb|ABC59068.2|  alpha tubulin 1                                         342   6e-112   
gb|KHN42598.1|  Tubulin alpha-2 chain                                   342   6e-112   
gb|KEH43997.1|  tubulin beta-1 chain                                    342   6e-112   
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                342   6e-112   
sp|Q38771.1|TBA_AVESA  RecName: Full=Tubulin alpha chain                342   7e-112   
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    342   7e-112   
gb|EYU34660.1|  hypothetical protein MIMGU_mgv1a006269mg                342   7e-112   
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             342   7e-112   
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    342   7e-112   
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             341   8e-112   
gb|KIZ03400.1|  Tubulin alpha chain                                     342   8e-112   
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    342   8e-112   
gb|ABL61219.1|  alpha-tubulin                                           337   8e-112   
gb|AAO46128.1|  alpha-tubulin                                           334   8e-112   
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             341   8e-112   
gb|ABL61202.1|  alpha-tubulin                                           336   8e-112   
emb|CAB76918.1|  alpha-tubulin 5                                        332   8e-112   
dbj|BAG99724.1|  unnamed protein product                                340   9e-112   
ref|WP_039310890.1|  hypothetical protein                               341   1e-111   
emb|CAB66336.1|  alpha-tubulin                                          341   1e-111   
prf||1503274A  alpha1 tubulin                                           341   1e-111
emb|CDP02221.1|  unnamed protein product                                341   1e-111   
gb|ABF98641.1|  Tubulin alpha-1 chain, putative, expressed              340   1e-111   
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     341   1e-111   
ref|NP_001291325.1|  tubulin alpha chain-like                           341   1e-111   
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     341   1e-111   
gb|ABL61204.1|  alpha-tubulin                                           335   1e-111   
ref|XP_005643073.1|  tubulin alpha chain                                341   1e-111   
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     341   1e-111   
gb|ABL61227.1|  alpha-tubulin                                           336   1e-111   
gb|ABL61213.1|  alpha-tubulin                                           336   1e-111   
gb|AAK37831.1|AF182309_1  alpha-tubulin                                 341   1e-111   
gb|ABL61217.1|  alpha-tubulin                                           336   1e-111   
sp|P33625.1|TBA_EUGGR  RecName: Full=Tubulin alpha chain                341   2e-111   
gb|KIZ01406.1|  Tubulin alpha-1 chain                                   341   2e-111   
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             341   2e-111   
gb|ETM52928.1|  tubulin alpha chain                                     339   2e-111   
ref|XP_005651460.1|  tubulin alpha chain                                340   2e-111   
gb|ABO47737.1|  alpha-tubulin                                           340   2e-111   
ref|XP_002508010.1|  alpha tubulin 2                                    340   2e-111   
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                340   2e-111   
dbj|BAC24800.1|  alpha tubulin                                          340   2e-111   
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                340   2e-111   
gb|ABL61203.1|  alpha-tubulin                                           335   2e-111   
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             340   2e-111   
gb|ADD84794.1|  tubulin-like protein                                    331   2e-111   
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             340   2e-111   
gb|ABQ59634.1|  alpha-tubulin 5                                         340   2e-111   
dbj|BAP59012.1|  alpha tubulin                                          340   2e-111   
gb|KJB34154.1|  hypothetical protein B456_006G050600                    332   2e-111   
ref|XP_010096739.1|  Tubulin alpha chain                                340   2e-111   
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                340   2e-111   
ref|NP_001167663.1|  tubulin alpha-3 chain                              340   2e-111   
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    340   2e-111   
gb|AFC88832.1|  putative tubulin alpha-3 chain                          340   2e-111   
emb|CAA06619.1|  alpha-tubulin 1                                        340   2e-111   
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                340   2e-111   
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             340   2e-111   
gb|AHJ80823.1|  Tua1                                                    340   2e-111   
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              340   2e-111   
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   340   2e-111   
gb|AHJ80817.1|  Tua1                                                    340   3e-111   
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    340   3e-111   
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              340   3e-111   
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              340   3e-111   
dbj|BAJ06362.1|  alpha-tubulin                                          340   3e-111   
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   340   3e-111   
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              340   3e-111   
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   340   3e-111   
emb|CDW82295.1|  alpha tubulin                                          340   3e-111   
tpg|DAA51109.1|  TPA: alpha tubulin                                     340   3e-111   
gb|EJY81124.1|  Alpha tubulin,putative                                  340   3e-111   
emb|CDY29334.1|  BnaA05g16010D                                          339   3e-111   
gb|ABL61214.1|  alpha-tubulin                                           335   3e-111   
gb|ETW27380.1|  tubulin alpha chain                                     335   3e-111   
gb|AFK33477.1|  unknown                                                 337   3e-111   
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             340   3e-111   
ref|XP_002466535.1|  hypothetical protein SORBIDRAFT_01g009570          340   3e-111   
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              340   3e-111   
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                340   3e-111   
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              340   3e-111   
gb|AHJ80815.1|  Tua1                                                    340   3e-111   
ref|XP_003058621.1|  alpha tubulin                                      340   3e-111   
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                340   3e-111   
gb|AGG37287.1|  alpha-tubulin 5                                         340   3e-111   
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     340   3e-111   
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     340   3e-111   
sp|P28287.1|TBA_OXYGR  RecName: Full=Tubulin alpha chain                340   3e-111   
emb|CAD13176.1|  alpha-tubulin                                          340   3e-111   
ref|NP_001275271.1|  alpha-tubulin-like protein                         340   3e-111   
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              340   4e-111   
gb|ABP65320.1|  alpha tubulin                                           340   4e-111   
emb|CDO97305.1|  unnamed protein product                                340   4e-111   
gb|AAG28536.1|AF199019_1  alpha tubulin                                 331   4e-111   
gb|ABB02631.1|  unknown                                                 340   4e-111   
gb|ACH68563.1|  alpha-tubulin                                           340   4e-111   
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              340   4e-111   
ref|XP_007512064.1|  alpha-tubulin                                      340   4e-111   
gb|ABU93324.1|  tubulin alpha subunit                                   340   4e-111   
emb|CDY66630.1|  BnaCnng51680D                                          339   4e-111   
ref|XP_003080933.1|  TBA_CHLVU Tubulin alpha chain (ISS)                340   4e-111   
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     340   4e-111   
gb|ABL61226.1|  alpha-tubulin                                           335   4e-111   
gb|ABV55999.1|  alpha-tubulin 7                                         340   4e-111   
emb|CEG01594.1|  Tubulin/FtsZ, 2-layer sandwich domain                  340   4e-111   
ref|XP_006650524.1|  PREDICTED: tubulin alpha-1 chain-like              340   4e-111   
gb|EWC76931.1|  tubulin alpha chain                                     335   4e-111   
gb|AAT09063.1|  alpha tubulin 1                                         340   5e-111   
gb|EPY40479.1|  tubulin alpha                                           332   5e-111   
gb|AAO46126.1|  alpha-tubulin                                           332   5e-111   
gb|ABU93323.1|  tubulin alpha subunit                                   339   5e-111   
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             339   6e-111   
gb|AIA82435.1|  alpha-tubulin-like protein 03                           339   6e-111   
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   339   6e-111   
emb|CCI45804.1|  unnamed protein product                                339   6e-111   
gb|AAU10519.1|  alpha tubulin                                           332   6e-111   
gb|KHG14074.1|  Tubulin alpha-2 chain                                   337   6e-111   
gb|ACU20294.1|  unknown                                                 335   6e-111   
gb|AIA82433.1|  alpha-tubulin-like protein 01                           339   6e-111   
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          339   6e-111   
ref|XP_002782100.1|  Tubulin alpha chain, putative                      335   6e-111   
ref|XP_001770881.1|  predicted protein                                  339   6e-111   
ref|NP_193232.1|  tubulin alpha-6 chain                                 339   6e-111   
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        339   7e-111   
ref|XP_001419217.1|  predicted protein                                  339   7e-111   
ref|NP_171974.1|  tubulin alpha-4 chain                                 339   7e-111   
ref|XP_006431130.1|  hypothetical protein CICLE_v10011709mg             339   7e-111   
gb|ABL61218.1|  alpha-tubulin                                           334   7e-111   
emb|CAA62916.1|  alpha-tubulin                                          339   7e-111   
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             339   7e-111   
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             339   8e-111   
gb|AAB08791.1|  alpha tubulin                                           339   8e-111   
ref|XP_004489692.1|  PREDICTED: tubulin alpha-3 chain-like              339   8e-111   
emb|CCA20146.1|  alpha tubulin 1 putative                               339   8e-111   
gb|ETM53018.1|  tubulin alpha chain                                     332   8e-111   
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    339   8e-111   
ref|XP_007015700.1|  Tubulin alpha-5, putative                          343   9e-111   
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             339   9e-111   
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                339   9e-111   
ref|NP_001051132.1|  Os03g0726100                                       339   9e-111   
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain             339   9e-111   
gb|ABD92930.1|  alpha tubulin-2A                                        339   9e-111   
emb|CDJ60085.1|  tubulin alpha chain, putative                          338   9e-111   
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              338   9e-111   
ref|XP_002980240.1|  hypothetical protein SELMODRAFT_419896             337   9e-111   
gb|EPR58771.1|  alpha tubulin TUBA1                                     338   1e-110   
ref|XP_008877307.1|  tubulin alpha chain                                335   1e-110   
gb|EPY33355.1|  tubulin alpha                                           334   1e-110   
gb|EPY39349.1|  tubulin alpha                                           333   1e-110   
ref|XP_009537046.1|  hypothetical protein PHYSODRAFT_340566             334   1e-110   
gb|AAB86649.1|  alpha-tubulin                                           338   1e-110   
gb|ABK92552.1|  unknown                                                 338   2e-110   
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    338   2e-110   
gb|ABL61205.1|  alpha-tubulin                                           337   2e-110   
gb|AAB86648.1|  alpha-tubulin                                           338   2e-110   
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                338   2e-110   
gb|ABL61086.1|  alpha-tubulin                                           333   2e-110   
gb|AAX63396.1|  alpha-tubulin                                           338   2e-110   
ref|XP_002951007.1|  alpha tubulin                                      338   2e-110   
gb|ABL61209.1|  alpha-tubulin                                           337   2e-110   
gb|ETM30643.1|  tubulin alpha chain                                     338   2e-110   
gb|ETM52951.1|  tubulin alpha chain                                     338   2e-110   
gb|AIA82436.1|  alpha-tubulin-like protein 04                           338   2e-110   
gb|ABL61208.1|  alpha-tubulin                                           337   2e-110   
dbj|BAB19779.1|  alpha tubulin                                          338   2e-110   
gb|ABL61206.1|  alpha-tubulin                                           337   2e-110   
gb|AAT09064.1|  alpha tubulin 2                                         338   2e-110   
ref|XP_009842456.1|  tubulin alpha chain                                338   2e-110   
gb|ABP65323.1|  alpha tubulin                                           338   2e-110   
ref|XP_008872990.1|  tubulin alpha chain                                338   3e-110   



