BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF033H13

Length=739
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009795485.1|  PREDICTED: uncharacterized protein LOC104242165    209   2e-61   Nicotiana sylvestris
ref|XP_004230605.1|  PREDICTED: uncharacterized protein LOC101261168    208   6e-61   Solanum lycopersicum
emb|CDO97395.1|  unnamed protein product                                190   4e-54   Coffea canephora [robusta coffee]
ref|XP_009595944.1|  PREDICTED: uncharacterized protein LOC104092128    191   4e-53   
ref|XP_011088137.1|  PREDICTED: uncharacterized protein LOC105169445    182   4e-51   Sesamum indicum [beniseed]
ref|XP_007042870.1|  Nuclear transcription factor Y subunit C-4, ...    176   1e-48   
ref|XP_003527872.2|  PREDICTED: uncharacterized protein LOC100793605    166   6e-47   
ref|XP_003522750.2|  PREDICTED: uncharacterized protein LOC100789170    168   6e-47   Glycine max [soybeans]
ref|XP_003544241.1|  PREDICTED: uncharacterized protein LOC100781768    166   1e-46   
ref|XP_003518255.1|  PREDICTED: uncharacterized protein LOC100814797    166   1e-46   Glycine max [soybeans]
ref|XP_011462229.1|  PREDICTED: uncharacterized protein LOC105350910    169   3e-46   Fragaria vesca subsp. vesca
ref|XP_002283891.2|  PREDICTED: uncharacterized protein LOC100247170    168   1e-45   
ref|XP_008223356.1|  PREDICTED: uncharacterized protein LOC103323165    168   1e-45   Prunus mume [ume]
ref|XP_002273743.3|  PREDICTED: uncharacterized protein LOC100249012    168   2e-45   
gb|KDP26665.1|  hypothetical protein JCGZ_17823                         167   2e-45   Jatropha curcas
ref|XP_002522625.1|  conserved hypothetical protein                     165   7e-45   
gb|EYU39115.1|  hypothetical protein MIMGU_mgv1a027069mg                166   7e-45   Erythranthe guttata [common monkey flower]
ref|XP_002310494.2|  hypothetical protein POPTR_0007s03500g             166   8e-45   
ref|XP_010030014.1|  PREDICTED: uncharacterized protein LOC104419886    165   1e-44   Eucalyptus grandis [rose gum]
ref|XP_010273765.1|  PREDICTED: uncharacterized protein LOC104609205    164   4e-44   Nelumbo nucifera [Indian lotus]
ref|XP_011016907.1|  PREDICTED: uncharacterized protein LOC105120427    164   6e-44   Populus euphratica
ref|XP_011023096.1|  PREDICTED: uncharacterized protein LOC105124692    164   6e-44   Populus euphratica
gb|AES98227.2|  transmembrane protein, putative                         164   7e-44   Medicago truncatula
gb|KJB29354.1|  hypothetical protein B456_005G0963001                   160   1e-43   Gossypium raimondii
gb|KJB32109.1|  hypothetical protein B456_005G224700                    163   1e-43   Gossypium raimondii
ref|XP_007141255.1|  hypothetical protein PHAVU_008G180600g             157   2e-43   Phaseolus vulgaris [French bean]
ref|XP_008219312.1|  PREDICTED: uncharacterized protein LOC103319539    160   3e-43   
ref|XP_003615269.1|  hypothetical protein MTR_5g065970                  163   3e-43   
ref|XP_007137646.1|  hypothetical protein PHAVU_009G143900g             158   3e-43   Phaseolus vulgaris [French bean]
ref|XP_004501628.1|  PREDICTED: uncharacterized protein LOC101506643    162   3e-43   Cicer arietinum [garbanzo]
ref|XP_002301090.2|  hypothetical protein POPTR_0002s10470g             161   3e-43   
ref|XP_010064231.1|  PREDICTED: uncharacterized protein LOC104451216    161   5e-43   Eucalyptus grandis [rose gum]
ref|XP_009375494.1|  PREDICTED: uncharacterized protein LOC103964299    160   1e-42   Pyrus x bretschneideri [bai li]
ref|XP_008347812.1|  PREDICTED: uncharacterized protein LOC103410942    160   1e-42   Malus domestica [apple tree]
gb|KJB59886.1|  hypothetical protein B456_009G279400                    160   1e-42   Gossypium raimondii
ref|XP_004490432.1|  PREDICTED: uncharacterized protein LOC101499123    160   1e-42   
ref|XP_008390578.1|  PREDICTED: uncharacterized protein LOC103452820    160   2e-42   
ref|XP_007226906.1|  hypothetical protein PRUPE_ppa016217mg             160   2e-42   
ref|XP_003602935.1|  hypothetical protein MTR_3g100550                  160   2e-42   
ref|XP_009342577.1|  PREDICTED: uncharacterized protein LOC103934551    159   2e-42   Pyrus x bretschneideri [bai li]
ref|XP_008352712.1|  PREDICTED: uncharacterized protein LOC103416231    159   2e-42   
ref|XP_009374286.1|  PREDICTED: uncharacterized protein LOC103963226    159   2e-42   Pyrus x bretschneideri [bai li]
ref|XP_004301360.1|  PREDICTED: uncharacterized protein LOC101307700    159   3e-42   Fragaria vesca subsp. vesca
ref|XP_011043120.1|  PREDICTED: uncharacterized protein LOC105138666    159   3e-42   Populus euphratica
ref|XP_007018202.1|  Uncharacterized protein TCM_034490                 160   4e-42   
ref|XP_009774622.1|  PREDICTED: uncharacterized protein LOC104224639    158   2e-41   Nicotiana sylvestris
ref|XP_004136424.1|  PREDICTED: uncharacterized protein LOC101205953    154   2e-41   Cucumis sativus [cucumbers]
ref|XP_006597360.1|  PREDICTED: uncharacterized protein LOC102659744    156   3e-41   Glycine max [soybeans]
gb|KDP27984.1|  hypothetical protein JCGZ_19064                         156   4e-41   Jatropha curcas
ref|XP_008340704.1|  PREDICTED: uncharacterized protein LOC103403638    156   4e-41   Malus domestica [apple tree]
ref|XP_002323954.2|  hypothetical protein POPTR_0017s07500g             155   5e-41   Populus trichocarpa [western balsam poplar]
ref|XP_011092449.1|  PREDICTED: uncharacterized protein LOC105172627    155   6e-41   
ref|XP_008466168.1|  PREDICTED: uncharacterized protein LOC103503664    153   6e-41   Cucumis melo [Oriental melon]
ref|XP_009618057.1|  PREDICTED: uncharacterized protein LOC104110298    156   7e-41   Nicotiana tomentosiformis
emb|CDP11491.1|  unnamed protein product                                156   8e-41   Coffea canephora [robusta coffee]
gb|KDP41466.1|  hypothetical protein JCGZ_15873                         155   1e-40   Jatropha curcas
ref|XP_002514025.1|  conserved hypothetical protein                     155   1e-40   Ricinus communis
ref|XP_010939748.1|  PREDICTED: uncharacterized protein LOC105058495    153   6e-40   Elaeis guineensis
ref|XP_004504833.1|  PREDICTED: uncharacterized protein LOC101507733    152   9e-40   Cicer arietinum [garbanzo]
ref|XP_010675283.1|  PREDICTED: uncharacterized protein LOC104891302    152   2e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010272926.1|  PREDICTED: uncharacterized protein LOC104608592    151   3e-39   Nelumbo nucifera [Indian lotus]
gb|AFK37639.1|  unknown                                                 150   5e-39   Medicago truncatula
ref|XP_003608416.1|  hypothetical protein MTR_4g093860                  150   5e-39   Medicago truncatula
ref|XP_004252809.1|  PREDICTED: uncharacterized protein LOC101251865    149   2e-38   Solanum lycopersicum
ref|XP_009413889.1|  PREDICTED: uncharacterized protein LOC103995101    148   3e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010548868.1|  PREDICTED: uncharacterized protein LOC104820197    149   3e-38   Tarenaya hassleriana [spider flower]
gb|AFK34019.1|  unknown                                                 144   6e-38   Lotus japonicus
ref|XP_006301429.1|  hypothetical protein CARUB_v10021847mg             147   9e-38   Capsella rubella
gb|KFK40909.1|  hypothetical protein AALP_AA2G059000                    147   1e-37   Arabis alpina [alpine rockcress]
gb|EPS65863.1|  hypothetical protein M569_08912                         145   1e-37   Genlisea aurea
ref|XP_006338079.1|  PREDICTED: uncharacterized protein LOC102584542    147   1e-37   Solanum tuberosum [potatoes]
ref|XP_010470285.1|  PREDICTED: uncharacterized protein LOC104750...    146   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010511088.1|  PREDICTED: uncharacterized protein LOC104787248    145   4e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006392327.1|  hypothetical protein EUTSA_v10023489mg             145   5e-37   Eutrema salsugineum [saltwater cress]
ref|XP_010470286.1|  PREDICTED: uncharacterized protein LOC104750...    145   6e-37   Camelina sativa [gold-of-pleasure]
ref|XP_002886704.1|  hypothetical protein ARALYDRAFT_475423             145   7e-37   Arabidopsis lyrata subsp. lyrata
emb|CDY23810.1|  BnaA01g21610D                                          142   9e-37   Brassica napus [oilseed rape]
ref|XP_004237982.2|  PREDICTED: uncharacterized protein LOC101250984    143   1e-36   
emb|CDY29160.1|  BnaC09g15570D                                          144   1e-36   Brassica napus [oilseed rape]
gb|AAG50763.1|AC079131_8  hypothetical protein                          144   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009588038.1|  PREDICTED: uncharacterized protein LOC104085654    144   1e-36   Nicotiana tomentosiformis
ref|XP_009113331.1|  PREDICTED: uncharacterized protein LOC103838632    144   1e-36   Brassica rapa
gb|AEM45875.1|  hypothetical protein                                    144   2e-36   Brassica rapa subsp. oleifera [biennial turnip rape]
emb|CDY39912.1|  BnaA09g14940D                                          144   2e-36   Brassica napus [oilseed rape]
ref|NP_176109.2|  uncharacterized protein                               144   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010414766.1|  PREDICTED: uncharacterized protein LOC104700863    143   3e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010544075.1|  PREDICTED: uncharacterized protein LOC104816801    143   4e-36   Tarenaya hassleriana [spider flower]
ref|XP_009770120.1|  PREDICTED: uncharacterized protein LOC104220858    142   9e-36   Nicotiana sylvestris
ref|XP_009102651.1|  PREDICTED: uncharacterized protein LOC103828765    142   1e-35   Brassica rapa
emb|CDY46867.1|  BnaC01g27710D                                          141   2e-35   Brassica napus [oilseed rape]
ref|XP_009381478.1|  PREDICTED: uncharacterized protein LOC103969619    140   6e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010099469.1|  hypothetical protein L484_011169                   132   7e-32   
gb|KHN08240.1|  hypothetical protein glysoja_017718                     123   3e-31   Glycine soja [wild soybean]
ref|XP_009387165.1|  PREDICTED: uncharacterized protein LOC103974130    128   6e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN26129.1|  hypothetical protein glysoja_019453                     120   6e-30   Glycine soja [wild soybean]
gb|KHN25062.1|  hypothetical protein glysoja_046599                     119   7e-30   Glycine soja [wild soybean]
ref|XP_009404440.1|  PREDICTED: uncharacterized protein LOC103987768    125   9e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007223120.1|  hypothetical protein PRUPE_ppa007125mg             120   3e-28   
ref|XP_010916833.1|  PREDICTED: uncharacterized protein LOC105041590    119   2e-27   
emb|CAN73947.1|  hypothetical protein VITISV_032248                     119   2e-27   Vitis vinifera
ref|XP_010269428.1|  PREDICTED: uncharacterized protein LOC104606076    114   5e-27   
ref|XP_006841211.1|  hypothetical protein AMTR_s00135p00032540          115   3e-26   Amborella trichopoda
ref|XP_006657971.1|  PREDICTED: uncharacterized protein LOC102715955    114   7e-26   Oryza brachyantha
emb|CBI19248.3|  unnamed protein product                                107   1e-23   Vitis vinifera
ref|XP_009389561.1|  PREDICTED: uncharacterized protein LOC103976099    107   2e-23   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO81145.1|  hypothetical protein CISIN_1g016299mg                   104   1e-22   Citrus sinensis [apfelsine]
gb|EEE67606.1|  hypothetical protein OsJ_25158                          104   2e-22   Oryza sativa Japonica Group [Japonica rice]
gb|KCW66620.1|  hypothetical protein EUGRSUZ_F00410                     102   7e-22   Eucalyptus grandis [rose gum]
gb|EEC82462.1|  hypothetical protein OsI_26902                          102   1e-21   Oryza sativa Indica Group [Indian rice]
ref|NP_001060302.1|  Os07g0620600                                       102   1e-21   
ref|XP_006433845.1|  hypothetical protein CICLE_v10003130mg           85.5    2e-16   
ref|XP_008775001.1|  PREDICTED: uncharacterized protein LOC103695445  73.6    9e-12   Phoenix dactylifera
ref|XP_002526697.1|  conserved hypothetical protein                   73.9    9e-12   
gb|KDO43414.1|  hypothetical protein CISIN_1g038765mg                 68.9    1e-11   Citrus sinensis [apfelsine]
gb|KJB29352.1|  hypothetical protein B456_005G0962001                 65.5    1e-10   Gossypium raimondii
gb|AFK46323.1|  unknown                                               65.5    1e-10   Lotus japonicus
ref|XP_010107693.1|  hypothetical protein L484_007712                 65.1    1e-10   
ref|XP_010038433.1|  PREDICTED: uncharacterized protein LOC104426933  67.0    2e-09   Eucalyptus grandis [rose gum]
emb|CDP19944.1|  unnamed protein product                              66.6    3e-09   Coffea canephora [robusta coffee]
ref|XP_004148602.1|  PREDICTED: uncharacterized protein LOC101209474  65.9    5e-09   Cucumis sativus [cucumbers]
ref|XP_004172269.1|  PREDICTED: uncharacterized LOC101209474          65.9    5e-09   
ref|XP_008464242.1|  PREDICTED: uncharacterized protein LOC103502172  65.9    5e-09   Cucumis melo [Oriental melon]
ref|XP_004156629.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  65.1    8e-09   
ref|XP_004137689.1|  PREDICTED: uncharacterized protein LOC101205174  65.1    9e-09   Cucumis sativus [cucumbers]
ref|XP_004500447.1|  PREDICTED: uncharacterized protein LOC101506752  64.3    1e-08   Cicer arietinum [garbanzo]
ref|XP_010921054.1|  PREDICTED: uncharacterized protein LOC105044755  63.5    3e-08   Elaeis guineensis
ref|XP_010277645.1|  PREDICTED: uncharacterized protein LOC104612037  63.5    3e-08   Nelumbo nucifera [Indian lotus]
gb|KFK24641.1|  hypothetical protein AALP_AA8G005900                  62.4    8e-08   Arabis alpina [alpine rockcress]
ref|XP_010264515.1|  PREDICTED: uncharacterized protein LOC104602499  62.0    8e-08   Nelumbo nucifera [Indian lotus]
ref|XP_008442352.1|  PREDICTED: uncharacterized protein LOC103486248  62.0    9e-08   Cucumis melo [Oriental melon]
dbj|BAC75560.1|  hypothetical protein                                 61.6    1e-07   Oryza sativa Japonica Group [Japonica rice]
gb|KJB77076.1|  hypothetical protein B456_012G119400                  61.2    1e-07   Gossypium raimondii
ref|NP_001175347.1|  Os07g0692401                                     61.2    2e-07   
ref|XP_008384718.1|  PREDICTED: uncharacterized protein LOC103447298  60.8    2e-07   
ref|XP_010423986.1|  PREDICTED: uncharacterized protein LOC104709020  60.8    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010451944.1|  PREDICTED: uncharacterized protein LOC104734132  60.5    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_009774872.1|  PREDICTED: uncharacterized protein LOC104224855  60.5    3e-07   Nicotiana sylvestris
ref|XP_010093564.1|  hypothetical protein L484_014002                 59.3    3e-07   
ref|XP_006289569.1|  hypothetical protein CARUB_v10003115mg           60.1    5e-07   Capsella rubella
ref|XP_002272461.1|  PREDICTED: uncharacterized protein LOC100265673  59.7    5e-07   Vitis vinifera
ref|XP_008804157.1|  PREDICTED: uncharacterized protein LOC103717510  59.7    6e-07   
gb|EYU41971.1|  hypothetical protein MIMGU_mgv1a027046mg              59.7    6e-07   Erythranthe guttata [common monkey flower]
ref|XP_006481123.1|  PREDICTED: uncharacterized protein LOC102608338  59.3    7e-07   Citrus sinensis [apfelsine]
ref|XP_006429503.1|  hypothetical protein CICLE_v10011494mg           59.3    7e-07   Citrus clementina [clementine]
gb|KDO63279.1|  hypothetical protein CISIN_1g010086mg                 59.3    7e-07   Citrus sinensis [apfelsine]
ref|XP_011015027.1|  PREDICTED: uncharacterized protein LOC105118715  59.3    8e-07   Populus euphratica
ref|XP_010490518.1|  PREDICTED: uncharacterized protein LOC104768289  58.9    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_011095084.1|  PREDICTED: uncharacterized protein LOC105174622  58.9    1e-06   
ref|XP_002264939.1|  PREDICTED: uncharacterized protein LOC100263765  58.5    1e-06   Vitis vinifera
ref|XP_010543177.1|  PREDICTED: uncharacterized protein LOC104816178  58.5    1e-06   Tarenaya hassleriana [spider flower]
emb|CAN65583.1|  hypothetical protein VITISV_019793                   57.8    1e-06   Vitis vinifera
ref|XP_008231499.1|  PREDICTED: uncharacterized protein LOC103330643  58.2    2e-06   Prunus mume [ume]
gb|AFW71483.1|  hypothetical protein ZEAMMB73_430632                  57.8    2e-06   
ref|XP_006398590.1|  hypothetical protein EUTSA_v10015877mg           58.2    2e-06   Eutrema salsugineum [saltwater cress]
gb|KCW49402.1|  hypothetical protein EUGRSUZ_K02942                   57.8    2e-06   Eucalyptus grandis [rose gum]
ref|XP_008647032.1|  PREDICTED: uncharacterized protein LOC103628641  57.8    3e-06   
ref|XP_007208450.1|  hypothetical protein PRUPE_ppa004250mg           57.8    3e-06   Prunus persica
ref|NP_001143103.1|  hypothetical protein precursor                   57.8    3e-06   Zea mays [maize]
ref|NP_195791.1|  methyltransferase                                   57.4    3e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CDX80754.1|  BnaC03g00080D                                        57.4    3e-06   
dbj|BAJ97336.1|  predicted protein                                    57.4    4e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA64242.1|  TPA: hypothetical protein ZEAMMB73_693239            54.3    4e-06   
ref|NP_001169287.1|  hypothetical protein                             57.4    4e-06   Zea mays [maize]
ref|XP_007026550.1|  Methyltransferases                               57.4    4e-06   
ref|XP_009125399.1|  PREDICTED: uncharacterized protein LOC103850409  57.4    4e-06   Brassica rapa
ref|XP_002870902.1|  hypothetical protein ARALYDRAFT_486898           57.4    4e-06   
ref|XP_011080707.1|  PREDICTED: uncharacterized protein LOC105163...  57.0    4e-06   Sesamum indicum [beniseed]
ref|XP_004246304.1|  PREDICTED: uncharacterized protein LOC101267731  57.0    4e-06   Solanum lycopersicum
ref|XP_006658171.1|  PREDICTED: uncharacterized protein LOC102700724  57.0    4e-06   Oryza brachyantha
emb|CDY11183.1|  BnaA03g00190D                                        57.0    5e-06   Brassica napus [oilseed rape]
ref|XP_010233621.1|  PREDICTED: uncharacterized protein LOC104583389  56.6    5e-06   Brachypodium distachyon [annual false brome]
gb|KHN40685.1|  hypothetical protein glysoja_001183                   56.2    5e-06   Glycine soja [wild soybean]
ref|XP_009342226.1|  PREDICTED: uncharacterized protein LOC103934219  56.6    5e-06   
ref|XP_006828158.1|  hypothetical protein AMTR_s00023p00093390        56.6    6e-06   Amborella trichopoda
gb|EYU45992.1|  hypothetical protein MIMGU_mgv1a025887mg              56.6    6e-06   Erythranthe guttata [common monkey flower]
ref|XP_004492512.1|  PREDICTED: uncharacterized protein LOC101509260  56.6    6e-06   Cicer arietinum [garbanzo]
gb|KDP22815.1|  hypothetical protein JCGZ_00402                       56.6    6e-06   Jatropha curcas
ref|XP_008370209.1|  PREDICTED: uncharacterized protein LOC103433716  56.6    7e-06   
ref|XP_009130631.1|  PREDICTED: uncharacterized protein LOC103855402  56.2    8e-06   Brassica rapa
ref|XP_007208593.1|  hypothetical protein PRUPE_ppa022624mg           56.2    8e-06   Prunus persica
ref|XP_002461266.1|  hypothetical protein SORBIDRAFT_02g043860        56.2    8e-06   Sorghum bicolor [broomcorn]
gb|EPS62213.1|  hypothetical protein M569_12578                       56.2    8e-06   Genlisea aurea
ref|XP_009373100.1|  PREDICTED: uncharacterized protein LOC103962151  56.2    8e-06   Pyrus x bretschneideri [bai li]
ref|XP_001771643.1|  predicted protein                                55.8    1e-05   
ref|XP_009781173.1|  PREDICTED: uncharacterized protein LOC104230131  55.8    1e-05   Nicotiana sylvestris
ref|XP_004987042.1|  PREDICTED: uncharacterized protein LOC101779612  55.8    1e-05   Setaria italica
ref|XP_004497494.1|  PREDICTED: uncharacterized protein LOC101500848  55.8    1e-05   Cicer arietinum [garbanzo]
ref|XP_011019055.1|  PREDICTED: uncharacterized protein LOC105121895  55.5    1e-05   Populus euphratica
ref|XP_009412633.1|  PREDICTED: uncharacterized protein LOC103994078  55.5    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP19032.1|  unnamed protein product                              55.5    1e-05   Coffea canephora [robusta coffee]
ref|XP_010937964.1|  PREDICTED: uncharacterized protein LOC105057170  55.5    2e-05   Elaeis guineensis
ref|XP_008244798.1|  PREDICTED: uncharacterized protein LOC103342911  55.5    2e-05   
gb|KHN02118.1|  hypothetical protein glysoja_028321                   51.6    2e-05   Glycine soja [wild soybean]
ref|XP_004958788.1|  PREDICTED: uncharacterized protein LOC101783448  55.1    2e-05   Setaria italica
ref|XP_008369759.1|  PREDICTED: uncharacterized protein LOC103433285  55.1    2e-05   
gb|EMS66683.1|  hypothetical protein TRIUR3_26284                     54.3    2e-05   Triticum urartu
ref|XP_006603554.1|  PREDICTED: uncharacterized protein LOC102670512  55.1    2e-05   
ref|XP_009615562.1|  PREDICTED: uncharacterized protein LOC104108275  55.1    2e-05   Nicotiana tomentosiformis
ref|XP_007205122.1|  hypothetical protein PRUPE_ppa004877mg           54.7    2e-05   
ref|XP_002465406.1|  hypothetical protein SORBIDRAFT_01g038110        54.7    3e-05   
gb|EMT30745.1|  hypothetical protein F775_21759                       53.9    3e-05   
ref|XP_006381463.1|  hypothetical protein POPTR_0006s13070g           54.3    4e-05   Populus trichocarpa [western balsam poplar]
ref|XP_009349043.1|  PREDICTED: uncharacterized protein LOC103940618  54.3    4e-05   Pyrus x bretschneideri [bai li]
ref|XP_010553127.1|  PREDICTED: uncharacterized protein LOC104823307  54.3    4e-05   Tarenaya hassleriana [spider flower]
ref|XP_011048563.1|  PREDICTED: uncharacterized protein LOC105142571  53.9    4e-05   Populus euphratica
ref|XP_004296044.1|  PREDICTED: uncharacterized protein LOC101312240  53.9    5e-05   Fragaria vesca subsp. vesca
ref|XP_004302571.1|  PREDICTED: uncharacterized protein LOC101290967  53.9    5e-05   Fragaria vesca subsp. vesca
ref|XP_009606484.1|  PREDICTED: uncharacterized protein LOC104100...  53.9    5e-05   
ref|XP_008809973.1|  PREDICTED: uncharacterized protein LOC103721505  53.9    5e-05   
ref|XP_008359661.1|  PREDICTED: uncharacterized protein LOC103423371  53.1    5e-05   
gb|KEH42250.1|  peptide upstream ORF protein, putative                53.9    6e-05   Medicago truncatula
ref|XP_003623416.1|  hypothetical protein MTR_7g070530                53.5    7e-05   Medicago truncatula
tpg|DAA41831.1|  TPA: hypothetical protein ZEAMMB73_867074            53.5    7e-05   
ref|XP_008387644.1|  PREDICTED: uncharacterized protein LOC103450101  53.1    8e-05   
ref|XP_008366676.1|  PREDICTED: uncharacterized protein LOC103430317  53.1    8e-05   
ref|XP_003516409.1|  PREDICTED: uncharacterized protein LOC100811015  53.1    9e-05   
gb|KHN44850.1|  hypothetical protein glysoja_024421                   52.8    9e-05   Glycine soja [wild soybean]
ref|XP_008243928.1|  PREDICTED: uncharacterized protein LOC103342124  53.1    1e-04   Prunus mume [ume]
gb|KHN33252.1|  hypothetical protein glysoja_027939                   52.8    1e-04   Glycine soja [wild soybean]
gb|KHN29556.1|  hypothetical protein glysoja_005280                   52.4    1e-04   Glycine soja [wild soybean]
ref|XP_007140185.1|  hypothetical protein PHAVU_008G091100g           52.8    1e-04   Phaseolus vulgaris [French bean]
ref|XP_007134628.1|  hypothetical protein PHAVU_010G062900g           52.8    1e-04   Phaseolus vulgaris [French bean]
ref|XP_007145226.1|  hypothetical protein PHAVU_007G221200g           52.4    1e-04   Phaseolus vulgaris [French bean]
ref|XP_004506826.1|  PREDICTED: uncharacterized protein LOC101508795  52.4    2e-04   Cicer arietinum [garbanzo]
gb|AGV54215.1|  hypothetical protein                                  52.4    2e-04   Phaseolus vulgaris [French bean]
ref|XP_007017010.1|  Methyltransferase                                52.4    2e-04   
ref|XP_006360824.1|  PREDICTED: uncharacterized protein LOC102590367  52.4    2e-04   Solanum tuberosum [potatoes]
gb|KFK34589.1|  hypothetical protein AALP_AA5G165500                  52.0    2e-04   Arabis alpina [alpine rockcress]
ref|XP_009342781.1|  PREDICTED: uncharacterized protein LOC103934759  52.0    2e-04   Pyrus x bretschneideri [bai li]
ref|XP_011076494.1|  PREDICTED: uncharacterized protein LOC105160713  51.6    2e-04   Sesamum indicum [beniseed]
emb|CDY04832.1|  BnaAnng00140D                                        52.0    2e-04   
ref|XP_003537325.1|  PREDICTED: uncharacterized protein LOC100788611  51.6    3e-04   Glycine max [soybeans]
ref|XP_006376546.1|  hypothetical protein POPTR_0013s14950g           51.6    3e-04   
ref|XP_010683597.1|  PREDICTED: uncharacterized protein LOC104898243  51.2    4e-04   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN22782.1|  hypothetical protein glysoja_026750                   50.8    4e-04   Glycine soja [wild soybean]
gb|KJB78695.1|  hypothetical protein B456_013G013000                  50.8    5e-04   Gossypium raimondii
ref|XP_010099438.1|  hypothetical protein L484_011136                 50.4    6e-04   Morus notabilis
ref|XP_009606489.1|  PREDICTED: uncharacterized protein LOC104100...  50.4    8e-04   
ref|XP_010686186.1|  PREDICTED: uncharacterized protein LOC104900468  50.4    8e-04   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN41361.1|  hypothetical protein glysoja_047806                   48.9    0.001   Glycine soja [wild soybean]
gb|KEH28818.1|  methyltransferase domain protein                      50.1    0.001   Medicago truncatula



>ref|XP_009795485.1| PREDICTED: uncharacterized protein LOC104242165 [Nicotiana sylvestris]
Length=409

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 145/184 (79%), Gaps = 4/184 (2%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGAEK  559
            PE KK ALK LED L EPPRKAL KS  RKMKFLP+L+GDSL+NYPRRVFISD+KNG  +
Sbjct  226  PEDKKVALKGLEDVLFEPPRKALVKSISRKMKFLPELLGDSLENYPRRVFISDEKNGVAE  285

Query  558  WFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevv  379
            WF  NYPA NQ+F+ YN+DV+++DSEE   G   +G + WL   VK+ DYVVMKAEAEVV
Sbjct  286  WFQRNYPAKNQDFEVYNLDVEIQDSEEWGNGVPLLGAAEWLSKNVKEEDYVVMKAEAEVV  345

Query  378  eemvreRTICLVDELFLECKSQW---eegeggeENQRQR-AYWQCLELHGRLREEGVAVH  211
            EEM++++TICLVDELFL C++Q    ++ +  EEN  QR AYWQCL L+G+L +EGVAVH
Sbjct  346  EEMIKKKTICLVDELFLHCRNQLEDDDDDDYEEENGSQRKAYWQCLTLYGKLIDEGVAVH  405

Query  210  QWWS  199
            QWWS
Sbjct  406  QWWS  409



>ref|XP_004230605.1| PREDICTED: uncharacterized protein LOC101261168 [Solanum lycopersicum]
Length=411

 Score =   208 bits (530),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 148/185 (80%), Gaps = 5/185 (3%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGAEK  559
            PE KK ALK LED LLEPP++AL KS  RKMKFLP+L+GDSL+NYPRR+FISD+KNG  +
Sbjct  227  PEAKKVALKGLEDVLLEPPKRALLKSFSRKMKFLPELLGDSLENYPRRIFISDEKNGVAE  286

Query  558  WFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevv  379
            WF  +YPANNQ+F+ YN+DV++++SE++  G   VG + WL   VK+ DYVVMKAEAEVV
Sbjct  287  WFKRSYPANNQDFEIYNLDVEIQESEQSGDGVALVGTAEWLSKNVKEEDYVVMKAEAEVV  346

Query  378  eemvreRTICLVDELFLECKSQWeegeggeENQ-----RQRAYWQCLELHGRLREEGVAV  214
            EE+++++ ICLVDELFL C++Q EE    ++++     ++RAYWQCL L+G+L +EG+AV
Sbjct  347  EEIIKKKAICLVDELFLHCRNQLEEVGNDDDDEEENGSQKRAYWQCLTLYGKLIDEGIAV  406

Query  213  HQWWS  199
            HQWWS
Sbjct  407  HQWWS  411



>emb|CDO97395.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 138/184 (75%), Gaps = 5/184 (3%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS---MRKMKFLPDLMGDS--LQNYPRRVFISDDKN  571
            + +K ALK LEDALLEPPR+ L K S   MRK+KFLP L+GDS  L ++ RR+ ISDDKN
Sbjct  222  DARKMALKGLEDALLEPPRRTLLKYSRDEMRKIKFLPHLLGDSHSLASFRRRILISDDKN  281

Query  570  GAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkae  391
            G E WFH+NYP  NQ F+ YN+++  E          + G+S WL+N V+  D+VVMKAE
Sbjct  282  GFEGWFHNNYPTENQHFETYNLEITAEKLSSRSMVNPAAGISGWLKNNVRQEDFVVMKAE  341

Query  390  aevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVH  211
            A+VV+EM+ E+TICLVDELFLECK+ +++   G+EN+ +RAYWQCL L+G LR++GVAVH
Sbjct  342  AQVVDEMMEEKTICLVDELFLECKNHFQDDGVGDENESKRAYWQCLALYGSLRDQGVAVH  401

Query  210  QWWS  199
            QWW+
Sbjct  402  QWWN  405



>ref|XP_009595944.1| PREDICTED: uncharacterized protein LOC104092128 [Nicotiana tomentosiformis]
Length=527

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 137/175 (78%), Gaps = 2/175 (1%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGAEKW  556
            E KK ALK LED L EPPRKA  +S  RKMKFLP+L+ DSL+NYPRRVFISD+KNG  +W
Sbjct  226  EDKKVALKGLEDVLFEPPRKAFVRSVSRKMKFLPELLEDSLENYPRRVFISDEKNGVAEW  285

Query  555  FHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevve  376
            F  NYPA NQ+F+ YN+DV+++DSEE+  G   +G + WL   VK+ DYVVMKAEAEVVE
Sbjct  286  FQKNYPAKNQDFEIYNLDVEIQDSEESGNGAPLLGAAEWLSKNVKEEDYVVMKAEAEVVE  345

Query  375  emvreRTICLVDELFLECKSQWeegeggeE--NQRQRAYWQCLELHGRLREEGVA  217
            EM++++TICLVDELFL C++Q E+ +  EE    ++RAYWQCL L+G+L +EGVA
Sbjct  346  EMIKKKTICLVDELFLHCRNQLEDDDDFEEENGSQRRAYWQCLTLYGKLIDEGVA  400



>ref|XP_011088137.1| PREDICTED: uncharacterized protein LOC105169445 [Sesamum indicum]
Length=409

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 139/180 (77%), Gaps = 3/180 (2%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGAEK  559
            PE K+AALK LED  LEPPR+A    S RK+KFLPDL+ DSL+ YPRR+FISDD +  + 
Sbjct  231  PEKKRAALKGLEDVYLEPPRQAALVQSSRKIKFLPDLLKDSLEEYPRRIFISDDLSAVD-  289

Query  558  WFHDNYPANNQEFDFYNIDVKVEDSEETKTGE-ESVGLSNWLRNTVKDADYvvmkaeaev  382
            WF+ NYP  +QEF+ YN++V++  +  +K  E +   +SNW+   V+  DYVVMKAEAE+
Sbjct  290  WFYKNYPRGHQEFEVYNMEVEINKNGLSKRVESQETAVSNWITKKVRHEDYVVMKAEAEM  349

Query  381  veemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  202
            VEEM++++T+CLVDELFLECK+QW + +G E N  +RAYWQCL L+G++R+EG+AVHQWW
Sbjct  350  VEEMLKDKTLCLVDELFLECKNQW-QQDGEEGNGGKRAYWQCLTLYGKVRDEGIAVHQWW  408



>ref|XP_007042870.1| Nuclear transcription factor Y subunit C-4, putative [Theobroma 
cacao]
 gb|EOX98701.1| Nuclear transcription factor Y subunit C-4, putative [Theobroma 
cacao]
Length=407

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 135/186 (73%), Gaps = 9/186 (5%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI----SDDK  574
            E +KAALK LED L EPPR+ALAKS   +RKM FLPDL+GDSL++YPRRVFI    S+DK
Sbjct  222  EARKAALKGLEDVLFEPPRRALAKSHAYLRKMNFLPDLLGDSLEHYPRRVFINVGSSEDK  281

Query  573  NGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmka  394
            N   KWF  NYP  NQEF+FY++++ +   E  +     + +S+WL    ++ +YVVMKA
Sbjct  282  NVVMKWFDKNYPKRNQEFEFYSLEMGLSGGEGRRVSPR-IDVSDWLMKNAREEEYVVMKA  340

Query  393  eaevveemvreRTICLVDELFLECKSQWe--egeggeENQRQRAYWQCLELHGRLREEGV  220
            EA+ VEEM+  R I LVDELFLEC +QW+    +  ++ + +RAYW+CL L+GRLR+EGV
Sbjct  341  EADAVEEMIARRAISLVDELFLECDNQWQDGGKKNKKKKKSKRAYWECLALYGRLRDEGV  400

Query  219  AVHQWW  202
            AVHQWW
Sbjct  401  AVHQWW  406



>ref|XP_003527872.2| PREDICTED: uncharacterized protein LOC100793605 [Glycine max]
Length=210

 Score =   166 bits (421),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 129/189 (68%), Gaps = 11/189 (6%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI-----SD  580
            PE KK AL+ LED LLEPPR +  KS   +++ +FLPDLM DSL+ YPRRVFI       
Sbjct  24   PEAKKVALQKLEDVLLEPPRASSGKSRKYLKRTRFLPDLMNDSLEKYPRRVFIDVGVPEK  83

Query  579  DKNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKT--GEESVGLSNWLRNTVKDADYv  406
            D     +WF  NYP  NQ+F+ YNI+   E+S  +    G+E + +S+W+R  VK+ +YV
Sbjct  84   DGGSGMEWFSKNYPTRNQKFEMYNIETVAEESSSSSLSPGKEQIEMSDWVRKNVKEEEYV  143

Query  405  vmkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREE  226
            VMKAEAEVVEEM++ ++I LVDELFLECK +         N  +RAYW+CL L+G+LR+E
Sbjct  144  VMKAEAEVVEEMMKSKSIGLVDELFLECKPK--RENRSSGNSSRRAYWECLALYGKLRDE  201

