BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF033G18

Length=562
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009610364.1|  PREDICTED: uncharacterized protein LOC104104077    265   3e-86   Nicotiana tomentosiformis
ref|XP_009795967.1|  PREDICTED: uncharacterized protein LOC104242589    262   5e-85   Nicotiana sylvestris
emb|CDP10783.1|  unnamed protein product                                238   2e-75   Coffea canephora [robusta coffee]
ref|XP_004251523.1|  PREDICTED: uncharacterized protein LOC101250189    236   8e-75   Solanum lycopersicum
ref|XP_006351969.1|  PREDICTED: B-cell receptor-associated protei...    235   1e-74   Solanum tuberosum [potatoes]
ref|XP_010549208.1|  PREDICTED: B-cell receptor-associated protei...    231   5e-73   Tarenaya hassleriana [spider flower]
gb|KHN41234.1|  hypothetical protein glysoja_017278                     226   4e-71   Glycine soja [wild soybean]
ref|NP_001239654.1|  uncharacterized protein LOC100798727               226   5e-71   Glycine max [soybeans]
ref|XP_003605958.1|  hypothetical protein MTR_4g049540                  225   1e-70   Medicago truncatula
ref|XP_010252455.1|  PREDICTED: uncharacterized protein LOC104594039    225   1e-70   Nelumbo nucifera [Indian lotus]
gb|AFK33681.1|  unknown                                                 224   2e-70   Medicago truncatula
ref|XP_010244479.1|  PREDICTED: B-cell receptor-associated protei...    224   3e-70   Nelumbo nucifera [Indian lotus]
gb|ACJ84514.1|  unknown                                                 223   9e-70   Medicago truncatula
ref|XP_003539858.1|  PREDICTED: B-cell receptor-associated protei...    221   4e-69   
ref|XP_004506274.1|  PREDICTED: B-cell receptor-associated protei...    221   4e-69   Cicer arietinum [garbanzo]
ref|XP_010689493.1|  PREDICTED: B-cell receptor-associated protei...    221   4e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006403381.1|  hypothetical protein EUTSA_v10003268mg             221   5e-69   Eutrema salsugineum [saltwater cress]
gb|KHN21219.1|  hypothetical protein glysoja_006698                     221   5e-69   Glycine soja [wild soybean]
ref|XP_002270301.1|  PREDICTED: B-cell receptor-associated protei...    220   8e-69   Vitis vinifera
ref|XP_009123682.1|  PREDICTED: uncharacterized protein LOC103848551    217   1e-67   Brassica rapa
gb|AAM62748.1|  unknown                                                 216   3e-67   Arabidopsis thaliana [mouse-ear cress]
emb|CBI23212.3|  unnamed protein product                                216   7e-67   Vitis vinifera
ref|NP_568607.1|  B-cell receptor-associated 31-like protein            215   8e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006281077.1|  hypothetical protein CARUB_v10027105mg             215   1e-66   Capsella rubella
ref|XP_002262807.2|  PREDICTED: B-cell receptor-associated protei...    216   1e-66   
ref|XP_002863762.1|  hypothetical protein ARALYDRAFT_494776             215   1e-66   Arabidopsis lyrata subsp. lyrata
dbj|BAB09328.1|  unnamed protein product                                216   2e-66   Arabidopsis thaliana [mouse-ear cress]
gb|KFK32917.1|  hypothetical protein AALP_AA6G305900                    214   3e-66   Arabis alpina [alpine rockcress]
ref|XP_007132530.1|  hypothetical protein PHAVU_011G102200g             213   3e-66   Phaseolus vulgaris [French bean]
ref|XP_010494193.1|  PREDICTED: B-cell receptor-associated protei...    214   4e-66   Camelina sativa [gold-of-pleasure]
ref|XP_006447584.1|  hypothetical protein CICLE_v10016648mg             213   5e-66   Citrus clementina [clementine]
emb|CDY68895.1|  BnaCnng60970D                                          213   6e-66   Brassica napus [oilseed rape]
ref|XP_010481979.1|  PREDICTED: B-cell receptor-associated protei...    211   5e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010442176.1|  PREDICTED: B-cell receptor-associated protei...    209   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_009587048.1|  PREDICTED: B-cell receptor-associated protei...    209   2e-64   Nicotiana tomentosiformis
ref|XP_003540294.1|  PREDICTED: B-cell receptor-associated protei...    209   4e-64   Glycine max [soybeans]
gb|ACU19065.1|  unknown                                                 207   5e-64   Glycine max [soybeans]
ref|XP_007149980.1|  hypothetical protein PHAVU_005G115800g             208   5e-64   Phaseolus vulgaris [French bean]
ref|XP_002524828.1|  bcr-associated protein, bap, putative              207   8e-64   
ref|XP_003543392.1|  PREDICTED: B-cell receptor-associated protei...    207   1e-63   Glycine max [soybeans]
ref|XP_006449764.1|  hypothetical protein CICLE_v10016599mg             206   6e-63   
ref|XP_010046363.1|  PREDICTED: B-cell receptor-associated protei...    204   1e-62   Eucalyptus grandis [rose gum]
ref|XP_007026129.1|  B-cell receptor-associated 31-like                 203   6e-62   
gb|KDO78297.1|  hypothetical protein CISIN_1g021727mg                   201   5e-61   Citrus sinensis [apfelsine]
ref|XP_006467408.1|  PREDICTED: B-cell receptor-associated protei...    200   7e-61   
ref|XP_007046390.1|  B-cell receptor-associated 31-like                 199   1e-60   Theobroma cacao [chocolate]
ref|XP_009629450.1|  PREDICTED: uncharacterized protein LOC104119606    199   2e-60   Nicotiana tomentosiformis
ref|XP_006467407.1|  PREDICTED: B-cell receptor-associated protei...    200   2e-60   Citrus sinensis [apfelsine]
ref|XP_006383887.1|  hypothetical protein POPTR_0004s00930g             199   2e-60   Populus trichocarpa [western balsam poplar]
gb|KDP20721.1|  hypothetical protein JCGZ_21192                         198   3e-60   Jatropha curcas
gb|KDO78296.1|  hypothetical protein CISIN_1g021727mg                   201   4e-60   Citrus sinensis [apfelsine]
ref|XP_006389583.1|  hypothetical protein POPTR_0021s00340g             198   4e-60   Populus trichocarpa [western balsam poplar]
ref|XP_011096040.1|  PREDICTED: B-cell receptor-associated protei...    198   5e-60   Sesamum indicum [beniseed]
ref|XP_011046959.1|  PREDICTED: B-cell receptor-associated protei...    197   1e-59   Populus euphratica
ref|XP_010099186.1|  B-cell receptor-associated protein 31              196   2e-59   
gb|KJB68573.1|  hypothetical protein B456_010G251300                    196   2e-59   Gossypium raimondii
ref|XP_009797812.1|  PREDICTED: uncharacterized protein LOC104244159    196   3e-59   Nicotiana sylvestris
ref|XP_011008025.1|  PREDICTED: uncharacterized protein LOC105113519    196   3e-59   Populus euphratica
ref|XP_006348141.1|  PREDICTED: B-cell receptor-associated protei...    195   5e-59   Solanum tuberosum [potatoes]
gb|AFK47348.1|  unknown                                                 195   5e-59   Lotus japonicus
ref|XP_004233786.1|  PREDICTED: uncharacterized protein LOC101255462    194   1e-58   Solanum lycopersicum
ref|XP_004231615.1|  PREDICTED: B-cell receptor-associated protei...    194   2e-58   Solanum lycopersicum
ref|XP_003534595.1|  PREDICTED: B-cell receptor-associated protei...    194   3e-58   Glycine max [soybeans]
gb|ACU14586.1|  unknown                                                 193   5e-58   Glycine max [soybeans]
ref|XP_008440020.1|  PREDICTED: B-cell receptor-associated protei...    192   8e-58   Cucumis melo [Oriental melon]
gb|KEH36901.1|  B-cell receptor-associated-like protein                 192   8e-58   Medicago truncatula
gb|KHG15358.1|  B-cell receptor-associated 31                           192   1e-57   Gossypium arboreum [tree cotton]
gb|AFK46642.1|  unknown                                                 192   2e-57   Medicago truncatula
ref|XP_004151895.1|  PREDICTED: uncharacterized protein LOC101218101    191   2e-57   Cucumis sativus [cucumbers]
gb|KFK40615.1|  hypothetical protein AALP_AA2G019200                    191   4e-57   Arabis alpina [alpine rockcress]
gb|KHG10853.1|  B-cell receptor-associated 31                           190   5e-57   Gossypium arboreum [tree cotton]
ref|XP_004158560.1|  PREDICTED: uncharacterized LOC101218101            190   6e-57   
ref|NP_001236308.1|  uncharacterized protein LOC100526943               189   1e-56   Glycine max [soybeans]
ref|XP_004486174.1|  PREDICTED: B-cell receptor-associated protei...    189   1e-56   
gb|KJB69262.1|  hypothetical protein B456_011G013000                    189   1e-56   Gossypium raimondii
ref|XP_006350475.1|  PREDICTED: B-cell receptor-associated protei...    188   3e-56   Solanum tuberosum [potatoes]
ref|XP_004134773.1|  PREDICTED: uncharacterized protein LOC101221743    187   1e-55   Cucumis sativus [cucumbers]
ref|XP_008224696.1|  PREDICTED: B-cell receptor-associated protei...    186   2e-55   Prunus mume [ume]
ref|XP_002518447.1|  bcr-associated protein, bap, putative              186   2e-55   Ricinus communis
ref|XP_010458605.1|  PREDICTED: uncharacterized protein LOC104739838    185   5e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010493468.1|  PREDICTED: uncharacterized protein LOC104770706    185   8e-55   Camelina sativa [gold-of-pleasure]
ref|XP_007212007.1|  hypothetical protein PRUPE_ppa011145mg             185   8e-55   Prunus persica
gb|EYU27763.1|  hypothetical protein MIMGU_mgv1a012919mg                185   1e-54   Erythranthe guttata [common monkey flower]
gb|KFK35240.1|  hypothetical protein AALP_AA5G258500                    184   1e-54   Arabis alpina [alpine rockcress]
ref|XP_008784370.1|  PREDICTED: B-cell receptor-associated protei...    183   3e-54   Phoenix dactylifera
ref|XP_010476134.1|  PREDICTED: uncharacterized protein LOC104755448    183   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_008229967.1|  PREDICTED: B-cell receptor-associated protei...    183   3e-54   Prunus mume [ume]
ref|XP_007215939.1|  hypothetical protein PRUPE_ppa011161mg             182   5e-54   Prunus persica
emb|CDP04423.1|  unnamed protein product                                182   6e-54   Coffea canephora [robusta coffee]
ref|XP_003596956.1|  hypothetical protein MTR_2g088060                  182   8e-54   Medicago truncatula
ref|XP_008342021.1|  PREDICTED: B-cell receptor-associated protei...    181   1e-53   
ref|XP_002889902.1|  hypothetical protein ARALYDRAFT_334480             181   2e-53   
ref|NP_849648.4|  B-cell receptor-associated protein 31-like protein    181   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008348138.1|  PREDICTED: B-cell receptor-associated protei...    181   3e-53   
ref|XP_009353295.1|  PREDICTED: B-cell receptor-associated protei...    180   4e-53   Pyrus x bretschneideri [bai li]
ref|XP_006417293.1|  hypothetical protein EUTSA_v10008726mg             180   4e-53   Eutrema salsugineum [saltwater cress]
ref|XP_004293309.1|  PREDICTED: B-cell receptor-associated protei...    179   1e-52   Fragaria vesca subsp. vesca
ref|XP_010686812.1|  PREDICTED: B-cell receptor-associated protei...    179   1e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009347127.1|  PREDICTED: B-cell receptor-associated protei...    179   2e-52   Pyrus x bretschneideri [bai li]
emb|CDY34821.1|  BnaA09g47470D                                          178   3e-52   Brassica napus [oilseed rape]
ref|XP_009118164.1|  PREDICTED: uncharacterized protein LOC103843216    176   1e-51   Brassica rapa
ref|XP_009419329.1|  PREDICTED: B-cell receptor-associated protei...    176   1e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN44866.1|  hypothetical protein glysoja_040795                     175   5e-51   Glycine soja [wild soybean]
ref|XP_009403539.1|  PREDICTED: uncharacterized protein LOC103987073    174   1e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008780367.1|  PREDICTED: uncharacterized protein LOC103700158    174   1e-50   Phoenix dactylifera
ref|XP_007147709.1|  hypothetical protein PHAVU_006G148100g             172   1e-49   Phaseolus vulgaris [French bean]
ref|XP_010533802.1|  PREDICTED: uncharacterized protein LOC104809492    171   1e-49   Tarenaya hassleriana [spider flower]
ref|XP_010546686.1|  PREDICTED: uncharacterized protein LOC104818690    170   5e-49   Tarenaya hassleriana [spider flower]
ref|XP_011047243.1|  PREDICTED: B-cell receptor-associated protei...    169   1e-48   Populus euphratica
ref|XP_002320470.1|  hypothetical protein POPTR_0014s15290g             168   2e-48   Populus trichocarpa [western balsam poplar]
ref|XP_009390004.1|  PREDICTED: B-cell receptor-associated protei...    168   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008649481.1|  PREDICTED: uncharacterized protein LOC103630179    167   3e-48   Zea mays [maize]
ref|XP_010926189.1|  PREDICTED: uncharacterized protein LOC105048548    167   4e-48   Elaeis guineensis
ref|XP_006303826.1|  hypothetical protein CARUB_v10012392mg             167   6e-48   Capsella rubella
ref|XP_010089483.1|  hypothetical protein L484_011937                   167   2e-47   
ref|NP_001055067.1|  Os05g0272900                                       166   2e-47   
ref|XP_010916117.1|  PREDICTED: uncharacterized protein LOC105041025    164   6e-47   
emb|CDY34616.1|  BnaC08g41750D                                          164   1e-46   Brassica napus [oilseed rape]
ref|XP_006654198.1|  PREDICTED: B-cell receptor-associated protei...    162   3e-46   Oryza brachyantha
gb|KHN36526.1|  ATP-dependent helicase rhp16                            172   7e-46   Glycine soja [wild soybean]
gb|EMT11422.1|  hypothetical protein F775_31561                         161   9e-46   
ref|XP_008384089.1|  PREDICTED: B-cell receptor-associated protei...    161   1e-45   
dbj|BAK02060.1|  predicted protein                                      160   2e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001046689.1|  Os02g0321800                                       159   5e-45   
ref|XP_009357471.1|  PREDICTED: uncharacterized protein LOC103948199    159   1e-44   Pyrus x bretschneideri [bai li]
ref|XP_006647215.1|  PREDICTED: B-cell receptor-associated protei...    158   1e-44   Oryza brachyantha
ref|XP_010234160.1|  PREDICTED: uncharacterized protein LOC100839925    158   2e-44   Brachypodium distachyon [annual false brome]
ref|XP_010057913.1|  PREDICTED: B-cell receptor-associated protei...    157   3e-44   Eucalyptus grandis [rose gum]
gb|EAY85610.1|  hypothetical protein OsI_06982                          157   3e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_011086195.1|  PREDICTED: B-cell receptor-associated protei...    157   4e-44   Sesamum indicum [beniseed]
ref|XP_004287957.1|  PREDICTED: B-cell receptor-associated protei...    156   6e-44   Fragaria vesca subsp. vesca
ref|XP_003580219.1|  PREDICTED: B-cell receptor-associated protei...    156   1e-43   Brachypodium distachyon [annual false brome]
ref|XP_009358864.1|  PREDICTED: B-cell receptor-associated protei...    156   1e-43   Pyrus x bretschneideri [bai li]
ref|NP_001170289.1|  LOC100384252                                       155   3e-43   Zea mays [maize]
ref|NP_001154328.1|  B-cell receptor-associated protein 31-like p...    154   8e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008371075.1|  PREDICTED: B-cell receptor-associated protei...    154   9e-43   
ref|XP_004952370.1|  PREDICTED: B-cell receptor-associated protei...    152   3e-42   Setaria italica
gb|KHG00718.1|  separin                                                 150   3e-42   Gossypium arboreum [tree cotton]
gb|AAC17626.1|  Contains similarity to BAP31 protein gb|X81816 fr...    149   4e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006847259.1|  hypothetical protein AMTR_s00015p00062110          149   4e-41   
dbj|BAJ86435.1|  predicted protein                                      149   5e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003563854.1|  PREDICTED: B-cell receptor-associated protei...    143   9e-39   Brachypodium distachyon [annual false brome]
ref|NP_001057612.2|  Os06g0367500                                       140   9e-38   
gb|ADE75913.1|  unknown                                                 137   2e-36   Picea sitchensis
ref|XP_002453641.1|  hypothetical protein SORBIDRAFT_04g009770          137   3e-36   Sorghum bicolor [broomcorn]
dbj|BAJ87002.1|  predicted protein                                      134   2e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009802750.1|  PREDICTED: uncharacterized protein LOC104248228    132   2e-35   Nicotiana sylvestris
ref|XP_009599718.1|  PREDICTED: uncharacterized protein LOC104095323    131   6e-35   Nicotiana tomentosiformis
ref|XP_006365288.1|  PREDICTED: uncharacterized protein LOC102597522    131   8e-35   Solanum tuberosum [potatoes]
ref|XP_004248701.1|  PREDICTED: uncharacterized protein LOC101261860    130   1e-34   Solanum lycopersicum
ref|XP_008380294.1|  PREDICTED: uncharacterized protein LOC103443257    128   1e-33   
ref|XP_008229970.1|  PREDICTED: B-cell receptor-associated protei...    130   2e-33   Prunus mume [ume]
ref|XP_007215894.1|  hypothetical protein PRUPE_ppa010667mg             130   2e-33   Prunus persica
ref|XP_008226862.1|  PREDICTED: uncharacterized protein LOC103326424    126   6e-33   Prunus mume [ume]
ref|XP_010247234.1|  PREDICTED: B-cell receptor-associated protei...    128   8e-33   Nelumbo nucifera [Indian lotus]
ref|XP_008385961.1|  PREDICTED: uncharacterized protein LOC103448478    125   1e-32   
ref|XP_009381320.1|  PREDICTED: B-cell receptor-associated protei...    127   2e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006479253.1|  PREDICTED: B-cell receptor-associated protei...    127   2e-32   Citrus sinensis [apfelsine]
ref|XP_006452411.1|  hypothetical protein CICLE_v10009874mg             124   2e-32   Citrus clementina [clementine]
ref|NP_001051893.1|  Os03g0848400                                       126   3e-32   
ref|XP_009361097.1|  PREDICTED: uncharacterized protein LOC103951454    124   3e-32   Pyrus x bretschneideri [bai li]
ref|XP_006650891.1|  PREDICTED: B-cell receptor-associated protei...    126   3e-32   Oryza brachyantha
gb|KHG09837.1|  hypothetical protein F383_09194                         125   6e-32   Gossypium arboreum [tree cotton]
gb|KDO62065.1|  hypothetical protein CISIN_1g045614mg                   122   1e-31   Citrus sinensis [apfelsine]
gb|EAZ03537.1|  hypothetical protein OsI_25672                          124   2e-31   Oryza sativa Indica Group [Indian rice]
gb|EAY92582.1|  hypothetical protein OsI_14323                          124   3e-31   Oryza sativa Indica Group [Indian rice]
emb|CDP15777.1|  unnamed protein product                                121   3e-31   Coffea canephora [robusta coffee]
gb|EYU27354.1|  hypothetical protein MIMGU_mgv1a015673mg                122   3e-31   Erythranthe guttata [common monkey flower]
ref|XP_010927692.1|  PREDICTED: B-cell receptor-associated protei...    123   3e-31   Elaeis guineensis
ref|XP_006830526.1|  hypothetical protein AMTR_s00117p00045900          123   4e-31   Amborella trichopoda
ref|XP_004987306.1|  PREDICTED: uncharacterized protein LOC101775823    121   5e-31   Setaria italica
gb|ACG43219.1|  B-cell receptor-associated protein 31-like contai...    123   5e-31   Zea mays [maize]
gb|KHN38264.1|  hypothetical protein glysoja_003929                     121   5e-31   Glycine soja [wild soybean]
ref|XP_002463520.1|  hypothetical protein SORBIDRAFT_01g001290          123   5e-31   Sorghum bicolor [broomcorn]
gb|KJB26033.1|  hypothetical protein B456_004G226500                    122   6e-31   Gossypium raimondii
ref|XP_009371858.1|  PREDICTED: B-cell receptor-associated protei...    123   6e-31   Pyrus x bretschneideri [bai li]
ref|XP_008809940.1|  PREDICTED: B-cell receptor-associated protei...    122   6e-31   Phoenix dactylifera
ref|XP_006657620.1|  PREDICTED: B-cell receptor-associated protei...    122   8e-31   Oryza brachyantha
gb|KJB26032.1|  hypothetical protein B456_004G226500                    122   9e-31   Gossypium raimondii
gb|KJB10919.1|  hypothetical protein B456_001G232500                    122   1e-30   Gossypium raimondii
ref|XP_006452412.1|  hypothetical protein CICLE_v10009874mg             119   2e-30   
ref|NP_001141677.1|  uncharacterized protein LOC100273803 precursor     122   2e-30   
ref|XP_010069636.1|  PREDICTED: B-cell receptor-associated protei...    122   2e-30   Eucalyptus grandis [rose gum]
ref|XP_009370674.1|  PREDICTED: B-cell receptor-associated protei...    122   2e-30   Pyrus x bretschneideri [bai li]
gb|KHN11907.1|  hypothetical protein glysoja_019880                     119   2e-30   Glycine soja [wild soybean]
ref|NP_001143481.1|  hypothetical protein                               119   3e-30   Zea mays [maize]
ref|XP_007049723.1|  B-cell receptor-associated protein 31-like         120   4e-30   Theobroma cacao [chocolate]
ref|XP_011095414.1|  PREDICTED: uncharacterized protein LOC105174881    119   5e-30   Sesamum indicum [beniseed]
ref|XP_008372494.1|  PREDICTED: B-cell receptor-associated protei...    120   8e-30   Malus domestica [apple tree]
ref|XP_003532279.1|  PREDICTED: B-cell receptor-associated protei...    120   9e-30   Glycine max [soybeans]
ref|XP_008382607.1|  PREDICTED: B-cell receptor-associated protei...    119   1e-29   
ref|XP_009410623.1|  PREDICTED: B-cell receptor-associated protei...    119   1e-29   
ref|XP_004981056.1|  PREDICTED: B-cell receptor-associated protei...    119   2e-29   Setaria italica
ref|XP_008794596.1|  PREDICTED: B-cell receptor-associated protei...    119   2e-29   Phoenix dactylifera
ref|XP_002437063.1|  hypothetical protein SORBIDRAFT_10g020520          117   3e-29   Sorghum bicolor [broomcorn]
ref|XP_008802267.1|  PREDICTED: B-cell receptor-associated protei...    118   4e-29   Phoenix dactylifera
gb|KDP26363.1|  hypothetical protein JCGZ_17521                         117   6e-29   Jatropha curcas
ref|XP_003562352.1|  PREDICTED: B-cell receptor-associated protei...    117   6e-29   Brachypodium distachyon [annual false brome]
gb|EMS49195.1|  hypothetical protein TRIUR3_29235                       116   8e-29   Triticum urartu
gb|KDO62066.1|  hypothetical protein CISIN_1g046403mg                   114   8e-29   Citrus sinensis [apfelsine]
gb|EMT32966.1|  hypothetical protein F775_31670                         116   9e-29   
ref|XP_007140653.1|  hypothetical protein PHAVU_008G130500g             117   9e-29   Phaseolus vulgaris [French bean]
ref|XP_003552124.1|  PREDICTED: B-cell receptor-associated protei...    117   1e-28   Glycine max [soybeans]
ref|XP_004491413.1|  PREDICTED: uncharacterized protein LOC101509893    115   1e-28   Cicer arietinum [garbanzo]
gb|KDP39157.1|  hypothetical protein JCGZ_00914                         113   2e-28   Jatropha curcas
ref|XP_006452413.1|  hypothetical protein CICLE_v10009874mg             114   2e-28   
ref|XP_002303054.2|  hypothetical protein POPTR_0002s24670g             116   2e-28   Populus trichocarpa [western balsam poplar]
ref|XP_007134124.1|  hypothetical protein PHAVU_010G021100g             115   3e-28   Phaseolus vulgaris [French bean]
ref|XP_002266257.2|  PREDICTED: B-cell receptor-associated protei...    115   3e-28   Vitis vinifera
gb|ACG37455.1|  B-cell receptor-associated protein 31-like contai...    115   4e-28   Zea mays [maize]
gb|ACN36491.1|  unknown                                                 113   5e-28   Zea mays [maize]
ref|NP_001136567.1|  uncharacterized LOC100216689 precursor             115   7e-28   Zea mays [maize]
ref|XP_009779153.1|  PREDICTED: B-cell receptor-associated protei...    113   8e-28   Nicotiana sylvestris
ref|XP_004295837.1|  PREDICTED: uncharacterized protein LOC101305253    113   8e-28   Fragaria vesca subsp. vesca
ref|XP_011011172.1|  PREDICTED: uncharacterized protein LOC105115831    114   1e-27   Populus euphratica
ref|XP_009388739.1|  PREDICTED: uncharacterized protein LOC103975489    112   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010099686.1|  hypothetical protein L484_025117                   113   2e-27   Morus notabilis
ref|XP_010685051.1|  PREDICTED: B-cell receptor-associated protei...    113   3e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010274041.1|  PREDICTED: B-cell receptor-associated protei...    111   1e-26   Nelumbo nucifera [Indian lotus]
ref|XP_008674143.1|  PREDICTED: B-cell receptor-associated protei...    112   1e-26   
ref|XP_008460368.1|  PREDICTED: B-cell receptor-associated protei...    111   2e-26   Cucumis melo [Oriental melon]
ref|XP_002521067.1|  bcr-associated protein, bap, putative              111   5e-26   
ref|XP_007020770.1|  F-box family protein with a domain of Unchar...    114   5e-26   
ref|XP_006281079.1|  hypothetical protein CARUB_v10027107mg             109   6e-26   Capsella rubella
ref|XP_004491710.1|  PREDICTED: B-cell receptor-associated protei...    109   6e-26   Cicer arietinum [garbanzo]
ref|XP_010913045.1|  PREDICTED: B-cell receptor-associated protei...    109   8e-26   Elaeis guineensis
gb|KEH22623.1|  B-cell receptor-associated-like protein                 109   9e-26   Medicago truncatula
ref|XP_010552045.1|  PREDICTED: B-cell receptor-associated protei...    108   1e-25   Tarenaya hassleriana [spider flower]
ref|XP_004144386.1|  PREDICTED: uncharacterized protein LOC101213598    107   3e-25   Cucumis sativus [cucumbers]
gb|EMS58132.1|  hypothetical protein TRIUR3_00710                       107   4e-25   Triticum urartu
emb|CDX86287.1|  BnaA06g30040D                                          107   6e-25   
ref|XP_009151666.1|  PREDICTED: uncharacterized protein LOC103874978    107   6e-25   Brassica rapa
emb|CDX85356.1|  BnaC07g26670D                                          107   8e-25   
ref|XP_002863915.1|  hypothetical protein ARALYDRAFT_494932             106   1e-24   
ref|XP_009778813.1|  PREDICTED: uncharacterized protein LOC104228107    103   1e-24   Nicotiana sylvestris
ref|XP_010063029.1|  PREDICTED: uncharacterized protein LOC104450...    104   1e-24   Eucalyptus grandis [rose gum]
emb|CDY29829.1|  BnaC05g31610D                                          103   2e-24   Brassica napus [oilseed rape]
emb|CDP03896.1|  unnamed protein product                                105   2e-24   Coffea canephora [robusta coffee]
ref|XP_002317336.1|  hypothetical protein POPTR_0011s09140g             102   3e-24   Populus trichocarpa [western balsam poplar]
gb|EYU40619.1|  hypothetical protein MIMGU_mgv1a013665mg                105   4e-24   Erythranthe guttata [common monkey flower]
ref|XP_006298783.1|  hypothetical protein CARUB_v10014885mg             102   4e-24   Capsella rubella
ref|XP_008235454.1|  PREDICTED: B-cell receptor-associated protei...    104   5e-24   Prunus mume [ume]
ref|XP_009145629.1|  PREDICTED: uncharacterized protein LOC103869321    102   5e-24   Brassica rapa
ref|XP_011089080.1|  PREDICTED: uncharacterized protein LOC105170143    103   1e-23   Sesamum indicum [beniseed]
ref|XP_010488019.1|  PREDICTED: uncharacterized protein LOC104765923    101   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010508923.1|  PREDICTED: uncharacterized protein LOC104785412    101   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_004290194.1|  PREDICTED: B-cell receptor-associated protei...    103   2e-23   Fragaria vesca subsp. vesca
ref|XP_010466234.1|  PREDICTED: uncharacterized protein LOC104746450    100   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_004142754.1|  PREDICTED: uncharacterized protein LOC101213037    100   3e-23   
ref|XP_009775442.1|  PREDICTED: uncharacterized protein LOC104225364    101   6e-23   Nicotiana sylvestris
ref|XP_007216855.1|  hypothetical protein PRUPE_ppa021600mg             100   1e-22   
ref|XP_010666200.1|  PREDICTED: uncharacterized protein LOC104883381  99.0    1e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009610381.1|  PREDICTED: uncharacterized protein LOC104104089    101   1e-22   Nicotiana tomentosiformis
ref|XP_008458888.1|  PREDICTED: uncharacterized protein LOC103498158  98.6    1e-22   Cucumis melo [Oriental melon]
gb|KFK39354.1|  hypothetical protein AALP_AA3G233700                  99.0    1e-22   Arabis alpina [alpine rockcress]
ref|XP_011013138.1|  PREDICTED: uncharacterized protein LOC105117241  98.6    1e-22   Populus euphratica
ref|XP_004963921.1|  PREDICTED: B-cell receptor-associated protei...  98.2    2e-22   
ref|NP_566662.1|  B-cell receptor-associated protein 31-like protein  98.2    2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|EPS63018.1|  hypothetical protein M569_11771                       98.2    4e-22   Genlisea aurea
ref|XP_006340009.1|  PREDICTED: B-cell receptor-associated protei...  99.8    4e-22   Solanum tuberosum [potatoes]
gb|AAM67164.1|  unknown                                               97.4    4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011024634.1|  PREDICTED: uncharacterized protein LOC105125752  99.8    4e-22   Populus euphratica
ref|XP_006406381.1|  hypothetical protein EUTSA_v10021737mg           97.4    4e-22   Eutrema salsugineum [saltwater cress]
ref|XP_007142305.1|  hypothetical protein PHAVU_008G269400g           98.2    8e-22   Phaseolus vulgaris [French bean]
ref|XP_004247073.1|  PREDICTED: uncharacterized protein LOC101251810  98.6    1e-21   Solanum lycopersicum
gb|EPS57633.1|  hypothetical protein M569_17183                       97.1    3e-21   Genlisea aurea
ref|XP_002885374.1|  hypothetical protein ARALYDRAFT_479569           95.1    3e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_002862714.1|  hypothetical protein ARALYDRAFT_497321           95.1    4e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_010545515.1|  PREDICTED: uncharacterized protein LOC104817861  95.1    4e-21   Tarenaya hassleriana [spider flower]
ref|XP_010464329.1|  PREDICTED: uncharacterized protein LOC104744901  96.7    6e-21   Camelina sativa [gold-of-pleasure]
ref|XP_008467068.1|  PREDICTED: uncharacterized protein LOC103504505  94.4    6e-21   
ref|XP_009129743.1|  PREDICTED: uncharacterized protein LOC103854553  96.3    8e-21   Brassica rapa
emb|CDY51050.1|  BnaA02g30380D                                        95.9    1e-20   Brassica napus [oilseed rape]
gb|KDP22731.1|  hypothetical protein JCGZ_01833                       95.5    2e-20   Jatropha curcas
emb|CDY66080.1|  BnaCnng49520D                                        95.1    2e-20   Brassica napus [oilseed rape]
ref|XP_006395148.1|  hypothetical protein EUTSA_v10004894mg           94.4    4e-20   Eutrema salsugineum [saltwater cress]
gb|AFW70952.1|  hypothetical protein ZEAMMB73_233499                  92.0    6e-20   
ref|XP_010493705.1|  PREDICTED: B-cell receptor-associated protei...  92.8    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_006409380.1|  hypothetical protein EUTSA_v10022940mg           89.7    1e-19   
ref|NP_199677.1|  B-cell receptor-associated protein 31-like protein  92.4    2e-19   
ref|XP_002529922.1|  bcr-associated protein, bap, putative            91.7    4e-19   
ref|XP_007201384.1|  hypothetical protein PRUPE_ppa012189mg           89.7    9e-19   
gb|ACU15885.1|  unknown                                               86.3    4e-18   
gb|KFK38172.1|  hypothetical protein AALP_AA3G078300                  89.0    4e-18   
ref|XP_002884632.1|  hypothetical protein ARALYDRAFT_478041           87.8    9e-18   
ref|XP_010486262.1|  PREDICTED: B-cell receptor-associated protei...  87.0    2e-17   
ref|XP_010449720.1|  PREDICTED: B-cell receptor-associated protei...  87.0    2e-17   
ref|XP_008455897.1|  PREDICTED: B-cell receptor-associated protei...  83.6    4e-17   
ref|XP_009616881.1|  PREDICTED: uncharacterized protein LOC104109325  86.3    5e-17   
ref|XP_006407860.1|  hypothetical protein EUTSA_v10021483mg           85.5    5e-17   
ref|XP_010096876.1|  hypothetical protein L484_008070                 81.6    1e-16   
ref|XP_009795272.1|  PREDICTED: uncharacterized protein LOC104241998  84.3    2e-16   
ref|XP_007212356.1|  hypothetical protein PRUPE_ppa014571mg           80.1    5e-16   
ref|XP_003617596.1|  hypothetical protein MTR_5g093360                80.5    5e-16   
ref|NP_187375.1|  B-cell receptor-associated protein 31-like protein  82.8    6e-16   
gb|EMS47744.1|  hypothetical protein TRIUR3_06470                     82.8    8e-16   
gb|EMT23366.1|  hypothetical protein F775_19324                       81.6    2e-15   
emb|CBI28815.3|  unnamed protein product                              76.3    2e-14   
emb|CBI29413.3|  unnamed protein product                              72.8    7e-13   
ref|XP_006375656.1|  hypothetical protein POPTR_0014s18880g           70.5    5e-12   
ref|XP_010063030.1|  PREDICTED: uncharacterized protein LOC104450...  67.8    1e-11   
gb|AFW71006.1|  hypothetical protein ZEAMMB73_389553                  67.8    2e-11   
ref|XP_010466235.1|  PREDICTED: uncharacterized protein LOC104746451  65.9    1e-10   
gb|KJB13716.1|  hypothetical protein B456_002G090900                  63.9    7e-10   
ref|XP_006443575.1|  hypothetical protein CICLE_v100221652mg          62.4    1e-09   
gb|EYU39202.1|  hypothetical protein MIMGU_mgv1a024213mg              63.9    1e-09   
ref|XP_006479254.1|  PREDICTED: B-cell receptor-associated protei...  63.2    2e-09   
ref|XP_006443576.1|  hypothetical protein CICLE_v100221651mg          61.6    3e-09   
gb|EMT13188.1|  hypothetical protein F775_28124                       62.8    4e-09   
gb|KJB13713.1|  hypothetical protein B456_002G090600                  61.2    6e-09   
emb|CDX71552.1|  BnaC04g17870D                                        57.0    5e-08   
ref|NP_001175145.1|  Os07g0291200                                     58.5    5e-08   
ref|XP_006342256.1|  PREDICTED: uncharacterized protein LOC102584894  60.5    5e-08   
ref|XP_008353105.1|  PREDICTED: uncharacterized protein LOC103416652  57.0    2e-07   
ref|XP_008646901.1|  PREDICTED: uncharacterized protein LOC103628485  55.5    3e-07   
gb|AEW09002.1|  hypothetical protein CL3091Contig1_06                 53.5    2e-06   
emb|CAN62540.1|  hypothetical protein VITISV_031161                   53.9    2e-06   
ref|XP_004240151.1|  PREDICTED: uncharacterized protein LOC101249367  55.5    3e-06   
gb|AFG56242.1|  hypothetical protein CL3091Contig1_06                 52.0    5e-06   
gb|AFW77084.1|  hypothetical protein ZEAMMB73_955327                  52.8    5e-06   
gb|AFW77083.1|  hypothetical protein ZEAMMB73_955327                  52.4    6e-06   
gb|AFW77085.1|  hypothetical protein ZEAMMB73_955327                  51.6    7e-06   
gb|EMT13189.1|  hypothetical protein F775_28125                       51.2    1e-05   
ref|XP_006375655.1|  hypothetical protein POPTR_0014s18870g           49.7    7e-05   
emb|CBI23214.3|  unnamed protein product                              47.0    6e-04   