>ref|XP_008384431.1| PREDICTED: tubulin alpha-3 chain-like [Malus domestica]
Length=282

 Score =   355 bits (911),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQ+S+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  98   IHFMLSSYAPVISAAKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  157

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  158  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  217

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  218  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  265



>gb|ABR25510.1| tubulin alpha-1 chain [Oryza sativa Indica Group]
Length=255

 Score =   352 bits (902),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  70   IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  129

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  130  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  189

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  190  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  237



>emb|CAD20821.1| alpha tubulin [Zea mays]
Length=274

 Score =   352 bits (903),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  89   IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  148

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  149  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  208

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  209  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  256



>dbj|BAH20267.1| AT5G19780 [Arabidopsis thaliana]
Length=284

 Score =   352 bits (904),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  99   IHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  158

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  159  PKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  218

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  219  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  266



>emb|CAL35827.1| alpha-2 tubulin [Plantago major]
Length=249

 Score =   350 bits (899),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 163/168 (97%), Positives = 166/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLS+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  64   IHFMLSSYAPVISAEKAYHEQLSIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  123

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  124  PKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  183

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  184  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  231



>ref|XP_001777110.1| predicted protein [Physcomitrella patens]
 gb|EDQ58103.1| predicted protein [Physcomitrella patens]
Length=344

 Score =   354 bits (908),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  160  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  219

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  220  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  279

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  280  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  327



>emb|CAD20820.1| alpha tubulin [Zea mays]
Length=200

 Score =   348 bits (894),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  15   IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  74

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  75   PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  134

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  135  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  182



>ref|XP_009353129.1| PREDICTED: tubulin alpha-3 chain-like [Pyrus x bretschneideri]
Length=449

 Score =   357 bits (916),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 167/168 (99%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEITS+VFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITSSVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008386829.1| PREDICTED: tubulin alpha-3 chain-like [Malus domestica]
Length=449

 Score =   357 bits (915),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 167/168 (99%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKA+HEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAFHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDP39691.1| hypothetical protein JCGZ_02711 [Jatropha curcas]
Length=449

 Score =   357 bits (915),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 167/168 (99%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KJB83378.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=404

 Score =   354 bits (909),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLS+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  220  IHFMLSSYAPVISAEKAYHEQLSIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  279

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  280  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  339

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  340  AEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  387



>ref|XP_011034391.1| PREDICTED: tubulin alpha-3 chain [Populus euphratica]
Length=449

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/168 (99%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVN+AV+TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNSAVSTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37288.1| alpha-tubulin 6 [Salix arbutifolia]
Length=449

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/168 (99%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVN++VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNSSVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009366459.1| PREDICTED: tubulin alpha-3 chain [Pyrus x bretschneideri]
Length=449

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/168 (99%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKA+HEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAFHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKT+RTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTRRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002525416.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF36906.1| tubulin alpha chain, putative [Ricinus communis]
Length=449

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/168 (99%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKA+HEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAFHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004295008.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/168 (99%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQ+SVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQISVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008349406.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
 ref|XP_008366135.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
 ref|XP_009339175.1| PREDICTED: tubulin alpha-3 chain-like [Pyrus x bretschneideri]
Length=449

 Score =   355 bits (912),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQ+S+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009375870.1| PREDICTED: tubulin alpha-3 chain [Pyrus x bretschneideri]
Length=449

 Score =   355 bits (911),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQ+S+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008351479.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
Length=449

 Score =   355 bits (911),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQ+S+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011089722.1| PREDICTED: tubulin alpha-3 chain [Sesamum indicum]
Length=449

 Score =   355 bits (911),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 166/168 (99%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37290.1| alpha-tubulin 8 [Salix arbutifolia]
Length=449

 Score =   355 bits (910),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQ+SVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQISVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVN+AV+TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNSAVSTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007030078.1| Tubulin alpha-5 [Theobroma cacao]
 gb|EOY10580.1| Tubulin alpha-5 [Theobroma cacao]
Length=482

 Score =   356 bits (913),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 166/168 (99%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVIS+AKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  298  IHFMLSSYAPVISSAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  357

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  358  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  417

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  418  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  465



>emb|CDP17586.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   355 bits (910),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 166/168 (99%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006858944.1| hypothetical protein AMTR_s00068p00090790 [Amborella trichopoda]
 gb|ERN20411.1| hypothetical protein AMTR_s00068p00090790 [Amborella trichopoda]
Length=449

 Score =   355 bits (910),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 166/168 (99%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011021469.1| PREDICTED: tubulin alpha-3 chain-like [Populus euphratica]
Length=449