Query  225  GVAVHQWWS  199
            GVAVHQWW 
Sbjct  202  GVAVHQWWG  210



>ref|XP_003522750.2| PREDICTED: uncharacterized protein LOC100789170 [Glycine max]
Length=262

 Score =   168 bits (425),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 132/187 (71%), Gaps = 11/187 (6%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI---SDDK  574
            PE KKAAL+ LE+ LLEPPR A  KS   +++ +FLPDLMGDSL++YPRRVFI     +K
Sbjct  80   PEAKKAALQKLENVLLEPPRAASGKSPNYLKRTRFLPDLMGDSLEHYPRRVFIDVGPPEK  139

Query  573  NGAE--KWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvm  400
             G    +WF  NYP  +++F+ YNI+     +EE  TG+E + +S+W+R  VK+ +YVVM
Sbjct  140  EGGSGTEWFSKNYPTRDKKFEMYNIETV---TEEWSTGKEQIEMSDWVRKNVKEEEYVVM  196

Query  399  kaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGV  220
            KAEAEVVEEM++  +I LVDELFLECK           N  +RAYW+CL L+G+LR++GV
Sbjct  197  KAEAEVVEEMMKSSSIGLVDELFLECKPN-RGSRSSGINSNRRAYWECLALYGKLRDKGV  255

Query  219  AVHQWWS  199
            AVHQWW 
Sbjct  256  AVHQWWG  262



>ref|XP_003544241.1| PREDICTED: uncharacterized protein LOC100781768 [Glycine max]
Length=230

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 127/187 (68%), Gaps = 18/187 (10%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI-----SD  580
            PE KKAAL++LED LLEPPR A  KS   +++ K+LPDLMGDSL++YPRRVFI       
Sbjct  55   PEAKKAALQNLEDVLLEPPRAASGKSRVYLKRTKYLPDLMGDSLESYPRRVFIDVGLPEK  114

Query  579  DKNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvm  400
            D   A  WF   YP  N++F+ Y I+   E       G   + +S+WLRN V++ +YVVM
Sbjct  115  DGGSATDWFRKTYPTRNKDFEMYKIETVAE-------GGPQIEMSDWLRNNVREEEYVVM  167

Query  399  kaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGV  220
            K+E EVVEEM+R + I LVDELFLECK Q    +G  + +  RAYW+CL L+G+LR+EGV
Sbjct  168  KSETEVVEEMMRSKAIMLVDELFLECKPQ----QGNRKRKNGRAYWECLALYGKLRDEGV  223

Query  219  AVHQWWS  199
            AVHQWW 
Sbjct  224  AVHQWWG  230



>ref|XP_003518255.1| PREDICTED: uncharacterized protein LOC100814797 [Glycine max]
Length=230

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 127/187 (68%), Gaps = 18/187 (10%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI-----SD  580
            PE KKAAL++LED LLEPPR A  KS   +++ K+LPDLMGDSL+ YPRRVFI       
Sbjct  55   PEAKKAALQNLEDVLLEPPRAASGKSRVYLKRTKYLPDLMGDSLEGYPRRVFIDVGLPEK  114

Query  579  DKNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvm  400
            D      WFH  YP  N++F+ Y I+   E       G   + +S+WLR  V++ +YVVM
Sbjct  115  DGGSGTDWFHKTYPTRNKDFEIYKIETVAE-------GGPQIEMSDWLRKNVREEEYVVM  167

Query  399  kaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGV  220
            K+EAEVVEEM+R + I LVDELFLECK Q    +G  + + +RAYW+CL L+G+LR+EGV
Sbjct  168  KSEAEVVEEMMRSKAIMLVDELFLECKPQ----QGNVKKKNRRAYWECLALYGKLRDEGV  223

Query  219  AVHQWWS  199
            AVHQWW 
Sbjct  224  AVHQWWG  230



>ref|XP_011462229.1| PREDICTED: uncharacterized protein LOC105350910 [Fragaria vesca 
subsp. vesca]
Length=403

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 137/184 (74%), Gaps = 10/184 (5%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFISDDKN---  571
            E K+A L+ LED LLEPPR+ALAKSS  ++KMKFLPDL+G+SL+NY RR+F++ D N   
Sbjct  223  EAKEAVLQGLEDVLLEPPRRALAKSSQYLKKMKFLPDLLGNSLENYERRLFVNVDLNEQN  282

Query  570  -GAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmka  394
             G  +WFH NYP  N EF+ +N++V+ E  E +   ++ V  S WL+  VK+ DYVVMKA
Sbjct  283  SGTVEWFHQNYPKMNTEFEVHNLEVEAEAEEASSKPQKDV--SGWLKENVKEEDYVVMKA  340

Query  393  eaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAV  214
            EAEVV +M+++ TICLVDELFLEC ++W +      ++ +RAYW+C+ LHGRLR+ GVAV
Sbjct  341  EAEVVVDMMQKSTICLVDELFLECNNEWWQNGNS--DKSKRAYWECVALHGRLRDIGVAV  398

Query  213  HQWW  202
            HQW+
Sbjct  399  HQWF  402



>ref|XP_002283891.2| PREDICTED: uncharacterized protein LOC100247170 [Vitis vinifera]
 emb|CAN74009.1| hypothetical protein VITISV_003546 [Vitis vinifera]
Length=403

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 133/187 (71%), Gaps = 13/187 (7%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI-----SDD  577
            E KKAALK+LED LLEPPR A  KSS  +++ K+LPDL GDSL++YPRRVFI       D
Sbjct  222  EAKKAALKNLEDVLLEPPRAASRKSSSYLKRTKYLPDLTGDSLESYPRRVFIHVGPPETD  281

Query  576  KNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEES-VGLSNWLRNTVKDADYvvm  400
            +    +WF  +YP  N++F+ Y I+     +EE+K  EE+ +G+S WLR  VK+ +YVVM
Sbjct  282  EGKNVRWFASHYPTRNRDFEMYKIETT---TEESKGKEEAELGMSEWLRKNVKEEEYVVM  338

Query  399  kaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGV  220
            KAEAEVVEEMV+ + I LVDELFLECK Q       + N   RAYW+CL L+G+LR+EGV
Sbjct  339  KAEAEVVEEMVKSKAIGLVDELFLECKPQ--SLNNRKSNTGGRAYWECLALYGQLRDEGV  396

Query  219  AVHQWWS  199
            AVHQWWS
Sbjct  397  AVHQWWS  403



>ref|XP_008223356.1| PREDICTED: uncharacterized protein LOC103323165 [Prunus mume]
Length=408

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 134/184 (73%), Gaps = 7/184 (4%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI----SDDK  574
            E KK  LK LED +LEPPR+ LAKS+  ++K+KFLP+L+GDSLQ Y RRVF+    ++D 
Sbjct  225  EAKKTVLKGLEDVVLEPPRRVLAKSNEYLKKIKFLPNLLGDSLQGYDRRVFVYVDLNEDN  284

Query  573  NGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmka  394
            +G  +WF  NYP  ++EF+ YN++V+ E++  T        +S+WL+  V++ DYVVMKA
Sbjct  285  SGVTEWFQQNYPKMDKEFEVYNLEVEPEEASSTAVAPPRNDVSDWLKKNVREEDYVVMKA  344

Query  393  eaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAV  214
            EAE+V EM++++TICLVDELFLEC + W +  G     + RAYW+C+ L+GR+R+ GVAV
Sbjct  345  EAEMVVEMIKKKTICLVDELFLECNNGWWQKNGKTYGSK-RAYWECIALYGRVRDLGVAV  403

Query  213  HQWW  202
            HQW+
Sbjct  404  HQWF  407



>ref|XP_002273743.3| PREDICTED: uncharacterized protein LOC100249012 [Vitis vinifera]
Length=428

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 132/187 (71%), Gaps = 12/187 (6%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFIS----DDK  574
            + KKAALK LE ALLE PR AL +S   +++ KFLPDL+GDSL+ YP+R+FI+    +D 
Sbjct  246  QAKKAALKGLESALLESPRHALKQSRQYLKRTKFLPDLLGDSLEGYPQRIFINVGFKEDS  305

Query  573  NGAEKWFHDNYPANNQEFDFYNIDVKVE-DSEETKTGEES-VGLSNWLRNTVKDADYvvm  400
            +    WFH NYP  NQ+F  YN+++  +  S   + G+ + VG+S WL   VK+ +YVVM
Sbjct  306  SATMDWFHQNYPKRNQDFVIYNLEIDCQPGSLMPQMGKATNVGISGWLMENVKEEEYVVM  365

Query  399  kaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGV  220
            KAEAEVVEEM++ RT+CLVDELFL C  Q        EN +QRAYW+CL L+GRLR+EGV
Sbjct  366  KAEAEVVEEMIKGRTVCLVDELFLGCNHQ----RQKGENNKQRAYWECLALYGRLRDEGV  421

Query  219  AVHQWWS  199
            AVHQWW 
Sbjct  422  AVHQWWG  428



>gb|KDP26665.1| hypothetical protein JCGZ_17823 [Jatropha curcas]
Length=407

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 130/186 (70%), Gaps = 14/186 (8%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKALAKS--SMRKMKFLPDLMGDSLQNYPRRVFIS----DD  577
             E KK AL  LED LLEPPRK  AKS  SM K  + PDL+GDSL++YPRRVF+     + 
Sbjct  230  SEAKKDALNGLEDVLLEPPRKVFAKSTKSMSKFNYFPDLLGDSLEDYPRRVFVDVSLHEQ  289

Query  576  KNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmk  397
            KN  + WF +NYP  NQ+F+ YNI++  E    +K     + +SNWL   VK+ ++VVMK
Sbjct  290  KNVVKAWFSENYPTRNQKFETYNIEMVSEGV--SKMVSPGIDVSNWLMKNVKEDEFVVMK  347

Query  396  aeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVA  217
            AEAEVVEEM++ RTI LVDELFLEC++QWE        + +RAYW+CL L+GRLR++G+A
Sbjct  348  AEAEVVEEMMQRRTINLVDELFLECQNQWEG------KKSKRAYWECLALYGRLRDKGIA  401

Query  216  VHQWWS  199
            VHQWW 
Sbjct  402  VHQWWG  407



>ref|XP_002522625.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39712.1| conserved hypothetical protein [Ricinus communis]
Length=368

 Score =   165 bits (418),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 135/184 (73%), Gaps = 11/184 (6%)
 Frame = -2

Query  732  TKKAALKHLEDALLEPPRKALA--KSSMRKMKFLPDLMGDSLQNYPRRVFI----SDDKN  571
             KK ALK LED LLEPPRK L   +  ++K  +LPDL+GDSL+ Y RRVF+     ++K+
Sbjct  190  AKKTALKGLEDVLLEPPRKFLGEPRKYLKKFNYLPDLLGDSLEEYQRRVFVDVSSQEEKD  249

Query  570  GAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkae  391
            G   WF++NYP   Q F+ +NI++  E    +KT E SV +S+WL   VK+ ++VV+KAE
Sbjct  250  GVMAWFNENYPTRKQNFEIFNIEMAREGL--SKTAEASVNISDWLMKNVKEDEFVVLKAE  307

Query  390  aevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVH  211
            AEVVEEM+R RT+ LVDELFLEC++QW+ GEG   N+ +RAYW+CL L+GRLR++GVAVH
Sbjct  308  AEVVEEMIRRRTVGLVDELFLECQNQWQNGEG---NKGKRAYWECLALYGRLRDKGVAVH  364

Query  210  QWWS  199
            QWW 
Sbjct  365  QWWG  368



>gb|EYU39115.1| hypothetical protein MIMGU_mgv1a027069mg [Erythranthe guttata]
Length=404

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 130/185 (70%), Gaps = 17/185 (9%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAK-------SSMRKMKFLPDLMGDSLQNYPRRVFISDD  577
            E KKAALK LED  LEPPR+A  +        + RK+KFLPDL+ DSL  YPRRVFI+DD
Sbjct  229  EEKKAALKGLEDVYLEPPRRAEVEEKKKTSFKTSRKIKFLPDLLKDSLDEYPRRVFITDD  288

Query  576  KNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmk  397
             +  E WF+ +YP  +QEF+ Y++        E     +  G+SNW+R  V   DYVVMK
Sbjct  289  TSAVE-WFYKSYPMRDQEFEVYDV--------EASGAHKETGVSNWMRGKVGREDYVVMK  339

Query  396  aeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVA  217
            AEA++VEEM++E+T+CLVDELFLECK+QW++ E   +  + RAY QCL L+G++R+EG+A
Sbjct  340  AEAQLVEEMLKEKTLCLVDELFLECKNQWQDDEDQSDGSK-RAYCQCLALYGKVRDEGIA  398

Query  216  VHQWW  202
            VHQWW
Sbjct  399  VHQWW  403



>ref|XP_002310494.2| hypothetical protein POPTR_0007s03500g [Populus trichocarpa]
 gb|EEE90944.2| hypothetical protein POPTR_0007s03500g [Populus trichocarpa]
Length=406

 Score =   166 bits (420),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 136/184 (74%), Gaps = 11/184 (6%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFIS----DDK  574
            + KK AL+ LED LLEPPRKALAKS   +++ K+LP+L+GDSL++Y RRVFI     ++K
Sbjct  227  DAKKTALQGLEDVLLEPPRKALAKSRVYLKRFKYLPNLLGDSLEDYSRRVFIHAGLHEEK  286

Query  573  NGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmka  394
             GA +WF++NYP  NQ+F+F++I+   E    +K       +SNWL   V++ ++VVMKA
Sbjct  287  KGAMQWFNENYPTRNQDFEFHSINTLPEG--HSKRVASPADVSNWLMKNVREDEFVVMKA  344

Query  393  eaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAV  214
            EAEV EEM++ +TI LVDELFLEC +QW+ GE     + +RAYW+C+ L+GRLR+EGVAV
Sbjct  345  EAEVAEEMMKRKTIGLVDELFLECNNQWKNGER---KKSKRAYWECVALYGRLRDEGVAV  401

Query  213  HQWW  202
            HQWW
Sbjct  402  HQWW  405



>ref|XP_010030014.1| PREDICTED: uncharacterized protein LOC104419886 [Eucalyptus grandis]
 gb|KCW56953.1| hypothetical protein EUGRSUZ_I02628 [Eucalyptus grandis]
Length=405

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 131/185 (71%), Gaps = 17/185 (9%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFIS----DDK  574
            E KKA LK LED LLEPPR+AL +S   ++K+K+LP+L+GDSLQ Y RR FI+    +D 
Sbjct  232  EAKKATLKGLEDVLLEPPRRALVRSGDYLKKIKYLPELLGDSLQGYNRRSFITVGSREDD  291

Query  573  NGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmka  394
             G  +WF  NYPA +Q F+ +++D+         +G     +S+WL   V++ +YVVMKA
Sbjct  292  RGMVEWFRHNYPAQDQHFEVHHLDIG--------SGGAPADVSDWLTQNVREEEYVVMKA  343

Query  393  eaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAV  214
            +AEV EEM+R+RTI LVDE+FLEC SQW   +    N+ +RAYW+CL L+GRLR+EGVAV
Sbjct  344  DAEVAEEMMRKRTIHLVDEMFLECSSQWGYRKT---NKSRRAYWECLALYGRLRDEGVAV  400

Query  213  HQWWS  199
            HQWW+
Sbjct  401  HQWWA  405



>ref|XP_010273765.1| PREDICTED: uncharacterized protein LOC104609205 [Nelumbo nucifera]
Length=418

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 129/185 (70%), Gaps = 9/185 (5%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFIS----DDK  574
            E KKAAL  LED LLEPPRKA  +S   +++ KFLPDL GDSL+ YPRRVFI+    +  
Sbjct  237  EAKKAALDGLEDVLLEPPRKAHVESDKYLKRTKFLPDLTGDSLEGYPRRVFINVGLPERN  296

Query  573  NGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmka  394
             G+  WF  NYP  N +F+ Y I+    D   T T    + +S+WLR  VK+ +YVVMKA
Sbjct  297  GGSPDWFERNYPTRNWDFEIYKIETVATDELSTDTAVPQLEMSDWLRKNVKEEEYVVMKA  356

Query  393  eaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAV  214
            EAEVVEE+V+ + +CLVDELFLECK +   G GG +N+ +R YW+CL L+G+LR+EGVAV
Sbjct  357  EAEVVEELVKNKAMCLVDELFLECKHR---GLGGRKNKSKRVYWECLALYGKLRDEGVAV  413

Query  213  HQWWS  199
            HQWW 
Sbjct  414  HQWWG  418



>ref|XP_011016907.1| PREDICTED: uncharacterized protein LOC105120427 [Populus euphratica]
Length=420

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 127/187 (68%), Gaps = 14/187 (7%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFIS-----DD  577
            E KKAAL++LED LLEPPR A  KSS  ++K ++LPDLMGDSL++YPRRVFI       D
Sbjct  240  EAKKAALQNLEDVLLEPPRAASGKSSRYLKKTRYLPDLMGDSLESYPRRVFIDVGLPEKD  299

Query  576  KNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGE-ESVGLSNWLRNTVKDADYvvm  400
                  WF  NYP  N +F+ Y I+   E S   +  + E VG+S+WL++ VK  +YVVM
Sbjct  300  GGSGNGWFAKNYPTRNLDFEMYKIETVTEQSSGKEVPQVEEVGMSDWLKHNVKGEEYVVM  359

Query  399  kaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGV  220
            KAEAEVVEEMV+ + I LVDELFLECK +         N  ++ YW+CL L+G+LR+EGV
Sbjct  360  KAEAEVVEEMVKSKAIRLVDELFLECKPR------RNGNGSKKTYWECLALYGKLRDEGV  413

Query  219  AVHQWWS  199
            AVHQWW 
Sbjct  414  AVHQWWG  420



>ref|XP_011023096.1| PREDICTED: uncharacterized protein LOC105124692 [Populus euphratica]
Length=406

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 136/184 (74%), Gaps = 11/184 (6%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI----SDDK  574
            + KK AL+ LED LLEPPRKALAKS   +++ K+LP+L+GDSL++Y RRVFI     ++ 
Sbjct  227  DAKKTALQGLEDVLLEPPRKALAKSRVYLKRFKYLPNLLGDSLEDYSRRVFIHAGLQEEN  286

Query  573  NGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmka  394
             GA +WF++NYP  NQ+F+F++++   E   ++K       +SNWL   V++ ++VVMKA
Sbjct  287  KGAMQWFNENYPTRNQDFEFHSMNTLPEG--DSKRVASPADVSNWLMKNVREDEFVVMKA  344

Query  393  eaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAV  214
            EAEV EEM++ +TI LVDELFLEC +QW+ GE     + +RAYW+C+ L+GRLR+EGVAV
Sbjct  345  EAEVAEEMMKRKTIGLVDELFLECNNQWKNGER---KKSKRAYWECVALYGRLRDEGVAV  401

Query  213  HQWW  202
            HQWW
Sbjct  402  HQWW  405



>gb|AES98227.2| transmembrane protein, putative [Medicago truncatula]
Length=419

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 125/186 (67%), Gaps = 14/186 (8%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI-----SDD  577
            E K+AAL+ LED LLEPPR A  KS   +++ K+LPDLMGD+L++YPRRVFI       D
Sbjct  241  EAKRAALQKLEDVLLEPPRAASGKSRVYLKRTKYLPDLMGDTLESYPRRVFIDVGLPQKD  300

Query  576  KNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmk  397
                  WF  NYP  N+ F+ Y I+  VE S  T+     V +S+WL   VKD +YVVMK
Sbjct  301  GGSGTDWFSKNYPTRNKNFEMYKIETVVEGSPTTQ-----VEMSDWLMKNVKDEEYVVMK  355

Query  396  aeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVA  217
            AEAEVVEEM+R ++I LVDELFLECK Q          + +RAYW+CL L+G+LR+EGVA
Sbjct  356  AEAEVVEEMMRSKSIMLVDELFLECKPQ--GLNLKRGTRGRRAYWECLALYGKLRDEGVA  413

Query  216  VHQWWS  199
            VHQWW 
Sbjct  414  VHQWWG  419



>gb|KJB29354.1| hypothetical protein B456_005G0963001, partial [Gossypium raimondii]
Length=293

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 132/189 (70%), Gaps = 14/189 (7%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFI-----SDD  577
            E K+AALK LED LLEPPR +   +++ +++ K+LPDL+GDSL++YPRRVFI       D
Sbjct  109  EAKRAALKKLEDVLLEPPRASSGTSRTYLKRTKYLPDLLGDSLESYPRRVFIDVGLPKKD  168

Query  576  KNGAEKWFHDNYPANNQEFDFYNIDVKVEDS---EETKTGEESVGLSNWLRNTVKDADYv  406
               A  WF  NYP  N +F+ Y I+   +DS   E  +T  E+ G+S WLR  V++ +YV
Sbjct  169  GGSATTWFVKNYPTRNLKFEMYKIETLTKDSTKKEVPQTAAET-GMSGWLRKNVQEEEYV  227

Query  405  vmkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREE  226
            VMKAEAEVVE+MV+ + I LVDELFLECK +   G GG +N   RAYW+CL L+G+LR+E
Sbjct  228  VMKAEAEVVEDMVKSKAIRLVDELFLECKPK---GLGGRKNMSGRAYWECLALYGKLRDE  284

Query  225  GVAVHQWWS  199
            GVAVHQWW 
Sbjct  285  GVAVHQWWG  293



>gb|KJB32109.1| hypothetical protein B456_005G224700 [Gossypium raimondii]
Length=438

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 130/196 (66%), Gaps = 29/196 (15%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFIS-------  583
            E KKAAL  LED L EPPRKA AKS   ++K+ FLPDL+GDSL+NYPRRVFI        
Sbjct  253  EAKKAALSGLEDVLFEPPRKAWAKSHSYLKKINFLPDLLGDSLENYPRRVFIDVGSSNDD  312

Query  582  DDKNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvv  403
            DDKN   KWF +NYP  NQEF+ Y+I+              S+ +S+WL   V++ DYVV
Sbjct  313  DDKNIVMKWFEENYPKRNQEFEVYSIE-----------ATASIDVSDWLMMNVREEDYVV  361

Query  402  mkaeaevveemvreRTICLVDELFLECKSQWe---------egeggeENQRQRAYWQCLE  250
            MKAEAEVVE+M+  +TI LVDELF EC +QW+         +    +  + +RAYW+C+ 
Sbjct  362  MKAEAEVVEKMIERKTIGLVDELFFECNNQWQDEVKKKKKRKMGKKKRKKNKRAYWECVA  421

Query  249  LHGRLREEGVAVHQWW  202
            L+GRLR+EGVAVHQWW
Sbjct  422  LYGRLRDEGVAVHQWW  437



>ref|XP_007141255.1| hypothetical protein PHAVU_008G180600g [Phaseolus vulgaris]
 gb|ESW13249.1| hypothetical protein PHAVU_008G180600g [Phaseolus vulgaris]
Length=225

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 125/187 (67%), Gaps = 18/187 (10%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI-----SD  580
            PE KKAAL++LED LLEPPR A  KS   +++ K+LPDLMGDSL++YPR VFI       
Sbjct  50   PEAKKAALQNLEDVLLEPPRAASGKSRVYLKRTKYLPDLMGDSLESYPRCVFIDVGLPKQ  109

Query  579  DKNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvm  400
            D      WF   YP  N+ F+ Y ++   E   +T+       +S+WLR  VKD +YVVM
Sbjct  110  DGGSGTDWFKKRYPTRNKNFEMYKLETVAEGGPQTE-------MSDWLRKNVKDEEYVVM  162

Query  399  kaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGV  220
            KAEAE VEEM+R + I LVDELFLECK Q    +G  + + +RAYW+CL L+G+LR+EGV
Sbjct  163  KAEAEEVEEMMRSKAIRLVDELFLECKPQ----QGNVKRKSRRAYWECLALYGKLRDEGV  218

Query  219  AVHQWWS  199
            AVHQWW 
Sbjct  219  AVHQWWG  225



>ref|XP_008219312.1| PREDICTED: uncharacterized protein LOC103319539 [Prunus mume]
Length=334

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 134/196 (68%), Gaps = 21/196 (11%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFIS---DDKN  571
            E KK ALK+LED LLEPPR +  KS   +++ ++LPDLMGDSL++YPRRVFI     +K 
Sbjct  143  EAKKEALKNLEDVLLEPPRASSLKSRRYLKRTRYLPDLMGDSLESYPRRVFIDVGLPEKE  202

Query  570  GAEK--WFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESV--GLSNWLRNTVKDADYvv  403
            G     WF  NYP  N+ F+ Y I+   E+S    +G+E V  G+S WL+  VK+ +YVV
Sbjct  203  GGSGTGWFAKNYPTRNKNFEMYKIETVTEES----SGKEVVQTGMSEWLKKNVKEEEYVV  258

Query  402  mkaeaevveemvreRTICLVDELFLECKSQWeegeggeEN--------QRQRAYWQCLEL  247
            MKAEAEVVEEM+  + I LVDELFLECK Q + G+ G+ N        + +RAYWQCL L
Sbjct  259  MKAEAEVVEEMMNTKVIKLVDELFLECKPQGQNGKKGDNNSNTNTNYVRSRRAYWQCLAL  318

Query  246  HGRLREEGVAVHQWWS  199
            +G+LR+EGVAVHQWW 
Sbjct  319  YGQLRDEGVAVHQWWG  334



>ref|XP_003615269.1| hypothetical protein MTR_5g065970 [Medicago truncatula]
Length=478

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 125/186 (67%), Gaps = 14/186 (8%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI-----SDD  577
            E K+AAL+ LED LLEPPR A  KS   +++ K+LPDLMGD+L++YPRRVFI       D
Sbjct  271  EAKRAALQKLEDVLLEPPRAASGKSRVYLKRTKYLPDLMGDTLESYPRRVFIDVGLPQKD  330

Query  576  KNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmk  397
                  WF  NYP  N+ F+ Y I+  VE S  T+     V +S+WL   VKD +YVVMK
Sbjct  331  GGSGTDWFSKNYPTRNKNFEMYKIETVVEGSPTTQ-----VEMSDWLMKNVKDEEYVVMK  385

Query  396  aeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVA  217
            AEAEVVEEM+R ++I LVDELFLECK Q          + +RAYW+CL L+G+LR+EGVA
Sbjct  386  AEAEVVEEMMRSKSIMLVDELFLECKPQ--GLNLKRGTRGRRAYWECLALYGKLRDEGVA  443

Query  216  VHQWWS  199
            VHQWW 
Sbjct  444  VHQWWG  449



>ref|XP_007137646.1| hypothetical protein PHAVU_009G143900g [Phaseolus vulgaris]
 gb|ESW09640.1| hypothetical protein PHAVU_009G143900g [Phaseolus vulgaris]
Length=261

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 127/186 (68%), Gaps = 13/186 (7%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFISDDKNGAE  562
            E KKAAL+ LED LLEPPR A  KS    ++ +FLPDLM DSL++YPRRVFI  + +G E
Sbjct  82   EAKKAALQQLEDVLLEPPRAASGKSRKYFKRTRFLPDLMADSLESYPRRVFIDVESSGEE  141

Query  561  -----KWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmk  397
                 KWF + YP  N  F+ Y++ +  E+ EE +     +G+S+WLR  VK+ +YVVMK
Sbjct  142  EGNGAKWFTEKYPTRNTHFEMYDVKLVAEEVEEKEE----IGISDWLRKNVKEEEYVVMK  197

Query  396  aeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVA  217
            A AEVVE+M++  +I LVDELFLECK        G  N   RAYW+CL L+G+LR+EGVA
Sbjct  198  ANAEVVEDMMKSNSIGLVDELFLECKCNLGRSRRG--NNSGRAYWECLALYGQLRDEGVA  255

Query  216  VHQWWS  199
            VHQWW+
Sbjct  256  VHQWWN  261



>ref|XP_004501628.1| PREDICTED: uncharacterized protein LOC101506643 [Cicer arietinum]
Length=413

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 133/186 (72%), Gaps = 19/186 (10%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI------SD  580
            E KK ALK+LED LLEPPR A  KS   +++ K+LPDLMGDSL++Y RRVFI       +
Sbjct  238  EAKKNALKNLEDVLLEPPRAASGKSRIYLKRTKYLPDLMGDSLESYSRRVFIDVALPEKE  297

Query  579  DKNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvm  400
             ++G E WF  NYP  N++F+ Y I+  +E+S    +G E+ G+S+WL   VKD +YVVM
Sbjct  298  GESGTE-WFVKNYPTRNKKFEMYKIETVMEES----SGREN-GISDWLNKNVKDEEYVVM  351

Query  399  kaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGV  220
            KAEAEVVEEM+R  +I LVDELFLECK + +       N+ +RAYW+CL L+G+LR+EGV
Sbjct  352  KAEAEVVEEMMRSNSIGLVDELFLECKPRGQME-----NKNRRAYWECLALYGKLRDEGV  406

Query  219  AVHQWW  202
            AVHQWW
Sbjct  407  AVHQWW  412



>ref|XP_002301090.2| hypothetical protein POPTR_0002s10470g [Populus trichocarpa]
 gb|EEE80363.2| hypothetical protein POPTR_0002s10470g [Populus trichocarpa]
Length=384

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 127/187 (68%), Gaps = 14/187 (7%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI-----SDD  577
            E KKAAL++LED LLEPPR A  KSS  +++ ++LPDLMGDSL++YPRRVFI       +
Sbjct  204  EAKKAALENLEDVLLEPPRAASGKSSRYLKRTRYLPDLMGDSLESYPRRVFIDVGLPEKE  263

Query  576  KNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGE-ESVGLSNWLRNTVKDADYvvm  400
                  WF  NYP  N +F+ Y I+   E S   +  + E VG+S+WL++ VK  +YVVM
Sbjct  264  GGSGNGWFAKNYPTRNLDFEMYKIETVTEQSSGKEVPQVEEVGMSDWLKHNVKGEEYVVM  323

Query  399  kaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGV  220
            KAEAEVVEEMV+ + I LVDELFLECK +         N  ++ YW+CL L+G+LR+EGV
Sbjct  324  KAEAEVVEEMVKSKAIRLVDELFLECKPR------RNGNGSKKTYWECLALYGKLRDEGV  377

Query  219  AVHQWWS  199
            AVHQWW 
Sbjct  378  AVHQWWG  384



>ref|XP_010064231.1| PREDICTED: uncharacterized protein LOC104451216 [Eucalyptus grandis]
Length=426

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 129/195 (66%), Gaps = 17/195 (9%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI------S  583
            PE KKAAL++LED LLEPPR A  +S    ++ ++LPDLMGDSL++YPRRVFI       
Sbjct  234  PEQKKAALQNLEDVLLEPPRAASRRSRAYFKRTRYLPDLMGDSLESYPRRVFIDVGLPEK  293

Query  582  DDKNGAEKWFHDNYPANNQEFDFYNID-VKVEDSEETKTGEES------VGLSNWLRNTV  424
            D    +  WF  NYP  N  F+ Y I+ V  E+   T + E +      VG+ +WL+  V
Sbjct  294  DGGTSSTAWFARNYPTRNLHFEMYKIETVAAEEPTATSSKEATAAVAAQVGMPDWLKKNV  353

Query  423  KDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELH  244
            K+ +YVVMKAEAEVVEEMV+ + I LVDELFLECK +         ++ +RAYW+CL L+
Sbjct  354  KEEEYVVMKAEAEVVEEMVKSKAIGLVDELFLECKPKGGVTRMS--DRSRRAYWECLALY  411

Query  243  GRLREEGVAVHQWWS  199
            GRLR+EGVAVHQWW 
Sbjct  412  GRLRDEGVAVHQWWG  426



>ref|XP_009375494.1| PREDICTED: uncharacterized protein LOC103964299 [Pyrus x bretschneideri]
 ref|XP_009375495.1| PREDICTED: uncharacterized protein LOC103964300 [Pyrus x bretschneideri]
Length=412

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 129/188 (69%), Gaps = 15/188 (8%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKS--SMRKMKFLPDLMGDSLQNYPRRVFIS---DDKN  571
            E KK ALK LED LLEPPR A  KS   +++ +FLPDLMGDSL++YPRRVFI     +K 
Sbjct  231  EAKKEALKRLEDVLLEPPRAASRKSRRCLKRTRFLPDLMGDSLESYPRRVFIDVGLPEKE  290

Query  570  GAE--KWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESV--GLSNWLRNTVKDADYvv  403
            G     WF  NYP  N+ F+ Y I+   E+S    +G+E V  G+S WL   VK+ +YVV
Sbjct  291  GGSGTSWFAKNYPTRNKNFEMYKIETVTEES----SGKELVQTGMSEWLNKNVKEEEYVV  346

Query  402  mkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEG  223
            MKAEAEVV+EMV+ + I LVDELFLECK Q   G+     + +RAYWQCL L+G+LR+EG
Sbjct  347  MKAEAEVVDEMVKSKAIHLVDELFLECKPQGHNGKINV--RSRRAYWQCLALYGQLRDEG  404

Query  222  VAVHQWWS  199
            VAVHQWW 
Sbjct  405  VAVHQWWG  412



>ref|XP_008347812.1| PREDICTED: uncharacterized protein LOC103410942 [Malus domestica]
Length=412

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 128/188 (68%), Gaps = 15/188 (8%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFIS---DDKN  571
            E KK ALK LED LLEPPR +  KS   +++ ++LPDLMGDSL++YPRRVFI     +K 
Sbjct  231  EAKKEALKKLEDVLLEPPRASSGKSRRYLKRTRYLPDLMGDSLESYPRRVFIDVGLPEKE  290

Query  570  GAE--KWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESV--GLSNWLRNTVKDADYvv  403
            G     WF  NYP  ++ F+ Y I+   EDS    +G+E V  G+S WL   VKD +YVV
Sbjct  291  GGSGTSWFAKNYPTRDKNFEMYKIETVTEDS----SGKEVVQTGISEWLNKNVKDEEYVV  346

Query  402  mkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEG  223
            MKAEAEVVEEMV+ + I LVDELFLECK Q    +     + +RAYWQCL L+G+LR+EG
Sbjct  347  MKAEAEVVEEMVKSKAIHLVDELFLECKHQGHNQKINV--RSRRAYWQCLALYGQLRDEG  404

Query  222  VAVHQWWS  199
            VAVHQWW 
Sbjct  405  VAVHQWWG  412



>gb|KJB59886.1| hypothetical protein B456_009G279400 [Gossypium raimondii]
Length=397

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 128/188 (68%), Gaps = 12/188 (6%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI-----SDD  577
            E ++ ALK+LED LLEPPR    +S   M++ K+LPDL+GD+L++YPRRVFI       +
Sbjct  213  EARRQALKNLEDVLLEPPRSTSRRSKIFMKRTKYLPDLLGDTLESYPRRVFIDVGLLETE  272

Query  576  KNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEES--VGLSNWLRNTVKDADYvv  403
                  WF +NYP  N +FD Y I+   ++S    +   +   G+SNWLR  VK+ +YVV
Sbjct  273  GGSGTNWFAENYPTRNLKFDIYKIETLTKESSRKDSAATAAETGMSNWLRKNVKETEYVV  332

Query  402  mkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEG  223
            MKAEAEVVE+MV+ + I LVDELFLECK +     GG +N  +RAYW+CL L+G+LR+EG
Sbjct  333  MKAEAEVVEDMVKTKAIRLVDELFLECKPR---KHGGRKNMSRRAYWECLALYGKLRDEG  389

Query  222  VAVHQWWS  199
            VAVHQWW 
Sbjct  390  VAVHQWWG  397



>ref|XP_004490432.1| PREDICTED: uncharacterized protein LOC101499123 [Cicer arietinum]
Length=423

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 124/186 (67%), Gaps = 14/186 (8%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI-----SDD  577
            E KKAAL++LED LLEPPR A  KS   +++ K+LPDLMGD+L++YPRRVFI       D
Sbjct  245  EAKKAALQNLEDVLLEPPRAASGKSRVYLKRTKYLPDLMGDTLESYPRRVFIDVGLPQKD  304

Query  576  KNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmk  397
                  WF  NYP  N+ F+ Y I+  VE S   +     + +S+WL   VKD +YVVMK
Sbjct  305  GGSGTDWFSKNYPTRNKNFEMYKIETVVEGSTTAQ-----IEMSDWLTKNVKDEEYVVMK  359

Query  396  aeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVA  217
            AEAEVVEEM+R + I LVDELFLECK         +  + +RAYW+CL L+G+LR+EGVA
Sbjct  360  AEAEVVEEMMRSKAIMLVDELFLECKPH--GLNLKQGTRGRRAYWECLALYGKLRDEGVA  417

Query  216  VHQWWS  199
            VHQWW 
Sbjct  418  VHQWWG  423



>ref|XP_008390578.1| PREDICTED: uncharacterized protein LOC103452820 [Malus domestica]
Length=404

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 132/184 (72%), Gaps = 11/184 (6%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFISDDKN---  571
            E KK  L+ LED LLEPPR  LAKS+  ++K+KFLP+L+GDSL +Y RRVF++ D N   
Sbjct  225  EEKKTVLEGLEDVLLEPPRLVLAKSNEYLKKIKFLPELLGDSLDSYNRRVFVNVDLNEEN  284

Query  570  -GAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmka  394
             G  +WF  NYP  N EF+ YN++V+ E++  T   +    +S+WL++ V++ DYVVMKA
Sbjct  285  RGMIEWFDQNYPKMNNEFEVYNLEVEPEEASSTPEND----VSDWLKDNVREEDYVVMKA  340