>ref|XP_009610364.1| PREDICTED: uncharacterized protein LOC104104077 [Nicotiana tomentosiformis]
Length=219

 Score =   265 bits (677),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 154/173 (89%), Gaps = 3/173 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESINPTDQVL  347
            KTPLRKL+I++LDR KRGRGPL+VKSVAATV V+MIYTVYS++E+QSRP +++NPTDQ+L
Sbjct  25   KTPLRKLIIMTLDRVKRGRGPLIVKSVAATVLVIMIYTVYSIRELQSRPTDTVNPTDQIL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVN  167
            LA QILQA+LMGF LFL LM+DRLHHYIRELRLLRK MEAAKK DR  DNGKNG   E +
Sbjct  85   LAHQILQAALMGFCLFLGLMVDRLHHYIRELRLLRKTMEAAKKQDRALDNGKNG---EAS  141

Query  166  SLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            +LK+EI+S+++K+++LESE EAK +EVK+QK NS+S KGQSEKLLLEY +LL+
Sbjct  142  NLKDEISSLRNKVRQLESENEAKEKEVKSQKANSDSLKGQSEKLLLEYDRLLE  194



>ref|XP_009795967.1| PREDICTED: uncharacterized protein LOC104242589 [Nicotiana sylvestris]
Length=219

 Score =   262 bits (669),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 153/173 (88%), Gaps = 3/173 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESINPTDQVL  347
            KTPLRKL+I++LDR KRGRGPL+VKSVAATV V+MIYTVYS++E+QSRP +++NPTDQ+L
Sbjct  25   KTPLRKLIIMTLDRVKRGRGPLIVKSVAATVLVIMIYTVYSIRELQSRPTDTVNPTDQIL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVN  167
            LA QILQA+LMGF LFL LM+DRLHHYIRELRLLRK MEA KK DR  DNGKNG   E +
Sbjct  85   LAHQILQAALMGFCLFLGLMVDRLHHYIRELRLLRKTMEAVKKQDRALDNGKNG---EAS  141

Query  166  SLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            +LK+EI+S+++K+++LES+ EAK +EVK+QK NS+S KGQSEKLLLEY +LL+
Sbjct  142  NLKDEISSLRNKVRQLESDNEAKEKEVKSQKANSDSLKGQSEKLLLEYDRLLE  194



>emb|CDP10783.1| unnamed protein product [Coffea canephora]
Length=219

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 139/173 (80%), Gaps = 0/173 (0%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESINPTDQVL  347
            KTPLRKL I++LDR KRG GPLVVKSV ATV V+M Y+VY+++E+ SRP+ES NPTDQVL
Sbjct  22   KTPLRKLEIMALDRVKRGSGPLVVKSVGATVLVMMTYSVYTIRELNSRPVESFNPTDQVL  81

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVN  167
            LA ++L  SLMGF LFL+LMIDRLHHYIRELR+LRK MEAAKK  R  D GK     EVN
Sbjct  82   LAYEVLDTSLMGFSLFLALMIDRLHHYIRELRILRKTMEAAKKQSREVDEGKKANGAEVN  141

Query  166  SLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            +LKEE+ +MK+ I  LESEC+AK +E+KA + NSES K QSE LLLEY +LL+
Sbjct  142  ALKEEVTAMKTMINILESECKAKEKELKAAESNSESLKKQSEGLLLEYDRLLE  194



>ref|XP_004251523.1| PREDICTED: uncharacterized protein LOC101250189 [Solanum lycopersicum]
Length=219

 Score =   236 bits (601),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 151/173 (87%), Gaps = 3/173 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESINPTDQVL  347
            +TPLRKL+I+SLDR KRG GPL+VKSVAATV V+MIYTVYS++E+QSRP +S+NPTDQ+L
Sbjct  25   RTPLRKLIIMSLDRVKRGSGPLIVKSVAATVLVIMIYTVYSIKELQSRPADSVNPTDQIL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVN  167
            LA QIL+A+LMGF LFL LMIDRLHHYIRELRLLRK MEA KK DR  DN KNG   E +
Sbjct  85   LAHQILEAALMGFSLFLGLMIDRLHHYIRELRLLRKTMEAVKKQDRTLDNIKNG---EAS  141

Query  166  SLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            +L++EI+S+++++K+LESE EAK +EV++Q+ NS+S KGQSEKLLLEY ++L+
Sbjct  142  TLRDEISSLRNRMKQLESESEAKEKEVQSQRANSDSLKGQSEKLLLEYDRILE  194



>ref|XP_006351969.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum 
tuberosum]
Length=219

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 151/173 (87%), Gaps = 3/173 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESINPTDQVL  347
            +TPLRKL+I++LDR KRG GPL+VKSVAATV V+MIYTVYS++E+QSRP +S+NPTDQ+L
Sbjct  25   RTPLRKLIIMTLDRVKRGSGPLIVKSVAATVLVIMIYTVYSIKELQSRPADSVNPTDQIL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVN  167
            LA QIL+A+LMGF LFL LMIDRLHHYIRELRLLR+ MEA KK DR  DN KNG   E +
Sbjct  85   LAHQILEAALMGFSLFLGLMIDRLHHYIRELRLLRRTMEAVKKQDRTLDNIKNG---EAS  141

Query  166  SLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            +L++EI+S+++K+K+LESE EAK EEV++Q+ NS+S KGQSEKLLLEY ++L+
Sbjct  142  TLRDEISSLRNKMKQLESESEAKEEEVQSQRANSDSLKGQSEKLLLEYDRILE  194



>ref|XP_010549208.1| PREDICTED: B-cell receptor-associated protein 31 [Tarenaya hassleriana]
 ref|XP_010549209.1| PREDICTED: B-cell receptor-associated protein 31 [Tarenaya hassleriana]
Length=218

 Score =   231 bits (589),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 148/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I++LDR KRGRGP+VVK++A TVFV+++ +VYS+ +IQ   +ES  ++PTDQ
Sbjct  22   KTPLRKLVIMTLDRIKRGRGPVVVKTIATTVFVVLLSSVYSILKIQRGSVESGVLSPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            +L+A+ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RGF++GKN   EE
Sbjct  82   ILMAKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRGFEDGKNASAEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            V +L EE+A++K+KIK+LESECE KG+E+K+ +  +E+ + Q++  LLEY +LL+
Sbjct  142  VKALGEEVAALKAKIKRLESECETKGKELKSAQAETEALRKQADGFLLEYDRLLE  196



>gb|KHN41234.1| hypothetical protein glysoja_017278 [Glycine soja]
Length=213

 Score =   226 bits (576),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 140/175 (80%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I+SLDR KRGRGP+VV +V AT+ V++  ++YS+ +IQ R LE+  +NPTDQ
Sbjct  22   KTPLRKLVIVSLDRVKRGRGPVVVSTVGATLMVVLASSLYSMAKIQQRTLEAGIVNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELR LRK MEA KK  R F++GKNG +EE
Sbjct  82   VLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRSLRKTMEAIKKQSRSFEDGKNGNLEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
              +L EEI ++KSKIKKLESECEAKG + K  +   E+ K QSE  L+EY +LL+
Sbjct  142  HKALNEEITTLKSKIKKLESECEAKGNQAKTLETEVEALKKQSEGFLMEYDRLLE  196



>ref|NP_001239654.1| uncharacterized protein LOC100798727 [Glycine max]
 gb|ACU21248.1| unknown [Glycine max]
Length=213

 Score =   226 bits (576),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 140/175 (80%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I+SLDR KRGRGP+VV +V AT+ V++  ++YS+ +IQ R LE+  +NPTDQ
Sbjct  22   KTPLRKLVIVSLDRVKRGRGPVVVSTVGATLVVVLASSLYSMAKIQQRTLEAGIVNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELR LRK MEA KK  R F++GKNG +EE
Sbjct  82   VLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRSLRKTMEAIKKQSRSFEDGKNGNLEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
              +L EEI ++KSKIKKLESECEAKG + K  +   E+ K QSE  L+EY +LL+
Sbjct  142  HKALNEEITTLKSKIKKLESECEAKGNQAKTLETEVEALKKQSEGFLMEYDRLLE  196



>ref|XP_003605958.1| hypothetical protein MTR_4g049540 [Medicago truncatula]
 gb|AES88155.1| B-cell receptor-associated-like protein [Medicago truncatula]
 gb|AFK41440.1| unknown [Medicago truncatula]
Length=221

 Score =   225 bits (574),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 140/175 (80%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I+SLDR KRGRGP+VV +V AT+ V++  ++YS+ +IQ R +E+  +NPTDQ
Sbjct  22   KTPLRKLVIVSLDRVKRGRGPIVVTTVGATLIVVLSSSLYSMAKIQQRTVEAGVLNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK MEA KK  R F++GKNG  EE
Sbjct  82   VLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMEAVKKQTRSFEDGKNGSTEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
              +L EEI ++KSK+KKLESECEAKG + K  +   E+ K QSE  L+EY +LL+
Sbjct  142  QKALTEEITTLKSKVKKLESECEAKGTKEKTLETEVEALKKQSEGFLMEYDRLLE  196



>ref|XP_010252455.1| PREDICTED: uncharacterized protein LOC104594039 [Nelumbo nucifera]
Length=222

 Score =   225 bits (574),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 147/176 (84%), Gaps = 3/176 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTD  356
            KTPLRKL+I+ LDR KRGRGP++VK+V  T+ V+++ +VYS+ +IQ+R ++S   +NPTD
Sbjct  22   KTPLRKLIIMGLDRVKRGRGPVMVKTVCGTILVVLLSSVYSMTKIQNRSMDSAGIVNPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            QVL+A+ +L+ASLMGF LFL+LMIDRLHHYIRELRLLRK+MEA KK +RGF++GKNGG E
Sbjct  82   QVLMAKHLLEASLMGFSLFLALMIDRLHHYIRELRLLRKSMEAVKKQNRGFEDGKNGGPE  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            +  +L+EE AS+++K+K+LES+ EAK +E KA + N+E+ K QSE  LLEY +LL+
Sbjct  142  DTKALEEERASLRAKVKELESKFEAKTKETKAAEANAEALKKQSEGFLLEYDRLLE  197



>gb|AFK33681.1| unknown [Medicago truncatula]
Length=221

 Score =   224 bits (572),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 139/175 (79%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I+SLDR KRGRGP+VV +V AT+ V++  ++YS+ +IQ R +E+  +NPTDQ
Sbjct  22   KTPLRKLVIVSLDRVKRGRGPIVVTTVGATLIVVLSSSLYSMAKIQQRTVEAGVLNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK MEA KK  R F++GKNG  EE
Sbjct  82   VLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMEAVKKQTRSFEDGKNGSTEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
              +L EEI ++KSK+KKLESECEAKG + K  +   E+ K QSE   LEY +LL+
Sbjct  142  QKALTEEITTLKSKVKKLESECEAKGTKEKTLETEVEALKKQSEGFFLEYDRLLE  196