 Score =   355 bits (910),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQ+SVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQISVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVN+AV+TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNSAVSTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002325422.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
 gb|EEE99803.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
Length=449

 Score =   355 bits (910),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQ+SVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQISVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVN+AV+TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNSAVSTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EYU23006.1| hypothetical protein MIMGU_mgv1a006283mg [Erythranthe guttata]
Length=449

 Score =   354 bits (909),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 166/168 (99%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>tpg|DAA63280.1| TPA: alpha tubulin6 [Zea mays]
Length=320

 Score =   350 bits (897),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  135  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  194

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  195  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  254

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  255  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  302



>sp|P33624.1|TBA2_ANEPH RecName: Full=Tubulin alpha-2 chain, partial [Anemia phyllitidis]
 emb|CAA48928.1| alpha tubulin 2, partial [Anemia phyllitidis]
Length=364

 Score =   351 bits (901),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  181  IHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  240

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  241  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  300

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+K AFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  301  AEVFSRIDHKFDLMYAKLAFVHWYVGEGMEEGEFSEAREDLAALEKDY  348



>gb|AHJ80821.1| Tua3, partial [Eragrostis tef]
Length=401

 Score =   353 bits (905),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  216  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  275

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  276  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  335

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  336  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  383



>tpg|DAA41189.1| TPA: alpha tubulin5 [Zea mays]
Length=320

 Score =   350 bits (897),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  135  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  194

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  195  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  254

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  255  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  302



>ref|XP_002319688.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
 gb|EEE95611.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
Length=449

 Score =   354 bits (909),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 166/168 (99%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRID+KFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDYKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EYU31677.1| hypothetical protein MIMGU_mgv1a006281mg [Erythranthe guttata]
Length=449

 Score =   354 bits (909),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KCW87067.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=381

 Score =   352 bits (902),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  197  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  256

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINY+PPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  257  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYEPPTVVPGGDLAKVQRAVCMISNNTAV  316

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  317  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  364



>ref|XP_009413318.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   354 bits (908),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008240533.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Prunus mume]
Length=449

 Score =   354 bits (908),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNA+VATIKTKRTVQFVDWCPTGFKCGINY+PP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNASVATIKTKRTVQFVDWCPTGFKCGINYEPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007204346.1| hypothetical protein PRUPE_ppa005649mg [Prunus persica]
 gb|EMJ05545.1| hypothetical protein PRUPE_ppa005649mg [Prunus persica]
Length=449

 Score =   354 bits (908),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNA+VATIKTKRTVQFVDWCPTGFKCGINY+PP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNASVATIKTKRTVQFVDWCPTGFKCGINYEPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006286664.1| hypothetical protein CARUB_v10002583mg [Capsella rubella]
 ref|XP_010493056.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 ref|XP_010493058.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 gb|EOA19562.1| hypothetical protein CARUB_v10002583mg [Capsella rubella]
Length=450

 Score =   354 bits (908),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AHZ58481.1| alpha-tubulin, partial [Syntrichia caninervis]
Length=200

 Score =   345 bits (884),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 161/168 (96%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  16   IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  75

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  76   PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  135

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  136  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  183



>gb|AEG74028.1| alpha-tubulin [Pellia endiviifolia (species B)]
 gb|AEG74032.1| alpha-tubulin [Pellia endiviifolia (species B)]
Length=448

 Score =   353 bits (907),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHG26159.1| Tubulin alpha-6 chain [Gossypium arboreum]
Length=449

 Score =   353 bits (907),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNT+V
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHG06160.1| Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum]
Length=449

 Score =   353 bits (907),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011025144.1| PREDICTED: tubulin alpha-3 chain [Populus euphratica]
Length=450

 Score =   353 bits (907),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CDY44941.1| BnaA02g04460D [Brassica napus]
 emb|CDY44942.1| BnaA02g04470D [Brassica napus]
Length=450

 Score =   353 bits (907),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002303998.1| alpha-tubulin 2 family protein [Populus trichocarpa]
 gb|EEE78977.1| alpha-tubulin 2 family protein [Populus trichocarpa]
Length=450

 Score =   353 bits (907),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ACN40824.1| unknown [Picea sitchensis]
Length=449

 Score =   353 bits (907),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47741.1| alpha-tubulin [Gossypium hirsutum]
Length=449

 Score =   353 bits (907),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009406530.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHN06388.1| Tubulin alpha-3 chain [Glycine soja]
Length=421

 Score =   352 bits (904),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  237  IHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  296

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  297  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  356

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  357  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  404



>ref|XP_001777081.1| predicted protein [Physcomitrella patens]
 gb|EDQ58074.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010112637.1| Tubulin alpha-3 chain [Morus notabilis]
 gb|EXC34492.1| Tubulin alpha-3 chain [Morus notabilis]
Length=449

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 166/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009400845.1| PREDICTED: tubulin alpha-3 chain [Musa acuminata subsp. malaccensis]
Length=450

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KJB83375.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=449

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLS+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006445597.1| hypothetical protein CICLE_v10015224mg [Citrus clementina]
 ref|XP_006488930.1| PREDICTED: tubulin alpha-1 chain-like isoform X1 [Citrus sinensis]
 gb|ESR58837.1| hypothetical protein CICLE_v10015224mg [Citrus clementina]
 gb|KDO54446.1| hypothetical protein CISIN_1g013113mg [Citrus sinensis]
Length=449

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010673470.1| PREDICTED: tubulin alpha-3 chain [Beta vulgaris subsp. vulgaris]
Length=449

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLS+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD26887.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008223650.1| PREDICTED: tubulin alpha-3 chain-like [Prunus mume]
Length=450

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQ+S+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KJB44614.1| hypothetical protein B456_007G261000 [Gossypium raimondii]
Length=449

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGD+V
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDIV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNT+V
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_001782790.1| predicted protein [Physcomitrella patens]
 ref|XP_001782813.1| predicted protein [Physcomitrella patens]
 dbj|BAC24799.1| alpha tubulin [Physcomitrella patens]
 gb|EDQ52367.1| predicted protein [Physcomitrella patens]
 gb|EDQ52390.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002285721.1| PREDICTED: tubulin alpha-3 chain [Vitis vinifera]
Length=449

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011075054.1| PREDICTED: tubulin alpha-3 chain-like [Sesamum indicum]
Length=449

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVA+IKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAV
Sbjct  325  PKDVNAAVASIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009408459.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=450

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AHJ80820.1| Tua3, partial [Eragrostis tef]
Length=400

 Score =   351 bits (901),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/168 (96%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPE+T+AVFEPSSMMAKCDPRHGKYMACCLMYRGDV+
Sbjct  215  IHFMLSSYAPVISAEKAYHEQLSVPEVTNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVI  274

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  275  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  334

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  335  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  382



>ref|XP_007205189.1| hypothetical protein PRUPE_ppa005642mg [Prunus persica]
 gb|EMJ06388.1| hypothetical protein PRUPE_ppa005642mg [Prunus persica]
Length=450

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQ+S+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47735.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG06862.1| Tubulin alpha-6 chain [Gossypium arboreum]
 gb|KJB66054.1| hypothetical protein B456_010G125700 [Gossypium raimondii]
 gb|KJB66055.1| hypothetical protein B456_010G125700 [Gossypium raimondii]
Length=449

 Score =   353 bits (905),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37284.1| alpha-tubulin 2 [Salix arbutifolia]
Length=450

 Score =   353 bits (905),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHG06861.1| Tubulin alpha-6 chain [Gossypium arboreum]
Length=460

 Score =   353 bits (906),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  276  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  335

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  336  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  395

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  396  AEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  443



>gb|KHN47983.1| Tubulin alpha-3 chain [Glycine soja]
Length=423

 Score =   352 bits (902),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  238  IHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  297

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  298  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  357

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  358  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  405



>ref|XP_010454260.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 ref|XP_010454262.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
Length=450