Query  393  eaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAV  214
            EAEVV +MVR+RTICLVDELFLEC + W +        + RAYW+C+ L+GRLR+ GVAV
Sbjct  341  EAEVVVDMVRKRTICLVDELFLECSNGWWQXGRRNGGSK-RAYWECIALYGRLRDLGVAV  399

Query  213  HQWW  202
            HQW+
Sbjct  400  HQWF  403



>ref|XP_007226906.1| hypothetical protein PRUPE_ppa016217mg [Prunus persica]
 gb|EMJ28105.1| hypothetical protein PRUPE_ppa016217mg [Prunus persica]
Length=416

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 133/196 (68%), Gaps = 21/196 (11%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFIS---DDKN  571
            E KK ALK+LED LLEPPR +  KS   +++ ++LPDLMGDSL++YPRRVFI     +K 
Sbjct  225  EAKKEALKNLEDVLLEPPRASSLKSRRYLKRTRYLPDLMGDSLESYPRRVFIDVGLPEKE  284

Query  570  GAEK--WFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESV--GLSNWLRNTVKDADYvv  403
            G     WF  NYP  N+ F+ Y I+   E+S    +G+E V  G+S WL+  VK+ +YVV
Sbjct  285  GGSGTGWFAKNYPTRNKNFEMYKIETVTEES----SGKEVVQTGMSEWLKKNVKEEEYVV  340

Query  402  mkaeaevveemvreRTICLVDELFLECKSQWeegeggeEN--------QRQRAYWQCLEL  247
            MKAEAEVVEEM+  + I LVDELFLECK Q + G  G+ N        + +RAYWQCL L
Sbjct  341  MKAEAEVVEEMMNTKAIKLVDELFLECKPQGQNGNKGDNNSNSKTNYVRSRRAYWQCLAL  400

Query  246  HGRLREEGVAVHQWWS  199
            +G+LR+EGVAVHQWW 
Sbjct  401  YGQLRDEGVAVHQWWG  416



>ref|XP_003602935.1| hypothetical protein MTR_3g100550 [Medicago truncatula]
 gb|AES73186.1| peptide upstream ORF protein [Medicago truncatula]
Length=419

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 129/188 (69%), Gaps = 12/188 (6%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFIS---DDKN  571
            + KK AL++LED LLEPPR A  KS   +++ ++LPDLMGDSL++Y RRVFI     +K 
Sbjct  235  DAKKIALQNLEDVLLEPPRAASGKSRKYLKRTRYLPDLMGDSLESYTRRVFIDVGLPEKE  294

Query  570  GAEK--WFHDNYPANNQEFDFYNIDVKVEDSEETKTGEES--VGLSNWLRNTVKDADYvv  403
            G     WF  NYP  N+ F+ Y I+ +V   EE+   E S  +G+S+WL   VK+ +YVV
Sbjct  295  GGSGTDWFSKNYPTRNKNFEMYKIETRVMTEEESSRKEASSKIGMSDWLNKNVKEEEYVV  354

Query  402  mkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEG  223
            MKAEAEVVEEM+R   I LVDELFLECK +        EN+ +RAYW+CL L+G+LR+EG
Sbjct  355  MKAEAEVVEEMMRSNNIGLVDELFLECKPR---HGFKIENKNRRAYWECLALYGKLRDEG  411

Query  222  VAVHQWWS  199
            VAVHQWW 
Sbjct  412  VAVHQWWG  419



>ref|XP_009342577.1| PREDICTED: uncharacterized protein LOC103934551 [Pyrus x bretschneideri]
Length=412

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 130/188 (69%), Gaps = 15/188 (8%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFIS---DDKN  571
            E KK ALK+LED LLEPPR +  KS   +++ ++LPDLMGDSL++YPRRVFI     +K 
Sbjct  231  EAKKEALKNLEDVLLEPPRASSGKSRRYLKRTRYLPDLMGDSLESYPRRVFIDVGLPEKE  290

Query  570  GAE--KWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESV--GLSNWLRNTVKDADYvv  403
            G     WF  NYP  N+ F+ Y I+   E+S    +G+E V  G+S WL   VK+ +YVV
Sbjct  291  GGSGTSWFTKNYPTRNKNFEMYKIETVTEES----SGKEVVQTGMSEWLNKNVKEEEYVV  346

Query  402  mkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEG  223
            MKAEAEVVE+MV+ + I LVDELFLECK Q   G+     + +RAYWQCL L+G+LR+EG
Sbjct  347  MKAEAEVVEDMVKSKAIHLVDELFLECKPQGHNGKINI--RSRRAYWQCLALYGQLRDEG  404

Query  222  VAVHQWWS  199
            VAVHQWW 
Sbjct  405  VAVHQWWG  412



>ref|XP_008352712.1| PREDICTED: uncharacterized protein LOC103416231 [Malus domestica]
Length=412

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 130/188 (69%), Gaps = 15/188 (8%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFIS---DDKN  571
            E KK ALK+LED LLEPPR +  KS   +++ ++LPDLMGDSL++YPRRVFI     +K 
Sbjct  231  EAKKEALKNLEDVLLEPPRASSGKSRRYLKRTRYLPDLMGDSLESYPRRVFIDVGLPEKE  290

Query  570  G--AEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESV--GLSNWLRNTVKDADYvv  403
            G     WF  NYP  N+ F+ Y I+   E+S    +G+E V  G+S WL   VK+ +YVV
Sbjct  291  GRSGTSWFMKNYPTRNKNFEMYKIETVTEES----SGKEVVQTGMSEWLNKNVKEEEYVV  346

Query  402  mkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEG  223
            MKAEAEVVE+MV+ + I LVDELFLECK Q   G+     + +RAYWQCL L+G+LR+EG
Sbjct  347  MKAEAEVVEDMVKSKAIHLVDELFLECKPQGHNGKINV--RSRRAYWQCLALYGQLRDEG  404

Query  222  VAVHQWWS  199
            VAVHQWW 
Sbjct  405  VAVHQWWG  412



>ref|XP_009374286.1| PREDICTED: uncharacterized protein LOC103963226 [Pyrus x bretschneideri]
Length=412

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 130/188 (69%), Gaps = 15/188 (8%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFIS---DDKN  571
            E KK ALK+LED LLEPPR +  KS   +++ ++LPDLMGDSL++YPRRVFI     +K 
Sbjct  231  EAKKEALKNLEDVLLEPPRASSGKSRRYLKRTRYLPDLMGDSLESYPRRVFIDVGLPEKE  290

Query  570  GAE--KWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESV--GLSNWLRNTVKDADYvv  403
            G     WF  NYP  N+ F+ Y I+   E+S    +G+E V  G+S WL   VK+ +YVV
Sbjct  291  GGSGTSWFTKNYPTRNKNFEMYKIETVTEES----SGKEVVQTGMSEWLNKNVKEEEYVV  346

Query  402  mkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEG  223
            MKAEAEVVE+MV+ + I LVDELFLECK Q   G+     + +RAYWQCL L+G+LR+EG
Sbjct  347  MKAEAEVVEDMVKSKAIHLVDELFLECKPQGHNGKINI--RSRRAYWQCLALYGQLRDEG  404

Query  222  VAVHQWWS  199
            VAVHQWW 
Sbjct  405  VAVHQWWG  412



>ref|XP_004301360.1| PREDICTED: uncharacterized protein LOC101307700 [Fragaria vesca 
subsp. vesca]
Length=400

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 120/181 (66%), Gaps = 5/181 (3%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFISDDKNGAE  562
            + KK ALK+LED LLEPPR    KSS  ++K ++LPDLMGDSL+ Y RR+FI D      
Sbjct  223  DAKKEALKNLEDVLLEPPRAKSGKSSRYLKKTRYLPDLMGDSLEGYSRRIFI-DVGGSGT  281

Query  561  KWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaev  382
             WF  NYP  N+ F+ Y I+  + D      G     +S WL   VK+ +YVVMKAEAEV
Sbjct  282  NWFAKNYPTRNKNFEMYKIETTLTDESAGSKGVLQTSMSGWLEKNVKEEEYVVMKAEAEV  341

Query  381  veemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  202
            VEEM++ + + LVDELFLECK Q   G+G    +R  AYWQCL L+G+LR+EGVAVHQWW
Sbjct  342  VEEMMQGKVMNLVDELFLECKPQGHNGKGNVSTRR--AYWQCLALYGQLRDEGVAVHQWW  399

Query  201  S  199
             
Sbjct  400  G  400



>ref|XP_011043120.1| PREDICTED: uncharacterized protein LOC105138666 [Populus euphratica]
Length=406

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 132/184 (72%), Gaps = 11/184 (6%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSSM--RKMKFLPDLMGDSLQNYPRRVFI----SDDK  574
            + KK AL+ LED LLEPPRK L KS M  +  K+LPDL+GDSL+++ RR FI     +++
Sbjct  227  DAKKEALQGLEDILLEPPRKTLEKSRMYLKGFKYLPDLLGDSLEDFSRRFFIDAGSQEEE  286

Query  573  NGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmka  394
            NGA  WF++NYP  NQ+F+F++I++  E           V  SNWL   V++ ++VVMKA
Sbjct  287  NGAMLWFNENYPTRNQDFEFHSINMLSEGVPGRVASPADV--SNWLMKNVREDEFVVMKA  344

Query  393  eaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAV  214
            EAEV EEM+R +TI LVDELFLEC +QW++G+     + +RAYW+C+ L+GRLR+EGVAV
Sbjct  345  EAEVAEEMMRRKTIGLVDELFLECNNQWQKGQR---KKSRRAYWECVALYGRLRDEGVAV  401

Query  213  HQWW  202
            HQWW
Sbjct  402  HQWW  405



>ref|XP_007018202.1| Uncharacterized protein TCM_034490 [Theobroma cacao]
 gb|EOY15427.1| Uncharacterized protein TCM_034490 [Theobroma cacao]
Length=454

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 132/187 (71%), Gaps = 11/187 (6%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFIS---DDKN  571
            E KKAALK LED LLEPPR A   +K+ +++ K+LPDL+GD+L++YPRRVFI     +K 
Sbjct  271  EAKKAALKKLEDVLLEPPRAASRRSKTYLKRTKYLPDLLGDTLESYPRRVFIDVGVPEKE  330

Query  570  GAE--KWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEES-VGLSNWLRNTVKDADYvvm  400
            G     WF  NYP  N +F+ Y I+   ++S      + + +G+S+WLR  VK  ++VVM
Sbjct  331  GGSGPSWFAKNYPTRNLKFEMYKIETLTKESSRKDVPQLAEIGMSDWLRKNVKGEEFVVM  390

Query  399  kaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGV  220
            KAEAEVVE+MV+ ++I LVDELFLECK Q ++G     N  +RAYW+CL L+G+LR+EGV
Sbjct  391  KAEAEVVEDMVKSKSIRLVDELFLECKPQGDDGRK---NMSKRAYWECLALYGKLRDEGV  447

Query  219  AVHQWWS  199
            AVHQWW 
Sbjct  448  AVHQWWG  454



>ref|XP_009774622.1| PREDICTED: uncharacterized protein LOC104224639 [Nicotiana sylvestris]
Length=463

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 127/182 (70%), Gaps = 9/182 (5%)
 Frame = -2

Query  729  KKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFIS---DDKNGA  565
            K+AALK LED LLEPPR A  KSS  ++K ++LPDLMG SL++YPRRVFI     DKN  
Sbjct  286  KEAALKKLEDVLLEPPRAASGKSSRYLKKTRYLPDLMGVSLESYPRRVFIDVSLQDKNEG  345

Query  564  EKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeae  385
             +WF   YP  N +F+ + I+   E S E K     + +S+WL+N VK+ +YVVMKAEA+
Sbjct  346  SEWFSKYYPTKNTKFEIFKIETVTEQSSE-KEIPLIISMSDWLKNNVKENEYVVMKAEAD  404

Query  384  vveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQW  205
            VVEE+V+ + I LVDELFLECK Q   G    + + +RAYW+CL L+G LR+EG+AVHQW
Sbjct  405  VVEELVKNKAIKLVDELFLECKHQ---GIKKGDKKNRRAYWECLALYGLLRDEGIAVHQW  461

Query  204  WS  199
            W 
Sbjct  462  WG  463



>ref|XP_004136424.1| PREDICTED: uncharacterized protein LOC101205953 [Cucumis sativus]
 ref|XP_004160303.1| PREDICTED: uncharacterized protein LOC101230494 [Cucumis sativus]
 gb|KGN60254.1| hypothetical protein Csa_3G890100 [Cucumis sativus]
Length=311

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 121/186 (65%), Gaps = 10/186 (5%)
 Frame = -2

Query  729  KKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI------SDDK  574
            + AAL  LED LLEPPR A  KS   +++ ++LPDLM DSL++YPR +FI       +  
Sbjct  127  RAAALNELEDVLLEPPRSASRKSRRYLQRTRYLPDLMDDSLESYPRHIFIDAGVPEKEAG  186

Query  573  NGAEKWFHDNYPANNQEFDFYNID-VKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmk  397
                 WF  NYP  N++F+ Y I+ V  +   E+ + E  VG+S+WL N VK  DYVVMK
Sbjct  187  GSGTSWFDHNYPTRNKKFEMYKIETVSTDQLAESSSKEPQVGISDWLSNNVKAEDYVVMK  246

Query  396  aeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVA  217
            AEAE VE+M++ + + LVDELFLECK Q   G       R RAYWQCL L+G+LR+EGVA
Sbjct  247  AEAEAVEDMMKSKVVRLVDELFLECKPQKNGGRKVSGGGR-RAYWQCLALYGQLRDEGVA  305

Query  216  VHQWWS  199
            VHQWW 
Sbjct  306  VHQWWG  311



>ref|XP_006597360.1| PREDICTED: uncharacterized protein LOC102659744 [Glycine max]
 gb|KHN33553.1| hypothetical protein glysoja_005595 [Glycine soja]
Length=397

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 124/185 (67%), Gaps = 16/185 (9%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFIS----DDK  574
            E K  ALK LED LLEPPRKAL KS   + K+K+LPDL+GDSL+ Y RRVFI     ++ 
Sbjct  223  EAKSVALKGLEDVLLEPPRKALVKSRKYLNKIKYLPDLVGDSLEGYKRRVFIGVGLPEEN  282

Query  573  NGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmka  394
             G  +WF +NYP  N +F+ +++ V  ED            +S WL   VK+ +YVVMKA
Sbjct  283  KGVMQWFKENYPKKNTKFETHSVAVVPEDH---------FAVSAWLSKNVKEEEYVVMKA  333

Query  393  eaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAV  214
            EA VVEEM++ RTI LVDELFLECK++W +       + +R YW+CL L+GR+R+EGVAV
Sbjct  334  EAGVVEEMMKTRTIRLVDELFLECKNEWWQRGKTM-KKNERTYWECLALYGRVRDEGVAV  392

Query  213  HQWWS  199
            HQWW 
Sbjct  393  HQWWG  397



>gb|KDP27984.1| hypothetical protein JCGZ_19064 [Jatropha curcas]
Length=424

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 129/191 (68%), Gaps = 17/191 (9%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFIS---DDKN  571
            E +KAAL +LED LLEPPR A  KS   ++K +FLPDLMGDSL+ YPRRV+I     +K 
Sbjct  239  EARKAALNNLEDVLLEPPRAASGKSRRYLKKTRFLPDLMGDSLEGYPRRVYIDVGLPEKE  298

Query  570  GAEK--WFHDNYPANNQEFDFYNIDVKVEDSEETKTGEE-----SVGLSNWLRNTVKDAD  412
            G     WF  NYP  N +F+ Y    K+E   E+ +G+E      +G+S WLR  VK+ +
Sbjct  299  GGSGTGWFIKNYPTRNLDFEMY----KIETFTESWSGKEVPQVVDIGISGWLRKNVKEEE  354

Query  411  YvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLR  232
            YVVMKAEAEVVEEM+  + I LVDELF+ECK +   G  G  N  +RAYW+CL L+GRLR
Sbjct  355  YVVMKAEAEVVEEMMESKAIRLVDELFMECKLR-GHGAKGNNNAGRRAYWECLALYGRLR  413

Query  231  EEGVAVHQWWS  199
            +EG+AVHQWW 
Sbjct  414  DEGIAVHQWWG  424



>ref|XP_008340704.1| PREDICTED: uncharacterized protein LOC103403638 [Malus domestica]
Length=403

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 129/184 (70%), Gaps = 12/184 (7%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFISDDKN---  571
            E KK  L+ LED LLEPPR  LAKS+  + K+KFLPDL+GDSL  Y RRVF++ D N   
Sbjct  225  EEKKTVLEGLEDVLLEPPRHILAKSNEYLNKIKFLPDLLGDSLDIYNRRVFVNVDLNEEN  284

Query  570  -GAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmka  394
             G  +WFH  YP  NQ F+ YN++V+ E+       +    +S+WL++ V++ DYVVMKA
Sbjct  285  HGVVEWFHKKYPKKNQGFEVYNLEVEPEEGTTAPKND----VSDWLKDNVREEDYVVMKA  340

Query  393  eaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAV  214
            EAEVV EM+R+RTI LVDELFLEC + W E      ++R  AYW+C+ L+GRLR++GVAV
Sbjct  341  EAEVVVEMMRKRTIRLVDELFLECNNGWWESGRSGGSKR--AYWECIALYGRLRDQGVAV  398

Query  213  HQWW  202
            HQW+
Sbjct  399  HQWF  402



>ref|XP_002323954.2| hypothetical protein POPTR_0017s07500g [Populus trichocarpa]
 gb|EEF04087.2| hypothetical protein POPTR_0017s07500g [Populus trichocarpa]
Length=406

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 130/184 (71%), Gaps = 11/184 (6%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSSM--RKMKFLPDLMGDSLQNYPRRVFI----SDDK  574
            + KK AL+ LED LLEPPRK   KS M  +  K+LPDL+GDSL+ + RR FI     +++
Sbjct  227  DAKKEALQGLEDILLEPPRKTPEKSRMYLKGFKYLPDLLGDSLEGFSRRFFIDAGSQEEE  286

Query  573  NGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmka  394
            NGA  WF++NYP  NQ+F+F++I++  E           V  SNWL   V++ ++VVMKA
Sbjct  287  NGAMLWFNENYPTRNQDFEFHSINMLSEGVPGRVASPADV--SNWLMKNVREDEFVVMKA  344

Query  393  eaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAV  214
            EAEV EEM++ +TI LVDELFLEC +QW++G+     + +RAYW+C+ L+GRLR+EGVAV
Sbjct  345  EAEVAEEMMKRKTIGLVDELFLECNNQWQKGQR---KKSRRAYWECVALYGRLRDEGVAV  401

Query  213  HQWW  202
            HQWW
Sbjct  402  HQWW  405



>ref|XP_011092449.1| PREDICTED: uncharacterized protein LOC105172627 [Sesamum indicum]
Length=408

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 131/188 (70%), Gaps = 22/188 (12%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRK-ALAKSSM---RKMKFLPDLMGDSLQNYPRRVFISDDKNG  568
            E K+AALK LED  LEPPR+ +L K S+   RK  FLPDL+ DSL  YPRRVFISDD + 
Sbjct  232  EEKRAALKGLEDVYLEPPRQTSLEKRSIAASRKFNFLPDLLKDSLDQYPRRVFISDDSST  291

Query  567  AEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESV-----GLSNWLRNTVKDADYvv  403
             + WF+ NYP  +QEF+ Y +++          G++ V      + NWL   V+  DYVV
Sbjct  292  LD-WFYKNYPMRDQEFEVYTVEI----------GKQGVLPHVAEVPNWLMKKVRREDYVV  340

Query  402  mkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEG  223
            MKAEA++VEEM++ + +CLVDELFLEC +QW++G+    N  +RAYWQCL L+G++R+EG
Sbjct  341  MKAEAQLVEEMLKNKALCLVDELFLECDNQWQDGDEE--NGSKRAYWQCLALYGKVRDEG  398

Query  222  VAVHQWWS  199
            +AVHQWW+
Sbjct  399  IAVHQWWN  406



>ref|XP_008466168.1| PREDICTED: uncharacterized protein LOC103503664 [Cucumis melo]
Length=308

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 121/185 (65%), Gaps = 10/185 (5%)
 Frame = -2

Query  729  KKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI------SDDK  574
            + AAL  LED LLEPPR A  KS   +++ ++LPDLM DSL++YPR +FI       +  
Sbjct  126  RAAALNELEDVLLEPPRSASRKSRRYLQRTRYLPDLMDDSLESYPRHIFIDAGVPEKEAG  185

Query  573  NGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmka  394
                 WF  NYP  N++F+ Y I+  V   + + + E  VG+S+WL N VK  DYVVMKA
Sbjct  186  GSGTSWFDHNYPTRNKKFEMYKIET-VSTDQASSSKEPQVGISDWLSNNVKAEDYVVMKA  244

Query  393  eaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAV  214
            EAEVVE+M++ + + LVDELFLECK Q   G       R RAYWQCL L+G+LR+EGVAV
Sbjct  245  EAEVVEDMMKSKVVRLVDELFLECKPQKNGGRKVSGGGR-RAYWQCLALYGQLRDEGVAV  303

Query  213  HQWWS  199
            HQWW 
Sbjct  304  HQWWG  308



>ref|XP_009618057.1| PREDICTED: uncharacterized protein LOC104110298 [Nicotiana tomentosiformis]
Length=468

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 130/186 (70%), Gaps = 15/186 (8%)
 Frame = -2

Query  732  TKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFIS---DDKNG  568
             K+AALK LED LLEPPR A  KSS  +++ ++LPDLMG SL+NYPRRVFI     DKN 
Sbjct  290  AKEAALKKLEDVLLEPPRAASGKSSRYLKRTRYLPDLMGVSLENYPRRVFIDVGLQDKNE  349

Query  567  AEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEES---VGLSNWLRNTVKDADYvvmk  397
               WF   YP  N +F+ + I+   ++S    +G+E    + +S+WL+N VK+++YVVMK
Sbjct  350  GSDWFSKYYPTKNTKFEIFKIETVTKES----SGKEIPMIISMSDWLKNNVKESEYVVMK  405

Query  396  aeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVA  217
            AEA+VVEE+V+ + I L+DELFLECK Q   G    + + +RAYW+CL L+G LR+EG+A
Sbjct  406  AEADVVEELVKNKAIRLIDELFLECKHQ---GMKKGDKKNRRAYWECLALYGLLRDEGIA  462

Query  216  VHQWWS  199
            VHQWW 
Sbjct  463  VHQWWG  468



>emb|CDP11491.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 127/190 (67%), Gaps = 18/190 (9%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSSM--RKMKFLPDLMGDSLQNYPRRVFI-------S  583
            E KK AL +LED LLEPPR A  KS+   ++ +FLPDL+GDSL++Y RRVFI       +
Sbjct  252  EVKKKALNNLEDVLLEPPRAASGKSNSYRKRTRFLPDLIGDSLESYSRRVFIDVGLPDKN  311

Query  582  DDKNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEE--SVGLSNWLRNTVKDADY  409
            DD +G   WF  NYP  N EF+ Y    K+E   E  + EE   +G+S+WLR  +K  +Y
Sbjct  312  DDSSGDVSWFKKNYPTKNTEFEVY----KIETVNEGPSREEVAQIGMSDWLRKNLKGNEY  367

Query  408  vvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLRE  229
            VVMKAEAEVVEE+VR + I LVDELFLECK +   G      + +RAYW+CL L+G LR+
Sbjct  368  VVMKAEAEVVEELVRSKAIKLVDELFLECKHR---GIKKSVKRSRRAYWECLALYGSLRD  424

Query  228  EGVAVHQWWS  199
            EG+AVHQWW 
Sbjct  425  EGIAVHQWWG  434



>gb|KDP41466.1| hypothetical protein JCGZ_15873 [Jatropha curcas]
Length=427

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 127/188 (68%), Gaps = 11/188 (6%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFIS---DDKN  571
            E + AAL +LED LLEPPR A  KSS  ++K ++LPDL+GDSL+ YPRRVFI     +K 
Sbjct  242  EARHAALNNLEDVLLEPPRSASGKSSRYLKKTRYLPDLLGDSLEGYPRRVFIDVGLPEKE  301

Query  570  GAEK--WFHDNYPANNQEFDFYNIDVKVED--SEETKTGEESVGLSNWLRNTVKDADYvv  403
            G     WF  NYP  N +F+ Y I+   E    +E    EE +G+S WLR  VK+ DYVV
Sbjct  302  GGSGTGWFAKNYPTRNLDFEVYKIETLPESWPGKELPQVEE-IGMSGWLRKNVKEEDYVV  360

Query  402  mkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEG  223
            MKAEAEVVEEM++ + I LVDELF+ECK +   G+G     R RAYW+CL L+GRLR+EG
Sbjct  361  MKAEAEVVEEMMKSKAIRLVDELFMECKPRGHGGKGNNCGGR-RAYWECLALYGRLRDEG  419

Query  222  VAVHQWWS  199
            + VHQWW 
Sbjct  420  IGVHQWWG  427



>ref|XP_002514025.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48608.1| conserved hypothetical protein [Ricinus communis]
Length=422

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 128/187 (68%), Gaps = 11/187 (6%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI-----SDD  577
            E +KA L +LED LLEPPR A  KS   +++ K+LPDLMGDSL++YPRRVFI       +
Sbjct  239  EARKAVLNNLEDVLLEPPRAASGKSRTYLKRTKYLPDLMGDSLESYPRRVFIDVGLPERE  298

Query  576  KNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGE-ESVGLSNWLRNTVKDADYvvm  400
            +     WF  +YP  N +F+ Y I+   E S   +  + E +G+S WL   VK+ +YVVM
Sbjct  299  RGSGIGWFAKHYPTRNLDFEMYKIETVTEVSSGKEVPQVEEIGMSGWLSKNVKEEEYVVM  358

Query  399  kaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGV  220
            KAEAEVVEEM+  R+I LVDELF++CK +   G GG+ N  +RAYW+CL L+GRLR+EG+
Sbjct  359  KAEAEVVEEMIESRSIRLVDELFMDCKPR---GHGGKGNGSRRAYWECLALYGRLRDEGI  415

Query  219  AVHQWWS  199
            AVHQWW 
Sbjct  416  AVHQWWG  422



>ref|XP_010939748.1| PREDICTED: uncharacterized protein LOC105058495 [Elaeis guineensis]
Length=406

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 119/180 (66%), Gaps = 13/180 (7%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRK-ALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGAEK  559
            + K+AAL  LE  LLEPP K   +K   R+ K+LPDLMGDSL  YPRRVF+   + G+EK
Sbjct  239  KAKEAALNELEGVLLEPPSKYEESKKLWRRTKYLPDLMGDSLAEYPRRVFVDVGRTGSEK  298

Query  558  WFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevv  379
            WF + YP  +  F+   +       E    G+E+VG+S WL   VK+ +YVVMKAEAEVV
Sbjct  299  WFLEEYPKGDSPFEMIRL-------EAVGRGKEAVGISEWLARNVKEEEYVVMKAEAEVV  351

Query  378  eemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  199
            EEMV  RTI LVDELFLEC++QW         + +R YW+CL L+GRL +EGVAVHQWW 
Sbjct  352  EEMVNGRTIGLVDELFLECQNQW-----QNGKRSRRTYWECLALYGRLWDEGVAVHQWWG  406



>ref|XP_004504833.1| PREDICTED: uncharacterized protein LOC101507733 [Cicer arietinum]
Length=388

 Score =   152 bits (384),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 127/183 (69%), Gaps = 12/183 (7%)
 Frame = -2

Query  732  TKKAALKHLEDALLEPPRKALAKSSMR-KMKFLPDLMGDSLQNYPRRVFIS----DDKNG  568
             KKAALK LEDALLEPPR A +KS+   K+K+LP+L+GDSL+ Y RR+FI     ++   
Sbjct  213  AKKAALKGLEDALLEPPRLAFSKSNKNFKIKYLPELLGDSLEGYKRRIFIGAGLHEENKA  272

Query  567  AEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaea  388
            A +WF  NYP    +F   N+ V  E+S+  +T      +S WL   VK+ +YVVMKAEA
Sbjct  273  AIEWFERNYPKKGTKFQINNLLVGPEESDVPRTD-----VSAWLSKHVKEDEYVVMKAEA  327

Query  387  evveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQ  208
            +VVEEM+R++TICLVDELFL+C ++W +       +  RAYW+CL L+GRLR+EGVAVHQ
Sbjct  328  DVVEEMMRKKTICLVDELFLQCDNEWWQTGKT--KKSGRAYWECLALYGRLRDEGVAVHQ  385

Query  207  WWS  199
            WW 
Sbjct  386  WWG  388



>ref|XP_010675283.1| PREDICTED: uncharacterized protein LOC104891302 [Beta vulgaris 
subsp. vulgaris]
Length=421

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 122/186 (66%), Gaps = 13/186 (7%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFIS-DDKNGA  565
            E KKA L +LED LLEPPR A  KS   +RK KFLPDL+ DSL+ Y RRV+I     +G+
Sbjct  242  EEKKAVLGNLEDVLLEPPRSATGKSKTYLRKTKFLPDLLNDSLEGYSRRVYIDVGGGHGS  301

Query  564  EKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEES----VGLSNWLRNTVKDADYvvmk  397
             +WF  NYP  N++FD Y I+   E   E+    E     +G+S+WL   VK  +YVVMK
Sbjct  302  TRWFEQNYPTRNKDFDMYRIETVPETEVESDDAWEGPPTQMGISDWLWRNVKAEEYVVMK  361

Query  396  aeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVA  217
            A+AEVVEEM++ + I LVDELFLECK        G+    +RAYW+CL L+GRLR+ GVA
Sbjct  362  ADAEVVEEMLKSKAIALVDELFLECKP------FGKGGTSKRAYWECLALYGRLRDFGVA  415

Query  216  VHQWWS  199
            VHQWW 
Sbjct  416  VHQWWG  421



>ref|XP_010272926.1| PREDICTED: uncharacterized protein LOC104608592 [Nelumbo nucifera]
Length=418

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 122/185 (66%), Gaps = 9/185 (5%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPR--KALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDD----K  574
            E K+AAL  LEDALLEPPR  K    + ++  ++LPDLM DSL+ YPR VFI  D     
Sbjct  237  EAKQAALNRLEDALLEPPRASKVELGNYLKTTRYLPDLMEDSLEGYPRHVFIDVDLQVKS  296

Query  573  NGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmka  394
            N +  WF  NYP  N++F+ Y ID+   D      G   + +S+WL   VK+ +YVVMKA
Sbjct  297  NASPGWFEQNYPTRNKDFEVYKIDMVTTDELSPDKGVPQMEMSDWLWKNVKEEEYVVMKA  356

Query  393  eaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAV  214
            EAEVVEEM++   I LVDELFLECK Q   G  G +++ +R YW+CL L+GRLR+EGVAV
Sbjct  357  EAEVVEEMMKSNAISLVDELFLECKHQ---GLCGRKSKNRRPYWECLALYGRLRDEGVAV  413

Query  213  HQWWS  199
            HQWW 
Sbjct  414  HQWWG  418



>gb|AFK37639.1| unknown [Medicago truncatula]
Length=389

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 124/183 (68%), Gaps = 12/183 (7%)
 Frame = -2

Query  732  TKKAALKHLEDALLEPPRKALAKSSMR-KMKFLPDLMGDSLQNYPRRVFIS----DDKNG  568
             K  AL+ LEDALLEPPR+  AKS+   K+K+LP+L+GDSL  Y RRVF+     D+   
Sbjct  214  AKTTALEGLEDALLEPPRQDSAKSNKNLKIKYLPELLGDSLDGYKRRVFVGVGLRDENKA  273

Query  567  AEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaea  388
            A +WF  NYP  + +F+ +N+ V  E+    +T      +S WL   VK  +Y VMKAEA
Sbjct  274  AVEWFERNYPKKSTKFEIHNLQVAPEEPNVPQTD-----VSAWLSKHVKADEYAVMKAEA  328

Query  387  evveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQ  208
            +VVEEM+R++TICLVDELFL+C +QW +       +  RAYWQCL+L+GRLR+EGVAVHQ
Sbjct  329  DVVEEMMRKKTICLVDELFLQCNNQWWQTGTR--KKSGRAYWQCLDLYGRLRDEGVAVHQ  386

Query  207  WWS  199
            WW 
Sbjct  387  WWG  389



>ref|XP_003608416.1| hypothetical protein MTR_4g093860 [Medicago truncatula]
 gb|AES90613.1| transmembrane protein, putative [Medicago truncatula]
Length=389

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 125/183 (68%), Gaps = 12/183 (7%)
 Frame = -2

Query  732  TKKAALKHLEDALLEPPRKALAKSSMR-KMKFLPDLMGDSLQNYPRRVFIS----DDKNG  568
             K  AL+ LEDALLEPPR+  AKS+   K+K+LP+L+GDSL  Y RRVF+     D+   
Sbjct  214  AKTTALEGLEDALLEPPRQDSAKSNKNLKIKYLPELLGDSLDGYKRRVFVGVGLRDENKA  273

Query  567  AEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaea  388
            A +WF  NYP  + +F+ +N+ V  E+    +T      +S WL   VK  +YVVMKAEA
Sbjct  274  AVEWFERNYPKKSTKFEIHNLQVAPEEPNVPQTD-----VSAWLSKHVKADEYVVMKAEA  328

Query  387  evveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQ  208
            +VVEEM+R++TICLVDELFL+C +QW +       +  RAYWQCL+L+GRLR+EGVAVHQ
Sbjct  329  DVVEEMMRKKTICLVDELFLQCNNQWWQTGTR--KKSGRAYWQCLDLYGRLRDEGVAVHQ  386

Query  207  WWS  199
            WW 
Sbjct  387  WWG  389



>ref|XP_004252809.1| PREDICTED: uncharacterized protein LOC101251865 [Solanum lycopersicum]
Length=433

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 123/187 (66%), Gaps = 14/187 (7%)
 Frame = -2

Query  729  KKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI---------S  583
            KK ALK LED LLEPPR +  KSS  ++K  FLPDLMG SL++YPRRVFI          
Sbjct  249  KKEALKKLEDVLLEPPRASSRKSSRYLKKTHFLPDLMGVSLESYPRRVFIDVGLQEKNEK  308

Query  582  DDKNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvv  403
               N    WF  +YP  N +F+ + I+   E+S   +    S+ +S+WL+  VK+ +YVV
Sbjct  309  SSDNYHSTWFTKHYPTKNTKFEMFKIETMNEESSGKEIPLSSINMSDWLQKNVKENEYVV  368

Query  402  mkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEG  223
            MKAEA+VVEEMV  R+I L+DELFLECK Q   G    + + +RAYW+CL L+G LR+EG
Sbjct  369  MKAEADVVEEMVNNRSIKLIDELFLECKHQ---GIKKSDKKNRRAYWECLSLYGLLRDEG  425

Query  222  VAVHQWW  202
            +AVHQWW
Sbjct  426  IAVHQWW  432



>ref|XP_009413889.1| PREDICTED: uncharacterized protein LOC103995101 [Musa acuminata 
subsp. malaccensis]
Length=386

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 119/192 (62%), Gaps = 13/192 (7%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKALAKSSMRKMKFLPDLMGDSLQNYPRRVFI----SDDKN  571
            PE KK AL+ LEDALLEPPR        R+ ++LP+L GD L  YPRRVF+    + +  
Sbjct  195  PEAKKKALRGLEDALLEPPRPG-QHGRQRRARYLPELTGDELDGYPRRVFVEMVAAGEAG  253

Query  570  GAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGE-ESVGLSNWLRNTVKDADYvvmka  394
              E WF  NYP   + FD   +++K ++ E  K  E  +  L+ WL   VK+ +YVV+KA
Sbjct  254  SGESWFKRNYPRKGRAFDVIRLEMKDDEDEAVKAEEGATASLAEWLERNVKEEEYVVVKA  313

Query  393  eaevveemvreRTICLVDELFLECKSQ-WeegeggeENQR------QRAYWQCLELHGRL  235
            EA  VEE + E  I LVDELFLEC  Q WE  E  E+ ++      QRAYWQCL L+G+L
Sbjct  314  EATAVEEAMAEGAIGLVDELFLECDHQSWEADEMREKVKKRATRGGQRAYWQCLALYGKL  373

Query  234  REEGVAVHQWWS  199
            R+ GVAVHQWWS
Sbjct  374  RDAGVAVHQWWS  385



>ref|XP_010548868.1| PREDICTED: uncharacterized protein LOC104820197 [Tarenaya hassleriana]
Length=432

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 128/197 (65%), Gaps = 18/197 (9%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQ--NYPRRVFI---SDD  577
            E +K AL  LED LLEPPR +  KS   +++ ++LPDLMGDSL   NYPRRVFI   + +
Sbjct  236  EARKRALNKLEDVLLEPPRASSRKSRTYLKRTRYLPDLMGDSLDLGNYPRRVFIEVGASE  295

Query  576  KNGAE--KWFHDNYPANNQEFDFYNIDVKVEDSE-------ETKTGEESVGLSNWLRNTV  424
            K G    +WF  NYP  N EF+ Y I+   E+         E  +  + +G+S W+R  V
Sbjct  296  KEGVSVTEWFAKNYPTRNLEFEMYKIETVSEEKSNSNEMNLEIDSVPQRMGMSEWMRENV  355