>ref|XP_010244479.1| PREDICTED: B-cell receptor-associated protein 31-like [Nelumbo 
nucifera]
Length=222

 Score =   224 bits (572),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 146/176 (83%), Gaps = 3/176 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTD  356
            KTPLRKL+I+ LDR KRGRGP++VK+VA TVFV+++ +VYS+ +IQ R +++   +NPTD
Sbjct  22   KTPLRKLVIMGLDRVKRGRGPVMVKTVAGTVFVVLLSSVYSMMKIQKRSMDAAVVVNPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            QVL+A+ +L+ASLMGF LFL+LMIDRLHHYIRELRLLRK MEA KK +RGF++GKNG  E
Sbjct  82   QVLMAKHLLEASLMGFSLFLALMIDRLHHYIRELRLLRKGMEAIKKQNRGFEDGKNGVAE  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            E  +L+EE+A+++ K+K+LESECE + +E+K  + N+ + + QSE +LLEY +L++
Sbjct  142  ETKALEEEMANLRGKVKQLESECEVQTKELKTAEANTVALRKQSEGILLEYDRLME  197



>gb|ACJ84514.1| unknown [Medicago truncatula]
Length=221

 Score =   223 bits (568),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 139/175 (79%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I+SLDR KRGRGP+VV +V AT+ V++  ++YS+ +IQ R +E+  +NPTDQ
Sbjct  22   KTPLRKLVIVSLDRVKRGRGPIVVTTVGATLIVVLSSSLYSMAKIQQRTVEAGVLNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK  EA KK  R F++GKNG  EE
Sbjct  82   VLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTTEAVKKQTRSFEDGKNGSTEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
              +L EEI ++KSK+KKLESECEAKG + K  +   E+ K QSE  L+EY +LL+
Sbjct  142  QKALTEEITTLKSKVKKLESECEAKGTKEKTLETEVEALKKQSEGFLMEYDRLLE  196



>ref|XP_003539858.1| PREDICTED: B-cell receptor-associated protein 31-like [Glycine 
max]
Length=221

 Score =   221 bits (564),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I+SLD  KRGRGP+VV +V AT+ V++  ++YS+ +IQ R LE+  +NPTDQ
Sbjct  22   KTPLRKLVIVSLDSVKRGRGPVVVSTVGATLMVVLASSLYSMAKIQQRTLEAGIVNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+++ +L+ASLMGF+LFLSLMIDRLHHYIRELR LRK MEA KK  R F++GKNG  EE
Sbjct  82   VLMSKHMLEASLMGFLLFLSLMIDRLHHYIRELRSLRKTMEAIKKQSRSFEDGKNGNSEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
              +L EEI ++KSKIKKLESECEAKG + K  +   E+ K QSE  L+EY +LL+
Sbjct  142  HKALNEEITTLKSKIKKLESECEAKGSQAKTLETEVEALKKQSEGFLMEYDRLLE  196



>ref|XP_004506274.1| PREDICTED: B-cell receptor-associated protein 31-like [Cicer 
arietinum]
Length=221

 Score =   221 bits (563),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I+SLDR KRGRGP+VV +V AT+ V++  ++YS+ +IQ R +E+  INPTDQ
Sbjct  22   KTPLRKLVIVSLDRVKRGRGPIVVTTVGATLVVVLSSSLYSMAKIQQRTIEAGIINPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+++ +L+ASLMGF+LFLSLMIDRLHHYIRELRLLRK MEA KK  R F++GKNG  EE
Sbjct  82   VLMSKHMLEASLMGFMLFLSLMIDRLHHYIRELRLLRKTMEAVKKQTRSFEDGKNGNTEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
              +L EEI ++KSK+K LESECE+KG + K      E+ K QSE  L+EY +LL+
Sbjct  142  QKALAEEITTLKSKVKMLESECESKGNKEKTLHTEVEALKKQSEGFLMEYDRLLE  196



>ref|XP_010689493.1| PREDICTED: B-cell receptor-associated protein 31 [Beta vulgaris 
subsp. vulgaris]
Length=221

 Score =   221 bits (563),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQ  353
            +TPLRKL+I+ LDR KRGRGP+V+ +V  T+ VL++ T+ ++  IQ R +E  +INPTDQ
Sbjct  22   RTPLRKLVILGLDRMKRGRGPIVITTVGGTILVLLVTTISTIVNIQQRDIEPGTINPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            +L  + +L ASLMGF+LFL LM+DRLHHYIRELRLLRK MEA KK +R FD+ KNG  EE
Sbjct  82   ILFTRSLLDASLMGFILFLGLMMDRLHHYIRELRLLRKTMEAVKKQNRSFDDAKNGSSEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            + +++EE+A++KS+IK +ESEC AK +E+KA +  SE+ K QSE LLLEY +LL+
Sbjct  142  LKAMEEEVATLKSRIKTMESECVAKTDEIKASESKSEALKKQSEGLLLEYDRLLE  196



>ref|XP_006403381.1| hypothetical protein EUTSA_v10003268mg [Eutrema salsugineum]
 gb|ESQ44834.1| hypothetical protein EUTSA_v10003268mg [Eutrema salsugineum]
Length=218

 Score =   221 bits (563),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 143/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQ  353
            KTPLRKL+I++ DR KRGRGP+VVK++ ATVFV+++ +VYS+  IQ R  +  ++NPTDQ
Sbjct  22   KTPLRKLIILTFDRIKRGRGPVVVKTIGATVFVVLMSSVYSLLSIQRRSEDGAALNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RGF++GKN   EE
Sbjct  82   VLASKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRGFEDGKNTSGEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            V +L EEIA++KSKI KLESE E+KG+E+K  +  +E+ + Q++  L+EY +LL+
Sbjct  142  VKALVEEIAALKSKIGKLESESESKGKELKGARAETEALRKQADGFLMEYDRLLE  196



>gb|KHN21219.1| hypothetical protein glysoja_006698 [Glycine soja]
Length=221

 Score =   221 bits (563),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I+SLD  KRGRGP+VV +V AT+ V++  ++YS+ +IQ R LE+  +NPTDQ
Sbjct  22   KTPLRKLVIVSLDSVKRGRGPVVVSTVGATLMVVLASSLYSMAKIQQRTLEAGIVNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+++ +L+ASLMGF+LFLSLMIDRLHHYIRELR LRK MEA KK  R F++GKNG  EE
Sbjct  82   VLMSKHMLEASLMGFLLFLSLMIDRLHHYIRELRSLRKTMEAIKKQSRSFEDGKNGNSEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
              +L EEI ++KSKIKKLESECEAKG + K  +   E+ K QSE  L+EY +LL+
Sbjct  142  HKALNEEITALKSKIKKLESECEAKGSQAKTLETEVEALKKQSEGFLMEYDRLLE  196



>ref|XP_002270301.1| PREDICTED: B-cell receptor-associated protein 31-like [Vitis 
vinifera]
Length=214

 Score =   220 bits (561),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 147/175 (84%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL++++LDR KRGRGP++ ++VA TVFV+++ +VYS+ +IQ+R +E   INPTDQ
Sbjct  22   KTPLRKLVVMALDRVKRGRGPIMAQTVATTVFVVLMSSVYSMMKIQNRSVEPGLINPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+A+ +L+ASLMGF+LFL+LMIDRLHHYIRELRLLRKAMEA KK +RGF++GKNG  EE
Sbjct  82   VLMARHLLEASLMGFLLFLALMIDRLHHYIRELRLLRKAMEAEKKQNRGFEDGKNGRAEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
              ++ EE++S++++IKKLESECE K +E +A + N+ + K QSE  LLEY +LL+
Sbjct  142  AKAMGEEMSSLRTQIKKLESECETKAKEAEAAEANTVALKKQSEGFLLEYDRLLE  196



>ref|XP_009123682.1| PREDICTED: uncharacterized protein LOC103848551 [Brassica rapa]
 emb|CDY02396.1| BnaA02g23050D [Brassica napus]
Length=218

 Score =   217 bits (553),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 141/175 (81%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I++ DR KRGRGP+VVK++ ATVFV++I +VYS+  IQ R  +   +NPTDQ
Sbjct  22   KTPLRKLIILTFDRIKRGRGPVVVKTIGATVFVVLISSVYSLLSIQRRSEDGAVLNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +R F++GKN   EE
Sbjct  82   VLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRSFEDGKNTNGEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            V +L EEIA +K+KIKKLESE E+KG+E+K+ +  +E+ +  ++  L+EY +LL+
Sbjct  142  VKALGEEIAVLKAKIKKLESESESKGKELKSAQAETEALRKSADGFLMEYDRLLE  196



>gb|AAM62748.1| unknown [Arabidopsis thaliana]
Length=218

 Score =   216 bits (551),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 140/175 (80%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I++ DR KRGRGP+VVK++  TVFV+++ ++YS+  IQ R  +   +NPTDQ
Sbjct  22   KTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSIYSLVNIQRRSEDGAVLNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RGF++GK    EE
Sbjct  82   VLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRGFEDGKTTSGEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            V +L EEIA++K+KIK LESE E+KG+E+K  +  +E+ + QS+  L+EY +LL+
Sbjct  142  VKALGEEIAALKAKIKTLESESESKGKELKGAQGETEALRKQSDGFLMEYDRLLE  196



>emb|CBI23212.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   216 bits (549),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 142/175 (81%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I+ LDR KRGRGP++VK+VAATV V++I +VYS+ +I+ R ++   +NPTDQ
Sbjct  22   KTPLRKLVIMGLDRVKRGRGPIMVKTVAATVLVVLISSVYSMMKIRKRGIDDDVVNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+A+ +L+ SLMGF LFL+LMIDRLHHYIRELRL RK+MEA KK +RGF++GK GG  E
Sbjct  82   VLMAKHLLETSLMGFTLFLALMIDRLHHYIRELRLRRKSMEAIKKQNRGFEDGKTGGSAE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            + +++EE+A++ +K+K+LESE E K +E KA + N+ + + QSE  LLEY +LL+
Sbjct  142  IKAMEEEMAALGAKLKQLESEIETKTKEAKAAETNAVALRKQSEGFLLEYDRLLE  196



>ref|NP_568607.1| B-cell receptor-associated 31-like protein [Arabidopsis thaliana]
 gb|AAK96684.1| Unknown protein [Arabidopsis thaliana]
 gb|ABD43004.1| At5g42570 [Arabidopsis thaliana]
 gb|AED94830.1| B-cell receptor-associated 31-like protein [Arabidopsis thaliana]
Length=218

 Score =   215 bits (548),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 140/175 (80%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I++ DR KRGRGP+VVK++  TVFV+++ ++YS+  IQ R  +   +NPTDQ
Sbjct  22   KTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSIYSLVNIQRRSEDGAVLNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RGF++GK    EE
Sbjct  82   VLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRGFEDGKTTSGEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            V +L EEIA++K+KIK LESE E+KG+E+K  +  +E+ + Q++  L+EY +LL+
Sbjct  142  VKALGEEIAALKAKIKTLESESESKGKELKGAQGETEALRKQADGFLMEYDRLLE  196



>ref|XP_006281077.1| hypothetical protein CARUB_v10027105mg [Capsella rubella]
 gb|EOA13975.1| hypothetical protein CARUB_v10027105mg [Capsella rubella]
Length=218

 Score =   215 bits (547),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 139/175 (79%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I++ D+ KRGRGP+VVK++  TVFV+++ +VYS+  IQ R  +   +NPTDQ
Sbjct  22   KTPLRKLIILTFDKIKRGRGPVVVKTIGTTVFVVLLSSVYSLVNIQRRSEDGAVLNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RGF++GK    EE
Sbjct  82   VLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRGFEDGKTTSGEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            V +L EEI ++K+KIK LESE E+KG+E+K  K  +E+ + Q++  LLEY +LL+
Sbjct  142  VKALGEEIVALKTKIKTLESESESKGKELKGAKGETEALRKQADGFLLEYDRLLE  196



>ref|XP_002262807.2| PREDICTED: B-cell receptor-associated protein 31 [Vitis vinifera]
Length=248

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 142/175 (81%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I+ LDR KRGRGP++VK+VAATV V++I +VYS+ +I+ R ++   +NPTDQ
Sbjct  49   KTPLRKLVIMGLDRVKRGRGPIMVKTVAATVLVVLISSVYSMMKIRKRGIDDDVVNPTDQ  108

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+A+ +L+ SLMGF LFL+LMIDRLHHYIRELRL RK+MEA KK +RGF++GK GG  E
Sbjct  109  VLMAKHLLETSLMGFTLFLALMIDRLHHYIRELRLRRKSMEAIKKQNRGFEDGKTGGSAE  168

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            + +++EE+A++ +K+K+LESE E K +E KA + N+ + + QSE  LLEY +LL+
Sbjct  169  IKAMEEEMAALGAKLKQLESEIETKTKEAKAAETNAVALRKQSEGFLLEYDRLLE  223



>ref|XP_002863762.1| hypothetical protein ARALYDRAFT_494776 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40021.1| hypothetical protein ARALYDRAFT_494776 [Arabidopsis lyrata subsp. 
lyrata]
Length=218

 Score =   215 bits (547),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 142/175 (81%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I++ DR KRGRGP+VVK++  TVF++++ ++YS+ +IQ R  +   +NPTDQ
Sbjct  22   KTPLRKLIILTFDRIKRGRGPVVVKTIGITVFIVLLSSIYSLVKIQRRSEDGAVLNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RGF++GKN   EE
Sbjct  82   VLASKYLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRGFEDGKNTSGEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            V ++ EEIA++K+KIK LESE E+KG+E+K  +  +E+ + Q++  L+EY +LL+
Sbjct  142  VKAIGEEIAALKAKIKTLESESESKGKELKGAQGETEALRKQADGFLMEYDRLLE  196



>dbj|BAB09328.1| unnamed protein product [Arabidopsis thaliana]
Length=252

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 140/175 (80%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I++ DR KRGRGP+VVK++  TVFV+++ ++YS+  IQ R  +   +NPTDQ
Sbjct  22   KTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSIYSLVNIQRRSEDGAVLNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RGF++GK    EE
Sbjct  82   VLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRGFEDGKTTSGEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            V +L EEIA++K+KIK LESE E+KG+E+K  +  +E+ + Q++  L+EY +LL+
Sbjct  142  VKALGEEIAALKAKIKTLESESESKGKELKGAQGETEALRKQADGFLMEYDRLLE  196



>gb|KFK32917.1| hypothetical protein AALP_AA6G305900 [Arabis alpina]
Length=218

 Score =   214 bits (545),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 142/175 (81%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I++ DR KRGRGP+VVK++  T+FV+++ ++YS+  IQ R  +   +NPTDQ
Sbjct  22   KTPLRKLIILTFDRIKRGRGPVVVKTIGTTLFVVLMSSLYSLLNIQRRSEDGAVLNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RGF++GKN   EE
Sbjct  82   VLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRGFEDGKNTSGEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            V +L EEIA++K+K KKLES+ E+KG+E+K+ +  +E+ + Q++  LLEY +LL+
Sbjct  142  VKALGEEIAALKAKNKKLESDSESKGKELKSAQAETEALRKQADGFLLEYDRLLE  196



>ref|XP_007132530.1| hypothetical protein PHAVU_011G102200g [Phaseolus vulgaris]
 gb|ESW04524.1| hypothetical protein PHAVU_011G102200g [Phaseolus vulgaris]
Length=212

 Score =   213 bits (543),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 135/175 (77%), Gaps = 3/175 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KT LRKL+IISLDR KRGRGP+VV +V AT+ V++  ++YS+ +IQ R LE+  +NPTDQ
Sbjct  22   KTSLRKLVIISLDRVKRGRGPIVVSTVGATLVVVLSSSLYSMTKIQQRTLEAGILNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+++ +L+ASLMGF+LFLSLMIDRLHHYIRELRLLRK  E  KK  R F++GKNG  EE
Sbjct  82   VLMSKHMLEASLMGFLLFLSLMIDRLHHYIRELRLLRKTNEVIKKQSRSFEDGKNGNAEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
              +L  EIA++KSKIKKLESECE KG E K  +   E  K QSE  L+EY +LL+
Sbjct  142  QKTLT-EIATLKSKIKKLESECETKGNEAKTLETEVEVLKKQSEGFLMEYDRLLE  195



>ref|XP_010494193.1| PREDICTED: B-cell receptor-associated protein 31-like [Camelina 
sativa]
Length=218

 Score =   214 bits (544),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 139/175 (79%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I++ DR KRGRGP+VVK++  TVFV+++ +VYS+  I+ R  +   +NPTDQ
Sbjct  22   KTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSVYSLINIRRRSEDGAVLNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RGF++GK    EE
Sbjct  82   VLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRGFEDGKTTSGEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            V +L EEIA++K+KIK +ESE E KG+E+K  K  +E+ + Q++  LLEY +LL+
Sbjct  142  VKALGEEIAALKAKIKTVESESEGKGKELKEAKGETEALRKQADGFLLEYDRLLE  196



>ref|XP_006447584.1| hypothetical protein CICLE_v10016648mg [Citrus clementina]
 ref|XP_006469667.1| PREDICTED: B-cell receptor-associated protein 31-like [Citrus 
sinensis]
 gb|ESR60824.1| hypothetical protein CICLE_v10016648mg [Citrus clementina]
 gb|KDO54706.1| hypothetical protein CISIN_1g027898mg [Citrus sinensis]
Length=217

 Score =   213 bits (543),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 143/174 (82%), Gaps = 2/174 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I+SLDR KRGRGP+VVK+V  T+F++++ +VYS+ +IQ R LE+  +NPTDQ
Sbjct  22   KTPLRKLVIMSLDRVKRGRGPVVVKTVGGTLFIVLMSSVYSILKIQQRTLETGALNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            +L+++ +L+ASLMGF+LFLSLM+DRLHHYIRELRLLRKAMEAAKK  R F++GKN  V+E
Sbjct  82   ILMSKHMLEASLMGFLLFLSLMMDRLHHYIRELRLLRKAMEAAKKQTRSFEDGKNDNVDE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  11
               L ++IA++K+KIKKLESECE K +E  A K  +E+ K QSE  LLEY +LL
Sbjct  142  RKGLGDDIATLKTKIKKLESECEMKDKEANAAKAEAEALKKQSEGFLLEYDRLL  195



>emb|CDY68895.1| BnaCnng60970D [Brassica napus]
Length=218

 Score =   213 bits (542),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 140/175 (80%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I++ DR KRGRGP+VVK++ ATVFV+++ +VYS+  IQ R  +   +NPTDQ
Sbjct  22   KTPLRKLIILTFDRIKRGRGPVVVKTIGATVFVVLMSSVYSLLSIQRRSEDGAVLNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +R F++GKN   EE
Sbjct  82   VLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRSFEDGKNTNGEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            V +L  EIA +K+KIKKLESE E+KG+E+K+ +  +E+ +  ++  L+EY +LL+
Sbjct  142  VKALGGEIAVLKAKIKKLESESESKGKELKSAQAETEALRKSADGFLMEYDRLLE  196



>ref|XP_010481979.1| PREDICTED: B-cell receptor-associated protein 31-like [Camelina 
sativa]
Length=218

 Score =   211 bits (536),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 139/175 (79%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I++ DR KRGRGP+VVK++  T+FV+++ +VY +  I+ R  +   +NPTDQ
Sbjct  22   KTPLRKLIILTFDRIKRGRGPVVVKTIGTTLFVVLLSSVYGLVNIRRRSEDGAVLNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME+AKK +RGF++GK    EE
Sbjct  82   VLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMESAKKQNRGFEDGKTKSGEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            V +L EEIA++K+KIK +ESE E KG+E+K  K  +E+ + Q++  LLEY +LL+
Sbjct  142  VKALGEEIAALKAKIKTVESESEGKGKELKEAKGETEALRKQADGFLLEYDRLLE  196



>ref|XP_010442176.1| PREDICTED: B-cell receptor-associated protein 31-like [Camelina 
sativa]
Length=218

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I++ DR KRGRGP+VVK++  TVFV+++ +VYS+  I+ R  +   +NPTDQ
Sbjct  22   KTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSVYSLVNIRRRSEDGAVLNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RGF++GK    EE
Sbjct  82   VLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRGFEDGKTTSGEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            V +L EEIA +K+KIK +ESE + KG+E+K  K  +E+ + Q+++ L EY +LL+
Sbjct  142  VKALGEEIAVLKAKIKTVESESDGKGKELKEAKGETEALRKQADEFLKEYDRLLE  196



>ref|XP_009587048.1| PREDICTED: B-cell receptor-associated protein 31 [Nicotiana tomentosiformis]
Length=222

 Score =   209 bits (532),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 136/176 (77%), Gaps = 3/176 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPTD  356
            KTPLRKL+I+ LDR KRGRGP++VK+VA T+FV+M+ T+YS+  I++R ++    I PTD
Sbjct  22   KTPLRKLVIMGLDRVKRGRGPIIVKTVAGTLFVVMLSTIYSIASIRTRWMDEGGDITPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            Q+LLAQ +L+ASLMGF LFL+ MIDRLHHYIREL + RK MEA KK +R F++GK+G  E
Sbjct  82   QILLAQHLLEASLMGFSLFLAFMIDRLHHYIRELSMRRKTMEAVKKQNRAFEDGKSGASE  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            E+ +L+EE ++++ KIK+LESE + K +E    + N+ + K QSE  LLEY +LL+
Sbjct  142  EIKTLEEEASALRGKIKQLESELQEKAKEASGAEANAVALKKQSEGFLLEYDRLLE  197



>ref|XP_003540294.1| PREDICTED: B-cell receptor-associated protein 31-like [Glycine 
max]
Length=221

 Score =   209 bits (531),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 137/174 (79%), Gaps = 2/174 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTP RKL+II+LDR KRGRGP+VVK+VAAT+ V++  ++YS+ +I+ R L++  +NPTDQ
Sbjct  22   KTPARKLVIITLDRVKRGRGPVVVKTVAATLLVVLASSLYSIAKIRRRNLDAPVVNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  R F++GK+    E
Sbjct  82   VLVSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKQSRSFEDGKSVSAAE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  11
              +L EE A +K KI+KLESECE +  + KA +   E+ + QSE  L+EY +LL
Sbjct  142  HKALLEENAMLKPKIEKLESECEVEASKAKALETEVEALRKQSEGFLMEYDRLL  195



>gb|ACU19065.1| unknown [Glycine max]
Length=200

 Score =   207 bits (528),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 127/162 (78%), Gaps = 2/162 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I+SLD  KRGRGP+VV +V AT+ V++  ++YS+ +IQ R LE+  +NPTDQ
Sbjct  22   KTPLRKLVIVSLDSVKRGRGPVVVSTVGATLMVVLASSLYSMAKIQQRTLEAGIVNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+++ +L+ASLMGF+LFLSLMIDRLHHYIRELR LRK MEA KK  R F++GKNG  EE
Sbjct  82   VLMSKHMLEASLMGFLLFLSLMIDRLHHYIRELRSLRKTMEAIKKQSRSFEDGKNGNSEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQ  47
              +L EEI ++KSKIKKLESECEAKG + K  +   E+ K  
Sbjct  142  HKALNEEITTLKSKIKKLESECEAKGSQAKTLETEVEALKSN  183



>ref|XP_007149980.1| hypothetical protein PHAVU_005G115800g [Phaseolus vulgaris]
 gb|ESW21974.1| hypothetical protein PHAVU_005G115800g [Phaseolus vulgaris]
Length=221