 Score =   353 bits (905),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CDY42294.1| BnaC02g09000D [Brassica napus]
 emb|CDY42295.1| BnaC02g09010D [Brassica napus]
Length=450

 Score =   353 bits (905),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010531152.1| PREDICTED: tubulin alpha-3 chain [Tarenaya hassleriana]
Length=449

 Score =   353 bits (905),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008804327.1| PREDICTED: tubulin alpha-1 chain-like [Phoenix dactylifera]
Length=450

 Score =   353 bits (905),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006286795.1| hypothetical protein CARUB_v10003470mg [Capsella rubella]
 gb|EOA19693.1| hypothetical protein CARUB_v10003470mg [Capsella rubella]
Length=450

 Score =   353 bits (905),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 163/168 (97%), Positives = 166/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLS+PEITSAVFEP SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSIPEITSAVFEPGSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV TIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CDX88875.1| BnaA03g07740D [Brassica napus]
 emb|CDX70890.1| BnaC03g09740D [Brassica napus]
Length=450

 Score =   352 bits (904),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_197478.1| tubulin alpha-3 [Arabidopsis thaliana]
 ref|NP_197479.1| tubulin alpha-5 [Arabidopsis thaliana]
 ref|XP_002871906.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002873963.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006400538.1| hypothetical protein EUTSA_v10013521mg [Eutrema salsugineum]
 ref|XP_006400540.1| hypothetical protein EUTSA_v10013523mg [Eutrema salsugineum]
 ref|XP_010420793.1| PREDICTED: tubulin alpha-3 chain [Camelina sativa]
 sp|Q56WH1.2|TBA3_ARATH RecName: Full=Tubulin alpha-3 chain [Arabidopsis thaliana]
 sp|B9DHQ0.2|TBA5_ARATH RecName: Full=Tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAK32888.1|AF367301_1 AT5g19770/T29J13_190 [Arabidopsis thaliana]
 gb|AAA32888.1| alpha-tubulin [Arabidopsis thaliana]
 gb|AAA32891.1| alpha-5 tubulin [Arabidopsis thaliana]
 gb|AAK64169.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAL38340.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85097.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN31860.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN31861.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN28834.1| At5g19770/T29J13_190 [Arabidopsis thaliana]
 gb|AAN65084.1| unknown protein [Arabidopsis thaliana]
 gb|EFH48165.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50222.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 gb|AED92747.1| tubulin alpha-3 [Arabidopsis thaliana]
 gb|AED92748.1| tubulin alpha-5 [Arabidopsis thaliana]
 gb|ESQ41991.1| hypothetical protein EUTSA_v10013521mg [Eutrema salsugineum]
 gb|ESQ41993.1| hypothetical protein EUTSA_v10013523mg [Eutrema salsugineum]
 gb|KFK26213.1| tubulin alpha-3 alpha-5 chain [Arabis alpina]
 gb|KFK26214.1| hypothetical protein AALP_AA8G217400 [Arabis alpina]
Length=450

 Score =   352 bits (904),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008813089.1| PREDICTED: tubulin alpha-3 chain [Phoenix dactylifera]
Length=450

 Score =   352 bits (904),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010257632.1| PREDICTED: tubulin alpha-3 chain [Nelumbo nucifera]
Length=449

 Score =   352 bits (904),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009126391.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   352 bits (904),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 163/168 (97%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010535933.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Tarenaya hassleriana]
Length=449

 Score =   352 bits (904),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABB16994.1| unknown [Solanum tuberosum]
Length=467

 Score =   353 bits (905),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  283  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  342

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  343  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  402

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  403  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  450



>ref|XP_003562846.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=450

 Score =   352 bits (904),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001242878.1| uncharacterized protein LOC100806907 [Glycine max]
 gb|ACU18050.1| unknown [Glycine max]
Length=450

 Score =   352 bits (904),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006579487.1| PREDICTED: tubulin A isoform X1 [Glycine max]
Length=449

 Score =   352 bits (904),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGY80453.1| tubulin [Dendrocalamus latiflorus]
Length=450

 Score =   352 bits (904),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009120857.1| PREDICTED: tubulin alpha-3 chain [Brassica rapa]
 emb|CDX92501.1| BnaA10g15400D [Brassica napus]
 emb|CDX92502.1| BnaA10g15410D [Brassica napus]
Length=450

 Score =   352 bits (904),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 163/168 (97%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD26886.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   352 bits (904),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|Q43473.1|TBA1_HORVU RecName: Full=Tubulin alpha-1 chain [Hordeum vulgare]
 emb|CAA67942.1| alpha-tubulin 1 [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   352 bits (904),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABD92942.1| alpha tubulin-1D [Triticum aestivum]
 gb|ABD92944.1| alpha tubulin-1A [Triticum aestivum]
 gb|EMS54563.1| Tubulin alpha-1 chain [Triticum urartu]
 gb|EMT26472.1| Tubulin alpha-1 chain [Aegilops tauschii]
Length=450

 Score =   352 bits (904),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001237301.1| tubulin A [Glycine max]
 gb|AAX86047.1| tubulin A [Glycine max]
Length=450

 Score =   352 bits (903),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001105324.1| tubulin alpha-5 chain [Zea mays]
 sp|Q02245.1|TBA5_MAIZE RecName: Full=Tubulin alpha-5 chain; AltName: Full=Alpha-5-tubulin 
[Zea mays]
 emb|CAA44862.1| alpha-tubulin #5 [Zea mays]
 gb|AAA33437.1| alpha-tubulin [Zea mays]
 gb|AAA16225.1| alpha-tubulin [Zea mays]
 emb|CAD20822.1| alpha tubulin [Zea mays]
 tpg|DAA41190.1| TPA: alpha tubulin5 [Zea mays]
Length=450

 Score =   352 bits (903),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004958110.1| PREDICTED: tubulin alpha-3 chain-like [Setaria italica]
Length=450

 Score =   352 bits (903),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009126389.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   352 bits (903),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 163/168 (97%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAJ06363.1| alpha-tubulin [Alopecurus aequalis]
Length=450

 Score =   352 bits (903),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010934670.1| PREDICTED: tubulin alpha-3 chain-like [Elaeis guineensis]
Length=450

 Score =   352 bits (903),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD26891.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   352 bits (903),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|O22349.1|TBA3_ELEIN RecName: Full=Tubulin alpha-3 chain; AltName: Full=Alpha-3-tubulin 
[Eleusine indica]
 gb|AAC05719.1| alpha-tubulin 3 [Eleusine indica]
Length=450

 Score =   352 bits (903),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007159433.1| hypothetical protein PHAVU_002G237400g [Phaseolus vulgaris]
 gb|ESW31427.1| hypothetical protein PHAVU_002G237400g [Phaseolus vulgaris]
Length=449

 Score =   352 bits (903),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD24765.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   352 bits (903),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001105588.1| tubulin alpha-6 chain [Zea mays]
 sp|P33627.1|TBA6_MAIZE RecName: Full=Tubulin alpha-6 chain; AltName: Full=Alpha-6-tubulin 
[Zea mays]
 emb|CAA44863.1| alpha-tubulin #6 [Zea mays]
 gb|ACN35801.1| unknown [Zea mays]
 gb|AFE82989.1| tubulin alpha-5 [Saccharum hybrid cultivar]
 tpg|DAA63282.1| TPA: alpha tubulin6 [Zea mays]
Length=450

 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001060075.1| Os07g0574800 [Oryza sativa Japonica Group]
 sp|P28752.1|TBA1_ORYSJ RecName: Full=Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 emb|CAA77988.1| alpha 1 tubulin [Oryza sativa Japonica Group]
 emb|CAA62918.1| alfa-tubulin [Oryza sativa Japonica Group]
 dbj|BAC83168.1| Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 dbj|BAD30236.1| Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 gb|ABG78594.1| alpha-tubulin [Oryza sativa Japonica Group]
 dbj|BAF21989.1| Os07g0574800 [Oryza sativa Japonica Group]
 gb|EAZ04436.1| hypothetical protein OsI_26583 [Oryza sativa Indica Group]
 gb|EAZ40391.1| hypothetical protein OsJ_24840 [Oryza sativa Japonica Group]
 dbj|BAG90561.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91280.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97017.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGH17548.1| alpha tubulin [Oryza sativa]
Length=450