Query  423  KDADYvvmkaeaevveemvreRTICLVDELFLECKSQWee--geggeENQRQRAYWQCLE  250
            K+ +YVVMKAEAEVVEEMVR +TI +VDELFLECK +     G   + N   RAYW+CL 
Sbjct  356  KEEEYVVMKAEAEVVEEMVRSKTIKMVDELFLECKPKGLGFGGRKSQSNNGGRAYWECLA  415

Query  249  LHGRLREEGVAVHQWWS  199
            L+G+LR+EG+AVHQWW 
Sbjct  416  LYGKLRDEGIAVHQWWG  432



>gb|AFK34019.1| unknown [Lotus japonicus]
Length=257

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 129/186 (69%), Gaps = 17/186 (9%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFIS-----DD  577
            ETKK ALK LED LLEPPR+ + KS   ++K+K+LP+L+GDSL+ Y RR+FIS      +
Sbjct  82   ETKKEALKGLEDVLLEPPRQRIIKSRKYLKKIKYLPELLGDSLEGYNRRLFISAGLLSKE  141

Query  576  KNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmk  397
              G  +WF  NYP  + +F+ +++    ED  +          S WL   VK+ +YVVMK
Sbjct  142  NKGVIEWFERNYPKKDTKFEIHSLLFVPEDDNDV---------SAWLSKHVKEEEYVVMK  192

Query  396  aeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVA  217
            AEAEVVEEM++ERTI LVDELFLECK++W + +G    + +RAYW+CL L+GRLR+EGVA
Sbjct  193  AEAEVVEEMIKERTIYLVDELFLECKNEWWQKKGKR-KKSRRAYWECLALYGRLRDEGVA  251

Query  216  VHQWWS  199
            VHQWW 
Sbjct  252  VHQWWG  257



>ref|XP_006301429.1| hypothetical protein CARUB_v10021847mg [Capsella rubella]
 gb|EOA34327.1| hypothetical protein CARUB_v10021847mg [Capsella rubella]
Length=422

 Score =   147 bits (372),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 126/188 (67%), Gaps = 13/188 (7%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDS--LQNYPRRVFISDDKNG  568
            E K+ AL+ LED LLEPPR A  KS    ++ ++LPDLMGDS  L++Y RRVFI D  NG
Sbjct  239  EAKEKALRKLEDVLLEPPRSASRKSRTYFKRTRYLPDLMGDSMDLESYSRRVFI-DVGNG  297

Query  567  ----AEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvm  400
                  +WF +NYP  NQ F+ Y I+     ++ET    E +G+  WL   VK+ +YVVM
Sbjct  298  KGSSGTEWFIENYPTRNQNFEMYKIETV---NDETSLESEKMGMPEWLNENVKEEEYVVM  354

Query  399  kaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQ-RAYWQCLELHGRLREEG  223
            KAEAEVVEEM+R ++I +VDELFLECK +     G +   +  RAYW+CL L+G+LR+EG
Sbjct  355  KAEAEVVEEMMRSKSIKMVDELFLECKPKGLGLRGRKMQSKSGRAYWECLALYGKLRDEG  414

Query  222  VAVHQWWS  199
            VAVHQWW 
Sbjct  415  VAVHQWWG  422



>gb|KFK40909.1| hypothetical protein AALP_AA2G059000 [Arabis alpina]
Length=420

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 126/188 (67%), Gaps = 13/188 (7%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQ--NYPRRVFISDDKNG  568
            E KK AL  LED LLEPPR A  KSS  +++ ++LPDLMGD+L   +Y RRVFI D  NG
Sbjct  237  EAKKNALSKLEDVLLEPPRAASRKSSTYLKRTRYLPDLMGDTLDLGSYSRRVFI-DVGNG  295

Query  567  ----AEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvm  400
                  +WF  NYP  N +F+ Y I+     ++E     E +G++ WLR  VK+ +YVVM
Sbjct  296  KGSSGTEWFVKNYPTRNLKFEMYKIETV---NDEMSLESEQMGMTEWLRENVKEEEYVVM  352

Query  399  kaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQ-RAYWQCLELHGRLREEG  223
            KAEAEVVEEM+R ++I +VDELFLECK +     G +   +  RAYW+CL L+G+LR+EG
Sbjct  353  KAEAEVVEEMMRSKSIKMVDELFLECKPKGLGLRGRKMQSKNGRAYWECLALYGKLRDEG  412

Query  222  VAVHQWWS  199
            VAVHQWW 
Sbjct  413  VAVHQWWG  420



>gb|EPS65863.1| hypothetical protein M569_08912, partial [Genlisea aurea]
Length=351

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 127/187 (68%), Gaps = 21/187 (11%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKS-SMRKMKFLPDLMGD--SLQNYPRRVFISDDKNGA  565
            E K+  LK LEDA LEPPR+   K  + RK+KFLPDL+    SL  YPRRVFISD+    
Sbjct  178  EMKRTILKGLEDAYLEPPRRKPPKIFTSRKIKFLPDLLKGYYSLAEYPRRVFISDESTAL  237

Query  564  EKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeae  385
            + WF+ NYP  +QEF+ YN+        E  +G    G+S+WL   VK  DYVVMKAEAE
Sbjct  238  D-WFYKNYPMRDQEFEIYNV--------EGTSG----GVSSWLEKKVKTEDYVVMKAEAE  284

Query  384  vveemvreRTICLVDELFLECKSQWeegeg-----geENQRQRAYWQCLELHGRLREEGV  220
            VVEE++R++ + LVDELFLEC+++WE  +         +  +RAYWQCLEL+G++R++G+
Sbjct  285  VVEEVLRDQRMYLVDELFLECRNEWELEKKDNRLSNSSSSNKRAYWQCLELYGKVRDQGI  344

Query  219  AVHQWWS  199
            AVHQWW+
Sbjct  345  AVHQWWN  351



>ref|XP_006338079.1| PREDICTED: uncharacterized protein LOC102584542 [Solanum tuberosum]
Length=402

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 127/187 (68%), Gaps = 15/187 (8%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI------S  583
            P  K+ ALK LED LLEPPR A  KSS  ++K ++LP+LM   L++YPRRVFI       
Sbjct  222  PNAKEDALKKLEDVLLEPPRAASGKSSRYLKKTRYLPELMNIRLESYPRRVFIDVGLQNK  281

Query  582  DDKNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvv  403
            ++K+    WF  +YP  N +F+ + I++  ++S         +G+S+WL   VK+ +YVV
Sbjct  282  NEKSSDSSWFSKHYPTRNTKFEIFKIEIVAKES-----SAPLIGMSDWLEKNVKENEYVV  336

Query  402  mkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEG  223
            MKAEAEVVEEMVR + I LVDELFLECK Q    + G++ + +RAYW+CL L+G LR+EG
Sbjct  337  MKAEAEVVEEMVRNKAIKLVDELFLECKHQ--GVKKGDKKKSRRAYWECLSLYGMLRDEG  394

Query  222  VAVHQWW  202
            VAVHQWW
Sbjct  395  VAVHQWW  401



>ref|XP_010470285.1| PREDICTED: uncharacterized protein LOC104750217 isoform X1 [Camelina 
sativa]
Length=421

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 128/188 (68%), Gaps = 13/188 (7%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDS--LQNYPRRVFISDDKNG  568
            +TK+ AL+ LED LLEPPR A  KS    ++ ++LPDLMGD+  L++Y RRVFI D  NG
Sbjct  238  DTKEKALRKLEDVLLEPPRAASRKSRTYFKRTRYLPDLMGDNMDLESYSRRVFI-DVGNG  296

Query  567  ----AEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvm  400
                  +WF  NYP  NQ+F+ Y I+     ++E     E +G++ WL++ VK+ +YVVM
Sbjct  297  KGSSGTEWFIQNYPTRNQKFEMYKIETV---NDEMSLESEKMGMTEWLKDNVKEDEYVVM  353

Query  399  kaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQ-RAYWQCLELHGRLREEG  223
            KAEAEVVEEM+R ++I +VDELFLECK +     G     +  RAYW+CL L+G+LR+EG
Sbjct  354  KAEAEVVEEMMRSKSIKMVDELFLECKPKGLGLRGRTMQSKNGRAYWECLALYGKLRDEG  413

Query  222  VAVHQWWS  199
            VAVHQWW 
Sbjct  414  VAVHQWWG  421



>ref|XP_010511088.1| PREDICTED: uncharacterized protein LOC104787248 [Camelina sativa]
Length=421

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 128/188 (68%), Gaps = 13/188 (7%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDS--LQNYPRRVFISDDKNG  568
            E K+ AL+ LED LLEPPR A  KS    ++ ++LPDLMGD+  L++Y RRVFI D  NG
Sbjct  238  EAKEKALRKLEDVLLEPPRAASRKSRTYFKRTRYLPDLMGDNMDLESYSRRVFI-DVGNG  296

Query  567  ----AEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvm  400
                  +WF  NYP  NQ+F+ Y I+     ++E     E +G++ WL++ VK+ +YVVM
Sbjct  297  KGSSGTEWFIQNYPTRNQKFEMYKIETV---NDEMSLESEKMGMTEWLKDNVKEDEYVVM  353

Query  399  kaeaevveemvreRTICLVDELFLECK-SQWeegeggeENQRQRAYWQCLELHGRLREEG  223
            KAEAEVVEEM+R ++I +VDELFLECK +         +++  RAYW+CL L+G+LR+EG
Sbjct  354  KAEAEVVEEMMRSKSIKMVDELFLECKPNALGLRGRKMQSKSGRAYWECLALYGKLRDEG  413

Query  222  VAVHQWWS  199
            VAVHQWW 
Sbjct  414  VAVHQWWG  421



>ref|XP_006392327.1| hypothetical protein EUTSA_v10023489mg [Eutrema salsugineum]
 gb|ESQ29613.1| hypothetical protein EUTSA_v10023489mg [Eutrema salsugineum]
Length=416

 Score =   145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 127/186 (68%), Gaps = 13/186 (7%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSL--QNYPRRVFISDDKNG  568
            E KK AL  LED LLEPPR A  KS   +++ ++LPDLMGD+L   +Y RRVFI D  NG
Sbjct  235  EAKKKALSKLEDVLLEPPRAASRKSRTYLKRTRYLPDLMGDTLDLASYTRRVFI-DVSNG  293

Query  567  ----AEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvm  400
                  +W   NYP  NQ+F+ Y I+     ++E     E++G++ WL+  VK+ +YVVM
Sbjct  294  KGSSGTEWLVKNYPTRNQKFEMYKIETV---NDEMSLESENMGMTEWLKENVKEEEYVVM  350

Query  399  kaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGV  220
            KAEAEVVEEM+R ++I +VDELFLECK +   G    +++  RAYW+CL L+G+LR+EGV
Sbjct  351  KAEAEVVEEMMRSKSIKMVDELFLECKPK-GLGLRKMQSKNGRAYWECLALYGKLRDEGV  409

Query  219  AVHQWW  202
            AVHQWW
Sbjct  410  AVHQWW  415



>ref|XP_010470286.1| PREDICTED: uncharacterized protein LOC104750217 isoform X2 [Camelina 
sativa]
Length=408

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 126/186 (68%), Gaps = 24/186 (13%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDS--LQNYPRRVFISDDKNG  568
            +TK+ AL+ LED LLEPPR A  KS    ++ ++LPDLMGD+  L++Y RRVFI D  NG
Sbjct  238  DTKEKALRKLEDVLLEPPRAASRKSRTYFKRTRYLPDLMGDNMDLESYSRRVFI-DVGNG  296

Query  567  ----AEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvm  400
                  +WF  NYP  NQ+F+ Y I+     ++E     E +G++ WL++ VK+ +YVVM
Sbjct  297  KGSSGTEWFIQNYPTRNQKFEMYKIETV---NDEMSLESEKMGMTEWLKDNVKEDEYVVM  353

Query  399  kaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGV  220
            KAEAEVVEEM+R ++I +VDELFLECK             + RAYW+CL L+G+LR+EGV
Sbjct  354  KAEAEVVEEMMRSKSIKMVDELFLECKP------------KGRAYWECLALYGKLRDEGV  401

Query  219  AVHQWW  202
            AVHQWW
Sbjct  402  AVHQWW  407



>ref|XP_002886704.1| hypothetical protein ARALYDRAFT_475423 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62963.1| hypothetical protein ARALYDRAFT_475423 [Arabidopsis lyrata subsp. 
lyrata]
Length=420

 Score =   145 bits (365),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 128/187 (68%), Gaps = 13/187 (7%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSL--QNYPRRVFISDDKNG  568
            E ++ AL+ LED LLEPPR A  KS    ++ ++LPDLMGD+L  ++Y RRVFI D  NG
Sbjct  237  EAREKALRKLEDVLLEPPRAASRKSRTYFKRTRYLPDLMGDNLDLESYSRRVFI-DVGNG  295

Query  567  ----AEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvm  400
                  +WF +NYP  NQ+F+ Y I+     ++E     E +G++ WL+  VK+ +YVVM
Sbjct  296  KGSSGMEWFVENYPTRNQKFEMYKIETV---NDEMSLESEKMGMTEWLKENVKEEEYVVM  352

Query  399  kaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQ-RAYWQCLELHGRLREEG  223
            KAEAEVVEEM+R ++I +VDELFLECK +     G +   +  RAYW+CL L+G+LR+EG
Sbjct  353  KAEAEVVEEMMRSKSIKMVDELFLECKPKGLGLRGRKMQSKSGRAYWECLALYGKLRDEG  412

Query  222  VAVHQWW  202
            VAVHQWW
Sbjct  413  VAVHQWW  419



>emb|CDY23810.1| BnaA01g21610D [Brassica napus]
Length=274

 Score =   142 bits (357),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 127/188 (68%), Gaps = 13/188 (7%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDS--LQNYPRRVFISDDKNG  568
            E KK AL  LED LLEPPR A  KS   +++ ++LPDLMGD+  L +Y RRVFI D  NG
Sbjct  91   EAKKNALSKLEDVLLEPPRAASRKSRTYLKRTRYLPDLMGDTMDLGSYSRRVFI-DVGNG  149

Query  567  ----AEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvm  400
                  +WF  NYP  N +F+ Y I   V D +  ++  E++G++ WL+  VK+ +YVVM
Sbjct  150  KGSSGTEWFVKNYPTRNLKFEMYKIKT-VNDEKSLES--ENMGMTEWLKENVKEEEYVVM  206

Query  399  kaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQ-RAYWQCLELHGRLREEG  223
            KAEAEVVEEM+R ++I +VDELFLECK +     G +   +  +AYW+CL L+G+LR+EG
Sbjct  207  KAEAEVVEEMMRSKSIKMVDELFLECKPKGLGLRGRKMQSKSGKAYWECLALYGKLRDEG  266

Query  222  VAVHQWWS  199
            VAVHQWW 
Sbjct  267  VAVHQWWG  274



>ref|XP_004237982.2| PREDICTED: uncharacterized protein LOC101250984 [Solanum lycopersicum]
Length=334

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 125/188 (66%), Gaps = 16/188 (9%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI-------  586
            P  K+ ALK LED LLEPPR +  KSS  +++ ++LP+LM   L +YPRRVFI       
Sbjct  153  PNAKEDALKKLEDVLLEPPRASSGKSSRYLKRTRYLPELMNIPLDSYPRRVFIEIFGLQD  212

Query  585  SDDKNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYv  406
             ++K+G   WF  NYP  N +F+ + I+   ++S         + +S+WL   VK+ +YV
Sbjct  213  KNEKSGDSTWFSKNYPTRNTKFEIFRIEAVTKES-----SAPLIEMSDWLEKNVKEDEYV  267

Query  405  vmkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREE  226
            VMKAEAEVVEEMVR + I LVDELFLECK Q    + G++ + +RAYW+CL L+G LR+E
Sbjct  268  VMKAEAEVVEEMVRNKAIKLVDELFLECKHQ--GVKKGDKKKSRRAYWECLSLYGMLRDE  325

Query  225  GVAVHQWW  202
            GVAVHQWW
Sbjct  326  GVAVHQWW  333



>emb|CDY29160.1| BnaC09g15570D [Brassica napus]
Length=422

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 124/187 (66%), Gaps = 12/187 (6%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSL--QNYPRRVFI--SDDK  574
            E KK AL  LED LLEPPR A  KS   +++ ++LPDLMGDSL  ++Y RRVFI   D K
Sbjct  238  EAKKKALSKLEDVLLEPPRAASRKSRTYLKRTRYLPDLMGDSLDLKSYSRRVFIDVGDGK  297

Query  573  -NGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmk  397
             +   +WF  NYP     F+ Y I      ++E     E++G++ WL+  VKD +YVVMK
Sbjct  298  GSSGTEWFVKNYPTKKLRFEMYKIQTV---NDEMSIESENMGITEWLKENVKDEEYVVMK  354

Query  396  aeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQ--RAYWQCLELHGRLREEG  223
            AEAEVVEEM+R ++I +VDELFLECK +     G    Q +  RAYW+CL L+G+LR+EG
Sbjct  355  AEAEVVEEMMRNKSIKMVDELFLECKPKGLGLRGRRTMQSKSGRAYWECLALYGKLRDEG  414

Query  222  VAVHQWW  202
            VAVHQWW
Sbjct  415  VAVHQWW  421



>gb|AAG50763.1|AC079131_8 hypothetical protein [Arabidopsis thaliana]
Length=420

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 128/187 (68%), Gaps = 13/187 (7%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSL--QNYPRRVFISDDKNG  568
            + ++ AL+ LED LLEPPR A  KS    ++ ++LPDLMGD+L  ++Y RRVFI D  NG
Sbjct  237  DAREKALRKLEDVLLEPPRAASRKSRTYFKRTRYLPDLMGDNLDLESYSRRVFI-DVGNG  295

Query  567  ----AEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvm  400
                  +WF +NYP  NQ+F+ Y I+  V D  E     E +G++ WL+  VK+ +YVVM
Sbjct  296  KGSSGMEWFVENYPTRNQKFEMYKIET-VND--EMSLESEKMGMTEWLKENVKEEEYVVM  352

Query  399  kaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQ-RAYWQCLELHGRLREEG  223
            KAEAE+VEEM+R ++I +VDELFLECK +     G +   +  RAYW+CL L+G+LR+EG
Sbjct  353  KAEAEMVEEMMRSKSIKMVDELFLECKPKGLGLRGRKMQSKSGRAYWECLALYGKLRDEG  412

Query  222  VAVHQWW  202
            VAVHQWW
Sbjct  413  VAVHQWW  419



>ref|XP_009588038.1| PREDICTED: uncharacterized protein LOC104085654 [Nicotiana tomentosiformis]
Length=427

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 128/188 (68%), Gaps = 15/188 (8%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI------S  583
            P+ K+AALK LED LLEPPR A  KSS  +++ ++L +LM   L++YPRRVFI       
Sbjct  247  PKAKEAALKKLEDVLLEPPRAASGKSSRYLKRTRYLSELMDIPLESYPRRVFIDVGLQEK  306

Query  582  DDKNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvv  403
            ++ +    WF  +YP  N +F+ + I+   ++S       + +G+S+WL+  VK+ +YVV
Sbjct  307  NEGSADSSWFSKHYPTRNTKFEIFKIETVTKES-----SAQLIGMSDWLKKNVKENEYVV  361

Query  402  mkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEG  223
            MKAEAEVVEEMVR + I LVDELFLECK Q    + G++ + +RAYW+CL L+G LR+EG
Sbjct  362  MKAEAEVVEEMVRNKAIRLVDELFLECKHQ--GIKKGDKKKSRRAYWECLSLYGMLRDEG  419

Query  222  VAVHQWWS  199
            VAVHQWW 
Sbjct  420  VAVHQWWG  427



>ref|XP_009113331.1| PREDICTED: uncharacterized protein LOC103838632 [Brassica rapa]
Length=418

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 125/187 (67%), Gaps = 12/187 (6%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSL--QNYPRRVFI--SDDK  574
            E KK AL  LED LLEPPR A  KS   +++ ++LPDLMGDSL  ++Y RRVFI   D K
Sbjct  234  EAKKRALSKLEDVLLEPPRAASRKSRTYLKRTRYLPDLMGDSLDLESYSRRVFIDVGDGK  293

Query  573  -NGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmk  397
             +   +WF  NYP     F+ Y I      ++E     E++G++ WL+  VKD +YVVMK
Sbjct  294  GSSGTEWFVKNYPTRKLRFEMYKIQTV---NDEMSIESENMGITEWLKENVKDEEYVVMK  350

Query  396  aeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQ--RAYWQCLELHGRLREEG  223
            AEAEVVEEM+R ++I +VDELFLECK +     G  + Q +  RAYW+CL L+G+LR+EG
Sbjct  351  AEAEVVEEMMRNKSIKMVDELFLECKPKGLALRGRRKMQSKSGRAYWECLALYGKLRDEG  410

Query  222  VAVHQWW  202
            VAVHQWW
Sbjct  411  VAVHQWW  417



>gb|AEM45875.1| hypothetical protein [Brassica rapa subsp. oleifera]
Length=419

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 125/187 (67%), Gaps = 12/187 (6%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSL--QNYPRRVFI--SDDK  574
            E KK AL  LED LLEPPR A  KS   +++ ++LPDLMGDSL  ++Y RRVFI   D K
Sbjct  235  EVKKRALSKLEDVLLEPPRAASRKSRTYLKRTRYLPDLMGDSLDLESYSRRVFIDVGDGK  294

Query  573  -NGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmk  397
             +   +WF  NYP     F+ Y I      ++E     E++G++ WL+  VKD +YVVMK
Sbjct  295  GSSGTEWFVKNYPTRKLRFEMYKIQTV---NDEMSIESENMGITEWLKENVKDEEYVVMK  351

Query  396  aeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQ--RAYWQCLELHGRLREEG  223
            AEAEVVEEM+R ++I +VDELFLECK +     G  + Q +  RAYW+CL L+G+LR+EG
Sbjct  352  AEAEVVEEMMRNKSIKMVDELFLECKPKGLALRGRRKMQSKSGRAYWECLALYGKLRDEG  411

Query  222  VAVHQWW  202
            VAVHQWW
Sbjct  412  VAVHQWW  418



>emb|CDY39912.1| BnaA09g14940D [Brassica napus]
Length=419

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 125/187 (67%), Gaps = 12/187 (6%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSL--QNYPRRVFI--SDDK  574
            E KK AL  LED LLEPPR A  KS   +++ ++LPDLMGDSL  ++Y RRVFI   D K
Sbjct  235  EAKKRALSKLEDVLLEPPRAASRKSRTYLKRTRYLPDLMGDSLDLESYSRRVFIDVGDGK  294

Query  573  -NGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmk  397
             +   +WF  NYP     F+ Y I      ++E     E++G++ WL+  VKD +YVVMK
Sbjct  295  GSSGTEWFVKNYPTRKLRFEMYKIQTV---NDEMSIESENMGITEWLKENVKDEEYVVMK  351

Query  396  aeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQ--RAYWQCLELHGRLREEG  223
            AEAEVVEEM+R ++I +VDELFLECK +     G  + Q +  RAYW+CL L+G+LR+EG
Sbjct  352  AEAEVVEEMMRNKSIKMVDELFLECKPKGLALRGRRKMQSKSGRAYWECLALYGKLRDEG  411

Query  222  VAVHQWW  202
            VAVHQWW
Sbjct  412  VAVHQWW  418



>ref|NP_176109.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG50697.1|AC079604_4 hypothetical protein [Arabidopsis thaliana]
 dbj|BAC43031.1| unknown protein [Arabidopsis thaliana]
 gb|ABE65720.1| unknown [Arabidopsis thaliana]
 gb|AEE33501.1| uncharacterized protein AT1G58120 [Arabidopsis thaliana]
Length=420

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 128/188 (68%), Gaps = 13/188 (7%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSL--QNYPRRVFISDDKNG  568
            + ++ AL+ LED LLEPPR A  KS    ++ ++LPDLMGD+L  ++Y RRVFI D  NG
Sbjct  237  DAREKALRKLEDVLLEPPRAASRKSRTYFKRTRYLPDLMGDNLDLESYSRRVFI-DVGNG  295

Query  567  ----AEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvm  400
                  +WF +NYP  NQ+F+ Y I+     ++E     E +G++ WL+  VK+ +YVVM
Sbjct  296  KGSSGMEWFVENYPTRNQKFEMYKIETV---NDEMSLESEKMGMTEWLKENVKEEEYVVM  352

Query  399  kaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQ-RAYWQCLELHGRLREEG  223
            KAEAE+VEEM+R ++I +VDELFLECK +     G +   +  RAYW+CL L+G+LR+EG
Sbjct  353  KAEAEMVEEMMRSKSIKMVDELFLECKPKGLGLRGRKMQSKSGRAYWECLALYGKLRDEG  412

Query  222  VAVHQWWS  199
            VAVHQWW 
Sbjct  413  VAVHQWWG  420



>ref|XP_010414766.1| PREDICTED: uncharacterized protein LOC104700863 [Camelina sativa]
Length=408

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 125/187 (67%), Gaps = 24/187 (13%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDS--LQNYPRRVFISDDKNG  568
            + K+ AL+ LED LLEPPR A  KS    ++ ++LPDLMGD+  L++Y RRVFI D  NG
Sbjct  238  DAKEKALRKLEDVLLEPPRAASRKSRTYFKRTRYLPDLMGDNMDLESYSRRVFI-DVGNG  296

Query  567  ----AEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvm  400
                  +WF  NYP  NQ+F+ Y I+     ++E     E +G++ WL++ VK+ +YVVM
Sbjct  297  KGSSGTEWFIQNYPTRNQKFEMYKIETV---NDEMSLESEKMGMTEWLKDNVKEDEYVVM  353

Query  399  kaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGV  220
            KAEAEVVEEM+R ++I +VDELFLECK             + RAYW+CL L+G+LR+EGV
Sbjct  354  KAEAEVVEEMMRSKSIKMVDELFLECKP------------KGRAYWECLALYGKLRDEGV  401

Query  219  AVHQWWS  199
            AVHQWW 
Sbjct  402  AVHQWWG  408



>ref|XP_010544075.1| PREDICTED: uncharacterized protein LOC104816801 [Tarenaya hassleriana]
Length=451

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 123/197 (62%), Gaps = 19/197 (10%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQ--NYPRRVFI------  586
            E ++ AL  LED LLEPPR +  KS   +++ ++LPDLM DSL   NYPRRVFI      
Sbjct  254  EARRRALSKLEDVLLEPPRASSRKSRTYLKRTRYLPDLMADSLDLDNYPRRVFIDVGMSG  313

Query  585  -SDDKNGAEKWFHDNYPANNQEFDFYNIDVKVEDSE------ETKTGEESVGLSNWLRNT  427
                     +WF  NYP  N EF+ Y I+   EDS       E  +  + +G+S W+R  
Sbjct  314  SRGGGGSVTEWFAKNYPTRNLEFEMYKIETVSEDSSNNEMNLEIDSVPQRMGMSEWMREN  373

Query  426  VKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeeg--eggeENQRQRAYWQCL  253
            VK+ +YVVMKAEAEVVEEMVR ++I +VDELFLECK +         + N   RAYW+CL
Sbjct  374  VKEEEYVVMKAEAEVVEEMVRSKSIKVVDELFLECKPKGLGSGGRKSQSNNGGRAYWECL  433

Query  252  ELHGRLREEGVAVHQWW  202
             L+G+LR++G+AVHQWW
Sbjct  434  ALYGKLRDQGIAVHQWW  450



>ref|XP_009770120.1| PREDICTED: uncharacterized protein LOC104220858 [Nicotiana sylvestris]
Length=427

 Score =   142 bits (357),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 123/190 (65%), Gaps = 21/190 (11%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI------S  583
            P  K+AALK LED LLEPPR A  KS   +++ ++L +LM   L++YPRRVFI       
Sbjct  247  PSAKEAALKKLEDVLLEPPRAASGKSGKYLKRTRYLSELMDIPLESYPRRVFIDVGLQEK  306

Query  582  DDKNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEES---VGLSNWLRNTVKDAD  412
             +  G   WF  +YP  N +F+ + I        ET T E S   +G+S+WL+  VK  +
Sbjct  307  SEALGDSSWFSKHYPTRNTKFEIFKI--------ETVTKESSAPLIGMSDWLKKNVKKNE  358

Query  411  YvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLR  232
            YVVMKAEA VVEEMVR + I LVDELFLECK Q    + G++ + +RAYW+CL L+G LR
Sbjct  359  YVVMKAEAGVVEEMVRNKAIRLVDELFLECKHQ--GIKKGDKKKSRRAYWECLSLYGMLR  416

Query  231  EEGVAVHQWW  202
            +EGVAVHQWW
Sbjct  417  DEGVAVHQWW  426



>ref|XP_009102651.1| PREDICTED: uncharacterized protein LOC103828765 [Brassica rapa]
Length=419

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 125/188 (66%), Gaps = 13/188 (7%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDS--LQNYPRRVFISDDKNG  568
            E KK AL  LED LLEPPR A  KS   +++ ++LPDLMGD+  L +Y RRVFI D  NG
Sbjct  236  EAKKKALSKLEDVLLEPPRAASRKSRTYLKRTRYLPDLMGDTMDLGSYSRRVFI-DVGNG  294

Query  567  ----AEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvm  400
                  +WF  NYP  N +F+ Y I      ++E     E++G++ WL+  VK+ +YVVM
Sbjct  295  KGSSGTEWFVKNYPTRNLKFEMYKIKTV---NDEMSLESENMGMTEWLKENVKEEEYVVM  351

Query  399  kaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQ-RAYWQCLELHGRLREEG  223
            KAEAEVVEEM+R ++I +VDELFLECK +     G +   +  +AYW+CL L+G+LR+EG
Sbjct  352  KAEAEVVEEMMRSKSIKMVDELFLECKPKGLGLRGRKMQSKSGKAYWECLALYGKLRDEG  411

Query  222  VAVHQWWS  199
            VAVHQWW 
Sbjct  412  VAVHQWWG  419



>emb|CDY46867.1| BnaC01g27710D [Brassica napus]
Length=449

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 125/187 (67%), Gaps = 13/187 (7%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDS--LQNYPRRVFISDDKNG  568
            E KK AL  LED LLEPPR A  KS   +++ ++LPDLMGD+  L +Y RRVFI D  NG
Sbjct  266  EAKKNALSKLEDVLLEPPRAASRKSRTYLKRTRYLPDLMGDTMDLGSYSRRVFI-DVGNG  324

Query  567  ----AEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvm  400
                  +WF  NYP  N +F+ Y I      ++E     E++G++ WL+  VK+ +YVVM
Sbjct  325  KGSSGTEWFVKNYPTRNLKFEMYKIKTV---NDEMSLESENMGMTEWLKENVKEEEYVVM  381

Query  399  kaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQ-RAYWQCLELHGRLREEG  223
            KAEAEVVEEM+R ++I +VDELFLECK +     G +   +  +AYW+CL L+G+LR+EG
Sbjct  382  KAEAEVVEEMMRSKSIKMVDELFLECKPKGLGLRGRKMQSKTGKAYWECLALYGKLRDEG  441

Query  222  VAVHQWW  202
            VAVHQWW
Sbjct  442  VAVHQWW  448



>ref|XP_009381478.1| PREDICTED: uncharacterized protein LOC103969619 [Musa acuminata 
subsp. malaccensis]
Length=430

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 119/185 (64%), Gaps = 14/185 (8%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPP--RKALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNG-  568
            PE+    L  LEDALLEPP  RKA +  +M++ +FL +L+  SL  Y RRVF+     G 
Sbjct  255  PESIIGVLNGLEDALLEPPSDRKA-STRAMKRTRFLSNLLAGSLNEYSRRVFVDVGMPGR  313

Query  567  --AEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmka  394
               +KWF+ +YP  N EF+   +DV      E K    + G++ WL   +K+ +YVVMKA
Sbjct  314  ATIDKWFNKHYPKRNSEFEIIKLDV----VGEVKYASVASGIAGWLSKNLKEEEYVVMKA  369

Query  393  eaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAV  214
            EAEVVEEMVRE    LVDELFLECK+QW +        R+RAYW+CL L+G+LR+EG+AV
Sbjct  370  EAEVVEEMVREGATGLVDELFLECKTQWHKQG----KGRRRAYWECLALYGKLRDEGIAV  425

Query  213  HQWWS  199
            HQWW 
Sbjct  426  HQWWG  430



>ref|XP_010099469.1| hypothetical protein L484_011169 [Morus notabilis]
 gb|EXB78544.1| hypothetical protein L484_011169 [Morus notabilis]
Length=496

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 115/171 (67%), Gaps = 9/171 (5%)
 Frame = -2

Query  687  PPRKALAK---SSMRKMKFLPDLMGD-SLQNYPRRVFIS----DDKNGAEKWFHDNYPAN  532
            P R+ L+K   +  RK+KFLP L+GD SL+ + RRVF++    +      +WFH NYP  
Sbjct  327  PRRRQLSKDLENYSRKIKFLPQLLGDDSLEGFRRRVFVNVGLPEQSKDVTQWFHQNYPKM  386

Query  531  NQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTI  352
             QEF+ Y+++V V     ++       +S+WL   V++ DYVV+KAEA+ VEEM+ +RTI
Sbjct  387  KQEFEVYDLNV-VPKEGTSRLASTQNDISDWLTKNVREEDYVVIKAEADAVEEMINKRTI  445

Query  351  CLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  199
             LVDELF+EC +QW E     +N+ +RAYW+CL L+GR+++EGVAVHQWW 
Sbjct  446  HLVDELFMECNNQWWEVGKNSKNESKRAYWECLALYGRVKDEGVAVHQWWG  496



>gb|KHN08240.1| hypothetical protein glysoja_017718 [Glycine soja]
Length=144

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 100/148 (68%), Gaps = 9/148 (6%)
 Frame = -2

Query  627  MGDSLQNYPRRVFI-----SDDKNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGE  463
            MGDSL++YPRRVFI       +     +WF  NYP  +++F+ YNI+     +EE  TG+
Sbjct  1    MGDSLEHYPRRVFIDVGPPEKEGGSGTEWFSKNYPTRDKKFEMYNIETV---TEEWSTGK  57

Query  462  ESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeEN  283
            E + +S+W+R  VK+ +YVVMKAEAEVV+EM++   I LVDELFLECK           N
Sbjct  58   EQIEMSDWVRKNVKEEEYVVMKAEAEVVKEMMKSSAIGLVDELFLECKPN-RGSRISGIN  116

Query  282  QRQRAYWQCLELHGRLREEGVAVHQWWS  199
              +RAYW+CL L+G+LR++GVAVHQWW 
Sbjct  117  SNRRAYWECLALYGKLRDKGVAVHQWWG  144



>ref|XP_009387165.1| PREDICTED: uncharacterized protein LOC103974130 [Musa acuminata 
subsp. malaccensis]
Length=387

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 115/189 (61%), Gaps = 10/189 (5%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKALAKSSMRKMKFLPDLMGDSLQNYPRRVFI----SDDKN  571
            P  KK AL  LE ALLEPP     +   R+ ++LP+L  D L  YPRRVF+    + +  
Sbjct  199  PVAKKEALSGLEGALLEPPEPG-RRGWQRRARYLPELTRDELDGYPRRVFVEVAGAGEAG  257

Query  570  GAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEE--SVGLSNWLRNTVKDADYvvmk  397
                WF  NYP   + FD   ++V  +++++T   E+  S  L+ WL   VK+ +YVV+K
Sbjct  258  SGAAWFEQNYPRKGRAFDVIRVEVMEKENKDTDEAEKGASPSLAEWLERNVKEEEYVVVK  317

Query  396  aeaevveemvreRTICLVDELFLECKSQ-WeegeggeENQR--QRAYWQCLELHGRLREE  226
            AEA  VEE V E  I LVDELFLEC  Q WE+ +  +   R  +RAYW+CL L+G+LR+ 
Sbjct  318  AEASAVEEAVAEGAIGLVDELFLECDHQLWEDDDTKKGETRGGRRAYWECLALYGKLRDA  377

Query  225  GVAVHQWWS  199
            GVAVHQWWS
Sbjct  378  GVAVHQWWS  386



>gb|KHN26129.1| hypothetical protein glysoja_019453 [Glycine soja]
Length=137

 Score =   120 bits (300),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 97/148 (66%), Gaps = 16/148 (11%)
 Frame = -2

Query  627  MGDSLQNYPRRVFI-----SDDKNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGE  463
            MGDSL+ YPRRVFI       D      WFH  YP  N++F+ Y I+   E       G 
Sbjct  1    MGDSLEGYPRRVFIDVGLPEKDGGSGTDWFHKTYPTRNKDFEIYKIETVAE-------GG  53

Query  462  ESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeEN  283
              + +S+WLR  V++ +YVVMK+EAEVVEEM+R + I LVDELFLECK Q    +G  + 
Sbjct  54   PQIEMSDWLRKNVREEEYVVMKSEAEVVEEMMRSKAIMLVDELFLECKPQ----QGNVKK  109

Query  282  QRQRAYWQCLELHGRLREEGVAVHQWWS  199
            + +RAYW+CL L+G+LR+EGVAVHQWW 
Sbjct  110  KNRRAYWECLALYGKLRDEGVAVHQWWG  137