 Score =   208 bits (530),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTP RKL+I++LDR KRGRGP+VVK+VAAT+ V++  ++YS+ +IQ R L++  +NPTDQ
Sbjct  22   KTPARKLVILTLDRLKRGRGPVVVKTVAATLLVVLASSLYSIAKIQRRSLDASVVNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+++  L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK MEAAKK  R F++GK+    E
Sbjct  82   VLVSKHTLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMEAAKKQSRSFEDGKSVSAAE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
              +L EEI+  K++++KLESECE K  + K  +   E+ + QSE  L+EY +LL+
Sbjct  142  HKALVEEISGFKAEVEKLESECEVKASKAKTLEAEVEALRKQSEGFLMEYDRLLE  196



>ref|XP_002524828.1| bcr-associated protein, bap, putative [Ricinus communis]
 gb|EEF37548.1| bcr-associated protein, bap, putative [Ricinus communis]
Length=209

 Score =   207 bits (527),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 144/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQ  353
            KTPLRKL+I+SLDR KRGRGP++VK+V  TVFV+++ +VYS+ +IQ+R +E  ++NPTDQ
Sbjct  10   KTPLRKLVIMSLDRVKRGRGPVMVKTVGGTVFVVLLSSVYSMVKIQNRTIEGGAVNPTDQ  69

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELR+LRK MEAAKK  RGF++GKNG  +E
Sbjct  70   VLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRILRKTMEAAKKQSRGFEDGKNGSADE  129

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
              +L EE+ ++++KIK LES+ E K +E KA +   E+ + QSE  L+EYG+LL+
Sbjct  130  AKALGEEVKTLQNKIKYLESKFEEKAKEAKAAEAEVEALRKQSEVFLIEYGRLLE  184



>ref|XP_003543392.1| PREDICTED: B-cell receptor-associated protein 31-like [Glycine 
max]
Length=221

 Score =   207 bits (527),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 135/174 (78%), Gaps = 2/174 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTP RKL+I++LDR KRGRGP+VVK+VAAT+ V++  ++YS+ +I+ R L++   NPTDQ
Sbjct  22   KTPARKLVIVTLDRLKRGRGPVVVKTVAATLLVVLASSLYSIAKIRHRNLDAPVANPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+ + +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  R F+ GK+    E
Sbjct  82   VLVYKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKQSRSFEGGKSVSAAE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  11
              +L EEIA +K KI+KLESECE +  + KA +   E+ + QSE  L+EY +LL
Sbjct  142  HKALVEEIAMLKPKIEKLESECEMEASKAKALETEVEALRKQSEGFLMEYDRLL  195



>ref|XP_006449764.1| hypothetical protein CICLE_v10016599mg [Citrus clementina]
 gb|ESR63004.1| hypothetical protein CICLE_v10016599mg [Citrus clementina]
Length=223

 Score =   206 bits (523),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 134/177 (76%), Gaps = 4/177 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES----INPT  359
            KTPLRKLLI+SLDR KRGRGP+VVK+VA TV V++I +VY++  IQ R ++     +NPT
Sbjct  22   KTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMIIQKRWIDDEGAVVNPT  81

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            DQVLLA  +L+A+LMG  LFL+ MIDRLHHYIRELR+ RK MEA K   RGF++GK  G 
Sbjct  82   DQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAIKNQSRGFEDGKAAGS  141

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            EE+ +L++++ ++KSK+K+LESE E K +E  A + N+ + + QSE  L EY +LL+
Sbjct  142  EEIKALEDQMTTLKSKLKELESELETKSKEANAAETNAVALRKQSEGFLFEYDRLLE  198



>ref|XP_010046363.1| PREDICTED: B-cell receptor-associated protein 31 [Eucalyptus 
grandis]
 gb|KCW88772.1| hypothetical protein EUGRSUZ_A01117 [Eucalyptus grandis]
Length=221

 Score =   204 bits (520),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 139/174 (80%), Gaps = 2/174 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I++LDR KRGRGP++VK+V  T+ V++  ++YS+ +IQ R +E+  +NPTDQ
Sbjct  22   KTPLRKLVIMALDRVKRGRGPVMVKTVGVTLLVVLASSLYSMVKIQRRTVEAGLLNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+++ +L+ASLMGFVLFLSLM+DRLHHYIRELRLLRK MEAAKK  RG D GKNG  EE
Sbjct  82   VLMSKHMLEASLMGFVLFLSLMLDRLHHYIRELRLLRKTMEAAKKQSRGIDEGKNGSAEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  11
            V  LKEEIA++++K+ KLE+E   K +E K  +  +E+ K QSE LLLEY +LL
Sbjct  142  VKGLKEEIATLRTKLNKLENEYGTKDKEAKTAEAEAEALKKQSEGLLLEYDRLL  195



>ref|XP_007026129.1| B-cell receptor-associated 31-like [Theobroma cacao]
 gb|EOY28751.1| B-cell receptor-associated 31-like [Theobroma cacao]
Length=221

 Score =   203 bits (516),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 138/177 (78%), Gaps = 2/177 (1%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPT  359
            S KTPLRKL+I+ LDR KRGRGP++VK+VA TV V+M+ +VYS+ +IQ R ++  + NPT
Sbjct  20   SFKTPLRKLVIMGLDRVKRGRGPVMVKTVAGTVSVVMMSSVYSMMKIQKRWIDDGAANPT  79

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            DQVL+A+ +L+A+LMG  LFL+LMIDRLHHYIRELRL RK MEAAKK  RGF++ K GG 
Sbjct  80   DQVLMAKHLLEATLMGASLFLALMIDRLHHYIRELRLRRKNMEAAKKQGRGFEDVKPGGS  139

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
             EV +L+EE+ +++ K K+LES+ E K +E+ A + N+ + + QSE  LLEY +LL+
Sbjct  140  NEVKALEEEVTALREKFKQLESDLETKTKEMNAAEANAVALRKQSEGFLLEYDRLLE  196



>gb|KDO78297.1| hypothetical protein CISIN_1g021727mg [Citrus sinensis]
Length=223

 Score =   201 bits (510),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 131/177 (74%), Gaps = 4/177 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES----INPT  359
            KTPLRKLLI+SLDR KRGRGP+VVK+VA TV V++I +VY++  IQ R ++     +NPT
Sbjct  22   KTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMMIQKRWIDDEGAVVNPT  81

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            DQVLLA  +L+A+LMG  LFL+ MIDRLHHYIRELR+ RK MEA K   RGF++GK    
Sbjct  82   DQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAIKNQSRGFEDGKAASS  141

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            EE+ +L++++ ++K K+K LESE E K +E  A + N+ + + QSE  L EY +LL+
Sbjct  142  EEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAVALRKQSEGFLFEYDRLLE  198



>ref|XP_006467408.1| PREDICTED: B-cell receptor-associated protein 31-like isoform 
X2 [Citrus sinensis]
Length=223

 Score =   200 bits (509),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 131/177 (74%), Gaps = 4/177 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES----INPT  359
            KTPLRKLLI+SLDR KRGRGP+VVK+VA TV V++I +VY++  IQ R ++     +NPT
Sbjct  22   KTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMIIQKRWIDDEGAVVNPT  81

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            DQVLLA  +L+A+LMG  LFL+ MIDRLHHYIRELR+ RK MEA K   RGF++GK    
Sbjct  82   DQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAIKNQSRGFEDGKAASS  141

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            EE+ +L++++ ++K K+K LESE E K +E  A + N+ + + QSE  L EY +LL+
Sbjct  142  EEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAVALRKQSEGFLFEYDRLLE  198



>ref|XP_007046390.1| B-cell receptor-associated 31-like [Theobroma cacao]
 gb|EOY02222.1| B-cell receptor-associated 31-like [Theobroma cacao]
Length=219

 Score =   199 bits (507),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 141/175 (81%), Gaps = 4/175 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTP RKLLI++LDR KRGRGP+V+ +VAAT+ V++  T+YS+ +IQ R +++  +NPTDQ
Sbjct  22   KTPFRKLLIMALDRVKRGRGPVVLTTVAATLMVVLASTLYSMLKIQRRTIDAAALNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+++ +L+ASLMGFVLFL+LMIDRLHHYIRELR LRK+ME AKK  +G+++ KN G  E
Sbjct  82   VLMSKHMLEASLMGFVLFLALMIDRLHHYIRELRFLRKSMETAKKQSQGYEDRKNAG--E  139

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            + +L EE   +K+KIKKLESECE K +EV+A +  +E+ + QSE LLLEY +LL+
Sbjct  140  LKALGEETVILKTKIKKLESECETKSKEVEAAQAEAEALRKQSEGLLLEYDRLLE  194



>ref|XP_009629450.1| PREDICTED: uncharacterized protein LOC104119606 [Nicotiana tomentosiformis]
Length=221

 Score =   199 bits (507),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 132/176 (75%), Gaps = 3/176 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPTD  356
            KTPLRKL+I+ LDR KRGRGP+VVK++  T+FV+M+ T+YSV  I+ R ++   +I PTD
Sbjct  22   KTPLRKLVIMGLDRIKRGRGPIVVKTIGGTIFVVMLSTIYSVVSIRKRWIDEDGNITPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            Q+L+AQ +L+ASLMGF LFL+LM+DRLHHYIRELR+ RK+MEA  K +RGF++GKNG  +
Sbjct  82   QILMAQHLLEASLMGFSLFLALMVDRLHHYIRELRIRRKSMEAVNKQNRGFEDGKNGACD  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            ++ SL+EE ++++ KIKKLE   E K  E    + NS + K QSE   LE   LL+
Sbjct  142  DMKSLEEEASALRLKIKKLELCLEEKARETSDAEANSVALKKQSENFGLENDSLLE  197



>ref|XP_006467407.1| PREDICTED: B-cell receptor-associated protein 31-like isoform 
X1 [Citrus sinensis]
Length=242

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 131/177 (74%), Gaps = 4/177 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES----INPT  359
            KTPLRKLLI+SLDR KRGRGP+VVK+VA TV V++I +VY++  IQ R ++     +NPT
Sbjct  22   KTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMIIQKRWIDDEGAVVNPT  81

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            DQVLLA  +L+A+LMG  LFL+ MIDRLHHYIRELR+ RK MEA K   RGF++GK    
Sbjct  82   DQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAIKNQSRGFEDGKAASS  141

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            EE+ +L++++ ++K K+K LESE E K +E  A + N+ + + QSE  L EY +LL+
Sbjct  142  EEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAVALRKQSEGFLFEYDRLLE  198



>ref|XP_006383887.1| hypothetical protein POPTR_0004s00930g [Populus trichocarpa]
 gb|ERP61684.1| hypothetical protein POPTR_0004s00930g [Populus trichocarpa]
Length=219

 Score =   199 bits (505),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 138/176 (78%), Gaps = 6/176 (3%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTD  356
            K+PLRK LI+SLDR KRGRGP++VK+VA TVF+++I +VYS+ +IQ R ++    +NPTD
Sbjct  22   KSPLRKFLIMSLDRLKRGRGPVMVKTVAGTVFLVLISSVYSMVKIQKRGIDVGGVVNPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            QVL+A+ +L+A+LMG +LFLSLMIDRLHHYIRELR+ RK+MEA KK +R F++GK   VE
Sbjct  82   QVLMAKHLLEATLMGSILFLSLMIDRLHHYIRELRMRRKSMEAVKKQNRSFEDGK---VE  138

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            E  +L+ E+++++ K+K+L+SE E K +EV   + N+ +   QSE  LLEY +LL+
Sbjct  139  ETKALETEVSTLQEKLKQLQSELEVKSKEVNTSEANAAALSKQSEGFLLEYDRLLE  194



>gb|KDP20721.1| hypothetical protein JCGZ_21192 [Jatropha curcas]
Length=206

 Score =   198 bits (504),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 135/173 (78%), Gaps = 5/173 (3%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQ  353
            KTPLRKL+++ LDR KRGRGP+VVK+VA TV V++I +VYS+ +IQ R ++  ++NPTDQ
Sbjct  10   KTPLRKLVLMVLDRVKRGRGPIVVKTVAGTVLVVLISSVYSMMKIQKRWIDEGAVNPTDQ  69

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL++  +LQA+LMGF LFL+LMIDRLHHYIRELR+ RK+MEA KK  R F++GK   VEE
Sbjct  70   VLMSGHLLQATLMGFCLFLALMIDRLHHYIRELRMRRKSMEAIKKQSRAFEDGK---VEE  126

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQL  14
              +++EEI ++++K+K LES+ E K +E  A + N+ + K Q+E  LLEY +L
Sbjct  127  SKAMEEEITTLRAKLKHLESDLEMKTKEAHASEANAVALKKQAEGFLLEYDRL  179



>gb|KDO78296.1| hypothetical protein CISIN_1g021727mg [Citrus sinensis]
Length=308

 Score =   201 bits (511),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 131/177 (74%), Gaps = 4/177 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES----INPT  359
            KTPLRKLLI+SLDR KRGRGP+VVK+VA TV V++I +VY++  IQ R ++     +NPT
Sbjct  22   KTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMMIQKRWIDDEGAVVNPT  81

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            DQVLLA  +L+A+LMG  LFL+ MIDRLHHYIRELR+ RK MEA K   RGF++GK    
Sbjct  82   DQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAIKNQSRGFEDGKAASS  141

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            EE+ +L++++ ++K K+K LESE E K +E  A + N+ + + QSE  L EY +LL+
Sbjct  142  EEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAVALRKQSEGFLFEYDRLLE  198



>ref|XP_006389583.1| hypothetical protein POPTR_0021s00340g [Populus trichocarpa]
 gb|ABK95443.1| unknown [Populus trichocarpa]
 gb|ERP48497.1| hypothetical protein POPTR_0021s00340g [Populus trichocarpa]
Length=219

 Score =   198 bits (503),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 136/176 (77%), Gaps = 6/176 (3%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPTD  356
            KTPLRKLLI+SLDR KRGRGP++VK+VA TVFV+++ +VYS+ +IQ R ++   ++NPTD
Sbjct  22   KTPLRKLLIMSLDRVKRGRGPVMVKTVAGTVFVVLMSSVYSMVKIQKRWIDDGGAVNPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            QVLLA+ +L+A+LMG +LFL LMIDRLHHYIRELR+ RK ME  KK +R F++GK   VE
Sbjct  82   QVLLAKHLLEATLMGSILFLGLMIDRLHHYIRELRMRRKTMEDVKKQNRSFEDGK---VE  138

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            E  +L+ E ++++ K+K+LESE E K +EV   + N+ +   QSE  LLEY +LL+
Sbjct  139  ETKALEAEASTLREKLKQLESELEIKTKEVNTSEANAVALSKQSEGFLLEYDRLLE  194



>ref|XP_011096040.1| PREDICTED: B-cell receptor-associated protein 31 [Sesamum indicum]
Length=221

 Score =   198 bits (503),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 130/175 (74%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I+ LDR KRGRGP+VVK+VAAT+FV+M+ +VY+   IQ R ++    NPTDQ
Sbjct  22   KTPLRKLVIMGLDRVKRGRGPVVVKTVAATIFVVMMASVYNAVAIQRRWIQDGEANPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            +L A  IL+ASLMGF LFL+LMIDRLHHYIRELR+ RK MEA KK  R F++ K    EE
Sbjct  82   ILFANHILEASLMGFALFLALMIDRLHHYIRELRIRRKTMEAVKKQSRVFEDSKPPATEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            + +L+EE  +++ +IK LE++ E K +E  + + N+ + K QSE  LLEY +LL+
Sbjct  142  IKALEEETIALRGRIKDLETQLEEKNKESGSAEANAMALKKQSEGFLLEYDRLLE  196



>ref|XP_011046959.1| PREDICTED: B-cell receptor-associated protein 31-like [Populus 
euphratica]
Length=219

 Score =   197 bits (500),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 138/176 (78%), Gaps = 6/176 (3%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTD  356
            K+P+RK LI+SLDR KRGRGP++VK+VA TVFV+++ +VYS+ +IQ R ++    +NPTD
Sbjct  22   KSPIRKFLIMSLDRLKRGRGPVMVKTVAGTVFVVLMSSVYSMVKIQKRGIDVGGVVNPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            QVL+A+ +L+A+LMG +LFLSLMIDRLHHYIRELR+ RK+MEA KK +R F++GK   VE
Sbjct  82   QVLMAKHLLEATLMGSILFLSLMIDRLHHYIRELRMRRKSMEAVKKQNRSFEDGK---VE  138

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            E  +L+ E+++++ K+K+L+SE E K +EV   + N+ +   QSE  LLEY +LL+
Sbjct  139  ETKALETEVSTLQEKLKQLQSELEVKTKEVNTSEANAIALSKQSEGFLLEYDRLLE  194



>ref|XP_010099186.1| B-cell receptor-associated protein 31 [Morus notabilis]
 gb|EXB77058.1| B-cell receptor-associated protein 31 [Morus notabilis]
Length=209

 Score =   196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 139/177 (79%), Gaps = 2/177 (1%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPT  359
            S KTPLRKL+I++LDR KRGRGP+VVK+V+AT  VL+  +VYS+ +IQ R ++  + NPT
Sbjct  8    SFKTPLRKLVIMALDRVKRGRGPVVVKTVSATAAVLLASSVYSMVKIQKRWIDDGASNPT  67

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            DQV++A+ +L+A+LMG  LFL LMIDRLHHYIRELR+ RK +EA KK ++ F++GK GG 
Sbjct  68   DQVIMAKHLLEATLMGSSLFLVLMIDRLHHYIRELRIRRKTLEAVKKQNQAFEDGKTGGS  127

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            +E+ + +EE+A++++ +K+LESE E K +++ A + N+ + + QSE  LLEY +LL+
Sbjct  128  DEIKAKEEEMATLRTTLKQLESELETKTKDIHAAEANAVALQKQSEGFLLEYDRLLE  184



>gb|KJB68573.1| hypothetical protein B456_010G251300 [Gossypium raimondii]
Length=222

 Score =   196 bits (499),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 136/178 (76%), Gaps = 3/178 (2%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESINP---  362
            S KTP RKL+I+ LDR KRGRGP+VVK+VA TVFV+M+ +VYS+ EIQ R ++   P   
Sbjct  20   SFKTPFRKLVIMGLDRLKRGRGPVVVKTVAGTVFVVMVSSVYSMMEIQKRWVDDDGPVSS  79

Query  361  TDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGG  182
            TDQVL+ + +L+A+LMG  +FL+LMIDRLHHYIRELR+ RK M+A KK  +G D+ K  G
Sbjct  80   TDQVLMVRHLLEATLMGATIFLALMIDRLHHYIRELRIRRKTMDAVKKQGQGSDDKKPDG  139

Query  181  VEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
             ++V SL+EE+ +++ K+K+LES+ EAK +++ A + N+ + + QSE LLLEY +LL+
Sbjct  140  FDKVKSLEEEVMTLREKLKQLESDIEAKTKQINAAEVNTVALRKQSEGLLLEYDRLLE  197



>ref|XP_009797812.1| PREDICTED: uncharacterized protein LOC104244159 [Nicotiana sylvestris]
Length=220

 Score =   196 bits (498),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 132/176 (75%), Gaps = 3/176 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPTD  356
            KTPLRK++I+ LDR KRGRGP+VVK++  T+F++M+ T+YSV  I+ R ++   +I PTD
Sbjct  22   KTPLRKVVIMGLDRIKRGRGPIVVKTIGGTIFMVMLSTIYSVVSIRKRWIDEDGNITPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            Q+L+AQ +L+ASLMGF LFL+LM+DRLHHYIRELR+ RK+MEA  K +RGF++GKNG  +
Sbjct  82   QILMAQHLLEASLMGFSLFLALMVDRLHHYIRELRMRRKSMEAVNKQNRGFEDGKNGASD  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            ++ SL+EE ++++ KIKKLE   E K  E    + NS + K QSE   LE   LL+
Sbjct  142  DMKSLEEEASALRLKIKKLELCLEEKARETSDAEANSVALKKQSENFRLENDYLLE  197



>ref|XP_011008025.1| PREDICTED: uncharacterized protein LOC105113519 [Populus euphratica]
Length=219

 Score =   196 bits (498),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 136/176 (77%), Gaps = 6/176 (3%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPTD  356
            KTPLRKLLI+SLDR KRGRGP++VK+VA TVFV+++ +VYS+ +IQ R ++   ++NPTD
Sbjct  22   KTPLRKLLIMSLDRVKRGRGPVMVKTVAGTVFVVLMSSVYSMVKIQKRWIDDGGAVNPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            QVLLA+ +L+A+LMG +LFL LMIDRLHHYIRELR+ RK ME  KK +R F++GK   VE
Sbjct  82   QVLLAKHLLEATLMGSILFLGLMIDRLHHYIRELRVRRKTMEDVKKQNRSFEDGK---VE  138

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            E  +L+ E ++++ K+++LESE E K +EV   + N+ +   QSE  LLEY +LL+
Sbjct  139  ETKALEAEASTLREKLQQLESELEIKTKEVNTSEANAIALSKQSEGFLLEYDRLLE  194



>ref|XP_006348141.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum 
tuberosum]
Length=222

 Score =   195 bits (496),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 129/174 (74%), Gaps = 3/174 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPTD  356
            KTPLRKL+I+ LDR KRGRGP+VVK+   T+F++M+ ++YSV  I  R ++   ++ PTD
Sbjct  22   KTPLRKLVIMGLDRVKRGRGPIVVKTTGGTIFIVMLSSIYSVVSIHKRWIDEDGNVTPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            Q+L+AQ +L+ASLMGF LFL+LMIDRLHHYIRELR+ RK+MEA  K +RGF++GKNG  +
Sbjct  82   QILMAQHLLEASLMGFSLFLALMIDRLHHYIRELRMRRKSMEAVNKQNRGFEDGKNGASD  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQL  14
            ++ SL+EE ++++ KIKKLE+  E K +E    + N  + K QSE  L E   L
Sbjct  142  DMKSLEEEASALRLKIKKLEATVEEKAKESSDAEANVVALKKQSEHFLRENDSL  195



>gb|AFK47348.1| unknown [Lotus japonicus]
Length=222

 Score =   195 bits (496),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 133/176 (76%), Gaps = 3/176 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTD  356
            KTPLRKL+I+ LDR KRGRGPL+V++V ATV V+++ ++YS+  IQ R +E    +NPTD
Sbjct  22   KTPLRKLMIMGLDRLKRGRGPLMVRTVGATVLVVLLSSLYSMFNIQKRGIEDGGVVNPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            QVL+A+ +L+A+LMG VLFL+LMIDRLHHYIRELR+ RK MEA KK  RG D+GK    E
Sbjct  82   QVLMAKHLLEATLMGAVLFLALMIDRLHHYIRELRVRRKTMEAVKKQSRGSDDGKAAHSE  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            E+ +++EE   ++++I +LESE ++K +EV   + N  + + QSE  LLEY +LL+
Sbjct  142  EIRAMEEETTKLRAEINRLESELKSKTKEVDGAEANVSALRKQSEGFLLEYDRLLE  197



>ref|XP_004233786.1| PREDICTED: uncharacterized protein LOC101255462 [Solanum lycopersicum]
Length=222

 Score =   194 bits (494),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPTD  356
            KTPLRKL+I+ LDR KRGRGP+VVK+   T+FV+M+ ++YSV  I  R ++   ++ PTD
Sbjct  22   KTPLRKLIIMGLDRVKRGRGPIVVKTTGGTIFVVMLSSIYSVVSIHKRWIDEDGNVTPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            Q+L+AQ +L+ASLMGF LFL LMIDRLHHYIRELR+ RK+MEA  K +RGF++GKNG  +
Sbjct  82   QILMAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRRKSMEAVNKQNRGFEDGKNGASD  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQL  14
            ++ SL+EE  +++ KIKKLE+  E K +E    + N  + K QSE  L E   L
Sbjct  142  DMKSLEEEAGALRLKIKKLEATVEEKAKESSDAEANVVALKKQSEHFLRENDSL  195