 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGD80034.1| alpha-tubulin 1 [Hevea brasiliensis]
Length=449

 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010044940.1| PREDICTED: tubulin alpha-3 chain [Eucalyptus grandis]
 gb|KCW87066.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=449

 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINY+PPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYEPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006657877.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=450

 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37286.1| alpha-tubulin 4 [Salix arbutifolia]
Length=450

 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 163/168 (97%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIK+KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKSKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002532068.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF30323.1| tubulin alpha chain, putative [Ricinus communis]
Length=449

 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KCW87065.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=458

 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  274  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  333

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINY+PPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  334  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYEPPTVVPGGDLAKVQRAVCMISNNTAV  393

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  394  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  441



>gb|KJB80786.1| hypothetical protein B456_013G115100 [Gossypium raimondii]
Length=449

 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQ+SVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQISVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKR VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRAVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVF+RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFARIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010420792.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
Length=183

 Score =   342 bits (877),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 164/165 (99%), Gaps = 0/165 (0%)
 Frame = -3

Query  772  MLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKD  593
            MLSSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKD
Sbjct  1    MLSSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKD  60

Query  592  VNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEV  413
            VNAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEV
Sbjct  61   VNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEV  120

Query  412  FSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            FSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  121  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  165



>ref|XP_006443441.1| hypothetical protein CICLE_v10020128mg [Citrus clementina]
 ref|XP_006479124.1| PREDICTED: tubulin alpha-3 chain-like [Citrus sinensis]
 gb|ESR56681.1| hypothetical protein CICLE_v10020128mg [Citrus clementina]
Length=449

 Score =   352 bits (902),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 166/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQ+SVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQISVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVN AVATIKTKR VQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAV
Sbjct  325  PKDVNTAVATIKTKRAVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011048194.1| PREDICTED: tubulin alpha-6 chain-like [Populus euphratica]
Length=450

 Score =   352 bits (902),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 163/168 (97%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIK+KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKSKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010923361.1| PREDICTED: tubulin alpha-3 chain [Elaeis guineensis]
Length=450

 Score =   352 bits (902),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009389058.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=450

 Score =   352 bits (902),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002297631.1| alpha-tubulin 2 family protein [Populus trichocarpa]
 gb|ABK92439.1| unknown [Populus trichocarpa]
 gb|EEE82436.1| alpha-tubulin 2 family protein [Populus trichocarpa]
Length=450

 Score =   352 bits (902),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 163/168 (97%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIK+KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKSKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABV55994.1| alpha-tubulin 6 [Populus tremuloides]
Length=449

 Score =   352 bits (902),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 165/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLS PEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSGPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRID+KFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDYKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004504311.1| PREDICTED: tubulin alpha-3 chain-like [Cicer arietinum]
Length=449

 Score =   352 bits (902),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 163/168 (97%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV TIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003629736.1| Alpha-tubulin [Medicago truncatula]
 gb|AET04212.1| tubulin beta-1 chain [Medicago truncatula]
Length=449

 Score =   352 bits (902),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 163/168 (97%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV TIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD24767.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   352 bits (902),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRG+VV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGNVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABR67425.1| alpha-tubulin 4 [Populus tremuloides]
Length=450

 Score =   352 bits (902),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 163/168 (97%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIK+KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKSKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009622332.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009766182.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
Length=449

 Score =   351 bits (901),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KA+HEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAFHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD24768.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   351 bits (901),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/168 (97%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHG+YMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGRYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010528739.1| PREDICTED: tubulin alpha-6 chain-like [Tarenaya hassleriana]
Length=450

 Score =   351 bits (900),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/168 (96%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKA+HEQLSVPEIT++VFEPS+MMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAFHEQLSVPEITTSVFEPSNMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVA+IKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVASIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD26890.1| alpha-tubulin [Miscanthus sinensis subsp. condensatus]
Length=450

 Score =   351 bits (900),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 166/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVI A KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVIPAEKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AFR42026.1| alpha-tubulin, partial [Populus trichocarpa]
Length=196

 Score =   342 bits (876),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  26   IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  85

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  86   PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  145

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  146  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  193



>ref|XP_010276368.1| PREDICTED: tubulin alpha-3 chain-like [Nelumbo nucifera]
Length=450

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/168 (96%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSY+PVIS+ KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYSPVISSEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008449885.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Cucumis melo]
Length=449

 Score =   350 bits (899),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 166/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA VQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLALVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AFR42049.1| alpha-tubulin, partial [Populus fremontii]
Length=197

 Score =   342 bits (876),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  26   IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  85

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  86   PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  145

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  146  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  193



>gb|AFR42020.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42021.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42022.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42023.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42024.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42025.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42027.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42028.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42029.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42030.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42031.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42032.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42033.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42034.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42037.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42038.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42039.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42041.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42045.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42046.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42048.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42056.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42057.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42058.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42059.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42060.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42061.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42062.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42063.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42064.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42065.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42066.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42067.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42068.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42069.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42070.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42071.1| alpha-tubulin, partial [Populus nigra]
Length=197

 Score =   342 bits (876),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  26   IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  85

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  86   PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  145

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  146  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  193



>gb|AFR42042.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42043.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42050.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42051.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42053.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42055.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   341 bits (875),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  23   IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  82

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  83   PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  142

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  143  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  190



>gb|KJB58759.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=340

 Score =   347 bits (889),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  155  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  214

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  215  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  274

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  275  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  322



>gb|AFR42035.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42040.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42044.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42052.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   341 bits (875),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  25   IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  84

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  85   PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  144

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  145  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  192



>ref|XP_004149645.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 ref|XP_004164931.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 gb|KGN54025.1| hypothetical protein Csa_4G268090 [Cucumis sativus]
Length=449

 Score =   350 bits (899),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 166/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA VQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLALVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAD94893.1| tubulin alpha-5 chain-like protein [Arabidopsis thaliana]
Length=183

 Score =   341 bits (874),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 160/165 (97%), Positives = 164/165 (99%), Gaps = 0/165 (0%)
 Frame = -3

Query  772  MLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKD  593
            MLSSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDP+HGKYMACCLMYRGDVVPKD
Sbjct  1    MLSSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPKHGKYMACCLMYRGDVVPKD  60

Query  592  VNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEV  413
            VNAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEV
Sbjct  61   VNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEV  120

Query  412  FSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            FSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  121  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  165



>gb|AFR42054.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   341 bits (875),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  25   IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  84

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  85   PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  144

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  145  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  192



>gb|AFR42036.1| alpha-tubulin, partial [Populus alba]
Length=195

 Score =   341 bits (875),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  24   IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  83

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  84   PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  143

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  144  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  191



>ref|XP_010054663.1| PREDICTED: tubulin alpha-3 chain-like [Eucalyptus grandis]
 gb|KCW89881.1| hypothetical protein EUGRSUZ_A02108 [Eucalyptus grandis]
Length=450

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/168 (97%), Positives = 166/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPS+MMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSNMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVP GDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPSGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
             EVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  VEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAO63773.2| alpha-tubulin 2 [Populus tremuloides]
Length=450

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 166/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAY EQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYREQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006433708.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
 gb|ESR46948.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
Length=218

 Score =   342 bits (876),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 158/168 (94%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KA+HEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  32   IHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  91

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  92   PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  151

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  152  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  199



>emb|CAD26893.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 166/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAA EKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAAHEKDY  432



>gb|AFR42047.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   341 bits (874),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  23   IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  82