>gb|KHN25062.1| hypothetical protein glysoja_046599 [Glycine soja]
Length=137

 Score =   119 bits (299),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 97/148 (66%), Gaps = 16/148 (11%)
 Frame = -2

Query  627  MGDSLQNYPRRVFI-----SDDKNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGE  463
            MGDSL++YPRRVFI       D   A  WF   YP  N++F+ Y I+   E       G 
Sbjct  1    MGDSLESYPRRVFIDVGLPEKDGGSATDWFRKTYPTRNKDFEMYKIETVAE-------GG  53

Query  462  ESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeEN  283
              + +S+WLRN V++ +YVVMK+E EVVEEM+R + I LVDELFLECK Q    +G  + 
Sbjct  54   PQIEMSDWLRNNVREEEYVVMKSETEVVEEMMRSKAIMLVDELFLECKPQ----QGNRKR  109

Query  282  QRQRAYWQCLELHGRLREEGVAVHQWWS  199
            +  RAYW+CL L+G+LR+EGVAVHQWW 
Sbjct  110  KNGRAYWECLALYGKLRDEGVAVHQWWG  137



>ref|XP_009404440.1| PREDICTED: uncharacterized protein LOC103987768 [Musa acuminata 
subsp. malaccensis]
Length=368

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 114/189 (60%), Gaps = 13/189 (7%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKALAKSSMRKMKFLPDLMGDSLQNYPRRVFI----SDDKN  571
            P  KK +L+ LE A+LEPP   + +   R+ ++LP L GD L  YPRRVF+      D  
Sbjct  183  PAAKKKSLRGLESAMLEPP---MQREWARRARYLPQLTGDELDGYPRRVFVEVAAKGDAG  239

Query  570  GAEKWFHDNYPANNQEFDFYNIDVKVEDSE--ETKTGEESVGLSNWLRNTVKDADYvvmk  397
                WF  NYP   + F+   ++V+  D E  E K G  S  L+ WL+  V++ +YVV+K
Sbjct  240  SGTAWFERNYPRKGRAFEEIRVEVEEGDDEVSEAKEGTSS-SLAEWLQRNVREEEYVVVK  298

Query  396  aeaevveemvreRTICLVDELFLECKSQW---eegeggeENQRQRAYWQCLELHGRLREE  226
            AE   VEE++ E  I LVDELFLEC  Q    +E E G    R+RAYW+CL L+G+LR+ 
Sbjct  299  AEVGAVEEVMAEGAIGLVDELFLECDHQLWDEDEKEKGARRGRRRAYWECLVLYGKLRDA  358

Query  225  GVAVHQWWS  199
            GVAVHQWWS
Sbjct  359  GVAVHQWWS  367



>ref|XP_007223120.1| hypothetical protein PRUPE_ppa007125mg [Prunus persica]
 gb|EMJ24319.1| hypothetical protein PRUPE_ppa007125mg [Prunus persica]
Length=381

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 112/177 (63%), Gaps = 23/177 (13%)
 Frame = -2

Query  726  KAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFISDDKNGAEKWF  553
            KA     +D +LEPPR+ LAKS+  ++K+KFLP+L+GDSL  Y RRVF++ D N      
Sbjct  225  KAKKTVFKDVVLEPPRRVLAKSNEYLKKIKFLPNLLGDSLPGYDRRVFVNVDSN------  278

Query  552  HDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevvee  373
             DN                 E++  T        LS+WL+  V++ DYVVMKAEAE+V E
Sbjct  279  EDNSGP--------------EEASSTVVALPRNDLSDWLKENVREEDYVVMKAEAEMVVE  324

Query  372  mvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  202
            M++++TICLVDELFLEC + W +  G     + RAYW+C+ L+GR+R+ GVAVHQW+
Sbjct  325  MIKKKTICLVDELFLECNNGWWQKNGKTYGSK-RAYWECIALYGRVRDLGVAVHQWF  380



>ref|XP_010916833.1| PREDICTED: uncharacterized protein LOC105041590 [Elaeis guineensis]
Length=421

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 119/184 (65%), Gaps = 10/184 (5%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNG---  568
            PE KK  L  LE  LLEPPR +  + S+R  ++LP+L GDSL  Y RRVF+     G   
Sbjct  242  PEAKKEVLNGLEGVLLEPPRTSRRQPSLRP-RYLPELTGDSLAGYRRRVFVDVGPAGTRG  300

Query  567  --AEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmka  394
              A  WF  +YP  +++F+     ++V+ +        + G++ WL   V++ +YVVMKA
Sbjct  301  GSAAAWFERHYPKGDRDFEI----IRVDVAVGEAEAAAAAGMAEWLEENVREEEYVVMKA  356

Query  393  eaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAV  214
            EAEVVEE+V+ R I LVDELFLEC   WE+ +G +E + +RAY +CL L+G+LR++GVAV
Sbjct  357  EAEVVEEVVKGRAIRLVDELFLECDHLWEKKKGRKEMRSRRAYRECLALYGKLRDQGVAV  416

Query  213  HQWW  202
            HQW+
Sbjct  417  HQWF  420



>emb|CAN73947.1| hypothetical protein VITISV_032248 [Vitis vinifera]
Length=399

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 103/149 (69%), Gaps = 8/149 (5%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFIS----DDK  574
            + KKAALK LE ALLE PR AL +S   +++ KFLPDL+GDSL+ YP+R+FI+    +  
Sbjct  244  QAKKAALKGLESALLESPRHALKQSRQYLKRTKFLPDLLGDSLEGYPQRIFINVGFKEXS  303

Query  573  NGAEKWFHDNYPANNQEFDFYNIDVKVE-DSEETKTGEES-VGLSNWLRNTVKDADYvvm  400
            +    WFH NYP  NQ+F  YN+++  +  S   + G+ + VG+S WL   VK+ +YVVM
Sbjct  304  SATMDWFHQNYPKRNQDFVIYNLEIDXQPGSLMPQMGKATNVGISGWLMENVKEEEYVVM  363

Query  399  kaeaevveemvreRTICLVDELFLECKSQ  313
            KAEAEVVEEM++ R +CLVDELFL C  Q
Sbjct  364  KAEAEVVEEMIKGRXVCLVDELFLGCNHQ  392



>ref|XP_010269428.1| PREDICTED: uncharacterized protein LOC104606076 [Nelumbo nucifera]
Length=224

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 105/169 (62%), Gaps = 13/169 (8%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI----SDDK  574
            E KKAAL  LED LLEPP++A  +S+  +++ KFLPDL G SL+ YPRRVF+     + K
Sbjct  60   EAKKAALDGLEDVLLEPPQRAHVESNKYLKRTKFLPDLTGYSLEGYPRRVFVDVGLPERK  119

Query  573  NGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmka  394
             G+  WF  NYP  N++ + Y I+    D   T T    + + +WLR  VK+ +YVVMKA
Sbjct  120  GGSPGWFEKNYPTRNRDSEIYKIETVSTDELSTDTAVPQLEMPDWLRKNVKEEEYVVMKA  179

Query  393  eaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLEL  247
            E EVVEE+V+ + ICLVDE+FLECK +          +R++  W  L L
Sbjct  180  EVEVVEELVKNKXICLVDEMFLECKHR-------GLGRRKKKSWGYLGL  221



>ref|XP_006841211.1| hypothetical protein AMTR_s00135p00032540 [Amborella trichopoda]
 gb|ERN02886.1| hypothetical protein AMTR_s00135p00032540 [Amborella trichopoda]
Length=404

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 80/201 (40%), Positives = 106/201 (53%), Gaps = 30/201 (15%)
 Frame = -2

Query  732  TKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFISDDKN----  571
            +K A ++ LE+ LLEPPR++  K    + ++KFLP++  D L  YPRRV+I         
Sbjct  209  SKAATMQKLEEILLEPPRESWIKGGEYLNRVKFLPNVAADYLSAYPRRVYIEVATRSKGF  268

Query  570  ---GAEKWFHDNYPANNQEFDFYNID-VKVEDSEETKT-------------GEESVGLSN  442
               G   WF  +YP N QEFDFY ++ VK      T T                  GLS 
Sbjct  269  RDEGVGPWFRKHYPTNGQEFDFYRVEKVKGGSYAATVTWTRRRATREGTEEEAGEEGLSE  328

Query  441  WLRNTVKDADYvvmkaeae-vveemvreRTICLVDELFLECKSQWeegeggeENQRQRAY  265
            W+R +V++ +YVVM+     VV EMV    ICLVDELF +C           +    RAY
Sbjct  329  WVRRSVREEEYVVMEVGGFDVVREMVESGAICLVDELFFKCPHA------APQGAVGRAY  382

Query  264  WQCLELHGRLREEGVAVHQWW  202
            W+C+ L+G LRE GVA HQWW
Sbjct  383  WECISLYGLLRERGVAAHQWW  403



>ref|XP_006657971.1| PREDICTED: uncharacterized protein LOC102715955 [Oryza brachyantha]
Length=374

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 101/187 (54%), Gaps = 14/187 (7%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKALAKSSMRKMK-FLPDLMGDSLQNYPRRVFI------SD  580
            P +KK AL  LE  LLEPP+K   +   R    +LP+L GDSL  Y RR FI      + 
Sbjct  189  PASKKDALAGLEAVLLEPPQKHHRRIIRRLRLRYLPELTGDSLDGYRRRTFIDVTPSRTG  248

Query  579  DKNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvm  400
               GA  WF  +YP    EFD   ++V    S          G++ WL   V++ DYVV+
Sbjct  249  ASTGAASWFKKHYPRGKHEFDIVRLNVAATASAHEAAK----GIAEWLEGNVREEDYVVV  304

Query  399  kaeaevve-emvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEG  223
            KA AE VE  + +   +  VDELFL+C +        E +  +R YW+CL L+GRLR+ G
Sbjct  305  KAGAEAVEEILRKRAAVRRVDELFLDCDAA--SAGADESSSARRPYWECLALYGRLRDHG  362

Query  222  VAVHQWW  202
            VAVHQWW
Sbjct  363  VAVHQWW  369



>emb|CBI19248.3| unnamed protein product [Vitis vinifera]
Length=358

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 79/117 (68%), Gaps = 11/117 (9%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI-----SDD  577
            E KKAALK+LED LLEPPR A  KSS  +++ K+LPDL GDSL++YPRRVFI       D
Sbjct  219  EAKKAALKNLEDVLLEPPRAASRKSSSYLKRTKYLPDLTGDSLESYPRRVFIHVGPPETD  278

Query  576  KNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEES-VGLSNWLRNTVKDADY  409
            +    +WF  +YP  N++F+ Y I+     +EE+K  EE+ +G+S WLR  VK+ +Y
Sbjct  279  EGKNVRWFASHYPTRNRDFEMYKIETT---TEESKGKEEAELGMSEWLRKNVKEEEY  332



>ref|XP_009389561.1| PREDICTED: uncharacterized protein LOC103976099 [Musa acuminata 
subsp. malaccensis]
Length=383

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 115/191 (60%), Gaps = 14/191 (7%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKALAKSSMRKMKFLPDLMGDSLQNYPRRVFI----SDDKN  571
            P+ KK AL  LE ALLEPP +   +   R+ ++LP+L GD L  YPRRVF+    + +  
Sbjct  195  PKAKKEALSGLEGALLEPPGR---RGWRRRTRYLPELTGDELDGYPRRVFVEVVAAGEAG  251

Query  570  GAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGE-ESVGLSNWLRNTVKDADYvvmka  394
                WF  +YP   + F+   ++V+VE+ +E +  E  S  L+ WL   V++ +YVV+KA
Sbjct  252  SGAAWFEQHYPRKGRAFEVIRVEVEVEEEDEEEPEEGASQSLAEWLERNVREEEYVVVKA  311

Query  393  eaevveemvreRTICLVDELFLECKSQW------eegeggeENQRQRAYWQCLELHGRLR  232
            EA  VEE V E  I LVDELFL+C  Q       ++ E       +RAYW+CL L+G+LR
Sbjct  312  EAGAVEEAVAEGVIGLVDELFLQCDHQLWEEDERKKKEKETTRSGRRAYWECLALYGKLR  371

Query  231  EEGVAVHQWWS  199
            + GVAVHQWWS
Sbjct  372  DAGVAVHQWWS  382



>gb|KDO81145.1| hypothetical protein CISIN_1g016299mg [Citrus sinensis]
Length=392

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 107/191 (56%), Gaps = 39/191 (20%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSSMRKMKFLPDLMGDSLQNYPRRVFIS----DDKN-  571
            E K+AAL  LE   LEPPR A  +SS        +LMGDSL++YPRRVF+     D+ N 
Sbjct  229  EAKRAALNELEYVSLEPPRFASRRSS--------NLMGDSLESYPRRVFVDVGLPDNINR  280

Query  570  -------GAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDAD  412
                       WF  +YP  N +F  Y I++  E+    K               VK+ +
Sbjct  281  KAGHTSGTGMDWFLKHYPMRNLDFKMYKIEIVSEECVRKK-------------KNVKEEE  327

Query  411  YvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLR  232
             VVMKA+AE+VE +V+ +TI LVDEL LECK +      G+ N+  RAYW+CL L+ RLR
Sbjct  328  CVVMKAKAEIVEGVVKSKTIRLVDELSLECKPR------GKGNRSIRAYWECLSLYRRLR  381

Query  231  EEGVAVHQWWS  199
            +EGVA HQWW 
Sbjct  382  DEGVAAHQWWG  392



>gb|EEE67606.1| hypothetical protein OsJ_25158 [Oryza sativa Japonica Group]
Length=414

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 101/185 (55%), Gaps = 14/185 (8%)
 Frame = -2

Query  738  PETKKA-ALKHLEDALLEPPRKALAKSSMRKMK-FLPDLMGDSLQNYPRRVFI---SDDK  574
            P +KK  AL  LE  LLEPP++   +   R    +LP+L GDSL+ Y RR FI       
Sbjct  196  PGSKKDDALAGLEAVLLEPPQRQHRRIIRRLRPRYLPELTGDSLEGYRRRTFIDVAPSRG  255

Query  573  NGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmka  394
             GA  WF  +YP   + FD   +D    D+ E      + G++ WL   V++ DYVV+KA
Sbjct  256  GGAASWFKKHYPRGKRVFDMVRLDAA--DATEPAASSSAAGIAEWLEGNVREEDYVVVKA  313

Query  393  eaevve-emvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVA  217
              E VE  + R   +  VDELFL+C ++         +  +  YW+CL L+GRLR+ GVA
Sbjct  314  GVEAVEEILRRRAAVRRVDELFLDCDTR------ARAHAARSPYWECLALYGRLRDHGVA  367

Query  216  VHQWW  202
            VHQWW
Sbjct  368  VHQWW  372



>gb|KCW66620.1| hypothetical protein EUGRSUZ_F00410 [Eucalyptus grandis]
Length=327

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 75/125 (60%), Gaps = 15/125 (12%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFI------S  583
            PE KKAAL++LED LLEPPR A  +S    ++ ++LPDLMGDSL++YPRRVFI       
Sbjct  173  PEQKKAALQNLEDVLLEPPRAASRRSRAYFKRTRYLPDLMGDSLESYPRRVFIDVGLPEK  232

Query  582  DDKNGAEKWFHDNYPANNQEFDFYNID-VKVEDSEETKTGEES------VGLSNWLRNTV  424
            D    +  WF  NYP  N  F+ Y I+ V  E+   T + E +      VG+ +WL+  V
Sbjct  233  DGGTSSTAWFARNYPTRNLHFEMYKIETVAAEEPTATSSKEATAAVAAQVGMPDWLKKNV  292

Query  423  KDADY  409
            K+ +Y
Sbjct  293  KEEEY  297



>gb|EEC82462.1| hypothetical protein OsI_26902 [Oryza sativa Indica Group]
Length=395

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 101/185 (55%), Gaps = 14/185 (8%)
 Frame = -2

Query  738  PETKKA-ALKHLEDALLEPPRKALAKSSMRKMK-FLPDLMGDSLQNYPRRVFI---SDDK  574
            P +KK  AL  LE  LLEPP++   +   R    +LP+L GDSL+ Y RR FI       
Sbjct  196  PGSKKDDALAGLEAVLLEPPQRQHRRIIRRLRPRYLPELTGDSLEGYRRRTFIDVAPSRG  255

Query  573  NGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmka  394
             GA  WF  +YP   + FD   +D    D+ E      + G++ WL   V++ DYVV+KA
Sbjct  256  GGAASWFKKHYPRGKRVFDMVRLDAA--DATEPAASSSAAGIAEWLEGNVREEDYVVVKA  313

Query  393  eaevve-emvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVA  217
              E VE  + R   +  VDELFL+C +          +  +R YW+CL L+GRLR+ GVA
Sbjct  314  GVEAVEEILRRRAAVRRVDELFLDCDAG------AGADAARRPYWECLALYGRLRDHGVA  367

Query  216  VHQWW  202
            VHQWW
Sbjct  368  VHQWW  372



>ref|NP_001060302.1| Os07g0620600 [Oryza sativa Japonica Group]
 dbj|BAC10179.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22216.1| Os07g0620600 [Oryza sativa Japonica Group]
Length=414

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 101/185 (55%), Gaps = 14/185 (8%)
 Frame = -2

Query  738  PETKKA-ALKHLEDALLEPPRKALAKSSMRKMK-FLPDLMGDSLQNYPRRVFI---SDDK  574
            P +KK  AL  LE  LLEPP++   +   R    +LP+L GDSL+ Y RR FI       
Sbjct  196  PGSKKDDALAGLEAVLLEPPQRQHRRIIRRLRPRYLPELTGDSLEGYRRRTFIDVAPSRG  255

Query  573  NGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmka  394
             GA  WF  +YP   + FD   +D    D+ E      + G++ WL   V++ DYVV+KA
Sbjct  256  GGAASWFKKHYPRGKRVFDMVRLDAA--DATEPAASSSAAGIAEWLEGNVREEDYVVVKA  313

Query  393  eaevve-emvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVA  217
              E VE  + R   +  VDELFL+C +          +  +R YW+CL L+GRLR+ GVA
Sbjct  314  GVEAVEEILRRRAAVRRVDELFLDCDAG------AGADAARRPYWECLALYGRLRDHGVA  367

Query  216  VHQWW  202
            VHQWW
Sbjct  368  VHQWW  372



>ref|XP_006433845.1| hypothetical protein CICLE_v10003130mg [Citrus clementina]
 gb|ESR47085.1| hypothetical protein CICLE_v10003130mg [Citrus clementina]
Length=269

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 96/179 (54%), Gaps = 31/179 (17%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGAEKW  556
            E K+AAL  LED  LEPP  A  +S             DSL++YPRRVF+  D    +  
Sbjct  122  EAKRAALNELEDVSLEPPWFASRRSR------------DSLESYPRRVFV--DVGLPDNI  167

Query  555  FHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevve  376
               +YP  N +F  Y I++    SEE +  +    +       +K        A+AE+VE
Sbjct  168  NRKHYPMRNLDFQMYKIEIV---SEECEGKKVKKNVKEEECVVMK--------AKAEIVE  216

Query  375  emvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  199
             +V+ +TI LVDEL LECK +      G+ N+  RAYW+CL L+ RLR+EGVA HQWW 
Sbjct  217  GVVKSKTIRLVDELSLECKPR------GKGNRSIRAYWECLSLYRRLRDEGVAAHQWWG  269



>ref|XP_008775001.1| PREDICTED: uncharacterized protein LOC103695445 [Phoenix dactylifera]
Length=350

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 55/102 (54%), Gaps = 17/102 (17%)
 Frame = -2

Query  705  EDALLEPPRKALAKSSMRKMKFLPDLMGDSLQNYPRRVFI---SDDKNGAEKWFHDNYPA  535
            ED L EPP K  ++   ++ K LPDLMGDSL  +PRRVF+      + G+EKWF + +P 
Sbjct  246  EDVLPEPPSKNESEKLRKRAKHLPDLMGDSLAEHPRRVFVDAGPPGRTGSEKWFQEQHPK  305

Query  534  NNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDADY  409
             N  F+   +D              +VG++ W+   VK+ +Y
Sbjct  306  GNSAFEIIRLD--------------AVGIAKWVARNVKEEEY  333



>ref|XP_002526697.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35719.1| conserved hypothetical protein [Ricinus communis]
Length=488

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 102/227 (45%), Gaps = 48/227 (21%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGA  565
            PE K+  +++ E  + E P K     K +++ +K+LP +   S +N    V +     G+
Sbjct  262  PEHKRELVRNAEVLIKEEPLKPWLTLKRNIQNVKYLPSMADISFKNRYVYVDVGARSYGS  321

Query  564  E--KWFHDNYPANNQEFDFYNIDV--------KVEDSEETKTGEESVG------------  451
                WF   YP  N+ FD Y I+         K+   +E K     +G            
Sbjct  322  SIGSWFKKQYPKQNRTFDVYAIEADKAFHQEYKLXXGKEVKDRGRGMGRIQPVTSSSSSS  381

Query  450  -----------------LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDE  337
                              + WL+NTV + D+VVMK + E  E      +     ICL+DE
Sbjct  382  ESDGSFDGEVDTIRGFDFAEWLKNTVTEKDFVVMKMDVEGTEFDLIPRLFETGAICLIDE  441

Query  336  LFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
            +FLEC  ++W+    G+ + + ++ Y QCL+L   LRE GV VHQWW
Sbjct  442  IFLECHYNRWQRCCPGQRSSKYEKTYGQCLDLFTSLRESGVLVHQWW  488



>gb|KDO43414.1| hypothetical protein CISIN_1g038765mg [Citrus sinensis]
Length=110

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 71/130 (55%), Gaps = 25/130 (19%)
 Frame = -2

Query  594  VFISDDKNGAEKWFHDNYPANNQEFDFYNIDVKVEDSEETKTGEESVGLSNWLRNTVKDA  415
            V ++++K G   WFH +YP + Q+F+ Y+++  V+     K  E  V             
Sbjct  6    VSLAEEKGGIMDWFHHSYPLD-QDFEMYSLEFNVKKEYVVKKVESEVA------------  52

Query  414  DYvvmkaeaevveemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRL  235
                        EEM+ ++ +CLVDE+FLEC +QW++    + ++ QRAY +C+ L+ RL
Sbjct  53   ------------EEMIEKKAVCLVDEMFLECNNQWQDEGKKKNDKSQRAYLECMTLYERL  100

Query  234  REEGVAVHQW  205
             +EGV VHQW
Sbjct  101  GDEGVPVHQW  110



>gb|KJB29352.1| hypothetical protein B456_005G0962001, partial [Gossypium raimondii]
Length=68

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 41/53 (77%), Gaps = 3/53 (6%)
 Frame = -2

Query  357  TICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  199
             I LVDELFLECK +   G GG +N  +RAYW+CL L+G+LR+EGVAVHQWW 
Sbjct  19   AIRLVDELFLECKPK---GLGGRKNMSRRAYWECLALYGKLRDEGVAVHQWWG  68



>gb|AFK46323.1| unknown [Lotus japonicus]
Length=67

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = -2

Query  357  TICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  199
            TI LVDELFLECK++W + +G    + ++AYW+CL L+GRLR+EGVAVHQWW 
Sbjct  16   TIYLVDELFLECKNEWWQKKGKR-KKSRKAYWECLALYGRLRDEGVAVHQWWG  67



>ref|XP_010107693.1| hypothetical protein L484_007712 [Morus notabilis]
 gb|EXC16666.1| hypothetical protein L484_007712 [Morus notabilis]
Length=63

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 36/53 (68%), Gaps = 5/53 (9%)
 Frame = -2

Query  357  TICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  199
             I LVDELFLECK             R+RAYW+CL L+GRLR+EGVAVHQWW 
Sbjct  16   AIRLVDELFLECKPD-----HKGGTVRRRAYWECLALYGRLRDEGVAVHQWWG  63



>ref|XP_010038433.1| PREDICTED: uncharacterized protein LOC104426933 [Eucalyptus grandis]
 gb|KCW88235.1| hypothetical protein EUGRSUZ_A00626 [Eucalyptus grandis]
Length=521

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 62/243 (26%), Positives = 106/243 (44%), Gaps = 67/243 (28%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNG--  568
            ++++  ++  E  ++E P K     K +++ +K+LP ++  S +N  R V++     G  
Sbjct  281  DSRRKLIRDAEPLIVEEPLKPWITLKRNIKNIKYLPSMVDISFRN--RYVYVDVGARGYG  338

Query  567  --AEKWFHDNYPANNQEFDFYNIDV-----------------------------------  499
                 WF   YP  N+ F+ Y I+                                    
Sbjct  339  SSIVSWFRKQYPKQNKTFEVYAIEADEHFYEEYKSKKHVTLLPYAAWVKNETLSFEINRD  398

Query  498  -------------KVEDSEETKTGE----ESVGLSNWLRNTVKDADYvvmkaeaevve--  376
                         +++  + +  GE    +    + WL+NTV + D+VVMK + E  E  
Sbjct  399  PGQKSEDKGRGMGRIQPVQSSSDGEVAKIQGFDFAEWLKNTVSEKDFVVMKMDVEGTEFD  458

Query  375  ---emvreRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVH  211
                ++    ICL+DELFLEC  ++W+    GE + + ++ Y QCL+L   LR+ GV VH
Sbjct  459  LIPRLIETGAICLIDELFLECHYNRWQRCCPGERSSKYEKTYGQCLDLFTSLRQSGVLVH  518

Query  210  QWW  202
            QWW
Sbjct  519  QWW  521



>emb|CDP19944.1| unnamed protein product [Coffea canephora]
Length=524

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 65/245 (27%), Positives = 107/245 (44%), Gaps = 66/245 (27%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRK--ALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGA  565
            P+ K+  ++  E  + E P+K     K +++ +K+LP ++  S ++    V +     G+
Sbjct  280  PDYKQQLIRKAEPLIAEEPKKPWITLKKNIQNIKYLPSMVDISFKHRYVYVDVGARSYGS  339

Query  564  E--KWFHDNYPANNQEFDFYNID-------------------------------------  502
                WF   YP  N+ F+ Y I+                                     
Sbjct  340  SIVSWFKKQYPKQNKTFEIYAIEADRHFHEDYKYRKGVKLLPFAAWVKNETLFFEINEDP  399

Query  501  -----VKVEDSEETKTGEESVGLSN-------------WLRNTVKDADYvvmkaeaevve  376
                 VK       +  + S G+S+             WL++TV + D+VVMK + E  E
Sbjct  400  IDKDVVKGRGMGRIQPVQSSTGVSDGNVDEIQGFDFAAWLKDTVSERDFVVMKMDVEGTE  459

Query  375  e-----mvreRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVA  217
                  ++    ICL+DE+FLEC  ++W++   GE + + ++ Y QCLEL+  LRE GV 
Sbjct  460  FNLIPRLIETGAICLIDEVFLECHYNRWQKCCPGERSSKYEKTYGQCLELYTSLRESGVL  519

Query  216  VHQWW  202
            VHQWW
Sbjct  520  VHQWW  524



>ref|XP_004148602.1| PREDICTED: uncharacterized protein LOC101209474 [Cucumis sativus]
 gb|KGN54421.1| hypothetical protein Csa_4G314480 [Cucumis sativus]
Length=520

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 103/246 (42%), Gaps = 67/246 (27%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGA  565
            P  K A  ++ E  +LE P K     K +++ +K+LP +   S +N    V +     G+
Sbjct  275  PGYKLALFRNAEPLILEEPLKPWLTLKRNIQNVKYLPSMAEISFKNRYVYVDVGARSYGS  334

Query  564  E--KWFHDNYPANNQEFDFYNIDVKVEDSEETKT--------------------------  469
                WF   YP  N+ F+ Y I+      E+ K+                          
Sbjct  335  SIGSWFKKQYPKQNKTFEVYAIEADQTFHEQYKSKKGVTLLPYAAWVRNETLAFEINKDP  394

Query  468  --GEESVGLS----------------------------NWLRNTVKDADYvvmkaeaevv  379
              G+E  G S                            NWL+NTV + D+VV+K + E  
Sbjct  395  GQGKEDKGASRGMGRIQPVQSLGQFDGEVNQIQGFDFANWLKNTVSEKDFVVLKMDVEGT  454

Query  378  eemvr-----eRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGV  220
            E  +         ICL+DE+FLEC  ++W+    G+ + + ++ Y +C++L   LR+ GV
Sbjct  455  EFELIPRLFETGAICLIDEMFLECHYNRWQRCCPGQRSTKYEKTYSECIDLFASLRQSGV  514

Query  219  AVHQWW  202
             VHQWW
Sbjct  515  LVHQWW  520



>ref|XP_004172269.1| PREDICTED: uncharacterized LOC101209474 [Cucumis sativus]
Length=520

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 103/246 (42%), Gaps = 67/246 (27%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGA  565
            P  K A  ++ E  +LE P K     K +++ +K+LP +   S +N    V +     G+
Sbjct  275  PGYKLALFRNAEPLILEEPLKPWLTLKRNIQNVKYLPSMAEISFKNRYVYVDVGARSYGS  334

Query  564  E--KWFHDNYPANNQEFDFYNID-----------------------VKVE----------  490
                WF   YP  N+ F+ Y I+                       V+ E          
Sbjct  335  SIGSWFKKQYPKQNKTFEVYAIEADQTFHEQYKSKKGVTLLPYAAWVRNETLAFEINKDP  394

Query  489  -DSEETKTGEESVG----------------------LSNWLRNTVKDADYvvmkaeaevv  379
               +E K G   +G                       +NWL+NTV   D+VV+K + E  
Sbjct  395  GQGKEDKGGSRGMGRIQPVQSLGQFDGEVNQIQGFDFANWLKNTVSQKDFVVLKMDVEGT  454

Query  378  eemvr-----eRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGV  220
            E  +         ICL+DE+FLEC  ++W+    G+ + + ++ Y +C++L   LR+ GV
Sbjct  455  EFELIPRLFETGAICLIDEMFLECHYNRWQRCCPGQRSTKYEKTYSECIDLFASLRQSGV  514

Query  219  AVHQWW  202
             VHQWW
Sbjct  515  LVHQWW  520



>ref|XP_008464242.1| PREDICTED: uncharacterized protein LOC103502172 [Cucumis melo]
Length=520

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 104/246 (42%), Gaps = 67/246 (27%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGA  565
            P  K A  ++ E  +LE P K     K +++ +K+LP +   S +N    V +     G+
Sbjct  275  PGYKLALFRNAEPLILEEPLKPWLTLKRNIQNIKYLPSMAEISFKNRYVYVDVGARSYGS  334

Query  564  E--KWFHDNYPANNQEFDFYNID-----------------------VKVE----------  490
                WF   YP  N+ F+ Y I+                       V+ E          
Sbjct  335  SIGSWFKKQYPKQNKTFEVYAIEADQTFHEQYKSKKGVTLLPYAAWVRNETLAFEINKDP  394

Query  489  -DSEETKTGEESVG----------------------LSNWLRNTVKDADYvvmkaeaevv  379
               +E K G   +G                       ++WL+NTV + D+VV+K + E  
Sbjct  395  GQEKEDKGGSRGMGRIQPVQSSGQFDGEVNQIQGFDFADWLKNTVSEKDFVVLKMDVEGT  454

Query  378  eemvr-----eRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGV  220
            E  +         ICL+DE+FLEC  ++W+    G+ + + ++ Y QC++L   LR+ GV
Sbjct  455  EFELIPRLFETGAICLIDEMFLECHYNRWQRCCPGQRSTKYEKTYSQCIDLFASLRQSGV  514

Query  219  AVHQWW  202
             VHQWW
Sbjct  515  LVHQWW  520



>ref|XP_004156629.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101205174 
[Cucumis sativus]
Length=508

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 68/245 (28%), Positives = 102/245 (42%), Gaps = 66/245 (27%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRK--ALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGA  565
            P  K+  ++  E  +LE P K     K +++K+++LP +   S +     V +     G+
Sbjct  264  PGFKEELIRKAEPLILEEPLKPWITLKRNIQKIRYLPSMADVSFKQRYVYVDVGARSYGS  323

Query  564  E--KWFHDNYPANNQEFDFYNIDV------------------------------------  499
                WF   YP  N+ FD Y I+                                     
Sbjct  324  SIGSWFKKQYPKQNKTFDVYAIEADKIFHEQYSSKKGVELLPYAAWVRNETLTFEINRDP  383

Query  498  --KVED-------------SEETKTGE----ESVGLSNWLRNTVKDADYvvmkaeaevve  376
              KV+D             S     GE    +    ++WL+NTV + D+VVMK + E  E
Sbjct  384  GQKVQDKGRGMGRIRPVVSSTRAFDGEVDEIQGFDFADWLKNTVTEKDFVVMKMDVEGTE  443

Query  375  -----emvreRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVA  217
                  + +   ICL+DELFLEC  ++W+    GE + +  + Y QCL+L   LR  GV 
Sbjct  444  FDLIPRLFKTGAICLIDELFLECHYNRWQRCCPGERSAKYDKTYGQCLDLFASLRRSGVL  503

Query  216  VHQWW  202
            VHQWW
Sbjct  504  VHQWW  508



>ref|XP_004137689.1| PREDICTED: uncharacterized protein LOC101205174 [Cucumis sativus]
 gb|KGN58713.1| hypothetical protein Csa_3G730770 [Cucumis sativus]
Length=508

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 68/245 (28%), Positives = 102/245 (42%), Gaps = 66/245 (27%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRK--ALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGA  565
            P  K+  ++  E  +LE P K     K +++K+++LP +   S +     V +     G+
Sbjct  264  PGFKEELIRKAEPLILEEPLKPWITLKRNIQKIRYLPSMADVSFKQRYVYVDVGARSYGS  323

Query  564  E--KWFHDNYPANNQEFDFYNIDV------------------------------------  499
                WF   YP  N+ FD Y I+                                     
Sbjct  324  SIGSWFKKQYPKQNKTFDVYAIEADKIFHEQYSSKKGVELLPYAAWVRNETLTFEINRDP  383

Query  498  --KVED-------------SEETKTGE----ESVGLSNWLRNTVKDADYvvmkaeaevve  376
              KV+D             S     GE    +    ++WL+NTV + D+VVMK + E  E
Sbjct  384  GQKVQDKGRGMGRIRPVVSSTRAFDGEVDEIQGFDFADWLKNTVTEKDFVVMKMDVEGTE  443

Query  375  -----emvreRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVA  217
                  + +   ICL+DELFLEC  ++W+    GE + +  + Y QCL+L   LR  GV 
Sbjct  444  FDLIPRLFKTGAICLIDELFLECHYNRWQRCCPGERSAKYDKTYGQCLDLFASLRRSGVL  503

Query  216  VHQWW  202
            VHQWW
Sbjct  504  VHQWW  508



>ref|XP_004500447.1| PREDICTED: uncharacterized protein LOC101506752 [Cicer arietinum]
Length=492

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 65/244 (27%), Positives = 102/244 (42%), Gaps = 65/244 (27%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRK--ALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGA  565
            P  K+  +K  E  +LE P K     K +++ +K+L  L+G S +N    V I     G+
Sbjct  249  PGYKREIVKTAESLILEEPLKPWIALKRNLKNIKYLTSLVGISFKNKYVYVDIGARSYGS  308

Query  564  E--KWFHDNYPANNQEFDFYNIDVKVEDSEE-----------------------------  478
                WF   YP  N+ F+ Y I+      EE                             
Sbjct  309  SIGSWFKKQYPKQNKTFEVYAIEADKTFHEEYRTKKGVTLLPYAAWVRNETLFFEITRDP  368

Query  477  ----------------TKTGEESVG---------LSNWLRNTVKDADYvvmkaeaevve-  376
                             +T    +G          ++WL++ V   D+VV+K + E  E 
Sbjct  369  SKKITMKGRGMGRINPVQTSSSHMGDKDKIQGFDFADWLKSVVTSKDFVVVKMDVEGTEF  428

Query  375  ----emvreRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAV  214
                 +++   ICL+DELFLEC  ++W+    G+ + + Q+ Y +CL+L   LR+ GV V
Sbjct  429  HLIPRLIQTGAICLIDELFLECHYNRWQRCCPGQRSAKFQKTYSECLDLFTSLRDIGVLV  488

Query  213  HQWW  202
            HQWW
Sbjct  489  HQWW  492



>ref|XP_010921054.1| PREDICTED: uncharacterized protein LOC105044755 [Elaeis guineensis]
Length=523

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 71/251 (28%), Positives = 100/251 (40%), Gaps = 74/251 (29%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDK---  574
            PE K   LK  E  + E P K     K ++R +K+LP +   S +  PR V++       
Sbjct  275  PEHKLQILKSAEPLIKEEPLKPWIALKRNIRNIKYLPSMADISFK--PRYVYVDVGARSY  332

Query  573  -NGAEKWFHDNYPANNQEFDFYNI------------------------------------  505
             +    WF   YP  N  FD Y I                                    
Sbjct  333  GSSIGSWFRKQYPKQNHTFDIYAIEADRAFHDEYAAKKNVKLLPFAAWVRNETLTFEINR  392