>ref|XP_004231615.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum 
lycopersicum]
Length=222

 Score =   194 bits (492),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 134/176 (76%), Gaps = 3/176 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPTD  356
            KTPLRKL+I+ LDR KRGRGP++VK+VA TVFV+M+ T+YSV  I +R ++    I PTD
Sbjct  22   KTPLRKLVIMGLDRVKRGRGPIIVKTVAGTVFVVMMSTIYSVASIHTRWVDEGGDITPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            Q+LLAQ +L+ASLMGF LFL+ MIDRLHHYIREL + RK MEA KK +R F++GKNG  E
Sbjct  82   QILLAQHLLEASLMGFSLFLAFMIDRLHHYIRELSMRRKTMEAVKKQNRAFEDGKNGASE  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            E+ +L+ E ++++ KI++LE E E K +E  + + N+ + K QSE  LLEY +LL+
Sbjct  142  EIKTLEGEASALREKIRQLELELEEKAKEASSAEANAGALKKQSEGFLLEYDRLLE  197



>ref|XP_003534595.1| PREDICTED: B-cell receptor-associated protein 31 [Glycine max]
 gb|KHN40872.1| B-cell receptor-associated protein 31 [Glycine soja]
Length=222

 Score =   194 bits (492),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 133/176 (76%), Gaps = 3/176 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTD  356
            KTPLRKL+I+ LDR KRGRGPL+VK+VA TV V+   +VYS+  IQ R +E    +NPTD
Sbjct  22   KTPLRKLVIMGLDRLKRGRGPLMVKTVAGTVLVVFFSSVYSMVNIQKRGIEEGAIVNPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            QVL+A+ +L+A+LMG +LFL+LMIDRLHHYIRELR+ RK MEA KK  RG ++GK    E
Sbjct  82   QVLMAKHLLEATLMGAILFLALMIDRLHHYIRELRIRRKGMEAVKKQTRGTEDGKVANSE  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            E+ +++EE A +++++ +LESE ++K ++V A + N  + + QSE  LLEY +LL+
Sbjct  142  EIKAVEEERARLRAELSRLESELQSKTKDVDAAEANVAALRKQSEGFLLEYDRLLE  197



>gb|ACU14586.1| unknown [Glycine max]
Length=225

 Score =   193 bits (490),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 133/176 (76%), Gaps = 3/176 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTD  356
            KTPLRKL+I+ LDR KRGRGPL+VK+VA TV V+   +VYS+  IQ R +E    +NPTD
Sbjct  22   KTPLRKLVIMGLDRLKRGRGPLMVKTVAGTVLVVFFSSVYSMVNIQKRGIEEGAVVNPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            QVL+A+ +L+A+LMG +LFL+LMIDRLHHYIRELR+ RK MEA KK  RG ++GK    E
Sbjct  82   QVLMAKHLLEATLMGAILFLALMIDRLHHYIRELRIRRKGMEAVKKQTRGTEDGKVANSE  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            E+ +++EE A +++++ +LESE ++K ++V A + N  + + QSE  LLEY +LL+
Sbjct  142  EIKAVEEERARLRAELSRLESELQSKTKDVDAAEANVAALRKQSEGFLLEYDRLLE  197



>ref|XP_008440020.1| PREDICTED: B-cell receptor-associated protein 29 [Cucumis melo]
Length=221

 Score =   192 bits (488),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 137/177 (77%), Gaps = 2/177 (1%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPT  359
            S KTPLRKL+I+++DR KRGRGP++VK+VA TV ++++ +VYS+  IQ R ++  +INPT
Sbjct  20   SFKTPLRKLVILAVDRMKRGRGPIMVKTVAGTVLIVLLSSVYSMVTIQKRWIDDGAINPT  79

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            DQVL+ + +L+A+LMG  LFL+LMIDRLHHY+RELRL RK MEA KK  R  ++GK    
Sbjct  80   DQVLMVKHLLEATLMGGSLFLALMIDRLHHYMRELRLRRKGMEAIKKQSRALEDGKVSKS  139

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            EE+ +L+EE  ++++K+K+LESE ++K ++V A + N  + + QSE LLLEY +LL+
Sbjct  140  EEIKALEEERTTLETKLKQLESELDSKTKDVTASEANVVALRKQSEGLLLEYDRLLE  196



>gb|KEH36901.1| B-cell receptor-associated-like protein [Medicago truncatula]
Length=222

 Score =   192 bits (489),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 137/176 (78%), Gaps = 3/176 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPTD  356
            KTPLRKL+I++LDR KRGRGP++VK+VA TV V++  +VYS+ +IQ R +E   S+NPTD
Sbjct  22   KTPLRKLVIMALDRLKRGRGPVMVKTVAGTVLVVLSSSVYSMMKIQQRGIEDGASVNPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            QVL+A+ +L+A+LMG +LFL+LMIDRLHHYIRELR+ RK+MEA KK  RG ++ K G  +
Sbjct  82   QVLMAKHLLEATLMGAILFLALMIDRLHHYIRELRIRRKSMEAVKKQMRGAEDAKAGTSD  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            E  ++++E A +++++ +LESE ++K +EV A + +  + + QSE  LLEY +LL+
Sbjct  142  ETKTMEQEAAKLRAEVGRLESELQSKDKEVGAAEASVSALRKQSEGFLLEYDRLLE  197



>gb|KHG15358.1| B-cell receptor-associated 31 [Gossypium arboreum]
Length=222

 Score =   192 bits (488),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 135/178 (76%), Gaps = 3/178 (2%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESINP---  362
            S KTP RKL+I+ LDR KRGRGP+VVK+VA TVFV+M+ +VYS+ EIQ R +    P   
Sbjct  20   SFKTPFRKLVIMGLDRLKRGRGPVVVKTVAGTVFVVMVSSVYSMMEIQKRWVGDDGPVSS  79

Query  361  TDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGG  182
            TDQVL+ + +L+A+LMG  +FL+LMIDRLHHYIRELR+ RK M+A KK  +G ++ K  G
Sbjct  80   TDQVLMVRHLLEATLMGATIFLALMIDRLHHYIRELRIRRKTMDAVKKQGQGSNDKKPDG  139

Query  181  VEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
             +++ SL+EE+ +++ K+K+LES+ EAK +++ A + N+ + + QSE LLLEY +LL+
Sbjct  140  FDKIKSLEEEVMTLREKLKQLESDIEAKTKQINAAEVNTVALRKQSEGLLLEYDRLLE  197



>gb|AFK46642.1| unknown [Medicago truncatula]
Length=222

 Score =   192 bits (487),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 136/176 (77%), Gaps = 3/176 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPTD  356
            KTPLRKL+I++LDR KRGRGP++VK+VA TV V++  +VYS+ +IQ R +E   S+NPTD
Sbjct  22   KTPLRKLVIMALDRLKRGRGPVMVKTVAGTVLVVLSSSVYSMMKIQQRGIEDGASVNPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            QVL+A+ +L+A+LMG +LFL+LMIDRLHHYIRELR+ RK+MEA KK  RG ++ K G  +
Sbjct  82   QVLMAKHLLEATLMGAILFLALMIDRLHHYIRELRIRRKSMEAVKKQMRGAEDAKAGTSD  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            E  ++++E A +++++ +LESE ++K +EV A +    + + QSE  LLEY +LL+
Sbjct  142  ETKTMEQEAAKLRAEVGRLESELQSKDKEVGAAEAGVSALRKQSEGFLLEYDRLLE  197



>ref|XP_004151895.1| PREDICTED: uncharacterized protein LOC101218101 [Cucumis sativus]
 gb|KGN63240.1| hypothetical protein Csa_2G416790 [Cucumis sativus]
Length=210

 Score =   191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 134/175 (77%), Gaps = 5/175 (3%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            +TPLRKL+I +LDR KRG+GP+VV+++A TVFV+++ +VYS+ +I +R +E+  +NPTDQ
Sbjct  22   RTPLRKLVIFTLDRLKRGKGPIVVQTIAGTVFVVLLSSVYSMLKIHNRMVEAGEVNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL++  +L+ASLMGF+LFL+LMIDRLHHYIRELRLLRK ME AKK  R     ++   E+
Sbjct  82   VLMSNHLLEASLMGFLLFLALMIDRLHHYIRELRLLRKTMEVAKKQIRA---SEDASAEK  138

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            + +L EE  +M++KI KLESE E K +E    +  +++ + QSE+ LLEY +LL+
Sbjct  139  LKALGEEATTMRNKITKLESEVEVKTKEANDAEAETDALRKQSEEYLLEYDRLLE  193



>gb|KFK40615.1| hypothetical protein AALP_AA2G019200 [Arabis alpina]
Length=221

 Score =   191 bits (484),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 135/177 (76%), Gaps = 2/177 (1%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL--ESINPT  359
            S KTP+RK LI+ LDR+KRGRGP+VVK+V+ T+FV+ + +VYS+ +IQ R     S+NPT
Sbjct  20   SFKTPIRKFLIMGLDRSKRGRGPMVVKTVSVTIFVVFVSSVYSMMKIQKRWFVEGSVNPT  79

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            D+V++A+ +L+++LMG VLFL LMIDRLHHY+RELR+ RK+MEA KK   GF++GK G  
Sbjct  80   DEVIMAKHLLESTLMGGVLFLGLMIDRLHHYMRELRVRRKSMEAIKKQTVGFESGKVGAS  139

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            +E+  L++E+ ++  K K LESE E   +EV++++ NS + + QSE  L+E+ +LL+
Sbjct  140  DEIKKLEDEVKALLEKEKHLESELETMTKEVRSEESNSVALQKQSEGFLIEFNRLLE  196



>gb|KHG10853.1| B-cell receptor-associated 31 [Gossypium arboreum]
Length=219

 Score =   190 bits (483),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 138/177 (78%), Gaps = 4/177 (2%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPT  359
            S KTPLRKL ++ LDR KRGRGPL+VK+VAAT+ V+MI +VYS+  IQ R ++  S NPT
Sbjct  20   SFKTPLRKLTLMVLDRVKRGRGPLMVKTVAATIAVVMISSVYSMMMIQKRWIDDGSANPT  79

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            +Q+L+ + +L+A+LMG VLFL+LMIDRLHHYIRELR+ RK+MEA KK   G ++GK+GG 
Sbjct  80   EQILMVKHLLEATLMGGVLFLALMIDRLHHYIRELRIRRKSMEAIKKQ--GPEDGKSGGS  137

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            ++V +L+ E+ ++++K+K+LES+ E K +E+ A   N+ + + QSE  LLEY +LL+
Sbjct  138  DKVKALEGEVTTLQAKLKQLESDLETKTKEMDAADANAVALRKQSEGFLLEYDRLLE  194



>ref|XP_004158560.1| PREDICTED: uncharacterized LOC101218101 [Cucumis sativus]
Length=210

 Score =   190 bits (482),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 134/175 (77%), Gaps = 5/175 (3%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            +TPLRKL+I +LDR KRG+GP+VV+++A TVFV+++ +VYS+ +I +R +E+  +NPTDQ
Sbjct  22   RTPLRKLVIFTLDRLKRGKGPIVVQTIAGTVFVVLLSSVYSMLKIHNRMVEAGEVNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL++  +L+ASLMGF+LFL+LMIDRLHHYIRELRLLRK ME AKK  R     ++   E+
Sbjct  82   VLMSNHLLEASLMGFLLFLALMIDRLHHYIRELRLLRKTMEVAKKQIRA---SEDASAEK  138

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            + +L E+  +M++KI KLESE E K +E    +  +++ + QSE+ LLEY +LL+
Sbjct  139  LKALGEDATTMRNKITKLESEVEVKTKEANDAEAETDALRKQSEEYLLEYDRLLE  193



>ref|NP_001236308.1| uncharacterized protein LOC100526943 [Glycine max]
 gb|ACU15966.1| unknown [Glycine max]
 gb|KHN33010.1| B-cell receptor-associated protein 31 [Glycine soja]
Length=222

 Score =   189 bits (481),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 134/176 (76%), Gaps = 3/176 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTD  356
            KTPLRKL+I+ LDR KRGRGPL+VK+VA TV V+++ +VYS+ +IQ R ++    +NPTD
Sbjct  22   KTPLRKLVIMGLDRLKRGRGPLMVKTVAGTVLVVLLSSVYSMLKIQKRGIQEGAVVNPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            QVL+A+ +L+A+LM  VLFL+LMIDRLHHYIRELR+ RK MEA KK  RG ++GK    E
Sbjct  82   QVLMAKHLLEATLMVAVLFLALMIDRLHHYIRELRIRRKGMEAVKKQTRGTEDGKVANSE  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            E+ S++EE A +++++ +LESE ++K ++V   + N  + + QSE  LLEY +LL+
Sbjct  142  EIKSVEEERARLRAELSRLESELQSKTKDVDGAEANIAALRKQSEGFLLEYDRLLE  197



>ref|XP_004486174.1| PREDICTED: B-cell receptor-associated protein 29-like [Cicer 
arietinum]
Length=222

 Score =   189 bits (481),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 134/176 (76%), Gaps = 3/176 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPTD  356
            KTPLRKL+I++LDR KRGRGPL+VK++A T+ V++  ++YS+ +IQ R +E   ++NPTD
Sbjct  22   KTPLRKLVIMALDRLKRGRGPLMVKTIAGTLLVVLSSSIYSMLKIQKRGIEDAAAVNPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            QVL+A+ +L+A+LMG VLFL+LM+DRLHHYIRELR+ RK+MEA KK  RG ++ K    E
Sbjct  82   QVLMAKHLLEATLMGAVLFLALMVDRLHHYIRELRIRRKSMEAVKKQMRGSEDAKAATSE  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            +  +++EE A +++ + +LESE ++K +EV   + N  + + QSE  LLEY +LL+
Sbjct  142  DTKAMEEEAAKLRAAVNRLESELQSKNKEVGVSEANVNALRKQSEGFLLEYDRLLE  197



>gb|KJB69262.1| hypothetical protein B456_011G013000 [Gossypium raimondii]
 gb|KJB69263.1| hypothetical protein B456_011G013000 [Gossypium raimondii]
Length=219

 Score =   189 bits (480),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 138/177 (78%), Gaps = 4/177 (2%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPT  359
            S KTPLRKL ++ LDR KRGRGPL+VK+VAAT+ V+MI +VYS+  IQ R ++  S NPT
Sbjct  20   SFKTPLRKLTLMVLDRVKRGRGPLMVKTVAATIAVVMISSVYSMMTIQKRWIDDGSANPT  79

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            +Q+L+ + +L+A+LMG VLFL+LMIDRLHHYIRELR+ RK+MEA KK   G ++GK+ G 
Sbjct  80   EQILMVKHLLEATLMGGVLFLALMIDRLHHYIRELRIRRKSMEAIKKQ--GPEDGKSSGS  137

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            ++V +L+ E+ ++++K+K+LES+ E K +E+ A + N+ + + QSE  LLEY +LL+
Sbjct  138  DKVKALEGEVTTLQAKLKQLESDLETKTKEMDAAEANAVALRKQSEGFLLEYDRLLE  194



>ref|XP_006350475.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum 
tuberosum]
Length=222

 Score =   188 bits (478),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 134/176 (76%), Gaps = 3/176 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPTD  356
            KTPLRKL+I+ LDR KRGRGP+++K+VA TVFV+M+ T+YSV  I +R ++    I PTD
Sbjct  22   KTPLRKLVIMGLDRVKRGRGPIIMKTVAGTVFVVMMSTIYSVASIHTRWVDEGGDITPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            Q+LLAQ +L+ASLMGF LFL+ MID+LHHYIREL + RK MEA KK +R F++GK+G  E
Sbjct  82   QILLAQHLLEASLMGFSLFLAFMIDKLHHYIRELSIRRKTMEAVKKQNRAFEDGKSGASE  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            E+ +L+ E ++++ KI++LE E E K +E  + + N+ + K QSE  LLEY +LL+
Sbjct  142  EIKTLEGEASALREKIRQLELELEEKAKEASSAEANAGALKKQSEGFLLEYDRLLE  197



>ref|XP_004134773.1| PREDICTED: uncharacterized protein LOC101221743 [Cucumis sativus]
 ref|XP_004170033.1| PREDICTED: uncharacterized protein LOC101228301 [Cucumis sativus]
 gb|KGN49093.1| hypothetical protein Csa_6G513570 [Cucumis sativus]
Length=221

 Score =   187 bits (474),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 135/177 (76%), Gaps = 2/177 (1%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPT  359
            S KTPLRKL+I+++DR KRGRGP++VK+VA TV ++++ +VYS+  IQ R ++  +INPT
Sbjct  20   SFKTPLRKLVILAVDRMKRGRGPIMVKTVAGTVLIVLLSSVYSMVTIQKRWIDDGAINPT  79

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            DQVL+ + +L+A+LMG  LFL+LMIDRLHHY+RELRL RK MEA KK  R  ++GK    
Sbjct  80   DQVLMVKHLLEATLMGGSLFLALMIDRLHHYMRELRLRRKGMEAIKKQSRAVEDGKVSKS  139

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            EE+ +L+EE  ++++K+K+LES  ++K +++   + N  + + QSE LLLEY +LL+
Sbjct  140  EEIKALEEERTTLETKLKQLESVLDSKTKDITTSEANVVALRKQSEGLLLEYDRLLE  196



>ref|XP_008224696.1| PREDICTED: B-cell receptor-associated protein 31 [Prunus mume]
Length=222

 Score =   186 bits (473),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 135/176 (77%), Gaps = 3/176 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTD  356
            +TP RKL+I+ LD+ KRGRGP+VVK+VA TV V ++ +VYS+ +I++  ++    ++PTD
Sbjct  22   RTPFRKLVILGLDQIKRGRGPIVVKTVAGTVLVALMTSVYSIIKIKNSRIDKAAIVSPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            QVL+ + +L+A+LMG  LFL+LMIDRLHHYIRELR+ RK+MEA KK +RG ++GK   ++
Sbjct  82   QVLMVKHLLEATLMGCFLFLALMIDRLHHYIRELRIRRKSMEAIKKQNRGSEDGKASSLD  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            E+ +L+ EIA++++++K+LESE E K ++V   + N  + + QSE  LLEY +LL+
Sbjct  142  EIKALENEIATLRTRLKQLESEIETKTKDVHTAESNVLALRKQSEGFLLEYDRLLE  197



>ref|XP_002518447.1| bcr-associated protein, bap, putative [Ricinus communis]
 gb|EEF43834.1| bcr-associated protein, bap, putative [Ricinus communis]
Length=218

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 133/175 (76%), Gaps = 5/175 (3%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTP RKL+++ LDR KRG GP++VK+VA T+ V++I +VYS+ +IQ R ++   +NPTDQ
Sbjct  22   KTPFRKLVLMGLDRVKRGSGPIIVKTVAGTILVVLISSVYSMMKIQKRGIDEGFVNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+A+ +L+A+LMG +LFL+LMIDRLHHYIRELR+ RK+MEA KK  R  ++GK    EE
Sbjct  82   VLMAKHLLEATLMGAMLFLALMIDRLHHYIRELRMRRKSMEAVKKQSRVAEDGK---AEE  138

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
              +L EE+ ++++++K+LESE E K +E  A + N+ + + QSE  LLEY +LL+
Sbjct  139  NKALGEEMTTLRARLKQLESELEVKTKEAHASETNAVALRKQSEGFLLEYDRLLE  193



>ref|XP_010458605.1| PREDICTED: uncharacterized protein LOC104739838 [Camelina sativa]
Length=221

 Score =   185 bits (470),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 135/177 (76%), Gaps = 2/177 (1%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPT  359
            S KTP+RKLLI+SLDRAKRGRGP+V+++V+ATV VL + +VY++  IQ R +E  ++NPT
Sbjct  20   SFKTPIRKLLIMSLDRAKRGRGPVVIQTVSATVIVLFVASVYNMMAIQKRWIEDGAVNPT  79

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            D+V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK     +  K  G+
Sbjct  80   DEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKTMEVIKKEGALLEGVKARGL  139

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            +E+ +LKEEI S++ + ++L SE EA+ +E++ QK ++ + + QSE  L+E+ +LL+
Sbjct  140  DEIKNLKEEITSLQKRQEQLNSELEARSKEIRTQKTSAVALQKQSEGFLIEFNRLLE  196



>ref|XP_010493468.1| PREDICTED: uncharacterized protein LOC104770706 [Camelina sativa]
Length=221

 Score =   185 bits (469),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 135/177 (76%), Gaps = 2/177 (1%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPT  359
            S KTP+RKLLI+SLDRAKRGRGP+V+++V+ATV VL + +VY++  IQ R +E  ++NPT
Sbjct  20   SFKTPIRKLLIMSLDRAKRGRGPVVIQTVSATVIVLFVASVYNMMAIQKRWIEDGAVNPT  79

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            D+V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK     +  K  G+
Sbjct  80   DEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKTMEVIKKEGALLEGVKARGL  139

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            +E+ +LKEEI S++ + ++L SE EA+ +E++ QK ++ + + QSE  L+E+ +LL+
Sbjct  140  DEIKNLKEEIMSLQKRQEQLNSELEARSKEIRTQKTSAVALQKQSEGFLIEFNRLLE  196



>ref|XP_007212007.1| hypothetical protein PRUPE_ppa011145mg [Prunus persica]
 gb|EMJ13206.1| hypothetical protein PRUPE_ppa011145mg [Prunus persica]
Length=222

 Score =   185 bits (469),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 134/176 (76%), Gaps = 3/176 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTD  356
            +TP RKL+I+ LD+ KRGRGP+VVK+VA TV V ++ +VYS+ +I++  ++    ++PTD
Sbjct  22   RTPFRKLVILGLDQIKRGRGPIVVKTVAGTVLVALMTSVYSIIKIKNSRIDKAAIVSPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            QVL+ + +L+A+LMG  LFL+LMIDRLHHYIRELR+ RK+MEA KK +RG ++GK   ++
Sbjct  82   QVLMVKHLLEATLMGCSLFLALMIDRLHHYIRELRIRRKSMEAIKKQNRGSEDGKASSLD  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            E+ +L+ EIA+ ++++K+LESE E K ++V   + N  + + QSE  LLEY +LL+
Sbjct  142  EIKALENEIATSRTRLKQLESEIETKTKDVHTAESNVLALRKQSEGFLLEYDRLLE  197



>gb|EYU27763.1| hypothetical protein MIMGU_mgv1a012919mg [Erythranthe guttata]
Length=236

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 135/193 (70%), Gaps = 23/193 (12%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESI--NPTDQ  353
            KTP+RKL+I+ LDR KRGRGP+VVK+VA TVFV+M+ TVY+V +IQ R ++ +  NPTDQ
Sbjct  22   KTPVRKLVIMGLDRVKRGRGPIVVKTVAGTVFVVMMATVYNVVKIQRRWIQDVEVNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VLLA+ +L+ASLMGF LFL+LMIDRLHHYIRELR+ RK MEA KK +R F++GK     E
Sbjct  82   VLLAKHLLEASLMGFSLFLALMIDRLHHYIRELRIRRKNMEAVKKQNRIFEDGKPL---E  138

Query  172  VNSLKEEIASMKSKIKKLE------------------SECEAKGEEVKAQKDNSESFKGQ  47
            +  L+EE  S++ +IK+LE                  ++ E K +E  + + N+ + K Q
Sbjct  139  IKLLEEEKISLRGRIKQLEAQLEDKTTSLHDRINQLGTQLEEKTKEASSSETNAIALKKQ  198