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  83   PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  142

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  143  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  190



>gb|ABO47738.1| alpha-tubulin [Gossypium hirsutum]
 gb|KJB40985.1| hypothetical protein B456_007G086400 [Gossypium raimondii]
Length=449

 Score =   350 bits (898),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 163/168 (97%), Positives = 166/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQ+SVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQISVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPAVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AIC33057.1| tubulin alpha-1 chain [Panax ginseng]
Length=449

 Score =   350 bits (897),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQ PTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQAPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
             EVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  VEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EYU34085.1| hypothetical protein MIMGU_mgv1a0196712mg, partial [Erythranthe 
guttata]
Length=217

 Score =   341 bits (875),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 158/168 (94%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT+  FEPSSMM KCDPRHGKYMACCLMYRGDVV
Sbjct  32   IHFMLSSYAPVISAEKAYHEQLSVSEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVV  91

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  92   PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  151

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  152  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  199



>ref|XP_007014666.1| Tubulin alpha-5 [Theobroma cacao]
 gb|EOY32285.1| Tubulin alpha-5 [Theobroma cacao]
Length=449

 Score =   349 bits (896),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 162/168 (96%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KA+HEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAFHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV+TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVSTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGV54500.1| tubulin A [Phaseolus vulgaris]
Length=449

 Score =   349 bits (896),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAB76917.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   343 bits (881),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 158/168 (94%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  103  IHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  162

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  163  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  222

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
             EVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  223  VEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270



>emb|CDP14299.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   349 bits (895),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 163/168 (97%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVIS+AKAYHEQLSVPEIT++VFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISSAKAYHEQLSVPEITNSVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVA+IKTKRTVQFVDWCPTGFKCGINYQPPTVVP GDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVASIKTKRTVQFVDWCPTGFKCGINYQPPTVVPCGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010693818.1| PREDICTED: tubulin alpha-3 chain-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   349 bits (895),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 163/168 (97%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMA CLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITTAVFEPSSMMAKCDPRHGKYMASCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAJ38386.1| alpha tubulin [Plantago major]
Length=270

 Score =   342 bits (878),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 158/168 (94%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT+  FEPSSMM KCDPRHGKYMACCLMYRGDVV
Sbjct  85   IHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVV  144

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  145  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  204

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  205  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  252



>gb|AAW57309.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=266

 Score =   342 bits (877),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 158/168 (94%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  80   IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  139

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  140  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  199

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRID+KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  200  AEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  247



>gb|KIY91712.1| Tubulin alpha chain [Monoraphidium neglectum]
Length=249

 Score =   342 bits (876),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 157/168 (93%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  63   IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVV  122

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNA+VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TAV
Sbjct  123  PKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAV  182

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSR+DHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  183  AEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>gb|AAW57310.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57311.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57313.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=267

 Score =   342 bits (877),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 158/168 (94%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  81   IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  140

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  141  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  200

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRID+KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  201  AEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  248



>ref|XP_010414865.1| PREDICTED: tubulin alpha-1 chain [Camelina sativa]
Length=450

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/168 (95%), Positives = 166/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVIS+AKAYHEQ SVPEIT++VFEPS+MMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISSAKAYHEQFSVPEITTSVFEPSNMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVN AVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNTAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KJB32211.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=361

 Score =   345 bits (886),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  176  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  235

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  236  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  295

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  296  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  343



>gb|AGI78243.1| alpha tubulin 5, partial [Caragana korshinskii]
Length=240

 Score =   340 bits (873),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 158/166 (95%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQ+S+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  75   IHFMLSSYAPVISAEKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  134

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV+ IKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKV RAVCMISNNTAV
Sbjct  135  PKDVNAAVSNIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNNTAV  194

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  284
            AEVFSRID KFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  195  AEVFSRIDQKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  240



>gb|KHG19627.1| Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum]
Length=449

 Score =   348 bits (893),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/168 (96%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHE +SVPEITS VFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEHISVPEITSVVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKR VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRAVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVF+RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFARIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD24766.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   348 bits (893),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/168 (96%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IH MLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHLMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIK KRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKAKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDP42087.1| hypothetical protein JCGZ_01875 [Jatropha curcas]
Length=450

 Score =   348 bits (892),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQ+S+PEIT+AVFEPS+MMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAQKAYHEQISIPEITNAVFEPSNMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLARVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGV54721.1| tubulin alpha-3 chain-like protein [Phaseolus vulgaris]
Length=448

 Score =   348 bits (892),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/168 (96%), Positives = 166/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNA+V+ IK KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNASVSNIKAKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRID+KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007161955.1| hypothetical protein PHAVU_001G111700g [Phaseolus vulgaris]
 gb|ESW33949.1| hypothetical protein PHAVU_001G111700g [Phaseolus vulgaris]
Length=448

 Score =   347 bits (891),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 162/168 (96%), Positives = 166/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNA+V+ IK KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNASVSNIKAKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRID+KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHN46768.1| Tubulin alpha-3 chain [Glycine soja]
Length=443

 Score =   347 bits (891),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 162/168 (96%), Positives = 166/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV+ IKTKRTVQFVDWCPTGFKCGINYQPPTVVP GDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVSNIKTKRTVQFVDWCPTGFKCGINYQPPTVVPAGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVF+RID+KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFARIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004252814.1| PREDICTED: tubulin alpha-2 chain-like [Solanum lycopersicum]
Length=227

 Score =   339 bits (870),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMM KCDPRHGKYMACCLM+RGDVV
Sbjct  41   IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVV  100

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQ+AVCMISN+T+V
Sbjct  101  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQKAVCMISNSTSV  160

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  161  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  208



>gb|AHJ80819.1| Tua1, partial [Eragrostis tef]
Length=243

 Score =   340 bits (871),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 157/168 (93%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  57   IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  116

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+V
Sbjct  117  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSV  176

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
             EVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  177  VEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  224



>ref|XP_008464962.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis melo]
Length=449

 Score =   347 bits (891),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 161/168 (96%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVIS+AKAYHEQLSVPEIT+AVF+PSSMM KCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISSAKAYHEQLSVPEITNAVFDPSSMMVKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+TAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004141134.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 gb|KGN59749.1| Tubulin alpha-3 chain [Cucumis sativus]
Length=449

 Score =   347 bits (891),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 161/168 (96%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVIS+AKAYHEQLSVPEIT+AVF+PSSMM KCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISSAKAYHEQLSVPEITNAVFDPSSMMVKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+TAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004493170.1| PREDICTED: tubulin alpha-3 chain-like [Cicer arietinum]
Length=450

 Score =   347 bits (891),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 160/168 (95%), Positives = 166/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVIS+AKAYHEQ+SVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISSAKAYHEQISVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV+ IKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKV RAVCMISNNTAV
Sbjct  325  PKDVNAAVSNIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABD92943.1| alpha tubulin-1B [Triticum aestivum]
Length=450

 Score =   347 bits (891),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/168 (96%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDWCPTGFKCGI YQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGIKYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVF RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFLRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003624633.1| Alpha-tubulin [Medicago truncatula]
 gb|ABK28851.1| alpha-tubulin [Medicago truncatula]
 gb|ABN08980.1| Tubulin/FtsZ, C-terminal [Medicago truncatula]
 gb|AES80851.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   347 bits (890),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 161/168 (96%), Positives = 166/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVIS+AKAYHEQ+SVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISSAKAYHEQISVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV+ IKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKV RAVCMISNNTAV
Sbjct  325  PKDVNAAVSNIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AHM93474.1| alpha-tubulin, partial [Camellia chekiangoleosa]
Length=327

 Score =   343 bits (879),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 158/168 (94%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMM KCDPRHGKYMACCLMYRGDVV
Sbjct  142  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMYRGDVV  201

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  202  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  261

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  262  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  309