Query  504  DVKVEDSEETKTGE----------ESVGLSN-------------WLRNTVKDADYvvmka  394
            D +  D+E+ K G            S G+S+             WL+++V + D+VVMK 
Sbjct  393  DPEQHDAEKEKGGRGMGRIRPVHGPSEGVSSGEVHTIHGFDFAEWLKSSVSEKDFVVMKM  452

Query  393  eaevve-----emvreRTICLVDELFLECK-SQWeegeggeENQRQR-AYWQCLELHGRL  235
            + E  E      +     ICL+DELFLEC  ++W+    G    + R  Y +CL L   L
Sbjct  453  DVEGTEFDLVPRLFETGAICLIDELFLECHYNRWQRCCPGVRTPKYRNTYGECLNLFTSL  512

Query  234  REEGVAVHQWW  202
            R+ GV VHQWW
Sbjct  513  RKSGVLVHQWW  523



>ref|XP_010277645.1| PREDICTED: uncharacterized protein LOC104612037 [Nelumbo nucifera]
Length=516

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 96/244 (39%), Gaps = 65/244 (27%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGA  565
            P  K   ++  E  + E P K     K +++ +K+LP +   S +     V +     G+
Sbjct  273  PGYKHELIRKAEPLITEEPLKPWLTLKRNIKNVKYLPSMADISFKQRYVYVDVGARSYGS  332

Query  564  E--KWFHDNYPANNQEFDFYNIDVKVEDSEETKT--------------------------  469
                WF   YP  N+ F+ Y I+       E KT                          
Sbjct  333  SIGSWFKKQYPKQNKTFEIYAIEADKSFHHEYKTRKGVTLLPYAAWVKNESLFFEINRDP  392

Query  468  ------GEESVG----------------------LSNWLRNTVKDADYvvmkaeaevvee  373
                  G   +G                       ++WL+N V + D+VVMK + E  E 
Sbjct  393  GHKGEPGGRGMGRIQPVQSSTNFVGDIDKIRGFDFAHWLKNAVSENDFVVMKMDVEGTEF  452

Query  372  mvr-----eRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAV  214
             +         ICL+DE+FLEC  ++W+    GE   + Q+ Y QCLEL   LRE GV V
Sbjct  453  HLIPRLFETGAICLIDEIFLECHYNRWQRCCPGERTSKYQKTYSQCLELFTSLRESGVLV  512

Query  213  HQWW  202
            HQWW
Sbjct  513  HQWW  516



>gb|KFK24641.1| hypothetical protein AALP_AA8G005900 [Arabis alpina]
Length=506

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 104/248 (42%), Gaps = 69/248 (28%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRK--ALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGA  565
            P  K+  ++  E  L E P K     K +++ +K+LP ++    ++    V +     G+
Sbjct  259  PGYKRDLIRDAEPILKEEPLKPWITLKRNIKNIKYLPSMVDIRFKSRYVYVDVGARSYGS  318

Query  564  E--KWFHDNYPANNQEFDFYNIDVKVEDSEETK---------------------------  472
                WF   YP  N+ FD + I+      EE K                           
Sbjct  319  SIGSWFKKEYPKQNKTFDVFAIEADKAFHEEYKIKKKVQLLPYAAWVKNETLSFEINHDP  378

Query  471  ----------------------TGEESVG---------LSNWLRNTVKDADYvvmkaeae  385
                                  +G+++ G          ++WL+  V+D D+VVMK + E
Sbjct  379  GKEVEAKAKGRGMGRIQPVTKNSGDDTGGEVNLIQGFDFADWLKKNVRDRDFVVMKMDVE  438

Query  384  vve-----emvreRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREE  226
              E      +++   ICL+DELFLEC  ++W+    G+ +Q+  + Y QCLEL   LR+ 
Sbjct  439  GTEFDLIPRLIKTGAICLIDELFLECHYNRWQRCCPGQRSQKYNKTYNQCLELFTSLRQT  498

Query  225  GVAVHQWW  202
            GV VHQWW
Sbjct  499  GVLVHQWW  506



>ref|XP_010264515.1| PREDICTED: uncharacterized protein LOC104602499 [Nelumbo nucifera]
Length=516

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 65/244 (27%), Positives = 98/244 (40%), Gaps = 65/244 (27%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGA  565
            P  K+  ++  E  + E P K     K +++ +K+LP ++  S +     V +     G+
Sbjct  273  PGYKQELIRKAEPLITEEPLKPWLTLKRNIKNVKYLPSMVDISFKQRYVYVDVGARSYGS  332

Query  564  E--KWFHDNYPANNQEFDFYNIDVKVEDSEETKT--------------------------  469
                WF   YP  N+ F  Y I+      +E +T                          
Sbjct  333  SIASWFRKQYPKQNKTFAIYAIEADKTFHQEYQTKKGVTLLPYAAWVRNESLFFEINRDP  392

Query  468  ------GEESVG----------------------LSNWLRNTVKDADYvvmkaeaevve-  376
                  G   +G                       ++WL+NTV + D+VVMK + E  E 
Sbjct  393  GHKNVAGGRGMGRIRPVQSSTNFVGDIDKIRGFDFAHWLKNTVSERDFVVMKMDVEGTEF  452

Query  375  ----emvreRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAV  214
                 +     ICL+DE+FLEC  ++W++   GE   + Q  Y QCLEL   LR  GV V
Sbjct  453  DLIPRLFETGAICLIDEIFLECHYNRWQKCCPGERTSKYQNTYSQCLELFTSLRASGVLV  512

Query  213  HQWW  202
            HQWW
Sbjct  513  HQWW  516



>ref|XP_008442352.1| PREDICTED: uncharacterized protein LOC103486248 [Cucumis melo]
Length=508

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 65/245 (27%), Positives = 102/245 (42%), Gaps = 66/245 (27%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRK--ALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGA  565
            P  K+  ++  E  +LE P +     K +++K+++LP +   S +     V +     G+
Sbjct  264  PGFKEELIRKAEPLILEEPLEPWITLKRNIQKIRYLPSMADISFKQRYVYVDVGARSYGS  323

Query  564  E--KWFHDNYPANNQEFDFYNIDV------------------------------------  499
                WF   YP  N+ FD Y I+                                     
Sbjct  324  SIGSWFKKQYPKQNKTFDVYAIEADKIFHEQYSSKKGVKLLPYAAWIRNETLTFEINRDP  383

Query  498  --KVEDSEE---------TKTGE--------ESVGLSNWLRNTVKDADYvvmkaeaevve  376
              KV+D            + TG         +    ++WL+NTV + D+VVMK + E  E
Sbjct  384  GQKVQDKGRGMGRIRPAVSSTGAFDGEVDEIQGFDFADWLKNTVTEKDFVVMKMDVEGTE  443

Query  375  -----emvreRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVA  217
                  + +   ICL+DE+FLEC  ++W+    GE + +  + Y QCL+L   LR  GV 
Sbjct  444  FDLIPRLFKTGAICLIDEIFLECHYNRWQRCCPGERSAKYDKTYGQCLDLFTSLRRSGVL  503

Query  216  VHQWW  202
            VHQWW
Sbjct  504  VHQWW  508



>dbj|BAC75560.1| hypothetical protein [Oryza sativa Japonica Group]
Length=480

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 69/238 (29%), Positives = 96/238 (40%), Gaps = 66/238 (28%)
 Frame = -2

Query  717  LKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGAE--KWFH  550
            L H E  + E PRK     K +++ +K+LP L   S +     V +     G+    WF 
Sbjct  243  LTHAEPLIQEEPRKPWITLKRNIKNIKYLPTLADISFKRNYVYVDVGARSYGSSIGSWFR  302

Query  549  DNYPANNQEFDFYNID-----------------------VKVED-----------SEETK  472
             +YP  N  F  + I+                       VK E             +E K
Sbjct  303  KHYPKQNHTFQVFAIEADPAFHSEYAAKKAVTLLPYAAWVKNETLNFEINADPGKEDEAK  362

Query  471  TGEESVG---------------------LSNWLRNTVKDADYvvmkaeaevveemvr---  364
                 +G                      + WL+ TV + DYVVMK + E  E  +    
Sbjct  363  ANGRGMGRIRPMAGKKMSGEVRSVPAFDFAEWLKRTVSEQDYVVMKMDVEGTEFDLIPRL  422

Query  363  --eRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
                 ICL+DELFLEC  ++W++   GE + + Q  Y +CLEL   LRE GV VHQWW
Sbjct  423  FDTGAICLIDELFLECHYNRWQKCCPGERSPKYQNTYDECLELFSSLRESGVLVHQWW  480



>gb|KJB77076.1| hypothetical protein B456_012G119400 [Gossypium raimondii]
Length=553

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 66/246 (27%), Positives = 103/246 (42%), Gaps = 67/246 (27%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRK--ALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGA  565
            P  K+  ++  E  + E P K     K ++  +K+LP ++  S +N    V +     G+
Sbjct  308  PGHKRELVQKAEPLIEEEPLKPWITLKRNINNVKYLPSMVDISFKNRYVYVDVGARSYGS  367

Query  564  E--KWFHDNYPANNQEFDFY-------------------------------------NID  502
                WF   YP  N+ F  Y                                     N D
Sbjct  368  SIGSWFRKQYPKQNKTFHVYAIEADKTFHQQYESKKKTVTLLPYAAWVKNETLRFEINRD  427

Query  501  VKVEDSEETK---------------TGE----ESVGLSNWLRNTVKDADYvvmkaeaevv  379
               E+ +E K                GE    + +  + WL+NTV ++D+VVMK + E  
Sbjct  428  PGQEEVDELKDKGRGMGRIQPVKSSGGEVDKIQGIDFAEWLKNTVTESDFVVMKMDVEGT  487

Query  378  ee-----mvreRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGV  220
            E      + +   ICL+DE+FLEC  ++W+    G+ + + ++ Y QCL+L   LRE GV
Sbjct  488  EFDLIPRLFKTGAICLIDEIFLECHYNRWQRCCPGQRSAKYEKTYGQCLQLFTSLRESGV  547

Query  219  AVHQWW  202
             VHQWW
Sbjct  548  LVHQWW  553



>ref|NP_001175347.1| Os07g0692401 [Oryza sativa Japonica Group]
 gb|EEE67866.1| hypothetical protein OsJ_25678 [Oryza sativa Japonica Group]
 dbj|BAH94075.1| Os07g0692401 [Oryza sativa Japonica Group]
Length=484

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 69/238 (29%), Positives = 96/238 (40%), Gaps = 66/238 (28%)
 Frame = -2

Query  717  LKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGAE--KWFH  550
            L H E  + E PRK     K +++ +K+LP L   S +     V +     G+    WF 
Sbjct  247  LTHAEPLIQEEPRKPWITLKRNIKNIKYLPTLADISFKRNYVYVDVGARSYGSSIGSWFR  306

Query  549  DNYPANNQEFDFYNID-----------------------VKVED-----------SEETK  472
             +YP  N  F  + I+                       VK E             +E K
Sbjct  307  KHYPKQNHTFQVFAIEADPAFHSEYAAKKAVTLLPYAAWVKNETLNFEINADPGKEDEAK  366

Query  471  TGEESVG---------------------LSNWLRNTVKDADYvvmkaeaevveemvr---  364
                 +G                      + WL+ TV + DYVVMK + E  E  +    
Sbjct  367  ANGRGMGRIRPMAGKKMSGEVRSVPAFDFAEWLKRTVSEQDYVVMKMDVEGTEFDLIPRL  426

Query  363  --eRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
                 ICL+DELFLEC  ++W++   GE + + Q  Y +CLEL   LRE GV VHQWW
Sbjct  427  FDTGAICLIDELFLECHYNRWQKCCPGERSPKYQNTYDECLELFSSLRESGVLVHQWW  484



>ref|XP_008384718.1| PREDICTED: uncharacterized protein LOC103447298 [Malus domestica]
Length=491

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 60/94 (64%), Gaps = 7/94 (7%)
 Frame = -2

Query  462  ESVGLSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeeg  301
            E    + WL++ V + D+VV+K + E  E     +++    ICL+DE+FLEC  ++W++ 
Sbjct  398  EGFDFAEWLKSVVSERDFVVVKMDVEGAEFHLIPKLIESGAICLIDEIFLECHYNRWQKC  457

Query  300  eggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
              G+ + + ++ YWQCLEL  +LRE GV VHQWW
Sbjct  458  CPGQRSPKFKKTYWQCLELFTKLRESGVLVHQWW  491



>ref|XP_010423986.1| PREDICTED: uncharacterized protein LOC104709020 [Camelina sativa]
Length=515

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 58/90 (64%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             ++WL+N V+D D+VVMK + E  E      +++   ICL+DELFLEC  ++W+    G+
Sbjct  426  FADWLKNNVRDRDFVVMKMDVEGTEFDLIPRLIKTGAICLIDELFLECHYNRWQRCCPGQ  485

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             +Q+  + Y QCLEL   LR+ GV VHQWW
Sbjct  486  RSQKYNKTYNQCLELFTSLRQRGVLVHQWW  515



>ref|XP_010451944.1| PREDICTED: uncharacterized protein LOC104734132 [Camelina sativa]
Length=515

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 58/90 (64%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             ++WL+N V+D D+VVMK + E  E      +++   ICL+DELFLEC  ++W+    G+
Sbjct  426  FADWLKNNVRDRDFVVMKMDVEGTEFDLIPRLIKTGAICLIDELFLECHYNRWQRCCPGQ  485

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             +Q+  + Y QCLEL   LR+ GV VHQWW
Sbjct  486  RSQKYNKTYNQCLELFTSLRQRGVLVHQWW  515



>ref|XP_009774872.1| PREDICTED: uncharacterized protein LOC104224855 [Nicotiana sylvestris]
Length=515

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 101/246 (41%), Gaps = 69/246 (28%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRK--ALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDK---  574
            P+ K   +K  E  + E P+K     K + +K+K+L  +   S +  PR V++       
Sbjct  272  PDYKLKLIKKAEPLIKEEPKKPWITLKKNAQKIKYLSSMADISFK--PRYVYVDVGARSY  329

Query  573  -NGAEKWFHDNYPANNQEFDFYNIDV----------------------------------  499
             +    WF   YP  N+ F+ Y I+                                   
Sbjct  330  GSSIVSWFKKQYPKQNKTFEIYAIEADKTFHGQYEGKKGVTLLPYAAWVRNETLSFEINQ  389

Query  498  --------------KVEDSEETKTGEESVGL------SNWLRNTVKDADYvvmkaeaevv  379
                          +++  E +      V L      + WL+++V + DYVVMK + E  
Sbjct  390  DPGHKDVAKGRGMGRIQPVESSSNSASEVDLIQGFDFAEWLKSSVSERDYVVMKMDVEGT  449

Query  378  e-----emvreRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGV  220
            E      +     ICL+DE+FLEC  ++W++   GE + + +  Y QCL+L   LRE GV
Sbjct  450  EFDLIPRLFETGAICLIDEVFLECHYNRWQKCCPGERSSKYEHTYGQCLDLFASLRESGV  509

Query  219  AVHQWW  202
             VHQWW
Sbjct  510  LVHQWW  515



>ref|XP_010093564.1| hypothetical protein L484_014002 [Morus notabilis]
 gb|EXB54271.1| hypothetical protein L484_014002 [Morus notabilis]
Length=258

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 56/90 (62%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             +NWL+NTV + D+VVMK + E  E      +     ICL+DE+FLEC   +W+    G+
Sbjct  169  FANWLKNTVLEKDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYKRWQRCCPGQ  228

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             +++ ++ Y QCLEL   LR+ GV VHQWW
Sbjct  229  RSEKYEKTYGQCLELFTSLRQSGVLVHQWW  258



>ref|XP_006289569.1| hypothetical protein CARUB_v10003115mg [Capsella rubella]
 gb|EOA22467.1| hypothetical protein CARUB_v10003115mg [Capsella rubella]
Length=515

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 66/111 (59%), Gaps = 11/111 (10%)
 Frame = -2

Query  501  VKVEDSEETKTGE----ESVGLSNWLRNTVKDADYvvmkaeaevve-----emvreRTIC  349
            VK   S +   GE    +    ++WL+N+V++ D+VVMK + E  E      +++   IC
Sbjct  405  VKRSTSSDDLAGEVNLIQGFDFADWLKNSVRERDFVVMKMDVEGTEFDLIPRLIKTGAIC  464

Query  348  LVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
            L+DELFLEC  ++W+    G+ +Q+  + Y QCLEL   LR+ GV VHQWW
Sbjct  465  LIDELFLECHYNRWQRCCPGQRSQKYNKTYNQCLELFTSLRQRGVLVHQWW  515



>ref|XP_002272461.1| PREDICTED: uncharacterized protein LOC100265673 [Vitis vinifera]
Length=503

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 59/94 (63%), Gaps = 7/94 (7%)
 Frame = -2

Query  462  ESVGLSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeeg  301
            + +  +NWL++TV + D+VVMK + E  E      ++    ICL+DE+FLEC  ++W+  
Sbjct  410  QGIDFANWLKSTVSERDFVVMKMDVEGTEFHLIPRLIETGAICLIDEIFLECHYNRWQRC  469

Query  300  eggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
              G+ + + Q+ Y QCL+L   LR+ GV VHQWW
Sbjct  470  CPGQRSSKFQKTYAQCLDLFSSLRKSGVLVHQWW  503



>ref|XP_008804157.1| PREDICTED: uncharacterized protein LOC103717510 [Phoenix dactylifera]
 ref|XP_008804158.1| PREDICTED: uncharacterized protein LOC103717510 [Phoenix dactylifera]
Length=523

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 71/249 (29%), Positives = 97/249 (39%), Gaps = 70/249 (28%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGA  565
            PE K   LK  E  + E P K     K +++ +K+LP +   S +     V +     G+
Sbjct  275  PEHKLQILKSAEPLIKEEPLKPWIALKRNIKNIKYLPSMADISFKRRYVYVDVGSRSYGS  334

Query  564  E--KWFHDNYPANNQEFDFYNI------------------------------------DV  499
                WF   YP  N  FD Y I                                    D 
Sbjct  335  SIGSWFRKQYPKQNHTFDIYAIEADRAFHDEYAAKKNVKLLPFAAWVRNETLTFEINHDP  394

Query  498  KVEDSEETKTGE----------ESVGLSN-------------WLRNTVKDADYvvmkaea  388
            +  D+E+ K G            S G+S+             WL+ TV D D+VVMK + 
Sbjct  395  EQHDAEKEKGGRGMGRIRPVRGPSEGVSSGELHTIHGFDFAEWLKRTVSDKDFVVMKMDV  454

Query  387  evve-----emvreRTICLVDELFLECK-SQWeegeggeENQRQR-AYWQCLELHGRLRE  229
            E  E      +     I L+DELFLEC  ++W+    GE   + R  Y +CL L   LR+
Sbjct  455  EGTEFDLVPRLFETGVISLIDELFLECHYNRWQRCCPGERTPKYRNTYGECLRLFTSLRK  514

Query  228  EGVAVHQWW  202
             GV VHQWW
Sbjct  515  SGVLVHQWW  523



>gb|EYU41971.1| hypothetical protein MIMGU_mgv1a027046mg [Erythranthe guttata]
Length=521

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 58/90 (64%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevvee-----mvreRTICLVDELFLECK-SQWeegegge  289
             ++WL+NTV + DYVVMK + E  E      +     ICL+DELFLEC  ++W++   GE
Sbjct  432  FADWLKNTVTERDYVVMKMDVEGTEFDLIPRLFETGAICLIDELFLECHYNRWQKCCPGE  491

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             +++ ++ Y QCL+L   LR+ GV VHQWW
Sbjct  492  RSKKYEKTYGQCLDLFTSLRKSGVLVHQWW  521



>ref|XP_006481123.1| PREDICTED: uncharacterized protein LOC102608338 [Citrus sinensis]
Length=518

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 56/90 (62%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             ++WL+NTV D D+VVMK + E  E      +     ICL+DE+FLEC  ++W+    G+
Sbjct  429  FADWLKNTVTDKDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQRCCPGQ  488

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + ++ Y QCLEL   LR+ GV VHQWW
Sbjct  489  RSPKYEKTYEQCLELFTSLRQNGVLVHQWW  518



>ref|XP_006429503.1| hypothetical protein CICLE_v10011494mg [Citrus clementina]
 gb|ESR42743.1| hypothetical protein CICLE_v10011494mg [Citrus clementina]
Length=518

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             ++WL+NTV D D+VVMK + E  E      +     ICL+DE+FLEC  ++W+     +
Sbjct  429  FADWLKNTVTDKDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQRCCPEQ  488

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + ++ Y QCLEL   LR+ GV VHQWW
Sbjct  489  RSPKYEKTYEQCLELFTSLRQNGVLVHQWW  518



>gb|KDO63279.1| hypothetical protein CISIN_1g010086mg [Citrus sinensis]
Length=518

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 56/90 (62%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             ++WL+NTV D D+VVMK + E  E      +     ICL+DE+FLEC  ++W+    G+
Sbjct  429  FADWLKNTVTDKDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQRCCPGQ  488

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + ++ Y QCLEL   LR+ GV VHQWW
Sbjct  489  RSPKYKKTYEQCLELFTSLRQNGVLVHQWW  518



>ref|XP_011015027.1| PREDICTED: uncharacterized protein LOC105118715 [Populus euphratica]
Length=514

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 63/247 (26%), Positives = 100/247 (40%), Gaps = 68/247 (28%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRK--ALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGA  565
            P  K+  +++ E  ++E P K     K ++  +K+L  +   S ++    V +     G+
Sbjct  268  PGYKRDLVRNAEALIMEEPLKPWITLKKNIMNIKYLTAIADISFKSRYVYVDVGARSYGS  327

Query  564  E--KWFHDNYPANNQEFDFYNID-------------------------------------  502
                WF   YP  N+ FD Y I+                                     
Sbjct  328  SIGSWFKKQYPKQNRTFDVYAIEADKAFYEEYRVKKGVTLLPYAAWVRNETLTFEINHDP  387

Query  501  ----------------VKVEDSEETKTGE----ESVGLSNWLRNTVKDADYvvmkaeaev  382
                            VK   S  +  GE    E    + WL++TV + D+VVMK + E 
Sbjct  388  GKEVKEKARGMGRIQPVKSSLSSRSFNGEVNEIEGFDFAEWLKSTVTEKDFVVMKMDVEG  447

Query  381  ve-----emvreRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEG  223
             E      +     ICL+DE+FLEC  ++W+    G+ + + ++ Y QCL+L   LR+ G
Sbjct  448  TEFDLIPRLFETGAICLIDEIFLECHYNRWQRCCPGQRSSKYEKTYGQCLDLFSSLRDRG  507

Query  222  VAVHQWW  202
            V VHQWW
Sbjct  508  VLVHQWW  514



>ref|XP_010490518.1| PREDICTED: uncharacterized protein LOC104768289 [Camelina sativa]
Length=514

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 58/90 (64%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             ++WL+N V++ D+VVMK + E  E      +++   ICL+DELFLEC  ++W+    G+
Sbjct  425  FADWLKNNVRERDFVVMKMDVEGTEFDLIPRLIKTGAICLIDELFLECHYNRWQRCCPGQ  484

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             +Q+  + Y QCLEL   LR+ GV VHQWW
Sbjct  485  RSQKYNKTYNQCLELFTSLRQRGVLVHQWW  514



>ref|XP_011095084.1| PREDICTED: uncharacterized protein LOC105174622 [Sesamum indicum]
Length=521

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevvee-----mvreRTICLVDELFLECK-SQWeegegge  289
             ++WL NTV + DYVVMK + E  E      +     ICL+DELFLEC  ++W++   GE
Sbjct  432  FADWLMNTVSERDYVVMKMDVEGTEFDLIPRLFETGAICLIDELFLECHYNRWQKCCPGE  491

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
               + Q+ Y QCL L   LR+ GV VHQWW
Sbjct  492  RTAKYQKTYGQCLNLFTSLRKSGVLVHQWW  521



>ref|XP_002264939.1| PREDICTED: uncharacterized protein LOC100263765 [Vitis vinifera]
Length=513

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 56/94 (60%), Gaps = 7/94 (7%)
 Frame = -2

Query  462  ESVGLSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeeg  301
            E    +NWL+N+V + D+VVMK + E  E      +     ICL+DE+FLEC  ++W+  
Sbjct  420  EGFDFANWLKNSVSERDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQRC  479

Query  300  eggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
              GE + + Q+ Y QCL+L   LR  GV VHQWW
Sbjct  480  CPGERSSKYQKTYDQCLDLFSNLRNSGVLVHQWW  513



>ref|XP_010543177.1| PREDICTED: uncharacterized protein LOC104816178 [Tarenaya hassleriana]
Length=519

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevveemvr-----eRTICLVDELFLECK-SQWeegegge  289
             + WL+NTV++ D+VVMK + E  E  +         ICL+DELFLEC  ++W+    G+
Sbjct  430  FAEWLKNTVRERDFVVMKMDVEGTEFELIPRLFETGAICLIDELFLECHYNRWQRCCPGQ  489

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + +  + Y QCLEL   LR+ GV VHQWW
Sbjct  490  RSSKYDKTYDQCLELFASLRQSGVLVHQWW  519



>emb|CAN65583.1| hypothetical protein VITISV_019793 [Vitis vinifera]
Length=277

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 56/94 (60%), Gaps = 7/94 (7%)
 Frame = -2

Query  462  ESVGLSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeeg  301
            E    +NWL+N+V + D+VVMK + E  E      +     ICL+DE+FLEC  ++W+  
Sbjct  184  EGFDFANWLKNSVSERDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQRC  243

Query  300  eggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
              GE + + Q+ Y QCL+L   LR  GV VHQWW
Sbjct  244  CPGERSSKYQKTYDQCLDLFSNLRNSGVLVHQWW  277



>ref|XP_008231499.1| PREDICTED: uncharacterized protein LOC103330643 [Prunus mume]
Length=491

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 103/244 (42%), Gaps = 65/244 (27%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRK--ALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGA  565
            P  K+  ++  E  + + P K     K +++K+K+L  ++  S +     V +     G+
Sbjct  248  PGYKREIVRKAEALIEQEPLKPWIALKRNLKKVKYLTSMVDISYKQRYVYVDVGARSYGS  307

Query  564  E--KWFHDNYPANNQEFDFYNIDVKVEDSEE-----------------------------  478
                WF   YP  N  F+ Y I+      EE                             
Sbjct  308  SIGSWFKKQYPKQNISFEVYAIEADKAFHEEYRTKKGVSLLPYAAWVRNETLFFEITRDP  367

Query  477  -TKTGEESVGL------------------------SNWLRNTVKDADYvvmkaeaevve-  376
              KT E+  G+                        ++WL+NTV + D+VV+K + E  E 
Sbjct  368  SKKTVEKGRGMGRVQPVRPSSNYGDNVDKIEGFDFADWLKNTVSERDFVVVKMDVEGTEF  427

Query  375  ----emvreRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAV  214
                 ++    ICL+DE+FLEC  ++W+    G+ + + ++ Y QCL+L  +LR+ GV V
Sbjct  428  HLIPRLIETGAICLIDEIFLECHYNRWQRCCPGQRSPKFKKTYGQCLDLFNKLRDAGVLV  487

Query  213  HQWW  202
            HQWW
Sbjct  488  HQWW  491



>gb|AFW71483.1| hypothetical protein ZEAMMB73_430632 [Zea mays]
Length=381

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 96/242 (40%), Gaps = 66/242 (27%)
 Frame = -2

Query  729  KKAALKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGAE--  562
            ++  L H E  + E P K     K +++ +K+LP L   S +     V +     G+   
Sbjct  140  RRQLLAHAEPLIQEEPLKPWITLKRNIKNIKYLPALADISFKRRYLYVDVGARSYGSSIG  199

Query  561  KWFHDNYPANNQEFDFYNID-----------------------VKVED-----------S  484
             WF   YP  N  F  + I+                       VK E             
Sbjct  200  SWFRKQYPKQNHTFQVFAIEADPAFHSEYAAKKGVTLLPYAAWVKNETLRFEINGDPGKE  259

Query  483  EETKTGEESVG---------------------LSNWLRNTVKDADYvvmkaeaevveemv  367
            +E K     +G                      + WLR TV + DYVVMK + E  E  +
Sbjct  260  DEAKANGRGMGRIRPATGKKMNGEVRSVPAFDFAEWLRQTVTEQDYVVMKMDVEGTEFDL  319

Query  366  r-----eRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQ  208
                     ICLVDELFLEC  ++W++   GE + + +  Y +CL+L   LRE GV VHQ
Sbjct  320  IPRLFDTGAICLVDELFLECHYNRWQKCCPGERSPKYENTYEECLDLFSSLRESGVLVHQ  379

Query  207  WW  202
            WW
Sbjct  380  WW  381



>ref|XP_006398590.1| hypothetical protein EUTSA_v10015877mg [Eutrema salsugineum]
 gb|ESQ40043.1| hypothetical protein EUTSA_v10015877mg [Eutrema salsugineum]
Length=513

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 65/109 (60%), Gaps = 11/109 (10%)
 Frame = -2

Query  495  VEDSEETKTGE----ESVGLSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLV  343
            V+ S  +  GE    +    ++WL+ +V++ D+VVMK + E  E      +++   ICL+
Sbjct  405  VKKSSSSLAGEVNLIQGFDFADWLKKSVRERDFVVMKMDVEGTEFDLIPRLIKTGAICLI  464

Query  342  DELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
            DELFLEC  ++W+    G+ +Q+  + Y QCLEL   LR+ GV VHQWW
Sbjct  465  DELFLECHYNRWQRCCPGQRSQKYNKTYNQCLELFTSLRQSGVLVHQWW  513



>gb|KCW49402.1| hypothetical protein EUGRSUZ_K02942 [Eucalyptus grandis]
Length=479

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 103/245 (42%), Gaps = 66/245 (27%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRK--ALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGA  565
            PE K+  +++ E  + E P K     K +++ +K+LP ++  S +N    V +     G+
Sbjct  235  PEYKQKLVRNAEPLIEEEPLKPWITLKRNIQNIKYLPSMVDISFKNRYVYVDVGARSYGS  294

Query  564  E--KWFHDNYPANNQEFD----------------------------------FYNID---  502
                WF   YP  N+ F+                                  F+ I+   
Sbjct  295  SIGSWFRKQYPKQNKTFEVFAIEADKTFHDEYKAKKAVTLLPYAAWVKNESLFFEINRDP  354

Query  501  --------------VKVEDSEETKTGE----ESVGLSNWLRNTVKDADYvvmkaeaevve  376
                          ++ + S     GE    +    + WL+ TV   D+VVMK + E  E
Sbjct  355  DHKAEVVKGRGMGRIQPKQSSAKSDGEVVKIKGFDFAEWLKRTVSAKDFVVMKMDVEGTE  414

Query  375  -----emvreRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVA  217
                  + +   ICL+DE+FLEC  ++W+    GE + + ++ Y QCL+L   LR+ G+ 
Sbjct  415  FDLIPRLFKTGAICLIDEIFLECHYNRWQRCCPGERSSKYEKTYRQCLDLFNSLRQSGIL  474

Query  216  VHQWW  202
            VHQWW
Sbjct  475  VHQWW  479



>ref|XP_008647032.1| PREDICTED: uncharacterized protein LOC103628641, partial [Zea 
mays]
Length=412

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 96/242 (40%), Gaps = 66/242 (27%)
 Frame = -2

Query  729  KKAALKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGAE--  562
            ++  L H E  + E P K     K +++ +K+LP L   S +     V +     G+   
Sbjct  171  RRQLLAHAEPLIQEEPLKPWITLKRNIKNIKYLPALADISFKRRYLYVDVGARSYGSSIG  230

Query  561  KWFHDNYPANNQEFDFYNID-----------------------VKVED-----------S  484
             WF   YP  N  F  + I+                       VK E             
Sbjct  231  SWFRKQYPKQNHTFQVFAIEADPAFHSEYAAKKGVTLLPYAAWVKNETLRFEINGDPGKE  290

Query  483  EETKTGEESVG---------------------LSNWLRNTVKDADYvvmkaeaevveemv  367
            +E K     +G                      + WLR TV + DYVVMK + E  E  +
Sbjct  291  DEAKANGRGMGRIRPATGKKMNGEVRSVPAFDFAEWLRQTVTEQDYVVMKMDVEGTEFDL  350

Query  366  r-----eRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQ  208
                     ICLVDELFLEC  ++W++   GE + + +  Y +CL+L   LRE GV VHQ
Sbjct  351  IPRLFDTGAICLVDELFLECHYNRWQKCCPGERSPKYENTYEECLDLFSSLRESGVLVHQ  410

Query  207  WW  202
            WW
Sbjct  411  WW  412



>ref|XP_007208450.1| hypothetical protein PRUPE_ppa004250mg [Prunus persica]
 gb|EMJ09649.1| hypothetical protein PRUPE_ppa004250mg [Prunus persica]
Length=520

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             +NWL+NT  + D+VVMK + E  E      +     ICL+DE+FLEC  ++W+    GE
Sbjct  431  FANWLKNTFSEKDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQRCCPGE  490

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + ++ Y QCL+L   LR+ GV VHQWW
Sbjct  491  RSSKYEKTYGQCLDLFTSLRQSGVLVHQWW  520



>ref|NP_001143103.1| hypothetical protein precursor [Zea mays]
 gb|ACG29006.1| hypothetical protein [Zea mays]
 gb|ACR37970.1| unknown [Zea mays]
 tpg|DAA64241.1| TPA: hypothetical protein ZEAMMB73_693239 [Zea mays]
Length=496

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 67/242 (28%), Positives = 95/242 (39%), Gaps = 66/242 (27%)
 Frame = -2

Query  729  KKAALKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGAE--  562
            ++  L H E  + E P K     K +++ +K+LP L   S +     V +     G+   
Sbjct  255  RRQLLAHAEPLIQEEPLKPWITLKRNIKNIKYLPALADISFKRRYLYVDVGARSYGSSIG  314

Query  561  KWFHDNYPANNQEFDFYNID-----------------------VKVED-----------S  484
             WF   YP  N  F  + I+                       VK E             
Sbjct  315  SWFRKQYPKQNHTFQVFAIEADPAFHSEYAAKKGVTLLPYAAWVKNETLRFEINGDPGKE  374

Query  483  EETKTGEESVG---------------------LSNWLRNTVKDADYvvmkaeaevv----  379
            +E K     +G                      + WLR TV + DYVVMK + E      
Sbjct  375  DEAKANGRGMGRIRPATGKKMNGEVRSVPAFDFAEWLRQTVTEQDYVVMKMDVEGTEFDL  434

Query  378  -eemvreRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQ  208
               +     ICLVDELFLEC  ++W++   GE + + +  Y +CL+L   LRE GV VHQ
Sbjct  435  IPRLFDTGAICLVDELFLECHYNRWQKCCPGERSPKYENTYEECLDLFSSLRESGVLVHQ  494

Query  207  WW  202
            WW
Sbjct  495  WW  496



>ref|NP_195791.1| methyltransferase [Arabidopsis thaliana]
 emb|CAB82287.1| putative protein [Arabidopsis thaliana]
 gb|AAL07072.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13203.1| unknown protein [Arabidopsis thaliana]
 gb|AAN60352.1| unknown [Arabidopsis thaliana]
 gb|AED90380.1| methyltransferase [Arabidopsis thaliana]
Length=513

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 58/90 (64%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             ++WL+ +V++ D+VVMK + E  E      +++   ICL+DELFLEC  ++W+    G+
Sbjct  424  FADWLKKSVRERDFVVMKMDVEGTEFDLIPRLIKTGAICLIDELFLECHYNRWQRCCPGQ  483

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             +Q+  + Y QCLEL   LR+ GV VHQWW
Sbjct  484  RSQKYNKTYNQCLELFNSLRQRGVLVHQWW  513



>emb|CDX80754.1| BnaC03g00080D [Brassica napus]
Length=504

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 64/109 (59%), Gaps = 11/109 (10%)
 Frame = -2

Query  495  VEDSEETKTGE----ESVGLSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLV  343
            V  S  +  GE    +    ++WL+ +V++ D+VVMK + E  E      +++   ICL+
Sbjct  396  VTKSSSSLAGEVNLIQGFDFADWLKKSVRERDFVVMKMDVEGTEFDLIPRLIKTGAICLI  455

Query  342  DELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
            DELFLEC  ++W+    G+ +Q+  + Y QCLEL   LR+ GV VHQWW
Sbjct  456  DELFLECHYNRWQRCCPGQRSQKYNKTYNQCLELFTSLRQRGVLVHQWW  504



>dbj|BAJ97336.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=491

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 96/246 (39%), Gaps = 70/246 (28%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGAE  562
            E K   L H E  + E P K     K +++ +K+LPDL   S +     V +     G+ 
Sbjct  248  EHKTQLLTHAEPLIQEEPLKPWLTLKRNIQNIKYLPDLADISFKRRYVYVDLGSRSYGSS  307

Query  561  --KWFHDNYPANNQEFDFY------------------------------------NIDVK  496
               WF   YP  N  F+ +                                    N D  
Sbjct  308  IGSWFRKQYPKQNHTFEVFAIEADPTFHPDYATRKGVTLLPYAAWVKNDTLSFEINGDPG  367