Query  46   SEKLLLEYGQLLD  8
            SE  LLEY +LL+
Sbjct  199  SEGFLLEYDRLLE  211



>gb|KFK35240.1| hypothetical protein AALP_AA5G258500 [Arabis alpina]
Length=221

 Score =   184 bits (467),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 134/177 (76%), Gaps = 2/177 (1%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPT  359
            S KTP+RKLLI+SLDRAKRGRGP+V+++++ TV V+++ +VYS+  IQ R +E  ++NPT
Sbjct  20   SFKTPIRKLLIMSLDRAKRGRGPVVIQTISVTVLVVLVASVYSMMNIQKRWIEDGAMNPT  79

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            D+V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK   G +  K   +
Sbjct  80   DEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKTMEVIKKEGAGLEGVKAKAL  139

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            +EV +LKEEI S++ + K+L SE E + +E++ +K ++ + + QSE  L+E+ +LL+
Sbjct  140  DEVKNLKEEIMSLQERQKQLASEIETRSKEIRTEKTSAIALQKQSEGFLIEFNRLLE  196



>ref|XP_008784370.1| PREDICTED: B-cell receptor-associated protein 31-like [Phoenix 
dactylifera]
Length=221

 Score =   183 bits (465),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 130/175 (74%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQ  353
            KTPLRKL I+ LDR KRGRGP++VK+VAAT+ +++  +VYS+ +I+S   E  S+ PTDQ
Sbjct  22   KTPLRKLAILGLDRLKRGRGPVMVKTVAATLLIVLASSVYSIAKIRSHSTEIGSLTPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+++ +L+ASLMG+ LFL+L+IDRLHHYIRELR LRK MEA  K +R  +  K GG +E
Sbjct  82   VLMSRHLLEASLMGYSLFLALIIDRLHHYIRELRGLRKNMEAVMKQNRALEETKGGGSDE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            + S  ++I ++  +IK L+ E EA+ +E KA + N+ + + QSE  LLEY +LL+
Sbjct  142  LKSQDKDITNLNEEIKHLKLELEARTKEAKAAEANTTALRKQSEGFLLEYDRLLE  196



>ref|XP_010476134.1| PREDICTED: uncharacterized protein LOC104755448 [Camelina sativa]
Length=221

 Score =   183 bits (465),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 134/177 (76%), Gaps = 2/177 (1%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPT  359
            S KTP+RKLLI+SLDRAKRGRGP+V+++V+ TV VL + +VY++  IQ R +E  ++NPT
Sbjct  20   SFKTPIRKLLIMSLDRAKRGRGPVVIQTVSVTVIVLFVASVYNMMAIQKRWIEDGAVNPT  79

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            D+V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK     +  K  G+
Sbjct  80   DEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKTMEVIKKEGALLEGVKARGL  139

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            +E+ +LKEEI S++ + ++L SE EA+ +E++ QK ++ + + QSE  L+E+ +LL+
Sbjct  140  DEIKNLKEEIMSLRKRQEQLNSELEARSKEIRTQKTSAVALQKQSEGFLIEFNRLLE  196



>ref|XP_008229967.1| PREDICTED: B-cell receptor-associated protein 31-like [Prunus 
mume]
Length=221

 Score =   183 bits (464),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 135/174 (78%), Gaps = 2/174 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            K+PLRKL+I++LD+ KRG+GP++VK+VA TVFV+++  VY++ +I++R +ES  +NPTD+
Sbjct  22   KSPLRKLVILALDKMKRGKGPVMVKTVAGTVFVVLLAGVYTLVDIKNRTIESGMLNPTDE  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL++ ++L+ SLMGF LFLSLM+DRLHHYIRELR LRKAM+AAKK  +     KNG  E+
Sbjct  82   VLMSVKMLEISLMGFFLFLSLMLDRLHHYIRELRFLRKAMDAAKKQSQSIQEEKNGSSEQ  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  11
            + +L +E  ++++KIK LESE E K ++ KA     E+ + QSE LL+EY +LL
Sbjct  142  LKTLAQENDTLRTKIKNLESEYETKAKKAKAAGSEVEALRKQSEGLLMEYDRLL  195



>ref|XP_007215939.1| hypothetical protein PRUPE_ppa011161mg [Prunus persica]
 gb|EMJ17138.1| hypothetical protein PRUPE_ppa011161mg [Prunus persica]
Length=221

 Score =   182 bits (463),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 135/174 (78%), Gaps = 2/174 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            K+PLRKL+I++LD+ KRG+GP++VK+VA TVFV+++  VY++ +I++R +ES  +NPTD+
Sbjct  22   KSPLRKLVILALDKMKRGKGPVMVKTVAGTVFVVLLAGVYNLVDIKNRTIESGVLNPTDE  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL++ ++L+ SLMGF LFLSLM+DRLHHYIRELR LRKAM+AAKK  +     KNG  E+
Sbjct  82   VLMSVKMLEISLMGFFLFLSLMLDRLHHYIRELRFLRKAMDAAKKQSQSIQEEKNGSSEQ  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  11
            + +L +E  ++++KIK LESE E K ++ KA     E+ + QSE LL+EY +LL
Sbjct  142  LKTLAQENDTLRTKIKNLESEYETKAKKAKAAGSEVEALRKQSEGLLMEYDRLL  195



>emb|CDP04423.1| unnamed protein product [Coffea canephora]
Length=218

 Score =   182 bits (463),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 128/175 (73%), Gaps = 5/175 (3%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL+I+ +DR KRGRGP VVK+VA T+ V+M+ + Y+   I +R  +   INPTDQ
Sbjct  22   KTPLRKLVIMGIDRVKRGRGPTVVKAVAGTLSVVMMSSGYNAVAIHNRWSQDADINPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            +L A  +L+ASLMGF LFL+ MIDRLHHYIRELR+ RK+MEA KK +R  D+GKNG   +
Sbjct  82   ILFANYLLEASLMGFSLFLAFMIDRLHHYIRELRIRRKSMEAGKKQNRISDDGKNG---D  138

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
              +L+EE A++++K+K LE+E + K +E  + + N  + K QSE  LLEY +LL+
Sbjct  139  FKALEEESAALRAKVKNLEAELDEKTKEASSAEANKLALKKQSEGFLLEYDRLLE  193



>ref|XP_003596956.1| hypothetical protein MTR_2g088060 [Medicago truncatula]
 gb|ABN08523.1| Prefoldin [Medicago truncatula]
 gb|AES67207.1| B-cell receptor-associated-like protein [Medicago truncatula]
Length=222

 Score =   182 bits (462),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 132/179 (74%), Gaps = 4/179 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPTD  356
            KTPLR L+II+L++ KRGRGP++VK+V  TV  ++   +Y++ +IQ R +E   +++ TD
Sbjct  22   KTPLRNLVIITLNKVKRGRGPVIVKTVVGTVVTMLGSALYNIFKIQRRSIEGFATVDSTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            QVLL+  +LQASL+GFVLFLSLMIDRLHHYIRELRLLR A+E  KK +R F N  N    
Sbjct  82   QVLLSNHVLQASLLGFVLFLSLMIDRLHHYIRELRLLRNAVETGKKQNRCFQNNTNIKAM  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY-GQLLDXE  2
            E  SLKEEI +++ KI+KLESECE KG  VK+ +   E+FK QSE  L+EY G L+D +
Sbjct  142  EHTSLKEEIGALRFKIEKLESECEVKGSRVKSLEIEVEAFKKQSEGFLMEYDGLLIDNQ  200



>ref|XP_008342021.1| PREDICTED: B-cell receptor-associated protein 31 [Malus domestica]
 ref|XP_008342022.1| PREDICTED: B-cell receptor-associated protein 31 [Malus domestica]
 ref|XP_008342023.1| PREDICTED: B-cell receptor-associated protein 31 [Malus domestica]
 ref|XP_008342024.1| PREDICTED: B-cell receptor-associated protein 31 [Malus domestica]
Length=221

 Score =   181 bits (460),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 136/174 (78%), Gaps = 2/174 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            K+PLRKL+I++LD+ KRG+GP++VK+VA TVF++++  VY++ +I++R  ES  +NPTD+
Sbjct  22   KSPLRKLVILALDKMKRGKGPVMVKTVAGTVFIVLLANVYNLVDIKNRTNESGVLNPTDE  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL++ ++L+ SLMGF LFLSLM+DRLHHYIRELR LRKAMEAAK+ ++   + KNG  E+
Sbjct  82   VLMSMKMLENSLMGFFLFLSLMMDRLHHYIRELRFLRKAMEAAKRQNQSSQDDKNGSSEQ  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  11
            + +L +E  ++++KI+ LESE E K ++ KA     E+ + QSE LL+EY +LL
Sbjct  142  LKTLVQENETLRTKIETLESEYETKAKKAKAAGSEVEALRKQSEGLLMEYDRLL  195



>ref|XP_002889902.1| hypothetical protein ARALYDRAFT_334480 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66161.1| hypothetical protein ARALYDRAFT_334480 [Arabidopsis lyrata subsp. 
lyrata]
Length=221

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 135/177 (76%), Gaps = 2/177 (1%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPT  359
            S KTP+RKLLI+SLDR+KRGRGP+V+++V+ATV VL++ +VY++  IQ R +E   +NPT
Sbjct  20   SFKTPMRKLLIMSLDRSKRGRGPVVIQTVSATVIVLLVTSVYNMMAIQKRWIEDGVVNPT  79

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            D+V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK     +  K  G+
Sbjct  80   DEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKNMEVIKKEGALLEGVKARGL  139

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            +EV +L EEI S++ + ++L+SE EA+ +E++ ++ ++ + + QSE  L+E+ +LL+
Sbjct  140  DEVKNLMEEITSLRKRQEQLDSELEARSKEIRTERTSAVALQKQSEGFLIEFNRLLE  196



>ref|NP_849648.4| B-cell receptor-associated protein 31-like protein [Arabidopsis 
thaliana]
 gb|AAM98189.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28811.1| B-cell receptor-associated protein 31-like protein [Arabidopsis 
thaliana]
Length=221

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 135/177 (76%), Gaps = 2/177 (1%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPT  359
            S KTP+RKLLI+SLDR+KRGRGP+V+++V+ATV VL++ +VY++  IQ R +E   +NPT
Sbjct  20   SFKTPIRKLLIMSLDRSKRGRGPVVIQTVSATVIVLLVTSVYNMMGIQKRWIEDGVVNPT  79

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            D+V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK     +  K  G+
Sbjct  80   DEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKNMEVIKKEGALLEGVKARGL  139

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            +EV +L EEI S++ + ++L+SE EA+ +E++ +K ++ + + QSE  L+E+ +LL+
Sbjct  140  DEVKNLMEEITSLRKRQEQLDSELEARSKEIRTEKTSAVALQKQSEGFLIEFNRLLE  196



>ref|XP_008348138.1| PREDICTED: B-cell receptor-associated protein 31-like [Malus 
domestica]
Length=221

 Score =   181 bits (458),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 133/174 (76%), Gaps = 2/174 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            K PLRKL+I++LD+ K+G+GP++VK+VA TVF +++  VY++ +I++R +ES  +NPTD+
Sbjct  22   KNPLRKLVILALDKMKQGKGPVMVKTVAGTVFAVLMADVYNLVDIKNRTIESGVLNPTDE  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL++ ++L+ SLMGF LFLSLMIDRLHHYIRELR LRKAMEA K+ ++     KNG  ++
Sbjct  82   VLMSVKMLEISLMGFFLFLSLMIDRLHHYIRELRFLRKAMEAVKRQNQSSQEEKNGSSKQ  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  11
            + ++ +E  ++++KIK LESE E K ++ +A     E+ + QSE LL+EY +LL
Sbjct  142  LKTIVQENETLRTKIKTLESEYETKEKKAEAAGSEVEALRKQSEGLLMEYDRLL  195



>ref|XP_009353295.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
 ref|XP_009353296.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
Length=221

 Score =   180 bits (457),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 131/174 (75%), Gaps = 2/174 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            K PLRKL+I++LD+ KRG+GP++VK+VA TVF +++  V+++ +I++R +ES  + PTD+
Sbjct  22   KNPLRKLVILALDKMKRGKGPVMVKTVAGTVFAVLMADVFNLVDIKNRTIESGVLKPTDE  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            +L++ ++L+ SLMGF LFLSLM DRLHHYIRELR LRKAMEAAK+ ++     KNG  E+
Sbjct  82   ILMSMKMLEISLMGFFLFLSLMTDRLHHYIRELRFLRKAMEAAKRQNQSSQEEKNGSSEQ  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  11
            + ++ +E  ++++KIK LE E E K ++ KA     E+ K QSE LL+EY +LL
Sbjct  142  LKTIVQENETLRTKIKTLEFEYETKEKKAKAAGSEVEALKKQSEGLLMEYDRLL  195



>ref|XP_006417293.1| hypothetical protein EUTSA_v10008726mg [Eutrema salsugineum]
 gb|ESQ35646.1| hypothetical protein EUTSA_v10008726mg [Eutrema salsugineum]
Length=221

 Score =   180 bits (457),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 135/177 (76%), Gaps = 2/177 (1%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPT  359
            S KTP+RKLLI+SLDRAKRGRGP+V+++++ATV V+++ +VYS+ +IQ R +E  ++NPT
Sbjct  20   SFKTPIRKLLIMSLDRAKRGRGPVVIQTISATVCVVLVASVYSMMKIQKRGIEDGAMNPT  79

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            D+V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK     +  K    
Sbjct  80   DEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKMMEVIKKEGAVLEGVKARAS  139

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            +EV +LKEE+ S++ + K+L SE EA+ +E++ +K ++ + + QSE  L+E+ +LL+
Sbjct  140  DEVKNLKEEVVSLQERQKQLVSEIEARSKEIRTEKTSAVALEKQSEGFLIEFNRLLE  196



>ref|XP_004293309.1| PREDICTED: B-cell receptor-associated protein 31-like [Fragaria 
vesca subsp. vesca]
Length=222

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 132/176 (75%), Gaps = 3/176 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESI---NPTD  356
            +TPLRKL+I+ LD+ KRGRGP+VVK+ A TVFV+++ ++Y + +I+    +++   +PTD
Sbjct  22   RTPLRKLVIVGLDQIKRGRGPVVVKTAAGTVFVVLLTSLYGMVKIKRSGADAVGILSPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            Q+L+ + +L+ +LMGF LFL LMIDR+HHYIRELR+ RK MEA KK +RG ++GK GG++
Sbjct  82   QILMFKHLLEVTLMGFFLFLVLMIDRIHHYIRELRVRRKTMEAIKKQNRGSEDGKAGGLD  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            EV +L+ E+++ + +IK+LES  E   +E  A + + ++ + QSE  LLEY +LL+
Sbjct  142  EVKALENEMSTSRLRIKQLESNIETTTKEAHAAEASVDALRKQSEGFLLEYDRLLE  197



>ref|XP_010686812.1| PREDICTED: B-cell receptor-associated protein 31-like [Beta vulgaris 
subsp. vulgaris]
Length=220

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 129/178 (72%), Gaps = 11/178 (6%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL------ESIN  365
            K+PLRKL+I  LD+ KRGRGP+VVK+V+AT+ +  I T+YS  +IQ R +      +++N
Sbjct  22   KSPLRKLVIAVLDKIKRGRGPIVVKTVSATISIFFISTLYSTLKIQRRGIGEDGAPDALN  81

Query  364  PTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNG  185
            PTDQVL ++ +L+ASLMGF+LFLSLMIDRLHHYIRELRL RK MEA KK+D      K  
Sbjct  82   PTDQVLFSKHLLEASLMGFILFLSLMIDRLHHYIRELRLRRKTMEAVKKND-----VKCA  136

Query  184  GVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  11
            G EE+ + ++++ + K+ I++LES+ E+K +E    +   E+ + QSE LLLEY +LL
Sbjct  137  GPEEIKAREQQVETFKAMIRQLESDLESKVKEASTSEATVEALRKQSEGLLLEYDRLL  194



>ref|XP_009347127.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
Length=221

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 129/173 (75%), Gaps = 2/173 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            K PLRKL+I++LD+ KRG+GP++VK+VA TVF +++  V+++ +I++R +ES  + PTD+
Sbjct  22   KNPLRKLVILALDKMKRGKGPVMVKTVAGTVFAVLMADVFNLVDIKNRTIESGVLKPTDE  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            +L++ ++L+ SLMGF LFLSLM DRLHHYIRELR LRKAMEAAK+ ++     KNG  E+
Sbjct  82   ILMSMKMLEISLMGFFLFLSLMTDRLHHYIRELRFLRKAMEAAKRQNQSSQEEKNGSPEQ  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQL  14
            + ++ +E  ++K+KIK LESE E   ++ K      E+ + QSE LL+EY +L
Sbjct  142  LKTIVQENETLKTKIKTLESEYETNAKKAKVAGSEVEALRKQSEGLLMEYDRL  194



>emb|CDY34821.1| BnaA09g47470D [Brassica napus]
Length=221

 Score =   178 bits (452),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 133/175 (76%), Gaps = 2/175 (1%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPT  359
            S KTP+RKLLI+SLDRAKRGRGP+VV++V+ATV V+++ +VYS+ +IQ R +E  ++NPT
Sbjct  20   SFKTPIRKLLIMSLDRAKRGRGPVVVQTVSATVCVVLVASVYSMMKIQKRWVEEGAMNPT  79

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            D+V++++ +L+++LMG  LFL LMIDRLHHY+RELR+ RK MEA KK     +  K    
Sbjct  80   DEVIMSKHLLESTLMGGFLFLGLMIDRLHHYMRELRMRRKTMEAIKKEGSVLEGEKARAS  139

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQL  14
            +EV SLK+EI +++ + K+L +E EAK +E++ ++ +  + + QSE  L+E+ +L
Sbjct  140  DEVKSLKQEITALQERQKQLAAEIEAKSKEIRTEETSGIALQKQSEGFLIEFNRL  194



>ref|XP_009118164.1| PREDICTED: uncharacterized protein LOC103843216 [Brassica rapa]
Length=221

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 132/175 (75%), Gaps = 2/175 (1%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPT  359
            S KTP+RKLLI+SLDRAKRGRGP+VV++V+ATV V+++ +VY + +IQ R +E  ++NPT
Sbjct  20   SFKTPIRKLLIMSLDRAKRGRGPVVVQTVSATVCVVLVASVYGMMKIQKRWVEEGAMNPT  79

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            D+V++++ +L+++LMG  LFL LMIDRLHHY+RELR+ RK MEA KK     +  K    
Sbjct  80   DEVIMSKHLLESTLMGGFLFLGLMIDRLHHYMRELRMRRKTMEAIKKEGSVLEGEKARAS  139

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQL  14
            +EV SLK+EI +++ + K+L +E EAK +E++ ++ +  + + QSE  L+E+ +L
Sbjct  140  DEVKSLKQEITALQERQKQLAAEIEAKSKEIRTEETSGIALQKQSEGFLIEFNRL  194



>ref|XP_009419329.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
Length=210

 Score =   176 bits (446),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 128/175 (73%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQ  353
            KTPLRKL+I+ LDR KRGRGP++VK+VA TV +++  ++YS+ +I+SR  E  +  PTDQ
Sbjct  22   KTPLRKLVILGLDRFKRGRGPVMVKTVAGTVVIVLASSLYSMAKIRSRSAEFGAFTPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+++ +L+ASLMG+ LFL L+IDRLHHYIRELR LRK+MEA  K +R  +  K GG +E
Sbjct  82   VLMSRHLLEASLMGYSLFLVLIIDRLHHYIRELRGLRKSMEAVMKQNRVLEETKCGGSDE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            + +   EIA +  +IK L+ E E + +E +A + N  + K QS+ LL+EY +LL+
Sbjct  142  IKTRDREIACLNEQIKHLKFESEERIKEARAAEANVMALKKQSDDLLIEYDRLLE  196



>gb|KHN44866.1| hypothetical protein glysoja_040795 [Glycine soja]
Length=217

 Score =   175 bits (443),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 130/174 (75%), Gaps = 6/174 (3%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTP RKL+II+LDR KR       K+VAAT+ V++  ++YS+ +I+ R L++  +NPTDQ
Sbjct  22   KTPARKLVIITLDRVKRVVV----KTVAATLLVVLASSLYSIAKIRRRNLDAPVVNPTDQ  77

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  R F++GK+    E
Sbjct  78   VLVSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKQSRSFEDGKSVSAAE  137

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  11
              +L EE A +K KI+KLESECE +  + KA +   E+ + QSE  L+EY +LL
Sbjct  138  HKALLEENAMLKPKIEKLESECEVEASKAKALETEVEALRKQSEGFLMEYDRLL  191



>ref|XP_009403539.1| PREDICTED: uncharacterized protein LOC103987073 [Musa acuminata 
subsp. malaccensis]
Length=221

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 130/175 (74%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQ  353
            KTPLRKL+++ LDR KRGRGP++VK+VA TV V++  ++YS+ +I S   E  ++ PTDQ
Sbjct  22   KTPLRKLVVVGLDRLKRGRGPVMVKTVAGTVLVVLASSLYSIAKISSGSAELGALTPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+++ +L+ASLMG+ LFL+L+IDRLHHY+RELR LRK+MEA  K +R  +  K GG  E
Sbjct  82   VLMSRHLLEASLMGYSLFLALIIDRLHHYVRELRGLRKSMEAVLKQNRVLEEAKTGGSSE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            V +L   IAS+  +IK+L+SE E + +E KA +  + + K QSE LLLEY +LL+
Sbjct  142  VKALDGMIASLNEQIKQLKSESEDRLQEAKAAEARAAALKKQSEDLLLEYDRLLE  196



>ref|XP_008780367.1| PREDICTED: uncharacterized protein LOC103700158 [Phoenix dactylifera]
 ref|XP_008780411.1| PREDICTED: uncharacterized protein LOC103700158 [Phoenix dactylifera]
Length=221

 Score =   174 bits (440),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 129/175 (74%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQ  353
            KTPLRKL  + LD  KRGRGP++VK+VA TV +++  +VYS+ EI+ R  E  S+ PTDQ
Sbjct  22   KTPLRKLATLGLDHLKRGRGPVMVKTVAGTVLLVLASSVYSMVEIRGRFTEIGSLTPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL++Q +L+ASLMG+ LFL+L+IDRLHHYIRELR LRK+MEA  K +R  +  KNGG +E
Sbjct  82   VLMSQNLLEASLMGYSLFLALIIDRLHHYIRELRRLRKSMEAVMKQNRALEETKNGGSDE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            + S  +E+ ++  +IK+L+ E EA+ +E KA + ++ + K QSE  LLEY  LL+
Sbjct  142  LKSRDKEVTNLNEQIKQLKLELEARTKEAKAAEASATALKKQSEGFLLEYDHLLE  196



>ref|XP_007147709.1| hypothetical protein PHAVU_006G148100g [Phaseolus vulgaris]
 gb|ESW19703.1| hypothetical protein PHAVU_006G148100g [Phaseolus vulgaris]
Length=222

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 135/176 (77%), Gaps = 3/176 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPTD  356
            KTPLRKL+I+ LDR KRGRGPL+VK+VA T+ V+++ +VYS+ +IQ   +E   S+NPTD
Sbjct  22   KTPLRKLVIMGLDRLKRGRGPLIVKTVAGTILVVLLSSVYSMIKIQKHEIEDGGSVNPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            QVL+A+ +L+A+LMG +LFL+LMIDRLHHYIRELR+ RK MEA KK  RG ++GK    E
Sbjct  82   QVLMAKHLLEATLMGGILFLALMIDRLHHYIRELRIRRKGMEAVKKQTRGSEDGKFTFSE  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            E+ +++EE A +++++++LESE ++K ++    + N  + + QSE  LLEY +LL+
Sbjct  142  EMKAVEEERARLRAELRRLESELQSKTKDADIAEANVSALRKQSEGFLLEYDRLLE  197



>ref|XP_010533802.1| PREDICTED: uncharacterized protein LOC104809492 [Tarenaya hassleriana]
Length=221