>gb|ABE01246.1| alpha tubulin [Camellia sinensis]
Length=449

 Score =   347 bits (890),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 161/168 (96%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEIT++VFEPS+MMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITNSVFEPSNMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PK VNAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNT V
Sbjct  325  PKGVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTLV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAH19954.1| AT1G50010 [Arabidopsis thaliana]
Length=248

 Score =   339 bits (870),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KA+HEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  63   IHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVV  122

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV TIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  123  PKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  182

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  183  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>ref|XP_006301274.1| hypothetical protein CARUB_v10021674mg [Capsella rubella]
 gb|EOA34172.1| hypothetical protein CARUB_v10021674mg [Capsella rubella]
Length=450

 Score =   347 bits (889),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVIS+AKAYHEQ SVPEIT++VFEPS+MMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISSAKAYHEQFSVPEITTSVFEPSNMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVN AVA IKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNTAVANIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003554022.1| PREDICTED: tubulin alpha-6 chain-like [Glycine max]
 gb|KHN34688.1| Tubulin alpha-3 chain [Glycine soja]
Length=451

 Score =   347 bits (889),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 162/168 (96%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV+ IK KRTVQFVDWCPTGFKCGINYQPPTVVP GDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVSNIKAKRTVQFVDWCPTGFKCGINYQPPTVVPAGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRID+KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDO81349.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=355

 Score =   343 bits (880),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 158/168 (94%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KA+HEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  169  IHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  228

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  229  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  288

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  289  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  336



>gb|AGV54497.1| tubulin alpha-3 chain-like protein [Phaseolus vulgaris]
Length=449

 Score =   346 bits (888),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/168 (96%), Positives = 166/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  266  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  325

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNA+V+ IK KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  326  PKDVNASVSNIKAKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  385

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRID+KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  386  AEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  433



>emb|CAD26892.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   346 bits (887),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/168 (96%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVI A KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVICAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKD NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDDNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD26888.1| alpha-tubulin [Miscanthus transmorrisonensis]
Length=450

 Score =   346 bits (887),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/168 (96%), Positives = 166/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCL+YRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLIYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRTVQFVDW PTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVATIKTKRTVQFVDWRPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KJB58756.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=415

 Score =   345 bits (884),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  230  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  289

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  290  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  349

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  350  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  397



>dbj|BAF01952.1| putative tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=202

 Score =   337 bits (864),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KA+HEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  17   IHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVV  76

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV TIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  77   PKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  136

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  137  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  184



>ref|XP_011078787.1| PREDICTED: tubulin alpha-1 chain-like [Sesamum indicum]
Length=451

 Score =   345 bits (886),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDV 
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITTAVFEPSSMMAKCDPRHGKYMACCLMYRGDVA  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVN AVATIKTKR VQFVDWCPTGFKCGINYQPPTVVPGGDLA+V+RAVCMISNNTAV
Sbjct  325  PKDVNTAVATIKTKRAVQFVDWCPTGFKCGINYQPPTVVPGGDLARVKRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFD+MY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDVMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KGN48654.1| hypothetical protein Csa_6G497050 [Cucumis sativus]
Length=415

 Score =   344 bits (883),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  230  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  289

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  290  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  349

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  350  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  397



>emb|CAA52158.1| alpha tubulin [Zea mays]
Length=256

 Score =   338 bits (868),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  70   IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  129

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+V
Sbjct  130  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSV  189

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
             EVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDL ALEKDY
Sbjct  190  VEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLRALEKDY  237



>gb|AAW57306.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57308.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=257

 Score =   338 bits (867),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMACC+MYRGDVV
Sbjct  71   IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCMMYRGDVV  130

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNA+VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T++
Sbjct  131  PKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSI  190

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSR+DHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKD+
Sbjct  191  AEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDF  238



>ref|XP_008621874.1| tubulin alpha, partial [Saprolegnia diclina VS20]
 gb|EQC24696.1| tubulin alpha, partial [Saprolegnia diclina VS20]
Length=273

 Score =   338 bits (868),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMA CLMYRGDVV
Sbjct  85   IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMAACLMYRGDVV  144

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN +A+
Sbjct  145  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNTSAI  204

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  205  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  252



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score =   345 bits (884),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 160/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSV EIT+  FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVAEITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAW57305.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=306

 Score =   339 bits (870),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 157/168 (93%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  121  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  180

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRA+CMISN+T+V
Sbjct  181  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAICMISNSTSV  240

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  241  AEVFSRIDFKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  288



>ref|NP_176654.1| tubulin alpha-1 chain [Arabidopsis thaliana]
 sp|P11139.1|TBA1_ARATH RecName: Full=Tubulin alpha-1 chain [Arabidopsis thaliana]
 gb|AAD38249.1|AC006193_5 alpha1 tubulin [Arabidopsis thaliana]
 gb|AAA32880.1| alpha-1-tubulin [Arabidopsis thaliana]
 gb|AAL24085.1| putative alpha-tubulin protein [Arabidopsis thaliana]
 gb|AAM14311.1| putative alpha-tubulin protein [Arabidopsis thaliana]
 gb|AEE34279.1| tubulin alpha-1 chain [Arabidopsis thaliana]
Length=450

 Score =   344 bits (883),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 158/168 (94%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVIS+AKAYHEQ SVPEIT++VFEPS+MMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISSAKAYHEQFSVPEITTSVFEPSNMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVN AVA IK KRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNTAVAAIKAKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAX96763.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|ABA92354.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
Length=346

 Score =   340 bits (873),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 157/168 (93%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  160  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  219

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+V
Sbjct  220  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSV  279

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
             EVFSRID KFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  280  VEVFSRIDIKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  327



>ref|XP_009131752.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   344 bits (883),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 160/168 (95%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAV   + KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNAAVGLSRLKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABR25378.1| tubulin alpha 3 chain [Oryza sativa Indica Group]
Length=207

 Score =   335 bits (860),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 157/168 (93%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  21   IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  80

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+V
Sbjct  81   PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSV  140

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
             EVFSRID KFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  141  VEVFSRIDIKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  188



>gb|EYU20672.1| hypothetical protein MIMGU_mgv1a004180mg [Erythranthe guttata]
Length=540

 Score =   347 bits (890),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 161/168 (96%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKA+HEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  356  IHFMLSSYAPVISAAKAFHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  415

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAV
Sbjct  416  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAV  475

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
             EVFSRI+HKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  476  VEVFSRINHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  523



>gb|EKF29047.1| epsilon tubulin, putative, partial [Trypanosoma cruzi marinkellei]
Length=240

 Score =   337 bits (863),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHF+L+SYAPVISA KAYHEQLSV EI++AVFEP+SMM KCDPRHGKYMACCLMYRGDVV
Sbjct  54   IHFVLTSYAPVISAEKAYHEQLSVSEISNAVFEPASMMTKCDPRHGKYMACCLMYRGDVV  113

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+
Sbjct  114  PKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAI  173

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  174  AEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  221



>gb|EPS62716.1| alpha-tubulin, partial [Genlisea aurea]
Length=404

 Score =   342 bits (878),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 158/168 (94%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT+  FEPSSMM KCDPRHGKYMACCLMYRGDVV
Sbjct  219  IHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVV  278

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  279  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  338

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  339  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  386



>gb|ADW83724.1| alpha-tubulin [Musa acuminata AAA Group]
Length=423

 Score =   343 bits (880),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 158/168 (94%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  237  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  296

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+V
Sbjct  297  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSV  356

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  357  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  404



>gb|AAO46127.1| alpha-tubulin [Streblomastix strix]
 gb|AAO46129.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   337 bits (864),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEP++MMAKCDPRHGKYMACC+MYRGDVV
Sbjct  64   IHFMLSSYAPVISAEKAYHEQLSVAEITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVV  123

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFK GINYQPPTVVPGGDLAKVQRAVCMISN+TA+
Sbjct  124  PKDVNAAVATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMISNSTAI  183