Query  495  VEDSEETKTGEESVG---------------------LSNWLRNTVKDADYvvmkaeaevv  379
             ED  E K     +G                      + WL+ TV + DYVVMK + E  
Sbjct  368  KED--EAKASGRGMGRIRPTAGKKMSGKVRRVQAFDFAEWLKQTVSEQDYVVMKMDVEGT  425

Query  378  eemvr-----eRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGV  220
            E  +         ICLVDE+FLEC  ++W++   GE + + Q  Y +CLEL   LRE GV
Sbjct  426  EFDLIPRLFDTGAICLVDEVFLECHYNRWQKCCPGERSPKYQNTYEECLELFSSLRESGV  485

Query  219  AVHQWW  202
             VHQW+
Sbjct  486  LVHQWF  491



>tpg|DAA64242.1| TPA: hypothetical protein ZEAMMB73_693239 [Zea mays]
Length=113

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevveemvr-----eRTICLVDELFLECK-SQWeegegge  289
             + WLR TV + DYVVMK + E  E  +         ICLVDELFLEC  ++W++   GE
Sbjct  24   FAEWLRQTVTEQDYVVMKMDVEGTEFDLIPRLFDTGAICLVDELFLECHYNRWQKCCPGE  83

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + +  Y +CL+L   LRE GV VHQWW
Sbjct  84   RSPKYENTYEECLDLFSSLRESGVLVHQWW  113



>ref|NP_001169287.1| hypothetical protein [Zea mays]
 gb|ACN33289.1| unknown [Zea mays]
 tpg|DAA41832.1| TPA: hypothetical protein ZEAMMB73_867074 [Zea mays]
Length=493

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 68/238 (29%), Positives = 94/238 (39%), Gaps = 66/238 (28%)
 Frame = -2

Query  717  LKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGAE--KWFH  550
            L H E  + E P K     K +M  +K+LP L   S +     V +     G+    WF 
Sbjct  256  LAHAEPLIQEEPLKPWLTLKRNMNNIKYLPALADISFKRRYVYVDVGAHSYGSSIGSWFR  315

Query  549  DNYPANNQEFDFYNID-----------------------VKVED-----------SEETK  472
             +YP  N  F  + I+                       VK E             +E K
Sbjct  316  KHYPKQNHTFQVFAIEADPAFHSEYATKKGVTLLPYAAWVKNETLVFEINGDPGKEDEAK  375

Query  471  TGEESVG---------------------LSNWLRNTVKDADYvvmkaeaevveemvr---  364
                 +G                     L+ WL+ TV + DY+VMK + E  E  +    
Sbjct  376  ANGRGMGRIRPTTGKKMSGEVRSVPAFDLAEWLKQTVTEQDYLVMKMDVEGTEFDLIPRL  435

Query  363  --eRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
                 ICLVDELFLEC  ++W++   GE + +    Y +CL+L   LRE GV VHQWW
Sbjct  436  FDTGAICLVDELFLECHYNRWQKCCPGERSPKYDNTYEECLDLFSSLRENGVLVHQWW  493



>ref|XP_007026550.1| Methyltransferases [Theobroma cacao]
 gb|EOY07052.1| Methyltransferases [Theobroma cacao]
Length=518

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 62/109 (57%), Gaps = 9/109 (8%)
 Frame = -2

Query  501  VKVEDSEETKTGEESVGL--SNWLRNTVKDADYvvmkaeaevve-----emvreRTICLV  343
            VK    E T   +E  G   + WL+NTV + D+VVMK + E  E      +     ICL+
Sbjct  410  VKSRQGEFTGEVDEIQGFDFAEWLKNTVTERDFVVMKMDVEGTEFDLIPRLFETGAICLI  469

Query  342  DELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
            DE+FLEC  ++W+    G+ + + ++ Y QCLEL   LR+ GV VHQWW
Sbjct  470  DEIFLECHYNRWQRCCPGQRSTKYEKNYGQCLELFTSLRKSGVLVHQWW  518



>ref|XP_009125399.1| PREDICTED: uncharacterized protein LOC103850409 [Brassica rapa]
Length=488

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 65/109 (60%), Gaps = 11/109 (10%)
 Frame = -2

Query  495  VEDSEETKTGE----ESVGLSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLV  343
            V+ S  +  GE    +    ++WL+ +V++ D+VVMK + E  E      +++   ICL+
Sbjct  380  VKKSSSSLAGEVNLIQGFDFADWLKKSVRERDFVVMKMDVEGTEFDLIPRLIKTGAICLI  439

Query  342  DELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
            DELFLEC  ++W+    G+ +Q+  + Y QCL+L   LR+ GV VHQWW
Sbjct  440  DELFLECHYNRWQRCCPGQRSQKYNKTYNQCLQLFTSLRQSGVLVHQWW  488



>ref|XP_002870902.1| hypothetical protein ARALYDRAFT_486898 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47161.1| hypothetical protein ARALYDRAFT_486898 [Arabidopsis lyrata subsp. 
lyrata]
Length=513

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 58/90 (64%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             ++WL+ +V++ D+VVMK + E  E      +++   ICL+DELFLEC  ++W+    G+
Sbjct  424  FADWLKKSVRERDFVVMKMDVEGTEFDLIPRLIKTGAICLIDELFLECHYNRWQRCCPGQ  483

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             +Q+  + Y QCLEL   LR+ GV VHQWW
Sbjct  484  RSQKYNKTYNQCLELFTSLRQRGVLVHQWW  513



>ref|XP_011080707.1| PREDICTED: uncharacterized protein LOC105163887 isoform X1 [Sesamum 
indicum]
Length=490

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 7/87 (8%)
 Frame = -2

Query  441  WLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegeggeENQ  280
            WL++TV + DYVV+K + E  E      ++    ICL+DE+FLEC  ++W+    G+ + 
Sbjct  404  WLKSTVVERDYVVVKMDVEGTEFHLIPRLIETGAICLIDEMFLECHYNRWQRCCPGKRSP  463

Query  279  R-QRAYWQCLELHGRLREEGVAVHQWW  202
            + Q  Y QCLEL+  LR+ GV VHQWW
Sbjct  464  KYQNTYAQCLELYSSLRKSGVLVHQWW  490



>ref|XP_004246304.1| PREDICTED: uncharacterized protein LOC101267731 [Solanum lycopersicum]
Length=510

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 97/244 (40%), Gaps = 65/244 (27%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRK--ALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGA  565
            P+ K   ++  E  + E P+K     K + + +K+L  +   S +     V +     G+
Sbjct  267  PDYKMKLIRKAEPLIKEEPKKPWITLKKNAQSIKYLSSMADISFKQRYVYVDVGSRSYGS  326

Query  564  E--KWFHDNYPANNQEFDFYNIDV------------------------------------  499
                WF   YP  N+ FD Y ++                                     
Sbjct  327  SIVSWFKKQYPKQNKTFDIYAVEADKTFHGQYKEKKGVTLLPYAAWVRNETLSFEINQDP  386

Query  498  ------------KVEDSEETKTGEESVGL------SNWLRNTVKDADYvvmkaeaevve-  376
                        +++  E +  G   V L      + WL + V + DYVVMK + E  E 
Sbjct  387  GHKDVSKGRGMGRIQPVESSSEGASEVDLIQGFDFAEWLMSAVSEKDYVVMKMDVEGTEF  446

Query  375  ----emvreRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAV  214
                 ++    ICL+DE+FLEC  ++W++   GE + +    Y QCL+L   LRE GV V
Sbjct  447  DLIPRLIETGAICLIDEVFLECHYNRWQKCCPGERSSKYPNTYSQCLDLFTSLRESGVLV  506

Query  213  HQWW  202
            HQWW
Sbjct  507  HQWW  510



>ref|XP_006658171.1| PREDICTED: uncharacterized protein LOC102700724 [Oryza brachyantha]
Length=482

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevveemvr-----eRTICLVDELFLECK-SQWeegegge  289
             + WL++TV + DYVVMK + E  E  +         ICL+DELFLEC  ++W++   GE
Sbjct  393  FAEWLKHTVSEQDYVVMKMDVEGTEFDLIPRLFDTGAICLIDELFLECHYNRWQKCCPGE  452

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + Q  Y +CLEL   LRE GV VHQWW
Sbjct  453  RSPKYQNTYDECLELFSSLRESGVLVHQWW  482



>emb|CDY11183.1| BnaA03g00190D [Brassica napus]
Length=500

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 58/90 (64%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             ++WL+ +V++ D+VVMK + E  E      +++   ICL+DELFLEC  ++W+    G+
Sbjct  411  FADWLKKSVRERDFVVMKMDVEGTEFDLIPRLIKTGAICLIDELFLECHYNRWQRCCPGQ  470

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             +Q+  + Y QCLEL   LR+ GV VHQWW
Sbjct  471  RSQKYNKTYNQCLELFTSLRQSGVLVHQWW  500



>ref|XP_010233621.1| PREDICTED: uncharacterized protein LOC104583389 [Brachypodium 
distachyon]
Length=506

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 68/238 (29%), Positives = 95/238 (40%), Gaps = 66/238 (28%)
 Frame = -2

Query  717  LKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGAE--KWFH  550
            L   E  +LE P K     K +++ +K+LP+L   S +     V +     G+    WF 
Sbjct  269  LTRAEPLILEEPLKPWLTLKRNLKNIKYLPELADISFKRRHVYVDVGARSYGSSIGSWFR  328

Query  549  DNYPANNQEFDFYNID-----------------------VKVED-----------SEETK  472
              YP  N  F+ + I+                       VK E             EE K
Sbjct  329  KQYPKQNHTFEVFAIEADPAFHPEYATRKGVTLLPYAAWVKNETLNFEINGDPGKEEEAK  388

Query  471  TGEESVG---------------------LSNWLRNTVKDADYvvmkaeaevveemvr---  364
                 +G                      + WL+ TV   DYVVMK + E  E  +    
Sbjct  389  ANGRGMGRIRPIAGKKMSGEVRSVPAFDFAEWLKQTVSQQDYVVMKMDVEGTEFDLIPRL  448

Query  363  --eRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
                 ICLVDELFLEC  ++W++   GE + + Q  Y +CLEL   LR+ GV VHQW+
Sbjct  449  FDTGAICLVDELFLECHYNRWQKCCPGERSPKYQNTYEECLELFSSLRDSGVLVHQWF  506



>gb|KHN40685.1| hypothetical protein glysoja_001183 [Glycine soja]
Length=277

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 100/246 (41%), Gaps = 67/246 (27%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRK--ALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGA  565
            P  K   +K  E  + E P K     K ++R +K+LP +   S +N    V +     G+
Sbjct  32   PGYKHDLVKIAEPLIEEEPLKPWITLKRNVRNIKYLPSIADISFKNRYVYVDVGARSYGS  91

Query  564  E--KWFHDNYPANNQEFDFYNIDV------------------------------------  499
                WF   YP  N+ F  Y I+                                     
Sbjct  92   SIGSWFRKQYPKQNKTFHVYAIEADKTFHQEYGLKKGITLVPYAAWVKNETLMFEIHRDP  151

Query  498  ------------KVEDSEETKTGE--------ESVGLSNWLRNTVKDADYvvmkaeaevv  379
                        +++  + +  GE        +    +NWL+ TV   D+VVMK + E  
Sbjct  152  GEHVEVKGRGMGRIQPLQSSGRGEFDGEVEKIQGFDFANWLKKTVSKNDFVVMKMDVEGT  211

Query  378  e-----emvreRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGV  220
            E      +++   ICL+DE+FLEC  ++W+    G+ + + ++ Y QCL+L   LR+ GV
Sbjct  212  EFDLIPRLIKTGAICLIDEIFLECHYNRWQRCCPGQRSAKYEKTYDQCLQLFKSLRQSGV  271

Query  219  AVHQWW  202
             VHQW+
Sbjct  272  LVHQWF  277



>ref|XP_009342226.1| PREDICTED: uncharacterized protein LOC103934219 [Pyrus x bretschneideri]
Length=470

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 59/94 (63%), Gaps = 7/94 (7%)
 Frame = -2

Query  462  ESVGLSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeeg  301
            E    + WL++ V + D+VV+K + E  E     +++    ICL+DE+FLEC  ++W++ 
Sbjct  377  EGFDFAEWLKSVVSERDFVVVKMDGEGAEFHLIPKLIESGAICLIDEIFLECHYNRWQKC  436

Query  300  eggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
              G+ + + ++ Y QCLEL  +LRE GV VHQWW
Sbjct  437  CSGQRSPKFKKTYGQCLELFTKLRENGVLVHQWW  470



>ref|XP_006828158.1| hypothetical protein AMTR_s00023p00093390 [Amborella trichopoda]
 gb|ERM95574.1| hypothetical protein AMTR_s00023p00093390 [Amborella trichopoda]
Length=495

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 57/239 (24%), Positives = 96/239 (40%), Gaps = 60/239 (25%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGA  565
            PE K+   +  E  ++E P K     K +++ +K+L  ++  S +     + +     G+
Sbjct  257  PEHKRKIARMAEPLIMEEPLKPWLTLKRNIKNIKYLSSMVDISFKRKYVYIDVGSRSYGS  316

Query  564  E--KWFHDNYPANNQEFDFYNID--------------VKVE---------------DSEE  478
                WF   YP  N+ F+ + I+              VK+                + E+
Sbjct  317  SIGSWFKKQYPKQNKTFEVFAIEADKTFHEEYSKKKGVKLVPKAAWVRDEMLRFEINGED  376

Query  477  TKTGE---------------------ESVGLSNWLRNTVKDADYvvmkaeaevve-----  376
            +  G                      E    + W+++ V   DYVVMK + E  E     
Sbjct  377  SGNGRGMGRIQMDGSNVQGRREVVEIEGFDFAKWVKSNVDKRDYVVMKMDVEGTEFDLLP  436

Query  375  emvreRTICLVDELFLECK-SQWeegeggeENQRQRAYWQCLELHGRLREEGVAVHQWW  202
             +     ICL+DE+FLEC  ++W++       + ++ Y  C+ L   LRE GV VHQWW
Sbjct  437  NLFETGAICLIDEIFLECHYNRWQKCCPERSKKYKKTYGDCMNLFTSLRESGVLVHQWW  495



>gb|EYU45992.1| hypothetical protein MIMGU_mgv1a025887mg [Erythranthe guttata]
Length=484

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 56/94 (60%), Gaps = 7/94 (7%)
 Frame = -2

Query  462  ESVGLSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeeg  301
            E    + WL++TV + DYVV+K + E  E      ++    ICL+DE+F+EC  ++W+  
Sbjct  391  EGFDFTAWLKSTVVERDYVVVKMDVEGTEFHLIPRLIESGAICLIDEMFIECHYNRWQRC  450

Query  300  eggeENQRQR-AYWQCLELHGRLREEGVAVHQWW  202
              G+ + + R  Y QCLEL   LR+ GV VHQWW
Sbjct  451  CPGKRSPKYRKTYAQCLELFSSLRKRGVLVHQWW  484



>ref|XP_004492512.1| PREDICTED: uncharacterized protein LOC101509260 [Cicer arietinum]
Length=521

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 56/90 (62%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevvee-----mvreRTICLVDELFLECK-SQWeegegge  289
             +NWL+NTV   D+VVMK + E  E      + +   ICL+DE+FLEC  ++W+    G+
Sbjct  432  FANWLKNTVSRNDFVVMKMDVEGTEFDLIPRLFKTGAICLIDEIFLECHYNRWQRCCPGQ  491

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + ++ Y QCL+L   LR+ G+ VHQWW
Sbjct  492  RSSKYEKTYDQCLDLFNSLRQSGILVHQWW  521



>gb|KDP22815.1| hypothetical protein JCGZ_00402 [Jatropha curcas]
Length=514

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 56/90 (62%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             + WL+NTV + D+VVMK + E  E      + +   ICL+DE+FLEC  ++W+    G+
Sbjct  425  FAEWLKNTVTEKDFVVMKMDVEGTEFDLIPRLFKTGAICLIDEIFLECHYNRWQRCCPGQ  484

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + ++ Y QCL+L   LR+ GV VHQWW
Sbjct  485  RSPKYEKTYGQCLKLFTSLRDSGVLVHQWW  514



>ref|XP_008370209.1| PREDICTED: uncharacterized protein LOC103433716 [Malus domestica]
Length=523

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             +NWL+ T  + D+VVMK + E  E      +     ICL+DE+FLEC  ++W+    GE
Sbjct  434  FANWLKKTFSEKDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQRCCPGE  493

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + +++Y QCL+L   LR+ GV VHQWW
Sbjct  494  RSSKYEKSYGQCLDLFASLRQSGVLVHQWW  523



>ref|XP_009130631.1| PREDICTED: uncharacterized protein LOC103855402 [Brassica rapa]
Length=508

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 63/109 (58%), Gaps = 11/109 (10%)
 Frame = -2

Query  495  VEDSEETKTGE----ESVGLSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLV  343
            V  S  +  GE    +    ++WL+  V++ D+VVMK + E  E      +++   ICL+
Sbjct  400  VTKSSSSLAGEVNLIQGFDFADWLKKRVRERDFVVMKMDVEGTEFDLIPRLIKTGAICLI  459

Query  342  DELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
            DELFLEC  ++W+    G+ +Q+  + Y QCLEL   LR+ GV VHQWW
Sbjct  460  DELFLECHYNRWQRCCPGQRSQKYNKTYNQCLELFTSLRQSGVLVHQWW  508



>ref|XP_007208593.1| hypothetical protein PRUPE_ppa022624mg [Prunus persica]
 gb|EMJ09792.1| hypothetical protein PRUPE_ppa022624mg [Prunus persica]
Length=491

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 58/94 (62%), Gaps = 7/94 (7%)
 Frame = -2

Query  462  ESVGLSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeeg  301
            E    ++WL+NT  + D+VV+K + E  E      ++    ICL+DE+FLEC  ++W+  
Sbjct  398  EGFDFADWLKNTASERDFVVVKMDVEGTEFHLIPRLIETGAICLIDEIFLECHYNRWQRC  457

Query  300  eggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
              G+ + + ++ Y QCL+L  +LR+ GV VHQWW
Sbjct  458  CPGQRSPKFKKTYGQCLDLFNKLRDTGVLVHQWW  491



>ref|XP_002461266.1| hypothetical protein SORBIDRAFT_02g043860 [Sorghum bicolor]
 gb|EER97787.1| hypothetical protein SORBIDRAFT_02g043860 [Sorghum bicolor]
Length=495

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 94/238 (39%), Gaps = 66/238 (28%)
 Frame = -2

Query  717  LKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGAE--KWFH  550
            L H E  + E P K     K +++ +K+LP L   S +     V +     G+    WF 
Sbjct  258  LAHAEPLIQEEPLKPWLTLKRNIKNIKYLPALADISFKRRYVYVDVGARSYGSSIGSWFR  317

Query  549  DNYPANNQEFDFYNID-----------------------VKVED-----------SEETK  472
              YP  N  F  + I+                       VK E             +E K
Sbjct  318  KQYPKQNHTFQVFAIEADPAFHSEYAAKKGVTLLPYAAWVKNETLRFEINGDPGKEDEAK  377

Query  471  TGEESVG---------------------LSNWLRNTVKDADYvvmkaeaevveemvr---  364
                 +G                      + WL+ TV + DYVVMK + E  E  +    
Sbjct  378  ANGRGMGRIRPATGKKMSGEVRSVPAFDFAEWLKQTVTEQDYVVMKMDVEGTEFDLIPRL  437

Query  363  --eRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
                 ICLVDELFLEC  ++W++   GE + + +  Y +CL+L   LRE GV VHQWW
Sbjct  438  FDTGAICLVDELFLECHYNRWQKCCPGERSPKYENTYEECLDLFSSLRESGVLVHQWW  495



>gb|EPS62213.1| hypothetical protein M569_12578 [Genlisea aurea]
Length=511

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 56/90 (62%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             + WL++TV + D+VVMK + E  E      +    +ICL+DELFLEC  ++W++   G+
Sbjct  422  FAAWLKSTVSERDFVVMKMDVEGTEFDLIPRLFETESICLIDELFLECHYNRWQKCCPGQ  481

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + +  + Y QCL+L   LRE GV VHQWW
Sbjct  482  RSSKYDKTYGQCLDLFSSLRERGVHVHQWW  511



>ref|XP_009373100.1| PREDICTED: uncharacterized protein LOC103962151 [Pyrus x bretschneideri]
Length=523

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 55/89 (62%), Gaps = 7/89 (8%)
 Frame = -2

Query  447  SNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegeggeE  286
            +NWL+ T  + D+VVMK + E  E      +     ICL+DE+FLEC  ++W+    GE 
Sbjct  435  ANWLKKTFSEKDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQRCCPGER  494

Query  285  NQR-QRAYWQCLELHGRLREEGVAVHQWW  202
            + + +++Y QCL+L   LR+ GV VHQWW
Sbjct  495  SSKYEKSYGQCLDLFASLRQSGVLVHQWW  523



>ref|XP_001771643.1| predicted protein [Physcomitrella patens]
 gb|EDQ63557.1| predicted protein [Physcomitrella patens]
Length=480

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 66/247 (27%), Positives = 102/247 (41%), Gaps = 70/247 (28%)
 Frame = -2

Query  735  ETKKAALKHLEDALLEPPRK--ALAKSSMRKMKFLPDLM------------------GDS  616
            ++K   LK  E  +L  P+K    +KSS+R MK+LP L                   G S
Sbjct  235  KSKADVLKLAEPLVLSEPKKPWIASKSSLRSMKYLPSLTDIRHHRRYIYVDIGSRNYGSS  294

Query  615  LQNYPRRVFISDDKNG------AEKWFHDNYPANNQEFDF--YNIDVKVE------DSEE  478
            + N+ ++ +     N       A+  F  +Y +N+ E +F  Y   ++ E      D + 
Sbjct  295  IGNWFQKAYPKQGHNFTIYAIEADSTFRHSY-SNHPEVNFMAYAAWIRNESLSFGSDMDR  353

Query  477  TKTGE-----------------------------ESVGLSNWLRNTVKDADYvvmkaeae  385
               G                              + + +S W+R+ V++ D++V+K + E
Sbjct  354  NGCGHRGGMGRIQYSPRVSQKSSWLDRCDHRAEVQGLDVSEWIRSMVREEDFLVVKMDVE  413

Query  384  vvee-----mvreRTICLVDELFLECK-SQWeegeggeENQRQRAYWQCLELHGRLREEG  223
              E      MV    ICLVDELFLEC  ++W+        +  R Y  C+ L   LR  G
Sbjct  414  GAETDLVPKMVDTGAICLVDELFLECHYNRWQRSSPHRSPKYNRTYQDCVSLFRSLRRRG  473

Query  222  VAVHQWW  202
            V VHQWW
Sbjct  474  VLVHQWW  480



>ref|XP_009781173.1| PREDICTED: uncharacterized protein LOC104230131 [Nicotiana sylvestris]
Length=499

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -2

Query  357  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             ICL+DELFLEC  S+W++   G+ + + ++ Y  CLEL   LRE GV VHQWW
Sbjct  444  AICLIDELFLECHYSRWQKCCPGKRSPKYEKTYAHCLELFSSLRERGVLVHQWW  497



>ref|XP_004987042.1| PREDICTED: uncharacterized protein LOC101779612 [Setaria italica]
Length=495

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
            L+ WL+ TV + DYVVMK + E  E      M+    ICLVDELFLEC  ++W+    GE
Sbjct  406  LAEWLKRTVSEQDYVVMKMDVEGTEFDLIPRMIETGAICLVDELFLECHYNRWQRCCPGE  465

Query  288  ENQRQR-AYWQCLELHGRLREEGVAVHQWW  202
             + + R  Y +CL+L   LR  GV VHQWW
Sbjct  466  RSPKYRNTYGECLQLFTSLRNSGVLVHQWW  495



>ref|XP_004497494.1| PREDICTED: uncharacterized protein LOC101500848 [Cicer arietinum]
Length=479

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 80/184 (43%), Gaps = 45/184 (24%)
 Frame = -2

Query  654  RKMKFLPDLMGDSLQNYPRRVFISDDKNGAEKWFHDNYPANNQEFDFYNI----------  505
            +K+ +LP  +  + +     V I + KN    WF  +YP + + F+ Y +          
Sbjct  303  KKISYLPKFVDVTSKKNLVYVNIGEVKN---TWFPPSYPIDQKHFNVYFVHYDTSIMLSH  359

Query  504  ----------------DVKVEDSEETKTGEESVGLSNWLRNTVKDADYvvmkaeaevvee  373
                            D K ED E    GEE   L  W + TV++AD+VV+K       E
Sbjct  360  VKGPRVTFVYHPELAEDFKHEDIEH-YMGEEDFDLVAWFKETVENADFVVLKMNIAGKVE  418

Query  372  mvr------eRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHGRLREEGVAVH  211
            M           IC +DELFL C        GG E++R R    C++++  LR  GV VH
Sbjct  419  MKFLRDIYESGVICFIDELFLGCSES-----GGAESERGR----CMDIYKGLRSNGVFVH  469

Query  210  QWWS  199
            QWW+
Sbjct  470  QWWN  473



>ref|XP_011019055.1| PREDICTED: uncharacterized protein LOC105121895 [Populus euphratica]
Length=514

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 56/94 (60%), Gaps = 7/94 (7%)
 Frame = -2

Query  462  ESVGLSNWLRNTVKDADYvvmkaeaevveemvr-----eRTICLVDELFLECK-SQWeeg  301
            E    + WL++TV + D+VVMK + E  E  +         ICL+DE+FLEC  ++W+  
Sbjct  421  EGFDFAEWLKSTVTEKDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQRC  480

Query  300  eggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
              G+ + + ++ Y QCL+L   LR+ GV VHQWW
Sbjct  481  CPGQRSSKYEKTYGQCLDLFTSLRDRGVLVHQWW  514



>ref|XP_009412633.1| PREDICTED: uncharacterized protein LOC103994078 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412634.1| PREDICTED: uncharacterized protein LOC103994078 [Musa acuminata 
subsp. malaccensis]
Length=514

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             + WL+ TV + DYVVMK + E  E      +     ICL+DELFLEC  ++W++   G+
Sbjct  425  FAAWLKRTVTERDYVVMKMDVEGTEFDLVPRLFETGGICLIDELFLECHYNRWQKCCPGQ  484

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + Q  Y +CL+L  RLR+ GV VHQWW
Sbjct  485  RSPKYQNTYGECLKLFTRLRDGGVLVHQWW  514



>emb|CDP19032.1| unnamed protein product [Coffea canephora]
Length=481

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 58/94 (62%), Gaps = 7/94 (7%)
 Frame = -2

Query  462  ESVGLSNWLRNTVKDADYvvmkaeaevveemvreRTI-----CLVDELFLECK-SQWeeg  301
            E++ L++WL  T    D+VVMK + E  E  +  R +     CL+DELFLEC   +W + 
Sbjct  388  EALDLADWLIRTFSKRDFVVMKMDIEGSEFDLMNRLVESGAFCLIDELFLECHYDRWIKC  447

Query  300  -eggeENQRQRAYWQCLELHGRLREEGVAVHQWW  202
              G + N+ +R+Y QC+ L+ +LR++G  VHQWW
Sbjct  448  CSGEKTNRHKRSYAQCMNLYAKLRKDGCFVHQWW  481



>ref|XP_010937964.1| PREDICTED: uncharacterized protein LOC105057170 [Elaeis guineensis]
Length=523

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 100/249 (40%), Gaps = 70/249 (28%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRK--ALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGA  565
            PE K   L+  E  + + P K     K +++ +K+LP ++  S ++    V +     G+
Sbjct  275  PEHKLQLLESAEPLIKDEPLKPWITLKRNIKNIKYLPSMVDISFKSRYVYVDVGARSYGS  334

Query  564  E--KWFHDNYPANNQEFDFY------------------------------------NIDV  499
                WF   YP  N  F  Y                                    N D 
Sbjct  335  SIGSWFRKQYPKQNHTFGIYAIEADPAFHDEYAAKKNVNLLPFAAWVRNETLAFEINHDP  394

Query  498  KVEDSEETK----------TGEESVGLSN-------------WLRNTVKDADYvvmkaea  388
            +  D E+ K           G  S G+S+             WL+ TV  +D+VVMK + 
Sbjct  395  EQHDVEKEKGSRGMGRIRPVGGLSEGVSSGEVHTIHGFDFAEWLKRTVTQSDFVVMKMDV  454

Query  387  evve-----emvreRTICLVDELFLECK-SQWeegeggeENQRQR-AYWQCLELHGRLRE  229
            E  E      + +   ICL+DELFLEC  ++W+    GE   + R  Y +CL+L   LR+
Sbjct  455  EGTEFDLVPRLFKTGAICLIDELFLECHYNRWQRCCPGERTPKYRNTYGECLKLFTSLRK  514

Query  228  EGVAVHQWW  202
             GV VHQWW
Sbjct  515  SGVLVHQWW  523



>ref|XP_008244798.1| PREDICTED: uncharacterized protein LOC103342911 [Prunus mume]
Length=520

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             +NWL+ T  + D+VVMK + E  E      +     ICL+DE+FLEC  ++W+    GE
Sbjct  431  FANWLKKTFSEKDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQRCCPGE  490

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + ++ Y QCL+L   LR+ GV VHQWW
Sbjct  491  RSSKYEKTYGQCLDLFTSLRQSGVLVHQWW  520



>gb|KHN02118.1| hypothetical protein glysoja_028321 [Glycine soja]
Length=72

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = -2

Query  354  ICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
            ICL+DELFLEC  ++W+    G+ N +  + Y QCL+L   LR  GV VHQWW
Sbjct  20   ICLIDELFLECHYNRWQRCCPGQRNAKYHKTYSQCLDLLTSLRNYGVLVHQWW  72



>ref|XP_004958788.1| PREDICTED: uncharacterized protein LOC101783448 [Setaria italica]
Length=488

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 66/238 (28%), Positives = 94/238 (39%), Gaps = 66/238 (28%)
 Frame = -2

Query  717  LKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGAE--KWFH  550
            LKH E  + E P K     K ++  +++LP L   S +     + +     G+    WF 
Sbjct  251  LKHAEPLIQEEPLKPWITLKRNINNIRYLPALADISFKRRYVYIDVGARSYGSSIGGWFR  310

Query  549  DNYPANNQEFDFY----------------------------NIDVKVE------DSEETK  472
             +YP  N  F  Y                            N  +K E        +E K
Sbjct  311  KHYPKQNHTFQVYAIEADPAFHSEYAAKKGVTLLPYAAWVKNDTLKFEINGDPGKEDEAK  370

Query  471  TGEESVG---------------------LSNWLRNTVKDADYvvmkaeaevveemvr---  364
                 +G                      + WL+ TV + DYVVMK + E  E  +    
Sbjct  371  ANGRGMGRIRPAAGNRMSGEVRSVPAFDFAEWLKQTVTEEDYVVMKMDVEGTEFDLIPRL  430

Query  363  --eRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
                 ICLVDELFLEC  ++W++   GE + + +  Y +CL+L   LRE GV VHQWW
Sbjct  431  FDTGAICLVDELFLECHYNRWQKCCPGERSPKYENTYEECLDLFSSLRESGVLVHQWW  488



>ref|XP_008369759.1| PREDICTED: uncharacterized protein LOC103433285 [Malus domestica]
Length=480

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 79/206 (38%), Gaps = 51/206 (25%)
 Frame = -2

Query  693  LEPPRKALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDK-----NGAEKWFHDNYPANN  529
            +EP  K       ++  +LP+ +   L +  R V+I         +    WF  +YP  +
Sbjct  273  MEPLVKEKPVEYGKRFAYLPNFV--DLSSKRRLVYIDIGAAQHLNSNVTNWFLPSYPIEH  330

Query  528  QEFDFYNID-------------------------------VKVEDSEETKTGEESVGLSN  442
            ++F+ Y +D                               V ++   +   G+E      
Sbjct  331  KDFNVYFVDHNTSVLLSYVKKPGITFVYHPGLAGIKPKVNVTIDGDTDPYVGDEGFDFLV  390

Query  441  WLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECKSQWeegeggeENQR  277
            W + TV  AD++V+K  A         E+     IC VDELFL C  Q + G     +  
Sbjct  391  WFKETVGFADFMVLKMNAGSAELKFLTELFESGAICFVDELFLHCSGQVDAGGAMPVD--  448

Query  276  QRAYWQCLELHGRLREEGVAVHQWWS  199
                  C+++ G LR  GV VHQWW 
Sbjct  449  ------CMDIFGSLRSSGVFVHQWWG  468



>gb|EMS66683.1| hypothetical protein TRIUR3_26284 [Triticum urartu]
Length=231

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 65/236 (28%), Positives = 92/236 (39%), Gaps = 72/236 (31%)
 Frame = -2

Query  717  LKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGAEKWFHDN  544
            L H E  +LE P K     K +++ +K+LP+L   S +   RR       +    WF   
Sbjct  4    LSHAEPLILEEPLKPWLTLKRNIQNIKYLPELADISFK---RRY-----GSSIGSWFRKQ  55

Query  543  YPANNQEFDF----------------------------------YNIDVKVEDSEETKTG  466
            YP  N  F+                                   + I+      +E K  
Sbjct  56   YPKQNHTFEVFAIEADPTFHPDYATRKGVTLLPYAAWVKNDTLSFEINGDPGKEDEAKAS  115

Query  465  EESVG---------------------LSNWLRNTVKDADYvvmkaeaevveemvr-----  364
               +G                      + WL+ TV + DYVVMK + E  E  +      
Sbjct  116  GRGMGRIRPTAGKKMSGKVRSVQAFDFAEWLKQTVSEQDYVVMKMDVEGTEFDLIPRLFD  175

Query  363  eRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
               ICLVDE+FLEC  ++W+    GE + + Q  Y +CLEL   LRE GV VHQW+
Sbjct  176  TGAICLVDEVFLECHYNRWQRCCPGERSPKYQNTYEECLELFSSLRESGVLVHQWF  231



>ref|XP_006603554.1| PREDICTED: uncharacterized protein LOC102670512 [Glycine max]
Length=409

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 91/220 (41%), Gaps = 65/220 (30%)
 Frame = -2

Query  666  KSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGAE--KWFHDNYPANNQEFDFYNIDV--  499
            K ++R +K+LP +   S +N    V +     G+    WF   YP  N+ F  Y I+   
Sbjct  190  KRNVRSIKYLPSIADISFKNRYVYVDVGARSYGSSIGSWFRKQYPKQNKTFHVYAIEADK  249

Query  498  ----------------------------------------------KVEDSEETKTGE--  463
                                                          +++  + +  GE  
Sbjct  250  TFHQEYGLKKGITLVPYAAWVKNETLMFEIHRDPGEHVEVKGRGMGRIQPLQSSGRGEFD  309

Query  462  ------ESVGLSNWLRNTVKDADYvvmkaeaevvee-----mvreRTICLVDELFLECK-  319
                  +    +NWL+ TV   D+VVMK + E  E      +++   ICL+DE+FLEC  
Sbjct  310  GEVEKIQGFDFANWLKKTVSKNDFVVMKMDVEGTEFDLIPRLIKTGAICLIDEIFLECHY  369

Query  318  SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
            ++W+    G+ + + ++ Y QCL+L   LR+ GV VHQW+
Sbjct  370  NRWQRCCPGQRSAKYEKTYDQCLQLFKSLRQSGVLVHQWF  409



>ref|XP_009615562.1| PREDICTED: uncharacterized protein LOC104108275 [Nicotiana tomentosiformis]
Length=515

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             + WL+++V + DYVVMK + E  E      +     ICL+DE+FLEC  ++W++   GE
Sbjct  426  FAEWLKSSVSERDYVVMKMDVEGTEFDLIPRLFETGAICLIDEVFLECHYNRWQKCCPGE  485

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + +  Y QCL+L   LRE GV VHQWW
Sbjct  486  RSSKYEHTYGQCLDLFTSLRESGVLVHQWW  515



>ref|XP_007205122.1| hypothetical protein PRUPE_ppa004877mg [Prunus persica]
 gb|EMJ06321.1| hypothetical protein PRUPE_ppa004877mg [Prunus persica]
Length=487

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/206 (26%), Positives = 79/206 (38%), Gaps = 51/206 (25%)
 Frame = -2

Query  693  LEPPRKALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDK-----NGAEKWFHDNYPANN  529
            +EP  K       +K  +LP+++   L +  R V++         + A+ WF  +YP   
Sbjct  284  MEPLVKEKPVDYGKKFNYLPNIV--DLSSKKRLVYVDIGAAEHLNSNAKNWFLPSYPVER  341

Query  528  QEFDFYNID-------------------------------VKVEDSEETKTGEESVGLSN  442
            + F  Y +D                               V  +   E   G+E      
Sbjct  342  KAFHTYFVDHNTSVLLSYVKKPGITFVYHPGLAGIKAQVNVTTDGETEPYVGDEGFDFHA  401

Query  441  WLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECKSQWeegeggeENQR  277
            W + TV+ AD+VV+K  A  V      E+     IC VDELFL C    + G     +  
Sbjct  402  WFKETVQFADFVVLKMNAGNVELKFLTELFESGAICFVDELFLHCSGSVDAGGAMPVD--  459

Query  276  QRAYWQCLELHGRLREEGVAVHQWWS  199
                  C+++ G LR  GV VHQWW 
Sbjct  460  ------CMDIFGSLRSSGVFVHQWWG  479