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 137/177 (77%), Gaps = 2/177 (1%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPT  359
            S KTP+RKLLI+SLDRAKRGRGP+VVK+V ATV V+M  +VYSV +IQ R ++  ++NPT
Sbjct  20   SFKTPIRKLLIMSLDRAKRGRGPVVVKTVVATVCVVMASSVYSVMKIQKRWIDEGTVNPT  79

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            D+VL+ + +L+++LMG  LFL LMIDRLHHY+RELR+ RK+MEA KK   GF++GK    
Sbjct  80   DEVLMTRNLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKSMEAIKKQGLGFEDGKAVAS  139

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            +E+ S++E+I S++    +LESE +AK +E ++++ N+ + + QSE  LLE+ +LL+
Sbjct  140  DELKSMEEQIRSLQEIKNQLESELDAKAKEARSEESNAVALRKQSEGFLLEFNRLLE  196



>ref|XP_010546686.1| PREDICTED: uncharacterized protein LOC104818690 [Tarenaya hassleriana]
 ref|XP_010546696.1| PREDICTED: uncharacterized protein LOC104818690 [Tarenaya hassleriana]
Length=221

 Score =   170 bits (430),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 134/177 (76%), Gaps = 2/177 (1%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPT  359
            S KTP+RKLLI+SLDRAKRGRGP+VVK+VAATV V+M  +VYS+ +IQ R ++  ++NPT
Sbjct  20   SFKTPIRKLLIMSLDRAKRGRGPVVVKTVAATVCVVMASSVYSMMKIQKRWIDEGTVNPT  79

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            D+VL+ + +L+++LMG  LFL LM DRLHHY+RELR+ RK+MEA KK   GF+ GK G  
Sbjct  80   DEVLMKKNLLESTLMGGFLFLGLMTDRLHHYMRELRVRRKSMEAIKKQGLGFNGGKPGNS  139

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            +E+  ++E+I +++   K+LESE EAK +E   ++  + + + QSE  LLE+ +LL+
Sbjct  140  DEIKGMEEQIRTLQEIQKQLESELEAKTKEANGEESGAVALRQQSEGFLLEFNRLLE  196



>ref|XP_011047243.1| PREDICTED: B-cell receptor-associated protein 31-like [Populus 
euphratica]
Length=218

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 139/175 (79%), Gaps = 5/175 (3%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            + PLRKL+I+ LDR KRGRGP+VVK+VA T+ VL++  VY++  IQ+R +E+  +NPTD+
Sbjct  22   RNPLRKLVIMGLDRVKRGRGPVVVKTVAGTILVLLLSNVYTIGNIQNRKMEAGALNPTDE  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+A  +LQASL+GF+LFLSLMIDRLHHYIRELRLLRKAMEAAKK +R F++GKNG   E
Sbjct  82   VLMAMLLLQASLLGFLLFLSLMIDRLHHYIRELRLLRKAMEAAKKQNRSFEDGKNG---E  138

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               L EE+ +++SK+KKLESE EAK +E +A +  +E+ + QSE  LL+Y  LL+
Sbjct  139  GKGLGEEVEALRSKVKKLESEYEAKVKEAEAAEAKAEALRKQSEGSLLQYDHLLE  193



>ref|XP_002320470.1| hypothetical protein POPTR_0014s15290g [Populus trichocarpa]
 gb|ABK92570.1| unknown [Populus trichocarpa]
 gb|EEE98785.1| hypothetical protein POPTR_0014s15290g [Populus trichocarpa]
Length=218

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 139/175 (79%), Gaps = 5/175 (3%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            + PLRK +I+ LDR KRGRGP+VVK+VA T+ VL++  VYS+  +Q+R +E+  +NPT++
Sbjct  22   RNPLRKFVIMGLDRVKRGRGPVVVKTVAGTILVLLLSNVYSIGNMQNRKMEAGALNPTEE  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+A Q+LQASL+GF+LFLSLMIDRLHHYIRELRLLRKAMEAAKK +R F++GKNG   E
Sbjct  82   VLMAMQLLQASLLGFLLFLSLMIDRLHHYIRELRLLRKAMEAAKKQNRSFEDGKNG---E  138

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               L EE+ +++SK+KKLESE EAK +E +A +  +E+ + QSE  LL+Y  LL+
Sbjct  139  GKGLGEEVETLRSKVKKLESEYEAKVKEAEAAEAKAEALRKQSEGSLLQYDHLLE  193



>ref|XP_009390004.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009390005.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
Length=221

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 127/174 (73%), Gaps = 2/174 (1%)
 Frame = -1

Query  523  TPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--LESINPTDQV  350
            TPLRKL ++ LDR KRGRGPLVV+++AAT  V++  ++YS+ +I SR   + ++ PTDQV
Sbjct  23   TPLRKLALLGLDRLKRGRGPLVVRTIAATGLVVLGSSLYSMSKIWSRSDQIGALTPTDQV  82

Query  349  LLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEV  170
            L ++  L+ASLMG+ LFL+L+IDRLHHYIRE R LRK+MEAA K +R  +  K+G  +E+
Sbjct  83   LHSRHFLEASLMGYSLFLALIIDRLHHYIREWRGLRKSMEAATKQNRLLEEAKSGKSDEI  142

Query  169  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +E+I S+  +I++L+   E + +EVK  + N+ + + QSE LLLEY +LL+
Sbjct  143  KGREEKITSLNEEIQQLKLASEERMKEVKTAEANAIALRKQSEGLLLEYDRLLE  196



>ref|XP_008649481.1| PREDICTED: uncharacterized protein LOC103630179 [Zea mays]
 gb|AFW77553.1| hypothetical protein ZEAMMB73_124915 [Zea mays]
Length=221

 Score =   167 bits (424),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = -1

Query  523  TPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--LESINPTDQV  350
            TP+R+L ++++DRAKRGRGP++ K++A T+ ++++   YSV +I+ R   L  + PTDQV
Sbjct  23   TPVRRLALLAIDRAKRGRGPVMAKTIAGTMLLVLVSAFYSVAKIRRREGELGQLTPTDQV  82

Query  349  LLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEV  170
            L ++ +L+ASLMG+ LFL L+IDRLHHYIRELR+LRK MEA  +  R  +  K+G  +E+
Sbjct  83   LASRHLLEASLMGYSLFLGLIIDRLHHYIRELRMLRKDMEAVTEQGRTLEAAKSGSTDEI  142

Query  169  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  11
               ++E+AS+K ++++L+++ + K E +K  + NS + + QSE LL EY +L+
Sbjct  143  QGYQKEVASLKEQVQELQNQSQKKTERLKTAEANSVALQKQSEGLLAEYDRLI  195



>ref|XP_010926189.1| PREDICTED: uncharacterized protein LOC105048548 [Elaeis guineensis]
Length=221

 Score =   167 bits (424),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 128/175 (73%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            KTPLRKL I+ LDR KRGRGP++VK+VA TV V++  +VYS+ +I+ R  E+  + PTDQ
Sbjct  22   KTPLRKLAILGLDRLKRGRGPVMVKTVAGTVLVVLASSVYSMLKIRDRSAETGFLTPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL++Q +L+ASLMG+ LFL+L+IDRLHHYIRELR LRK+MEA  K +R  +  KNGG ++
Sbjct  82   VLMSQNLLEASLMGYSLFLALIIDRLHHYIRELRGLRKSMEAVMKQNRALEETKNGGSDD  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            + S  +E   +  +IK+L+ E +A  +E KA + N+ +   QSE LL EY +LL+
Sbjct  142  LKSRDKETTDLNEQIKQLKLELDAISKEAKAAEANATALGKQSEGLLQEYDRLLE  196



>ref|XP_006303826.1| hypothetical protein CARUB_v10012392mg [Capsella rubella]
 gb|EOA36724.1| hypothetical protein CARUB_v10012392mg [Capsella rubella]
Length=221

 Score =   167 bits (422),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 138/177 (78%), Gaps = 2/177 (1%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPT  359
            S KTP+RKLLI+SLDRAKRGRGP+V+++V+ATV VL++ +VY++  IQ R +E  ++NPT
Sbjct  20   SFKTPIRKLLIMSLDRAKRGRGPVVIQTVSATVIVLLVASVYNMMGIQKRWIEDGAVNPT  79

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            D+V++A+ +L+++LMG +LFL LMIDRLHHY+RELR+ RK ME  KK     +  K  G+
Sbjct  80   DEVIMAKHLLESTLMGGLLFLGLMIDRLHHYMRELRIRRKTMEVIKKEGALLEGVKARGL  139

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            +E+ +LKEEI S++ + ++L+SE EAK +E++ +K ++ + + QSE  L+E+ +LL+
Sbjct  140  DEIKTLKEEIMSLRKRQEQLDSELEAKSKEIRTEKTSAVALQKQSEGFLIEFNRLLE  196



>ref|XP_010089483.1| hypothetical protein L484_011937 [Morus notabilis]
 gb|EXB37876.1| hypothetical protein L484_011937 [Morus notabilis]
Length=253

 Score =   167 bits (422),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 135/206 (66%), Gaps = 34/206 (17%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTD  356
            KTPLR+L++++LD+ KRGRGP++VK++A TVF+L + +V S   IQ+   E+   INPTD
Sbjct  22   KTPLRQLVLMALDKVKRGRGPVMVKTIAITVFLLFVVSVCSFVNIQNHITEAGGGINPTD  81

Query  355  QVLLAQQILQASLMGFVL-----FLSLMID--------------------------RLHH  269
            QVL+A+ +L+ASLMGF L     F +L ++                          RLHH
Sbjct  82   QVLMAKHLLEASLMGFQLEIIMNFPNLYVEGSHLGFASITAIMKDYAIIASVYKNYRLHH  141

Query  268  YIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEE  89
            YIRELR+LRK MEAAKK +RG +NGKNG   E+ + +++IA +K+ IKKLESEC+ K EE
Sbjct  142  YIRELRILRKTMEAAKKQNRGHENGKNGNAAELKASEQDIAQLKATIKKLESECKTKTEE  201

Query  88   VKAQKDNSESFKGQSEKLLLEYGQLL  11
             +A +  +E+ K QSE  L+EY  LL
Sbjct  202  AEAAEGKAEALKKQSEGFLMEYDHLL  227



>ref|NP_001055067.1| Os05g0272900 [Oryza sativa Japonica Group]
 gb|AAT85231.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16981.1| Os05g0272900 [Oryza sativa Japonica Group]
 gb|EAY97334.1| hypothetical protein OsI_19258 [Oryza sativa Indica Group]
 dbj|BAG97944.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63061.1| hypothetical protein OsJ_17869 [Oryza sativa Japonica Group]
Length=221

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 124/174 (71%), Gaps = 2/174 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQ  353
            +TP R+L ++++DRAKRGRGP++VK+VAAT+ V++  + YS+ +I+ R   L  + PTDQ
Sbjct  22   RTPFRRLALLAIDRAKRGRGPVMVKTVAATMLVVLGSSGYSIAKIRRRVGDLGQLTPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL ++ +L+ASLMG+ LFL L+IDRLHHYIRELR ++K MEA  K  R  +  K+G VEE
Sbjct  82   VLASRHLLEASLMGYSLFLGLIIDRLHHYIRELRTMKKNMEAVTKQSRTLEEAKHGSVEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  11
            +   ++EI+ +  ++++ +   E K EE+K  + N+ + + QSE LL EY +L+
Sbjct  142  IQQYQKEISRLNEQVQEFKRLSETKTEELKTAEANTLALQKQSEGLLTEYERLI  195



>ref|XP_010916117.1| PREDICTED: uncharacterized protein LOC105041025 [Elaeis guineensis]
Length=221

 Score =   164 bits (416),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 127/175 (73%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQ  353
            KTPLRKL I+ LDR KRGRGP++VK+VA TV +++  +VYS+ +I+S   E  S+ PTDQ
Sbjct  22   KTPLRKLAILGLDRLKRGRGPVMVKTVAGTVLIVLASSVYSMAKIRSHSTEIGSLTPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+++ +L+ASLMG+ LFL+L+IDRLHHYIRELR LRK MEA  K +R  +  K+GG +E
Sbjct  82   VLMSRHLLEASLMGYSLFLALIIDRLHHYIRELRGLRKNMEAVMKQNRALEETKSGGSDE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            +    +EI  +  +IK+L  + E+  +E KA + N+ + + QSE  LLEY +LL+
Sbjct  142  LKLRDKEITYLNEQIKQLNLKLESSTKEAKAAEANATALRKQSEGFLLEYDRLLE  196



>emb|CDY34616.1| BnaC08g41750D [Brassica napus]
Length=224

 Score =   164 bits (415),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 129/178 (72%), Gaps = 5/178 (3%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPT  359
            S KTP+RKLLI+SLDRAKRGRGP+VV++V+ATV V+++ +VYS+ +IQ R +E  + NPT
Sbjct  20   SFKTPIRKLLIMSLDRAKRGRGPVVVQTVSATVCVVLVASVYSMMKIQKRWVEEGATNPT  79

Query  358  DQVLLAQQILQASLMGFVLFLSL---MIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKN  188
            D+V++++ +L+++LMG   F S+   MIDRLHHY+RELR+ RK ME  KK     +  K 
Sbjct  80   DEVIMSKHLLESTLMGKSSFASVAAEMIDRLHHYMRELRMRRKTMEVIKKEGSVLEGEKA  139

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQL  14
               +EV SLK+EI +++ + K+L +E EA  +E++ ++ +  + + QSE  L+E+ +L
Sbjct  140  RASDEVKSLKQEITALQERQKQLAAEMEAMSKEIRTEETSGIALQKQSEGFLIEFNRL  197



>ref|XP_006654198.1| PREDICTED: B-cell receptor-associated protein 31-like [Oryza 
brachyantha]
Length=221

 Score =   162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 125/174 (72%), Gaps = 2/174 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQ  353
            +TP R+L +++LDRAKRGRGP++V++VAAT+ V++  + YS+ +I+ R   L  + PTDQ
Sbjct  22   RTPARRLALLALDRAKRGRGPVMVRTVAATMIVVLGSSGYSIAKIRRRVGDLGQLTPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL ++ +L+ASLMG+ LFL ++IDRLHHYIRELR ++K MEA  K  R  +  K+G VE 
Sbjct  82   VLASRHLLEASLMGYSLFLGIIIDRLHHYIRELRTMKKNMEAVTKQSRVLEEAKHGSVEG  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  11
            +   ++EI+S+  ++++L+   E K EE+K  + N+ + + QSE LL EY +L+
Sbjct  142  IQQYQKEISSLNEQVQELKRLSEKKTEELKTAEANALALQKQSEGLLTEYERLI  195



>gb|KHN36526.1| ATP-dependent helicase rhp16 [Glycine soja]
Length=1121

 Score =   172 bits (437),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 117/154 (76%), Gaps = 2/154 (1%)
 Frame = -1

Query  466   PLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQILQASLMGFVLFLS  293
             P+VVK+VAAT+ V++  ++YS+ +I+ R L++   NPTDQVL+ + +L+ASLMGFVLFLS
Sbjct  942   PVVVKTVAATLLVVLASSLYSIAKIRHRNLDAPVANPTDQVLVYKHMLEASLMGFVLFLS  1001

Query  292   LMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLES  113
             LMIDRLHHYIRELRLLRKAMEAAKK  R F+ GK+    E  +L EEIA +K KI+KLES
Sbjct  1002  LMIDRLHHYIRELRLLRKAMEAAKKQSRSFEGGKSVSAAEHKALVEEIAMLKPKIEKLES  1061

Query  112   ECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  11
             ECE +  + KA +   E+ + QSE  L+EY +LL
Sbjct  1062  ECEMEASKAKALETEVEALRKQSEGFLMEYDRLL  1095



>gb|EMT11422.1| hypothetical protein F775_31561 [Aegilops tauschii]
Length=222

 Score =   161 bits (408),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 125/181 (69%), Gaps = 8/181 (4%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-------S  371
            KTPLRKL ++ LDR KRGR  P+ VK+VA  V  L+  T+YS+ EI  R  +       +
Sbjct  22   KTPLRKLAMLGLDRLKRGRRAPVAVKTVAGVVITLLASTLYSMAEISGRAGDPEAGGGAA  81

Query  370  INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK  191
            ++PTDQVL ++ +L+ASLMG+ LFL+L+IDRLH YIRELR L+K +EA  K ++  + GK
Sbjct  82   LSPTDQVLFSRHLLEASLMGYTLFLALVIDRLHQYIRELRGLKKNVEAVSKQNKTLEEGK  141

Query  190  NGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  11
            +G  +E+   +EE+A++  ++KKL+ + + K EEV   +D + + + QSE LLLEY +LL
Sbjct  142  HGRSQEIAKYQEEVATLNEEMKKLKLQVQEKTEEVHVAEDKALAIQKQSESLLLEYDRLL  201

Query  10   D  8
            +
Sbjct  202  E  202



>ref|XP_008384089.1| PREDICTED: B-cell receptor-associated protein 29-like [Malus 
domestica]
Length=222

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 133/176 (76%), Gaps = 3/176 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTD  356
            +TP RKL+I+ LD+ KRGRGP+VVK+VAATVFV+++  VYS+ +I+   ++    ++PTD
Sbjct  22   RTPFRKLVILGLDQIKRGRGPVVVKTVAATVFVVLMTNVYSIVKIRGSRIDKAAVLSPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            QVL+ + +L A+LMG  LFL+LMIDRLHHYIRELR+ RK MEA KK +RG ++GK+  ++
Sbjct  82   QVLMIKHLLDATLMGCSLFLALMIDRLHHYIRELRIRRKGMEALKKQNRGSEDGKSSSLD  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            ++  L+ E+A++ +++K+LESE E K ++V   + +  + + QSE  LLEY +LL+
Sbjct  142  KMKVLENEMATLHTRLKQLESEIETKTKDVHTAESSILALRKQSEGFLLEYDRLLE  197



>dbj|BAK02060.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92500.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=222

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 126/181 (70%), Gaps = 8/181 (4%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-------S  371
            KTPLRKL ++ LDR KRGR  P+ VK+VA  VF L+  T+YS+ EI  R  +       +
Sbjct  22   KTPLRKLAMLGLDRLKRGRRAPVAVKTVAGVVFTLLASTLYSMAEISGRAGDPEGGGGAA  81

Query  370  INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK  191
            ++PTDQVL ++ +L+ASLMG+ LFL+L+IDRLH YIRELR L+K +EA  K ++  + GK
Sbjct  82   LSPTDQVLFSRHLLEASLMGYSLFLALVIDRLHQYIRELRGLKKNVEAVSKQNKMLEEGK  141

Query  190  NGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  11
            +G  +E+   +EE+A++  ++KKL+ + + K +EV   +D + + + QSE LLLEY +LL
Sbjct  142  HGRSQEIAKYQEEVATLNEEMKKLKLQVQEKTKEVHVAQDKTLAIQKQSESLLLEYDRLL  201

Query  10   D  8
            +
Sbjct  202  E  202



>ref|NP_001046689.1| Os02g0321800 [Oryza sativa Japonica Group]
 dbj|BAD28852.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08603.1| Os02g0321800 [Oryza sativa Japonica Group]
 gb|EAZ22804.1| hypothetical protein OsJ_06479 [Oryza sativa Japonica Group]
 dbj|BAG92174.1| unnamed protein product [Oryza sativa Japonica Group]
Length=226

 Score =   159 bits (403),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 121/185 (65%), Gaps = 12/185 (6%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--------  374
            KTPLRKL ++ +DR KRGR  P+ VK+VA  V  L+  T+YS+ EI  R           
Sbjct  22   KTPLRKLAVMGIDRLKRGRRAPVAVKTVAGVVLALLASTLYSMAEISGRAGGDPESGGGG  81

Query  373  ---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  203
               S++PTDQVL ++ +L+ASLMG+ LFL+L+IDRLH YIRELR L+K +EA  KH++  
Sbjct  82   GGASLSPTDQVLFSRHLLEASLMGYSLFLALVIDRLHQYIRELRGLKKNVEAVTKHNKML  141

Query  202  DNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY  23
            +  K+G  EE    +EEI ++   +KKL+ + + K EEV   +D + + + QSE LLLEY
Sbjct  142  EEAKHGRSEETKKYQEEIGALNEDMKKLKLQVQEKTEEVHVAEDKALAIRKQSESLLLEY  201

Query  22   GQLLD  8
             +LL+
Sbjct  202  DRLLE  206



>ref|XP_009357471.1| PREDICTED: uncharacterized protein LOC103948199 [Pyrus x bretschneideri]
Length=222

 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 132/176 (75%), Gaps = 3/176 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTD  356
            +TP RKL+I+ LD+ KRGRGP+VVK+VAATV V+++  VYS+ +I+   ++    ++PTD
Sbjct  22   RTPFRKLVILGLDQIKRGRGPVVVKTVAATVLVVLMTNVYSIVKIRGSRIDKAAVLSPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            QVL+ + +L A+LMG  LFL+LMIDRLHHYIRELR+ RK MEA KK +RG ++GK+  ++
Sbjct  82   QVLMIKHLLDATLMGCSLFLALMIDRLHHYIRELRIRRKGMEALKKQNRGSEDGKSSSLD  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            ++  L+ E+A++ +++K+LESE E K ++V   + +  + + QSE  LLEY +LL+
Sbjct  142  KMKVLENEMATLHTRLKQLESEIETKTKDVHTAESSVLALRKQSEGFLLEYDRLLE  197



>ref|XP_006647215.1| PREDICTED: B-cell receptor-associated protein 29-like [Oryza 
brachyantha]
Length=225

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 121/185 (65%), Gaps = 12/185 (6%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--------  374
            KTPLRKL ++ +D  KRGR  P+ VK+VA  V  L+  T+YS+ EI  R           
Sbjct  22   KTPLRKLAVLGIDCLKRGRRAPVAVKTVAGVVTALLTSTLYSMAEISGRAGGDPESGGGG  81

Query  373  ---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  203
               S++PTDQVL ++ +L+ASLMG+ LFL+L+IDRLH YIRELR L+K +EA  KH++  
Sbjct  82   GGASLSPTDQVLFSRHLLEASLMGYSLFLALVIDRLHQYIRELRGLKKNVEAVSKHNKML  141

Query  202  DNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY  23
            +  K+G +EE    +EEIA++   +KKL+ + + K EE    +D + + + QSE LLLEY
Sbjct  142  EEAKHGSIEETKKYQEEIAALNEDMKKLKLQVQEKTEEAHIAEDKALAIRKQSESLLLEY  201

Query  22   GQLLD  8
             +LL+
Sbjct  202  DRLLE  206



>ref|XP_010234160.1| PREDICTED: uncharacterized protein LOC100839925 [Brachypodium 
distachyon]
Length=222

 Score =   158 bits (399),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 123/181 (68%), Gaps = 8/181 (4%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-------S  371
            KTPLRKL ++ LDR KRGR  P+ VK+VA  V  L+  T+YS+ EI  R  +       +
Sbjct  22   KTPLRKLAVLGLDRLKRGRRAPVAVKTVAGVVLTLLASTLYSMAEISGRTGDPESGGGGA  81

Query  370  INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK  191
            ++PTDQVL ++ +L+ASLMG+ LFL+L+IDRLH YIRELR L+K +EA  K ++  +  K
Sbjct  82   LSPTDQVLFSRHLLEASLMGYSLFLALIIDRLHQYIRELRGLKKNVEAVSKQNKMLEETK  141

Query  190  NGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  11
            +G  EE    +EEIA++  ++KKL+ + + K EEV   +D + + + QSE LLLEY +LL
Sbjct  142  HGRNEETIKYQEEIATLNEEMKKLKLQVQEKTEEVHVAEDKALAIRKQSENLLLEYDRLL  201

Query  10   D  8
            +
Sbjct  202  E  202



>ref|XP_010057913.1| PREDICTED: B-cell receptor-associated protein 31-like [Eucalyptus 
grandis]
 gb|KCW75271.1| hypothetical protein EUGRSUZ_E04024 [Eucalyptus grandis]
Length=223