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  184  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  231



>gb|KDO49533.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=431

 Score =   343 bits (881),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  246  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  305

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  306  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  365

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  366  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  413



>gb|EKF28172.1| epsilon tubulin, putative [Trypanosoma cruzi marinkellei]
Length=249

 Score =   337 bits (863),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHF+L+SYAPVISA KAYHEQLSV EI++AVFEP+SMM KCDPRHGKYMACCLMYRGDVV
Sbjct  63   IHFVLTSYAPVISAEKAYHEQLSVSEISNAVFEPASMMTKCDPRHGKYMACCLMYRGDVV  122

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+
Sbjct  123  PKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAI  182

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  183  AEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>emb|CCD11782.1| unnamed protein product [Trypanosoma congolense IL3000]
Length=257

 Score =   337 bits (864),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHF+L+SYAPVISA KAYHEQLSV EI++AVFEP+SMM KCDPRHGKYMACCLMYRGDVV
Sbjct  71   IHFVLTSYAPVISAEKAYHEQLSVSEISNAVFEPASMMTKCDPRHGKYMACCLMYRGDVV  130

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+
Sbjct  131  PKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAI  190

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  191  AEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  238



>gb|AIX10773.1| alpha tubulin [Panax notoginseng]
Length=451

 Score =   344 bits (882),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 160/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002959708.1| alpha tubulin [Volvox carteri f. nagariensis]
 gb|EFJ39226.1| alpha tubulin [Volvox carteri f. nagariensis]
Length=255

 Score =   337 bits (864),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAP+ISA KAYHEQLSV EIT+A FEP+SMM KCDPRHGKYMACCLMYRGDVV
Sbjct  69   IHFMLSSYAPIISAEKAYHEQLSVAEITNAAFEPASMMVKCDPRHGKYMACCLMYRGDVV  128

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+
Sbjct  129  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAI  188

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
             E+FSR+DHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKD+
Sbjct  189  GEIFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDF  236



>ref|XP_003608582.1| Tubulin alpha-5 chain [Medicago truncatula]
 gb|AES90779.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   344 bits (882),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007515802.1| alpha-tubulin [Bathycoccus prasinos]
 emb|CCO14681.1| alpha-tubulin [Bathycoccus prasinos]
Length=415

 Score =   342 bits (878),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/168 (93%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  230  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  289

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVA+IKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+
Sbjct  290  PKDVNAAVASIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAI  349

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSR+DHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  350  AEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  397



>gb|EYU37544.1| hypothetical protein MIMGU_mgv1a007145mg [Erythranthe guttata]
Length=417

 Score =   342 bits (878),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  231  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  290

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  291  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  350

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  351  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  398



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61201.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   338 bits (867),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEP++MMAKCDPRHGKYMACC+MYRGDVV
Sbjct  113  IHFMLSSYAPVISAEKAYHEQLSVAEITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVV  172

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+
Sbjct  173  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAI  232

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRID KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  233  AEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  280



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003635553.2| PREDICTED: tubulin alpha chain-like [Vitis vinifera]
Length=451

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008787760.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=451

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008804464.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=450

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CBH08953.1| alpha tubulin, (fragment), partial [Trypanosoma brucei gambiense 
DAL972]
Length=190

 Score =   334 bits (856),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHF+L+SYAPVISA KAYHEQLSV EI++AVFEP+SMM KCDPRHGKYMACCLMYRGDVV
Sbjct  4    IHFVLTSYAPVISAEKAYHEQLSVSEISNAVFEPASMMTKCDPRHGKYMACCLMYRGDVV  63

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+
Sbjct  64   PKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAI  123

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  124  AEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  171



>emb|CAN62392.1| hypothetical protein VITISV_016172 [Vitis vinifera]
Length=435

 Score =   343 bits (879),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  250  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  309

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  310  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  369

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  370  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  417



>ref|NP_001289660.1| tubulin alpha chain-like [Eucalyptus grandis]
 gb|ABS50670.1| alpha-tubulin [Eucalyptus grandis]
Length=451

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002886753.1| alpha-1 tubulin [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63012.1| alpha-1 tubulin [Arabidopsis lyrata subsp. lyrata]
Length=450

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/168 (94%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVIS+AKAYHEQ SV EIT++VFEPS+MMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISSAKAYHEQFSVSEITTSVFEPSNMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVN AVA IKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAV
Sbjct  325  PKDVNTAVAAIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007032501.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY03427.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004136930.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 ref|XP_004155416.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 gb|KGN43837.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABR26150.1| tubulin alpha-3 chain [Oryza sativa Indica Group]
Length=186

 Score =   334 bits (856),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 156/167 (93%), Positives = 162/167 (97%), Gaps = 0/167 (0%)
 Frame = -3

Query  778  HFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVP  599
            HFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVP
Sbjct  1    HFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVP  60

Query  598  KDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVA  419
            KDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+V 
Sbjct  61   KDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVV  120

Query  418  EVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            EVFSRID KFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  121  EVFSRIDIKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  167



>ref|XP_002677064.1| alpha-tubulin [Naegleria gruberi]
 gb|EFC44320.1| alpha-tubulin [Naegleria gruberi]
Length=195

 Score =   334 bits (856),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 155/167 (93%), Positives = 162/167 (97%), Gaps = 0/167 (0%)
 Frame = -3

Query  778  HFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVP  599
            HFML SYAPVISA KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDVVP
Sbjct  8    HFMLCSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVP  67

Query  598  KDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVA  419
            KDVNAAVATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+A
Sbjct  68   KDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIA  127

Query  418  EVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            EVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  128  EVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  174



>ref|XP_008787237.1| PREDICTED: tubulin alpha chain [Phoenix dactylifera]
 ref|XP_010941981.1| PREDICTED: tubulin alpha chain [Elaeis guineensis]
Length=451

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008455054.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Cucumis melo]
Length=451

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ACN40181.1| unknown [Picea sitchensis]
 gb|ACN40840.1| unknown [Picea sitchensis]
Length=450

 Score =   343 bits (880),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002517492.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF45034.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   343 bits (880),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002283198.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
 ref|XP_006827169.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
 ref|XP_010939541.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
 gb|ERM94406.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
Length=450

 Score =   343 bits (880),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISAAKAYHEQLSV EIT+  FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAAKAYHEQLSVAEITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010266793.1| PREDICTED: tubulin alpha chain [Nelumbo nucifera]
Length=451

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AIX10966.1| tubulin [Ornithogalum saundersiae]
Length=451

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002275973.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
Length=450

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010242419.1| PREDICTED: tubulin alpha-1 chain [Nelumbo nucifera]
Length=451

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHN08201.1| Tubulin alpha chain [Glycine soja]
Length=457

 Score =   343 bits (881),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  270  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  329

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  330  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  389

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  437



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYTKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61216.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   338 bits (867),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEP++MMAKCDPRHGKYMACC+MYRGDVV
Sbjct  128  IHFMLSSYAPVISAEKAYHEQLSVAEITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVV  187

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+
Sbjct  188  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAI  247

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRID KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  248  AEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHFMLSSYAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVV
Sbjct  265  IHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVV  324

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V
Sbjct  325  PKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV  384

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CBH08958.1| alpha tubulin, (fragment) [Trypanosoma brucei gambiense DAL972]
Length=303

 Score =   338 bits (866),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  781  IHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVV  602
            IHF+L+SYAPVISA KAYHEQLSV EI++AVFEP+SMM KCDPRHGKYMACCLMYRGDVV
Sbjct  117  IHFVLTSYAPVISAEKAYHEQLSVSEISNAVFEPASMMTKCDPRHGKYMACCLMYRGDVV  176

Query  601  PKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAV  422
            PKDVNAAVATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+
Sbjct  177  PKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAI  236

Query  421  AEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  278
            AEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  237  AEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  284



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1534440539150