>ref|XP_002465406.1| hypothetical protein SORBIDRAFT_01g038110 [Sorghum bicolor]
 gb|EER92404.1| hypothetical protein SORBIDRAFT_01g038110 [Sorghum bicolor]
Length=491

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
            L+ WL+ TV + D+VVMK + E  E      ++    ICLVDELFLEC  ++W+    G 
Sbjct  402  LAEWLKRTVSEQDFVVMKMDVEGTEFDLIPRLIDTGAICLVDELFLECHYNRWQRCCPGV  461

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + +  Y +CLEL   LR+ GV VHQWW
Sbjct  462  RSPKYESTYGECLELFTSLRDSGVLVHQWW  491



>gb|EMT30745.1| hypothetical protein F775_21759 [Aegilops tauschii]
Length=308

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 65/242 (27%), Positives = 93/242 (38%), Gaps = 66/242 (27%)
 Frame = -2

Query  729  KKAALKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGAE--  562
            K   L H E  + E P K     K +++ +K+LP+L   S +     V +     G+   
Sbjct  67   KMQLLTHAEPLIEEEPLKPWLTLKRNIQNIKYLPELADISFKRRYVYVDLGSRSYGSSIG  126

Query  561  KWFHDNYPANNQEFDF----------------------------------YNIDVKVEDS  484
             WF   YP  N  F+                                   + I+      
Sbjct  127  SWFRKQYPKQNHTFEVFAIEADPTFHPDYATRKGVTLLPYAAWVKNDTLSFEINGDPGKE  186

Query  483  EETKTGEESVG---------------------LSNWLRNTVKDADYvvmkaeaevveemv  367
            +E K     +G                      + WL+ TV + DYVVMK + E  E  +
Sbjct  187  DEAKASGHGMGRIRPTAGKKMSGKVRSVQAFDFAEWLKQTVSEQDYVVMKMDVEGTEFDL  246

Query  366  r-----eRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQ  208
                     ICLVDE+FLEC  ++W+    GE + + Q  Y +CLEL   LRE GV VHQ
Sbjct  247  IPRLFDTGAICLVDEVFLECHYNRWQRCCPGERSPKYQNTYEECLELFSSLRESGVLVHQ  306

Query  207  WW  202
            W+
Sbjct  307  WF  308



>ref|XP_006381463.1| hypothetical protein POPTR_0006s13070g [Populus trichocarpa]
 gb|ERP59260.1| hypothetical protein POPTR_0006s13070g [Populus trichocarpa]
Length=459

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 56/214 (26%), Positives = 85/214 (40%), Gaps = 58/214 (27%)
 Frame = -2

Query  711  HLEDALLEPPRKALAKSSMRKMKFLPDLMGDSLQNYP-RRVFISDDKNGAE-------KW  556
            HLE+  LEP  +       + + +LP  +     + P R+  +  +  G E        W
Sbjct  260  HLEN--LEPLTEIKQGEHEKSIAYLPKFI-----DLPARKQLVYVEIGGGEHMNSSVSSW  312

Query  555  FHDNYPANNQEFDFYNIDVKVE----------------------------DSEE--TKTG  466
            F  +YPA++  F+ + +D                                D EE     G
Sbjct  313  FLPSYPADHSTFNVFFVDHNTSVLLSCVKKPGVTFIYYPGLAGDEATLDPDLEEFDPSMG  372

Query  465  EESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECKSQWeeg  301
            +E      W R TV+ AD+VV+K +A  V       + +   IC +DELFL C  Q    
Sbjct  373  DEGFDFLAWFRETVQYADFVVLKMKAGEVELKFLSGLFKSGAICFIDELFLSCSDQ----  428

Query  300  eggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  199
                + ++ R    C++L   LR  GV VHQWW 
Sbjct  429  ----DGEKGRVKGDCMDLFKSLRNTGVYVHQWWG  458



>ref|XP_009349043.1| PREDICTED: uncharacterized protein LOC103940618 [Pyrus x bretschneideri]
Length=492

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 79/206 (38%), Gaps = 51/206 (25%)
 Frame = -2

Query  693  LEPPRKALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDK-----NGAEKWFHDNYPANN  529
            +EP  K       ++  +LP+ +   L +  R V+I         +    WF  +YP  +
Sbjct  285  MEPLVKEKPVEYGKRFVYLPNFV--DLSSKRRLVYIDIGAAQHLNSNVTNWFLPSYPIEH  342

Query  528  QEFDFYNID-------------------------------VKVEDSEETKTGEESVGLSN  442
            ++F+ Y +D                               V ++   +   G+E      
Sbjct  343  KDFNVYFVDHNTSVLLSYVKKPGITFVYHPGLAGIKPKVNVTIDGDADPYVGDEGFDFLV  402

Query  441  WLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECKSQWeegeggeENQR  277
            W + TV  AD+VV+K  A  V      E+     IC VDELFL C  Q        E+  
Sbjct  403  WFKETVGFADFVVLKMNAGSVELKFLTELFESGAICFVDELFLHCSGQ--------EDAG  454

Query  276  QRAYWQCLELHGRLREEGVAVHQWWS  199
                  C+++ G LR  GV VHQWW 
Sbjct  455  GAMPVDCMDIFGSLRSSGVFVHQWWG  480



>ref|XP_010553127.1| PREDICTED: uncharacterized protein LOC104823307 [Tarenaya hassleriana]
Length=515

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             + WL++ V++ D+VVMK + E  E      +V    ICL+DELFLEC  ++W+    G+
Sbjct  426  FAEWLKSVVRERDFVVMKMDVEGTEFDLIPRLVETGAICLIDELFLECHYNRWQRCCPGQ  485

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + +  + Y QCLEL   LR+ GV VHQWW
Sbjct  486  RSTKYDKTYDQCLELFTSLRQSGVLVHQWW  515



>ref|XP_011048563.1| PREDICTED: uncharacterized protein LOC105142571 [Populus euphratica]
Length=459

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 63/157 (40%), Gaps = 43/157 (27%)
 Frame = -2

Query  564  EKWFHDNYPANNQEFDFYNIDVKVE----------------------------DSEE--T  475
              WF  +YPA++  F+ + +D                                D EE   
Sbjct  310  SSWFLPSYPADHNTFNVFFVDHNTSVLLSCVKRPGVTFIYYPGLAGDEATLDPDLEEFDP  369

Query  474  KTGEESVGLSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECKSQW  310
              G+E      W R TV+ AD+VV+K +A  V       + +   IC +DELFL C  Q 
Sbjct  370  SVGDEGFDFLAWFRETVQYADFVVLKMKAGEVELKFLSSLFKSGAICFIDELFLSCSDQ-  428

Query  309  eegeggeENQRQRAYWQCLELHGRLREEGVAVHQWWS  199
                   + ++ R    C++L   LR  GV VHQWW 
Sbjct  429  -------DGEKGRVKGDCMDLFKSLRNTGVYVHQWWG  458



>ref|XP_004296044.1| PREDICTED: uncharacterized protein LOC101312240 [Fragaria vesca 
subsp. vesca]
Length=504

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = -2

Query  357  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             ICL+DE+F+EC  ++W+    G+ + + +R+Y QCLEL  +LR  GV VHQWW
Sbjct  451  AICLIDEVFMECHYNRWQRCCRGQRSAKFKRSYDQCLELFNKLRAAGVLVHQWW  504



>ref|XP_004302571.1| PREDICTED: uncharacterized protein LOC101290967 [Fragaria vesca 
subsp. vesca]
Length=511

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             + W++NT  + D+VVMK + E  E      +     ICL+DE+FLEC  ++W+    GE
Sbjct  422  FAEWVKNTFTEKDFVVMKMDVEGTEFDLIPRLFETGAICLIDEVFLECHYNRWQRTLPGE  481

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + ++ Y QCL+L   LR+ GV VHQWW
Sbjct  482  RSAKYEKTYGQCLDLFTSLRQSGVLVHQWW  511



>ref|XP_009606484.1| PREDICTED: uncharacterized protein LOC104100844 isoform X1 [Nicotiana 
tomentosiformis]
Length=497

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -2

Query  357  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             ICL+DELFLEC  ++W+    G+ + +  + Y +CLEL   LRE GV VHQWW
Sbjct  442  AICLIDELFLECHYNRWQRCCPGKRSPKYDKTYAECLELFSSLRERGVLVHQWW  495



>ref|XP_008809973.1| PREDICTED: uncharacterized protein LOC103721505 [Phoenix dactylifera]
Length=520

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 53/90 (59%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             + WL+ TV ++D+VVMK + E  E      +     ICL+DELFLEC  ++W+    GE
Sbjct  431  FAKWLKRTVSESDFVVMKMDVEGTEFDLIPRLFETGAICLIDELFLECHYNRWQRCCPGE  490

Query  288  ENQRQR-AYWQCLELHGRLREEGVAVHQWW  202
               + R  Y +CL+L   LR+ GV VHQWW
Sbjct  491  RTPKYRKTYGECLKLFTSLRKSGVLVHQWW  520



>ref|XP_008359661.1| PREDICTED: uncharacterized protein LOC103423371, partial [Malus 
domestica]
Length=248

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 73/194 (38%), Gaps = 53/194 (27%)
 Frame = -2

Query  654  RKMKFLPDLMGDSLQNYPRRVFISDDKNGAE------KWFHDNYPANNQEFDFYNID---  502
            ++  +LP+ +  S +   RR+   D    A        WF  +YP   ++F+ Y +D   
Sbjct  54   KRFAYLPNFVDVSSK---RRLVYIDIGAAAHLNANVTNWFLPSYPIERKDFNVYFVDHNT  110

Query  501  ----------------------------VKVEDSEETKTGEESVGLSNWLRNTVKDADYv  406
                                        V ++   +   G+E      W + TV  AD+V
Sbjct  111  SVLLSYVKKPGITFVYHPGLAGIKPQVNVPIDGITDPYVGDEGFDFLVWFKETVGFADFV  170

Query  405  vmkaeaevv-----eemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHG  241
            V+K  A  V      E+     IC VDELFL C  Q         +        C+++ G
Sbjct  171  VLKMNAGNVELKFLTELFESGAICFVDELFLHCSGQ--------VDAGGEMPVDCMDIFG  222

Query  240  RLREEGVAVHQWWS  199
             LR  GV VHQWW 
Sbjct  223  SLRSSGVFVHQWWG  236



>gb|KEH42250.1| peptide upstream ORF protein, putative [Medicago truncatula]
Length=477

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 85/204 (42%), Gaps = 53/204 (26%)
 Frame = -2

Query  696  LLEPPRKALAKSS--MRKMKFLPDLMGDSLQNYPRRVFISDDKNGAEKWFHDNYPANNQE  523
            L+EPP   LAK +    K  +LP    D   +    V+++  ++    WF  +YP + ++
Sbjct  279  LIEPP---LAKETPYQEKTTYLPKF-KDVSSSKKNLVYVNIVEDEVGDWFPQSYPIHKKD  334

Query  522  FDFYNI------------------------------DVKVEDSEETKTGEESVGLSNWLR  433
            F+ Y +                              + KV   E     +E   L  W +
Sbjct  335  FNVYFVHYNTSIMLSHVKGPRVTFVYHPELNENFKDEAKVNVGEADVKEDEEFDLVAWFK  394

Query  432  NTVKDADYvvmkaeaevveemvreR------TICLVDELFLECKSQWeegeggeENQRQR  271
             TV++AD+V++K       EM           IC VDELFL C          E+ +R+R
Sbjct  395  ETVENADFVMVKMNIAGKVEMKFLSEIYKNGVICFVDELFLSCSES-------EDGERER  447

Query  270  AYWQCLELHGRLREEGVAVHQWWS  199
                C++++  LR  GV VHQWW+
Sbjct  448  ----CMDIYKGLRSNGVFVHQWWN  467



>ref|XP_003623416.1| hypothetical protein MTR_7g070530 [Medicago truncatula]
 gb|AES79634.1| methyltransferase domain protein [Medicago truncatula]
Length=509

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevvee-----mvreRTICLVDELFLECK-SQWeegegge  289
             +NWL+ TV   D+VVMK + E  E      + +   ICL+DE+FLEC  ++W+    G+
Sbjct  420  FANWLKKTVSKNDFVVMKMDVEGTEFDLIPRLFKTGAICLIDEIFLECHYNRWQRCCPGQ  479

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + ++ Y QCLEL   LR+ G+ VHQW+
Sbjct  480  RSSKYEKTYDQCLELFNSLRQSGILVHQWF  509



>tpg|DAA41831.1| TPA: hypothetical protein ZEAMMB73_867074 [Zea mays]
Length=704

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 93/237 (39%), Gaps = 66/237 (28%)
 Frame = -2

Query  717  LKHLEDALLEPPRKA--LAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGAE--KWFH  550
            L H E  + E P K     K +M  +K+LP L   S +     V +     G+    WF 
Sbjct  256  LAHAEPLIQEEPLKPWLTLKRNMNNIKYLPALADISFKRRYVYVDVGAHSYGSSIGSWFR  315

Query  549  DNYPANNQEFDFYNID-----------------------VKVED-----------SEETK  472
             +YP  N  F  + I+                       VK E             +E K
Sbjct  316  KHYPKQNHTFQVFAIEADPAFHSEYATKKGVTLLPYAAWVKNETLVFEINGDPGKEDEAK  375

Query  471  TGEESVG---------------------LSNWLRNTVKDADYvvmkaeaevveemvr---  364
                 +G                     L+ WL+ TV + DY+VMK + E  E  +    
Sbjct  376  ANGRGMGRIRPTTGKKMSGEVRSVPAFDLAEWLKQTVTEQDYLVMKMDVEGTEFDLIPRL  435

Query  363  --eRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQW  205
                 ICLVDELFLEC  ++W++   GE + +    Y +CL+L   LRE GV VHQW
Sbjct  436  FDTGAICLVDELFLECHYNRWQKCCPGERSPKYDNTYEECLDLFSSLRENGVLVHQW  492



>ref|XP_008387644.1| PREDICTED: uncharacterized protein LOC103450101 [Malus domestica]
Length=491

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 73/194 (38%), Gaps = 53/194 (27%)
 Frame = -2

Query  654  RKMKFLPDLMGDSLQNYPRRVFISDDKNGAE------KWFHDNYPANNQEFDFYNID---  502
            ++  +LP+ +  S +   RR+   D    A        WF  +YP   ++F+ Y +D   
Sbjct  297  KRFAYLPNFVDVSSK---RRLVYIDIGAAAHLNANVTNWFLPSYPIERKDFNVYFVDHNT  353

Query  501  ----------------------------VKVEDSEETKTGEESVGLSNWLRNTVKDADYv  406
                                        V ++   +   G+E      W + TV  AD+V
Sbjct  354  SVLLSYVKKPGITFVYHPGLAGIKPQVNVPIDGITDPYVGDEGFDFLVWFKETVGFADFV  413

Query  405  vmkaeaevv-----eemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHG  241
            V+K  A  V      E+     IC VDELFL C  Q         +        C+++ G
Sbjct  414  VLKMNAGNVELKFLTELFESGAICFVDELFLHCSGQ--------VDAGGEMPVDCMDIFG  465

Query  240  RLREEGVAVHQWWS  199
             LR  GV VHQWW 
Sbjct  466  SLRSSGVFVHQWWG  479



>ref|XP_008366676.1| PREDICTED: uncharacterized protein LOC103430317 [Malus domestica]
Length=491

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 73/194 (38%), Gaps = 53/194 (27%)
 Frame = -2

Query  654  RKMKFLPDLMGDSLQNYPRRVFISDDKNGAE------KWFHDNYPANNQEFDFYNID---  502
            ++  +LP+ +  S +   RR+   D    A        WF  +YP   ++F+ Y +D   
Sbjct  297  KRFAYLPNFVDVSSK---RRLVYIDIGAAAHLNANVTNWFLPSYPIERKDFNVYFVDHNT  353

Query  501  ----------------------------VKVEDSEETKTGEESVGLSNWLRNTVKDADYv  406
                                        V ++   +   G+E      W + TV  AD+V
Sbjct  354  SVLLSYVKKPGITFVYHPGLAGIKPQVNVPIDGITDPYVGDEGFDFLVWFKETVGFADFV  413

Query  405  vmkaeaevv-----eemvreRTICLVDELFLECKSQWeegeggeENQRQRAYWQCLELHG  241
            V+K  A  V      E+     IC VDELFL C  Q         +        C+++ G
Sbjct  414  VLKMNAGNVELKFLTELFESGAICFVDELFLHCSGQ--------VDAGGEMPVDCMDIFG  465

Query  240  RLREEGVAVHQWWS  199
             LR  GV VHQWW 
Sbjct  466  SLRSSGVFVHQWWG  479



>ref|XP_003516409.1| PREDICTED: uncharacterized protein LOC100811015 [Glycine max]
Length=488

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             + WL+NTV + D+VVMK + E  E      +     ICLVDE+FLEC  ++W+    G+
Sbjct  399  FAEWLKNTVSENDFVVMKMDVEGTEFDLIPRLFETGAICLVDEIFLECHYNRWQRCCPGQ  458

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + ++ Y QCL+L   LR+ GV VHQW+
Sbjct  459  RSPKYEKTYDQCLQLFTSLRQSGVLVHQWF  488



>gb|KHN44850.1| hypothetical protein glysoja_024421, partial [Glycine soja]
Length=390

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             + WL+NTV + D+VVMK + E  E      +     ICLVDE+FLEC  ++W+    G+
Sbjct  301  FAEWLKNTVSENDFVVMKMDVEGTEFDLIPRLFETGAICLVDEIFLECHYNRWQRCCPGQ  360

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + ++ Y QCL+L   LR+ GV VHQW+
Sbjct  361  RSPKYEKTYDQCLQLFTSLRQSGVLVHQWF  390



>ref|XP_008243928.1| PREDICTED: uncharacterized protein LOC103342124 [Prunus mume]
Length=487

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 78/206 (38%), Gaps = 51/206 (25%)
 Frame = -2

Query  693  LEPPRKALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDK-----NGAEKWFHDNYPANN  529
            +EP  K       +K  +LP+ +  S +N  R V++         + A  WF  +YP   
Sbjct  284  MEPLVKEKPVDYGKKFNYLPNFVDLSSKN--RLVYVDIGAAEHLNSNATNWFLPSYPVER  341

Query  528  QEFDFYNID-------------------------------VKVEDSEETKTGEESVGLSN  442
            + F  Y +D                               V  +   E   G+E      
Sbjct  342  KSFHTYFVDHNTSVLLSYVKKPGITFVYHPGLAGIKAQVNVTTDGETEPYVGDEGFDFHA  401

Query  441  WLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECKSQWeegeggeENQR  277
            W + TV+ AD+VV+K  A  V      E+     IC VDELFL C S  + G     +  
Sbjct  402  WFKETVQFADFVVLKMNAGNVELKFLAELFESGAICFVDELFLHCSSSVDAGGAMPVD--  459

Query  276  QRAYWQCLELHGRLREEGVAVHQWWS  199
                  C+++   LR  GV VHQWW 
Sbjct  460  ------CMDIFRSLRSSGVFVHQWWG  479



>gb|KHN33252.1| hypothetical protein glysoja_027939 [Glycine soja]
Length=293

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 56/90 (62%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             ++WL+NTV + D+VVMK + E  E      +     ICLVDE+FLEC  ++W+    G+
Sbjct  204  FADWLKNTVSENDFVVMKMDVEGTEFDLIPRLFETGAICLVDEIFLECHYNRWQRCCPGQ  263

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + ++ Y QCL+L   LR+ GV VHQW+
Sbjct  264  RSPKYEKTYDQCLQLFTSLRQSGVLVHQWF  293



>gb|KHN29556.1| hypothetical protein glysoja_005280 [Glycine soja]
Length=278

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 61/247 (25%), Positives = 99/247 (40%), Gaps = 68/247 (28%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRK--ALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGA  565
            P  K   +K  E  + E P K     K ++R +K+LP +   S +N    V +     G+
Sbjct  32   PGYKHDLVKIAEPLIEEEPLKPWITLKRNVRNIKYLPSMADISFKNRYVYVDVGARSYGS  91

Query  564  E--KWFHDNYPANNQEFDFY----------------------------------------  511
                WF   YP  N+ +  Y                                        
Sbjct  92   SIGSWFRKQYPKQNKTYHVYAIEADKTFHQGYGLKKGITLVPYAAWVKNETLMFEIHRNP  151

Query  510  --NIDVKVEDSEETKTGEESVG---------------LSNWLRNTVKDADYvvmkaeaev  382
              +++VK       +  + S+G                +NWL+  V   D+VVMK + E 
Sbjct  152  REHVEVKGRGMGRIQPLQSSLGKGEFDGKVEKIQGFDFANWLKKMVSKNDFVVMKMDVEG  211

Query  381  ve-----emvreRTICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEG  223
             E      +++   ICL+DE+FLEC  ++W+    G+ + + ++ Y QCL+L   LR+ G
Sbjct  212  TEFDLIPRLIKTGAICLIDEIFLECHYNRWQRCCPGQRSSKYEKTYDQCLQLFNSLRQSG  271

Query  222  VAVHQWW  202
            V VHQW+
Sbjct  272  VLVHQWF  278



>ref|XP_007140185.1| hypothetical protein PHAVU_008G091100g [Phaseolus vulgaris]
 gb|ESW12179.1| hypothetical protein PHAVU_008G091100g [Phaseolus vulgaris]
Length=508

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevvee-----mvreRTICLVDELFLECK-SQWeegegge  289
             + WL+ TV   D+VVMK + E  E      + +   ICL+DE+FLEC  ++W+    G+
Sbjct  419  FAEWLKKTVTKNDFVVMKMDVEGTEFDLIPRLFKTGAICLIDEIFLECHYNRWQRCCPGQ  478

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + ++ Y QCL+L   LR+ GV VHQWW
Sbjct  479  RSSKYEKTYDQCLQLFNSLRQSGVLVHQWW  508



>ref|XP_007134628.1| hypothetical protein PHAVU_010G062900g [Phaseolus vulgaris]
 gb|ESW06622.1| hypothetical protein PHAVU_010G062900g [Phaseolus vulgaris]
Length=505

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             ++WL+NTV   D+VVMK + E  E      +     ICLVDE+FLEC  ++W+    G+
Sbjct  416  FADWLKNTVSKNDFVVMKMDVEGTEFDLIPRLFETGAICLVDEIFLECHYNRWQRCCPGQ  475

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + ++ Y QCL+L   LR+ GV VHQW+
Sbjct  476  RSPKYEKTYDQCLQLFTSLRQSGVLVHQWF  505



>ref|XP_007145226.1| hypothetical protein PHAVU_007G221200g [Phaseolus vulgaris]
 gb|ESW17220.1| hypothetical protein PHAVU_007G221200g [Phaseolus vulgaris]
Length=482

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 94/205 (46%), Gaps = 47/205 (23%)
 Frame = -2

Query  696  LLEPPRKALAKSSM---RKMKFLPDLMGDSLQNYPRRVFIS----DDKNG---AEKWFHD  547
            L+EP  +  A+  +   R + +LP+L+   +    R V+I     D  N       WF  
Sbjct  271  LMEPLVEERARQDVKYERSVSYLPNLV--DVSGRKRMVYIDIGVRDLVNADVDVSDWFPP  328

Query  546  NYPANNQEFDFY----NIDV-------------------KVEDSEETK--TGEESVGLSN  442
            +YP + + F  Y    N+ V                   +V D+ +     GEE      
Sbjct  329  SYPIHLKAFSVYFVHYNVSVLSYVKRPRVTFVYHPGLAGRVADNVDMDPLLGEEEFDFLM  388

Query  441  WLRNTVKDADYvvmkae-----aevveemvreRTICLVDELFLECKSQWeegeggeENQR  277
            W + TV++AD+VV+K        + + ++    T+C VDELFL C S+ E+G+    + R
Sbjct  389  WFKETVQNADFVVLKMNVGDVEMKFLADIFESGTLCFVDELFLGC-SESEDGKDEIMSSR  447

Query  276  QRAYWQCLELHGRLREEGVAVHQWW  202
            +    QC++++  LR  GV VHQWW
Sbjct  448  E----QCMDIYKGLRSNGVYVHQWW  468



>ref|XP_004506826.1| PREDICTED: uncharacterized protein LOC101508795 [Cicer arietinum]
Length=511

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevvee-----mvreRTICLVDELFLECK-SQWeegegge  289
             ++WL+NTV   D+VVMK + E  E      +     ICLVDE+FLEC  ++W+    GE
Sbjct  422  FADWLKNTVTMNDFVVMKMDVEGTEFDLIPRLFETGAICLVDEIFLECHYNRWQRCCPGE  481

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + ++ Y QCL+L   LR+ GV VHQW+
Sbjct  482  RSPKYEKTYDQCLQLFNSLRQSGVLVHQWF  511



>gb|AGV54215.1| hypothetical protein [Phaseolus vulgaris]
Length=504

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevvee-----mvreRTICLVDELFLECK-SQWeegegge  289
             + WL+ TV   D+VVMK + E  E      + +   ICL+DE+FLEC  ++W+    G+
Sbjct  415  FAEWLKKTVTKNDFVVMKMDVEGTEFDLIPRLFKTGAICLIDEIFLECHYNRWQRCCPGQ  474

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + ++ Y QCL+L   LR+ GV VHQWW
Sbjct  475  RSSKYEKTYDQCLQLFNSLRQSGVLVHQWW  504



>ref|XP_007017010.1| Methyltransferase [Theobroma cacao]
 gb|EOY34629.1| Methyltransferase [Theobroma cacao]
Length=546

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
            L+ WL+N V + D+VVMK + E  E      ++    ICL+DE+FLEC  ++W+    G+
Sbjct  457  LAEWLKNVVSERDFVVMKMDVEGTEFHLMPRLIETGAICLIDEVFLECHYNRWQRCCPGQ  516

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + Q  Y QC++L   LR  GV VHQWW
Sbjct  517  RSPKYQNTYDQCVDLFDSLRARGVLVHQWW  546



>ref|XP_006360824.1| PREDICTED: uncharacterized protein LOC102590367 [Solanum tuberosum]
Length=510

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -2

Query  357  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             ICL+DE+FLEC  ++W++   GE + +    Y QCL+L   LRE GV VHQWW
Sbjct  457  AICLIDEVFLECHYNRWQKCCPGERSSKYPNTYSQCLDLFTSLRESGVLVHQWW  510



>gb|KFK34589.1| hypothetical protein AALP_AA5G165500 [Arabis alpina]
Length=465

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 55/205 (27%), Positives = 79/205 (39%), Gaps = 57/205 (28%)
 Frame = -2

Query  699  ALLEPPRKALAKSSMRKMKFLPDLMGDSLQNYPRRVFI----SDDKNGAEKWFHDNYPAN  532
             LLEP  +       R++ +LP+ +   L +  R V+I    +D  N    WF  +YP N
Sbjct  277  GLLEPLLEEKRSDFERRIHYLPEFI--DLSSRKRLVYIDIGAADHLNARSNWFLPSYPIN  334

Query  531  NQEFDFYNID-------------------------VKV-----EDSEETKTGEESVGLSN  442
             + F+ Y +                           KV     ED EE    ++S     
Sbjct  335  RKAFNSYFVHHNTSILTSYVKSPGVTFIYHPGLAAAKVTITSPEDQEEQFVEDDSFDFLA  394

Query  441  WLRNTVKDADYvvmkaeae-----vveemvreRTICLVDELFLECKSQWeegeggeENQR  277
            W + T   AD+VV+K          + E+++   IC VDELFL C               
Sbjct  395  WFKETASFADFVVLKMNTSDEELKFLSELMKTGAICSVDELFLHCT--------------  440

Query  276  QRAYWQCLELHGRLREEGVAVHQWW  202
               Y  C  +   LR+ GV VHQWW
Sbjct  441  --GYRDCTGIIKSLRDSGVFVHQWW  463



>ref|XP_009342781.1| PREDICTED: uncharacterized protein LOC103934759 [Pyrus x bretschneideri]
Length=491

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 54/209 (26%), Positives = 78/209 (37%), Gaps = 53/209 (25%)
 Frame = -2

Query  699  ALLEPPRKALAKSSMRKMKFLPDLMGDSLQNYPRRVFISDDKNGAE------KWFHDNYP  538
             ++EP  K       ++  +LP+ +  S +   RR+   D    A        WF  +YP
Sbjct  282  GIMEPLVKEKPVEYGKRFAYLPNFVDVSSK---RRLVYIDIGAAAHLNANVTNWFLPSYP  338

Query  537  ANNQEFDFYNID-----------------------------VKVEDSEETK--TGEESVG  451
               ++F+ Y +D                             V V +   T    G+E   
Sbjct  339  IERKDFNVYFVDHNTSVLLSYVKKPGITFVYHPGLAGINPQVNVPNDGITDPYVGDEGFD  398

Query  450  LSNWLRNTVKDADYvvmkaeaevv-----eemvreRTICLVDELFLECKSQWeegeggeE  286
               W + TV  AD+VV+K  A  V      E+     IC VDELFL C  Q         
Sbjct  399  FLVWFKETVGFADFVVLKMNAGNVELKFLTELFESGAICFVDELFLHCSGQ--------V  450

Query  285  NQRQRAYWQCLELHGRLREEGVAVHQWWS  199
            +        C+++ G LR  GV VHQWW 
Sbjct  451  DAGGEMPVDCMDIFGSLRSSGVFVHQWWG  479



>ref|XP_011076494.1| PREDICTED: uncharacterized protein LOC105160713 [Sesamum indicum]
Length=302

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 63/247 (26%), Positives = 100/247 (40%), Gaps = 71/247 (29%)
 Frame = -2

Query  738  PETKKAALKHLEDALLEPPRK---ALAKSSMRKMKFLPDLMGDSLQNYPRRVFIS----D  580
            PE ++  +  LE  + E P +    L K   + +K+LP ++   L    R ++I     D
Sbjct  59   PEYRRKLIPQLEPLISEEPLEIWEGLGKQE-KNVKYLPSMV--DLSTNSRFIYIDLGARD  115

Query  579  DKNGAEKWFHDNYPANNQEFDFYNIDV-----KVEDSEETKT------------------  469
              +    WF   YP  N+ F+ Y ++      K  +S E  T                  
Sbjct  116  YDSSIGSWFLKQYPKQNKTFEIYAVEADKAFHKQYESREGVTLLPYAAWVKNETVVFGSK  175

Query  468  --------------------GEESVGLS-----------NWLRNTVKDADYvvmkaeaev  382
                                  E+ GLS           +WL+ TV++ D+VV+K + E 
Sbjct  176  PIIVKDKVWRMRPFGRIEGQTAEADGLSAVTRVPAFDFVDWLKRTVRERDFVVVKMDIEG  235

Query  381  veemvreRTI-----CLVDELFLECK--SQWeegeggeENQRQRAYWQCLELHGRLREEG  223
             E  + +  +     CL+DELF+EC      +   G   N+   +Y QC +L  +LR +G
Sbjct  236  TEIRLVKELVERGAMCLIDELFMECHFDRYVKCCSGERINRFNYSYAQCYDLFLQLRNKG  295

Query  222  VAVHQWW  202
             AVHQWW
Sbjct  296  CAVHQWW  302



>emb|CDY04832.1| BnaAnng00140D [Brassica napus]
Length=881

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 63/108 (58%), Gaps = 11/108 (10%)
 Frame = -2

Query  495  VEDSEETKTGE----ESVGLSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLV  343
            V+ S  +  GE    +    ++WL+ +V + D+VVMK + E  E      +++   ICL+
Sbjct  415  VKKSSSSLAGEVNLIQGFDFADWLKKSVIERDFVVMKMDVEGTEFDLIPRLIKTGAICLI  474

Query  342  DELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQW  205
            DELFLEC  ++W+    G+ +Q+  + Y QCL+L   LR+ GV VHQW
Sbjct  475  DELFLECHYNRWQRCCPGQRSQKYNKTYNQCLQLFTSLRQSGVLVHQW  522



>ref|XP_003537325.1| PREDICTED: uncharacterized protein LOC100788611 [Glycine max]
Length=493

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -2

Query  357  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             ICL+DELFLEC  ++W+    G+ + +  + Y QCL+L   LR  GV VHQWW
Sbjct  440  AICLIDELFLECHYNRWQRCCPGQRSAKYHKTYSQCLDLFTSLRNYGVLVHQWW  493



>ref|XP_006376546.1| hypothetical protein POPTR_0013s14950g [Populus trichocarpa]
 gb|ERP54343.1| hypothetical protein POPTR_0013s14950g [Populus trichocarpa]
Length=471

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -2

Query  357  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             ICL+DELFLEC  ++W+    G+   + Q+ Y QCL+L   LR+ GV VHQWW
Sbjct  418  AICLIDELFLECHYNRWQRCCPGQRGVKYQKTYDQCLQLLNSLRKIGVLVHQWW  471



>ref|XP_010683597.1| PREDICTED: uncharacterized protein LOC104898243 [Beta vulgaris 
subsp. vulgaris]
Length=526

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 52/90 (58%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevve-----emvreRTICLVDELFLECK-SQWeegegge  289
             + WL+ TV + D+VVMK + E  E      +     ICL+DE+FLEC  ++W+    GE
Sbjct  437  FAQWLKETVTERDFVVMKMDVEGTEFDLIPRLFETGAICLIDEIFLECHYNRWQRCCPGE  496

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + ++ Y QCL L   LR  GV VHQWW
Sbjct  497  RSAKYEKTYDQCLNLFTSLRARGVLVHQWW  526



>gb|KHN22782.1| hypothetical protein glysoja_026750, partial [Glycine soja]
Length=328

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -2

Query  357  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             ICL+DELFLEC  ++W+    G+ + +  + Y QCL+L   LR  GV VHQWW
Sbjct  275  AICLIDELFLECHYNRWQRCCPGQRSAKYHKTYSQCLDLFTSLRNYGVLVHQWW  328



>gb|KJB78695.1| hypothetical protein B456_013G013000 [Gossypium raimondii]
Length=489

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -2

Query  357  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             ICL+DE+FLEC  ++W+    G+ + + ++ Y  CLEL   LR+ GV VHQWW
Sbjct  436  AICLIDEIFLECHYNRWQRCCPGQRSTKYKKHYRHCLELFTSLRKNGVLVHQWW  489



>ref|XP_010099438.1| hypothetical protein L484_011136 [Morus notabilis]
 gb|EXB78513.1| hypothetical protein L484_011136 [Morus notabilis]
Length=502

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 52/92 (57%), Gaps = 11/92 (12%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevveemvreRTI-----CLVDELFLECKSQWeegeggeE  286
             ++WL+ TV  +D+VV+K + E  E  +  R I     CLVDELFLEC   +   +    
Sbjct  413  FADWLKKTVSRSDFVVVKMDVEGTEFHLIPRLIKTGAMCLVDELFLEC--HYNRMQRCCP  470

Query  285  NQR----QRAYWQCLELHGRLREEGVAVHQWW  202
             +R    ++ Y QCL+L   +RE GV VHQWW
Sbjct  471  GERSVKYEKTYDQCLDLLKLIRESGVLVHQWW  502



>ref|XP_009606489.1| PREDICTED: uncharacterized protein LOC104100844 isoform X2 [Nicotiana 
tomentosiformis]
Length=494

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = -2

Query  357  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQW  205
             ICL+DELFLEC  ++W+    G+ + +  + Y +CLEL   LRE GV VHQW
Sbjct  442  AICLIDELFLECHYNRWQRCCPGKRSPKYDKTYAECLELFSSLRERGVLVHQW  494



>ref|XP_010686186.1| PREDICTED: uncharacterized protein LOC104900468 [Beta vulgaris 
subsp. vulgaris]
Length=484

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -2

Query  357  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             +CL+DE+FLEC  ++W++   G  + +  + Y QCL L   LRE GV VHQWW
Sbjct  431  ALCLIDEIFLECHYNRWQKCCPGVRSPKYDKTYDQCLNLLSSLRERGVVVHQWW  484



>gb|KHN41361.1| hypothetical protein glysoja_047806 [Glycine soja]
Length=201

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 56/90 (62%), Gaps = 7/90 (8%)
 Frame = -2

Query  450  LSNWLRNTVKDADYvvmkaeaevvee-----mvreRTICLVDELFLECK-SQWeegegge  289
             +NWL+ TV   D+VVMK + E  E      +++   ICL+D++FLEC  ++W+    G+
Sbjct  112  FANWLKKTVSKNDFVVMKMDVEGTEFDLIPRLIKTGAICLIDDIFLECHYNRWQRCCPGQ  171

Query  288  ENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             + + ++ Y QCL+L   LR+ GV VHQW+
Sbjct  172  RSAKYEKTYDQCLQLFKSLRQSGVLVHQWF  201



>gb|KEH28818.1| methyltransferase domain protein [Medicago truncatula]
Length=509

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -2

Query  357  TICLVDELFLECK-SQWeegeggeENQR-QRAYWQCLELHGRLREEGVAVHQWW  202
             ICLVDE+FLEC  ++W+    G+ + + ++ Y QCL+L   LR+ GV VHQW+
Sbjct  456  AICLVDEIFLECHYNRWQRCCPGQRSPKYEKTYDQCLQLFNSLRQSGVLVHQWF  509



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1354032766515