 Score =   157 bits (398),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 132/177 (75%), Gaps = 4/177 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE----SINPT  359
            KTPLRKL I+ LDR KRG GP+VV +VAATV V++   VYS+ +I+ R  E    + NPT
Sbjct  22   KTPLRKLAIVGLDRVKRGHGPVVVTTVAATVCVVLGSGVYSMVKIRRRGAEDGGGAANPT  81

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            DQVL+A+ +L+ +LMG  LFL+LMIDRLHHYIRELRL RK+MEA KK  R F++GKNG +
Sbjct  82   DQVLMAKHLLECTLMGATLFLALMIDRLHHYIRELRLRRKSMEAVKKQTRAFEDGKNGNL  141

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            EE+ +L+EE   ++ K+K+LES+ + + ++V A + NS + + QSE  LLEY +LL+
Sbjct  142  EELKNLEEETRVLREKVKQLESDLDTRTKDVHAAEANSVALRKQSEGFLLEYDRLLE  198



>gb|EAY85610.1| hypothetical protein OsI_06982 [Oryza sativa Indica Group]
Length=227

 Score =   157 bits (398),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 121/186 (65%), Gaps = 13/186 (7%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRP----------  380
            KTPLRKL ++ +DR KRGR  P+ VK+VA  V  L+  T+YS+ EI  R           
Sbjct  22   KTPLRKLAVMGIDRLKRGRRAPVAVKTVAGVVLALLASTLYSMAEISGRAGGDPESGGGG  81

Query  379  --LESINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  206
                S++PTDQVL ++ +L+ASLMG+ LFL+L+IDRLH YIRELR L+K +EA  KH++ 
Sbjct  82   GGGASLSPTDQVLFSRHLLEASLMGYSLFLALVIDRLHQYIRELRGLKKNVEAVIKHNKM  141

Query  205  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  26
             +  K+G  EE    +EEI ++   +KKL+ + + K EEV   +D + + + QSE LLLE
Sbjct  142  LEEAKHGRSEETKKYQEEIGALNEDMKKLKLQVQEKTEEVHVAEDKALAIRKQSESLLLE  201

Query  25   YGQLLD  8
            Y +LL+
Sbjct  202  YDRLLE  207



>ref|XP_011086195.1| PREDICTED: B-cell receptor-associated protein 31-like [Sesamum 
indicum]
Length=221

 Score =   157 bits (397),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 122/175 (70%), Gaps = 2/175 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQ  353
            K PLRK +I+ LDR KRG GP+VV++V  TVFV+M+ T+Y+   I+ R +   + + TDQ
Sbjct  22   KNPLRKTVIMGLDRIKRGSGPIVVQTVGGTVFVVMLATLYNAVAIKRRQMRDATTDSTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            +L A+ +L ASLMGF LFL L IDRLHHYIRELR+ RK++EA KK ++  ++ K    ++
Sbjct  82   ILCARHLLGASLMGFSLFLVLTIDRLHHYIRELRIWRKSIEALKKQNQALEDEKPAVSKQ  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            +  ++EE A+++ +IK+LE++ E K +E      ++ + K QS+  L+EY +LL+
Sbjct  142  IKVMEEEKATLQERIKELETQLEEKSKEASRAGASAVALKKQSDGFLIEYERLLE  196



>ref|XP_004287957.1| PREDICTED: B-cell receptor-associated protein 31-like [Fragaria 
vesca subsp. vesca]
Length=218

 Score =   156 bits (395),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 129/175 (74%), Gaps = 5/175 (3%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            K+PLRKL+I+ LD+ KRG+GP+VVK+V  TV  ++   +Y++ E++SR  E+  +NPTD+
Sbjct  22   KSPLRKLVILGLDKLKRGKGPVVVKTVGGTVAAVLCANIYNLNELKSRTNEAGMLNPTDE  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL++ ++L+ SLMGF LFLSLMIDRLHHYIRELR LRKAMEAAKK ++     K+ G + 
Sbjct  82   VLMSMKLLEISLMGFFLFLSLMIDRLHHYIRELRFLRKAMEAAKKQNQPTQEEKSEGHK-  140

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
              +L +E  ++++K+K LESE E K ++ KA     ++ K QSE LLLEY +LL+
Sbjct  141  --TLVQENETLRAKVKNLESEHETKEKKAKATGAEVQALKKQSEGLLLEYDRLLE  193



>ref|XP_003580219.1| PREDICTED: B-cell receptor-associated protein 31-like [Brachypodium 
distachyon]
Length=221

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 124/174 (71%), Gaps = 2/174 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQ  353
            +TP R+L ++++DR+KRGRGP++ ++VAAT+F+++  + YS+ +I+ R      + PTDQ
Sbjct  22   RTPARRLALLAVDRSKRGRGPIMARTVAATMFMVLGSSGYSIAKIRRREGDFAQLTPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL ++ +L+ASLMG+ LFL L+IDRLHHYIR++R ++K+MEA  K  +  +  K  G EE
Sbjct  82   VLASRHLLEASLMGYSLFLGLVIDRLHHYIRQIRTMKKSMEAVTKQSKTLEEAKLQGAEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  11
            +   +++I+S+  +++ ++ + E K EE+K  + N+ + + QSE LL EY +L+
Sbjct  142  IQGYQKKISSLNEQVQAVKHQYETKTEELKTAEANTLALRKQSEGLLTEYERLI  195



>ref|XP_009358864.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
Length=222

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 135/176 (77%), Gaps = 3/176 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTD  356
            KTP RKL+I+ LD+ KRGRGP+VVK+VAATVFV+++  VYS+ +I++  ++    ++PTD
Sbjct  22   KTPFRKLVILGLDQIKRGRGPVVVKTVAATVFVVVMTNVYSIVKIRASRIDKAAVLSPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            QVL+ + +L A+LMG  LFL+LMIDRLHHYIRELR+ RK+MEA KK +RG ++GK+  ++
Sbjct  82   QVLMIKHLLDATLMGCSLFLALMIDRLHHYIRELRIRRKSMEALKKQNRGSEDGKSSILD  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            ++   + E+A++++++K+LESE E K ++V   + N  + + QSE  LLEY +LL+
Sbjct  142  QMKVSENEMATLRTRLKQLESEIETKTKDVHTAESNVLALRKQSEGFLLEYDRLLE  197



>ref|NP_001170289.1| LOC100384252 [Zea mays]
 gb|ACG36076.1| B-cell receptor-associated protein 31-like containing protein 
[Zea mays]
 gb|AFW71005.1| b-cell receptor-associated protein 31-like containing protein 
[Zea mays]
Length=220

 Score =   155 bits (391),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 120/179 (67%), Gaps = 6/179 (3%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES-----IN  365
            KTPLRKL ++ +DR KRGR  P+VVK+VA  +  L+  T+YS+ +I     +S       
Sbjct  22   KTPLRKLAVLVIDRLKRGRHAPVVVKTVAGVILALLASTLYSMTQIAGSTSDSDSGGGPT  81

Query  364  PTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNG  185
            PTDQVL ++ +L+A LMG+ LFL+L+IDRLH YIR+LR  +K +EA +KH++  +  K+G
Sbjct  82   PTDQVLFSRHLLEACLMGYSLFLALVIDRLHQYIRDLRRFKKDLEAVRKHNKMLEEAKHG  141

Query  184  GVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
              EE    +EEIA++  ++KKL+ + + K EEV   +D + + + QSE LL EY +LL+
Sbjct  142  NSEEAKKYQEEIATLNKEMKKLKLQVQEKTEEVHVSEDKALAIQKQSEGLLTEYDRLLE  200



>ref|NP_001154328.1| B-cell receptor-associated protein 31-like protein [Arabidopsis 
thaliana]
 gb|AEE28812.1| B-cell receptor-associated protein 31-like protein [Arabidopsis 
thaliana]
Length=220

 Score =   154 bits (388),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 131/177 (74%), Gaps = 3/177 (2%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPT  359
            S KTP+RKLLI+SLDR+KRGRGP+V+++V+ATV VL++ +VY++  IQ R +E   +NPT
Sbjct  20   SFKTPIRKLLIMSLDRSKRGRGPVVIQTVSATVIVLLVTSVYNMMGIQKRWIEDGVVNPT  79

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            D+V++A+ +L+++LM  VL L L+   LHHY+RELR+ RK ME  KK     +  K  G+
Sbjct  80   DEVIMAKHLLESTLMVRVLELCLL-LWLHHYMRELRIRRKNMEVIKKEGALLEGVKARGL  138

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            +EV +L EEI S++ + ++L+SE EA+ +E++ +K ++ + + QSE  L+E+ +LL+
Sbjct  139  DEVKNLMEEITSLRKRQEQLDSELEARSKEIRTEKTSAVALQKQSEGFLIEFNRLLE  195



>ref|XP_008371075.1| PREDICTED: B-cell receptor-associated protein 31-like [Malus 
domestica]
Length=222

 Score =   154 bits (388),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 131/176 (74%), Gaps = 3/176 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTD  356
            KTP RKL+I+ LD+ KRGRGP+VV +VAATVFV+++  VY   +I++  ++    ++PTD
Sbjct  22   KTPFRKLVILGLDQIKRGRGPVVVATVAATVFVVLMTNVYGXVKIRASRIDKAAVLSPTD  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            QVLL + +L A+LMG  LFL+LMIDRLHHYIRELR  RK+MEA KK +RG ++GK+  ++
Sbjct  82   QVLLIKHLLDATLMGCSLFLALMIDRLHHYIRELRJRRKSMEALKKQNRGSEDGKSSILD  141

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            ++   + E+A++++++K+LES+ E K ++V   + N  + + QSE  LLEY +LL+
Sbjct  142  QMKVSENEMATLRARLKQLESDIETKTKDVHTAESNVLALRKQSEGFLLEYDRLLE  197



>ref|XP_004952370.1| PREDICTED: B-cell receptor-associated protein 31-like [Setaria 
italica]
Length=219

 Score =   152 bits (384),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 116/179 (65%), Gaps = 6/179 (3%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-----SIN  365
            KTPLRKL ++ LDR KRGR  P+ VK+VA     L+  T+YS+ EI  R  +      + 
Sbjct  22   KTPLRKLAVLGLDRLKRGRRAPVAVKTVAGVFLALLASTLYSMAEISGRASDPDSGGGLT  81

Query  364  PTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNG  185
            PTDQVL ++ +L+ASLMG+ LFL L+IDRLH YIR+LR  +K +EA  KH+   +  K G
Sbjct  82   PTDQVLFSRHLLEASLMGYTLFLMLVIDRLHQYIRDLRGFKKNLEAVSKHNNMLEEAKVG  141

Query  184  GVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
              EE    +EEIA++  ++ KL+ + + K EEV   +D + + + QSE LL+EY +LL+
Sbjct  142  ISEETKKYQEEIANLNKEMNKLKLQVQEKTEEVHVAEDKALAIQKQSEGLLIEYDRLLE  200



>gb|KHG00718.1| separin [Gossypium arboreum]
 gb|KJB67240.1| hypothetical protein B456_010G182000 [Gossypium raimondii]
Length=160

 Score =   150 bits (379),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 112/141 (79%), Gaps = 4/141 (3%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESINP--TDQ  353
            KTPLRKL+++ LDRAKRGRGP++VK+V  TV V+M+  ++S+  ++ R +   N   TD+
Sbjct  22   KTPLRKLVLMVLDRAKRGRGPVIVKTVGGTVSVVMLSYIFSMMMLKKRWIVDGNASLTDE  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            +L+A+ +L+ +LMG +LFLSL+ID+LHHYI+ELR+ RK ME AKK  +GF++   GG ++
Sbjct  82   ILMAKNLLETTLMGGLLFLSLIIDKLHHYIKELRIRRKTMETAKKQGQGFEDA--GGSDK  139

Query  172  VNSLKEEIASMKSKIKKLESE  110
            V +L+EEIA+++++IK+LES+
Sbjct  140  VTALEEEIATLRARIKQLESD  160



>gb|AAC17626.1| Contains similarity to BAP31 protein gb|X81816 from Mus musculus 
[Arabidopsis thaliana]
 gb|ACB88825.1| At1g11905 [Arabidopsis thaliana]
Length=228

 Score =   149 bits (377),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 102/132 (77%), Gaps = 2/132 (2%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPT  359
            S KTP+RKLLI+SLDR+KRGRGP+V+++V+ATV VL++ +VY++  IQ R +E   +NPT
Sbjct  20   SFKTPIRKLLIMSLDRSKRGRGPVVIQTVSATVIVLLVTSVYNMMGIQKRWIEDGVVNPT  79

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            D+V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK     +  K  G+
Sbjct  80   DEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKNMEVIKKEGALLEGVKARGL  139

Query  178  EEVNSLKEEIAS  143
            +EV +L EEI S
Sbjct  140  DEVKNLMEEITS  151



>ref|XP_006847259.1| hypothetical protein AMTR_s00015p00062110, partial [Amborella 
trichopoda]
 gb|ERN08840.1| hypothetical protein AMTR_s00015p00062110, partial [Amborella 
trichopoda]
Length=219

 Score =   149 bits (377),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 127/175 (73%), Gaps = 3/175 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--LESINPTDQ  353
            +TPLRKL+++ LDR KRGRGP VVK++A TVFV+++ +V SV +IQ R   + SI PTDQ
Sbjct  22   RTPLRKLVLLGLDRVKRGRGPAVVKTLATTVFVVLVSSVNSVMKIQRRASAVGSITPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+++ +L+AS+MG+ LFL+LMIDR+HH++ ELR+LRK + ++ +      +G N     
Sbjct  82   VLMSKHMLEASMMGYALFLTLMIDRMHHHMTELRILRKQIRSSGEGKSAGGSGDNSNSNR  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
              +L+E+IA+++ K+K+L+ E EAK  E K  + N+ + + QSE  LLEY +LL+
Sbjct  142  -RALEEDIAALQEKVKELQLESEAKDREAKTAETNAMALRKQSEGFLLEYDRLLE  195



>dbj|BAJ86435.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00959.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=221

 Score =   149 bits (376),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 122/174 (70%), Gaps = 2/174 (1%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQ  353
            +TP R+L ++++D +KRGRGP++ ++VAAT+ V++  + YS+ +I+ R  E   + PTDQ
Sbjct  22   RTPARRLALLAVDCSKRGRGPVMARTVAATMLVVLGSSGYSIAKIRRREGEFAQLTPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL ++ +L+ASLMG+ LFL L+IDRLHHYIR+LR ++K MEA  K  R  +  K G  EE
Sbjct  82   VLASRHLLEASLMGYSLFLGLIIDRLHHYIRQLRAMKKNMEAVTKQSRVLEETKLGDSEE  141

Query  172  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  11
            +   +++I S+  +++ L+ + E++ EE+K  + N+ + + QSE LL EY +L+
Sbjct  142  IQRYQKKIDSLNEQVQALKHQSESQTEELKTAEINNLALRKQSEGLLTEYERLI  195



>ref|XP_003563854.1| PREDICTED: B-cell receptor-associated protein 29 [Brachypodium 
distachyon]
Length=226

 Score =   143 bits (361),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 125/180 (69%), Gaps = 7/180 (4%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP----LES---I  368
            KTPLRKL +++LDR KRG+GP++V++VAATV V++  +++S+ +I        L++   +
Sbjct  22   KTPLRKLAMLALDRLKRGKGPVMVRTVAATVLVVLASSLHSMAKIHGHASGGELDAPGAL  81

Query  367  NPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKN  188
             PTDQVLLA+ +L+ASLMG+ LFL+L+IDRLH YIRE+R L+K +EA  K ++  +  K 
Sbjct  82   TPTDQVLLARHLLEASLMGYSLFLALIIDRLHRYIREMRGLKKNLEAVSKQNKTLEEVKL  141

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +     +++IAS+  +IKKL  + + K +EVK  +  + + + QSE L+L+Y +LL+
Sbjct  142  VTSDGSKPYQKDIASLNEEIKKLRLQLKEKADEVKDAEARAVAAQTQSEGLMLKYDRLLE  201



>ref|NP_001057612.2| Os06g0367500 [Oryza sativa Japonica Group]
 dbj|BAD69146.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG88794.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF19526.2| Os06g0367500 [Oryza sativa Japonica Group]
Length=199

 Score =   140 bits (352),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 120/174 (69%), Gaps = 9/174 (5%)
 Frame = -1

Query  502  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--------SINPTDQVL  347
            ++ LDR KRGRGP++V++VAATV V++  +V+S+ +I+ R           ++ PTDQVL
Sbjct  1    MLGLDRLKRGRGPVMVRTVAATVLVVLASSVHSMNKIRGRAAGELDGAGAGTLTPTDQVL  60

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK-NGGVEEV  170
            LA+ +L+ASLMG+ LFL+L+IDRLH+YIRE+R L++ +EAA K ++  D  K  G  +E 
Sbjct  61   LARHLLEASLMGYSLFLALVIDRLHNYIREVRGLKRNLEAASKLNKTLDEAKLIGSSDES  120

Query  169  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
             + +++IAS+  +IKK++ + + K  E K  +  + + + QSE L++EY  L++
Sbjct  121  KTYQKDIASLNEEIKKMKRQLKEKANEAKDAEAKALAAQKQSEGLMIEYNHLVE  174



>gb|ADE75913.1| unknown [Picea sitchensis]
Length=228

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 116/179 (65%), Gaps = 8/179 (4%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  347
            PLRKL+I  LD+ K G+G  +VK++  T+ V++  ++ S+ +IQ+R ++  +I PTDQ+L
Sbjct  25   PLRKLIIKILDQTKTGKGSAIVKTLGGTMLVILASSITSILKIQTRSVKMGTIAPTDQIL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD------NGKNG  185
            +   +L+ASLMGF LFL+++IDRLHHYIREL  LR  ME+ +K  +           +  
Sbjct  85   MRTHLLEASLMGFALFLAIIIDRLHHYIRELSGLRMNMESLRKQAKSSQEEYFRLKEEKE  144

Query  184  GVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            G  E+  LK+EIA +K K++KL  E + K  E +  + N+ + + QSE  LLEY +LL+
Sbjct  145  GSNEMTLLKDEIADLKQKLQKLTLESKEKEREAEVAESNALALRKQSEGFLLEYDRLLE  203



>ref|XP_002453641.1| hypothetical protein SORBIDRAFT_04g009770 [Sorghum bicolor]
 gb|EES06617.1| hypothetical protein SORBIDRAFT_04g009770 [Sorghum bicolor]
Length=222

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 121/181 (67%), Gaps = 8/181 (4%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESI------  368
            KTPLRKL ++ +DR KRGR  P+VVK+VA  V  L+  T+YS+ +I     +S       
Sbjct  22   KTPLRKLAVLVVDRLKRGRHAPVVVKTVAGVVLALLASTLYSMSQISGGASDSDSGSGGG  81

Query  367  -NPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK  191
              PTDQVL ++ +L+A LMG+ LFL+L+IDRLH YIR+LR+ +K +EA +KH++  +  K
Sbjct  82   PTPTDQVLFSRHLLEACLMGYSLFLALVIDRLHQYIRDLRVFKKDLEAVRKHNKMLEETK  141

Query  190  NGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  11
            +G  E+    +EEIA +  ++KKL+ + + K EEV   +D + + + QSE LL+EY +LL
Sbjct  142  HGNSEDAKKYQEEIAILNKEMKKLKLQVQEKIEEVHVAEDKALTIQKQSEGLLIEYDRLL  201

Query  10   D  8
            +
Sbjct  202  E  202



>dbj|BAJ87002.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=226

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 122/180 (68%), Gaps = 7/180 (4%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-------SI  368
            KTPLRKL +++LDR KRG+ P++V++VAATV V++  +++S+ +I             ++
Sbjct  22   KTPLRKLAMLALDRLKRGQAPVMVRTVAATVLVVLASSLHSMAKIHGHAGAGELDAPGAL  81

Query  367  NPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKN  188
            +PTDQVLLA+ +L+ASLMG++LFL+L+IDRLH YIRE+R L+K +EA  K ++  +  ++
Sbjct  82   SPTDQVLLARHLLEASLMGYILFLALVIDRLHSYIREMRGLKKNLEAVSKQNKTLEEARS  141

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            G  +E      ++AS+  +IKKL+ + + K +E K  +  + + + QSE L  +Y  LL+
Sbjct  142  GKSDESKPHHNDMASLNEEIKKLKLQLKEKAQEAKDAEAKAVAAQTQSEGLARKYDSLLE  201



>ref|XP_009802750.1| PREDICTED: uncharacterized protein LOC104248228 [Nicotiana sylvestris]
Length=145

 Score =   132 bits (332),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 88/105 (84%), Gaps = 2/105 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            +TPLRK ++++LDR+K+GRGP++VKS   T+FV+++  +++V  IQ+R  ES  +NPTDQ
Sbjct  22   RTPLRKPVLMALDRSKQGRGPVIVKSAGGTLFVVLVSILFNVTIIQNRATESGTVNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  218
            VLLA  +L+ASL+GF LFL+L+IDRLH+YI+ELRLLRK +EA KK
Sbjct  82   VLLANHLLEASLLGFSLFLALVIDRLHYYIKELRLLRKTLEAEKK  126



>ref|XP_009599718.1| PREDICTED: uncharacterized protein LOC104095323 [Nicotiana tomentosiformis]
Length=145

 Score =   131 bits (329),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 88/105 (84%), Gaps = 2/105 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            +TPLRK ++++LDR+K+GRGP++VKS   T+FV+++  +++V  IQ+R  +S  +NPTDQ
Sbjct  22   RTPLRKPVLMALDRSKQGRGPVIVKSAGGTLFVVLVSILFNVTIIQNRATDSGTVNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  218
            VLLA  +L+ASL+GF LFL+L+IDRLH+YI+ELRLLRK +EA KK
Sbjct  82   VLLANHLLEASLLGFSLFLALVIDRLHYYIKELRLLRKTLEAEKK  126



>ref|XP_006365288.1| PREDICTED: uncharacterized protein LOC102597522 [Solanum tuberosum]
Length=147

 Score =   131 bits (329),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 92/117 (79%), Gaps = 2/117 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            +TPLRK ++++LD++K+GRGP++VKS   T+FV+++  +++V  +Q+R  +S  +NPTDQ
Sbjct  23   RTPLRKPVLMALDKSKQGRGPVIVKSAGGTLFVVLVSILFNVTLMQNRATDSGTVNPTDQ  82

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGG  182
            VLLA  +L+ASL+GF LFL+L+IDRLH+YI+ELRLLRK +E  KK ++  D  +N  
Sbjct  83   VLLANHLLEASLLGFTLFLALVIDRLHYYIKELRLLRKTLEGEKKTNQSRDQVENAA  139



>ref|XP_004248701.1| PREDICTED: uncharacterized protein LOC101261860 [Solanum lycopersicum]
Length=147

 Score =   130 bits (327),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 90/111 (81%), Gaps = 2/111 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            +TPLRK ++++LD++K+GRGP++VKS   T+FV+++  +++V  +Q+R  +S  +NPTDQ
Sbjct  23   RTPLRKPVLMALDKSKQGRGPVIVKSAGGTLFVVLVSILFNVTLMQNRATDSGTVNPTDQ  82

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD  200
            VLLA  +L+ASL+GF LFL+L+IDRLH+YI+ELRLLRK ME  KK ++  D
Sbjct  83   VLLANHLLEASLLGFTLFLALVIDRLHYYIKELRLLRKTMEGEKKMNQNRD  133



>ref|XP_008380294.1| PREDICTED: uncharacterized protein LOC103443257 [Malus domestica]
Length=150

 Score =   128 bits (322),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 93/129 (72%), Gaps = 2/129 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            +TPLRKL+I+ LDR+K+GRGPLV KSV  T+ V    T+YSV  +Q R  E+  +NPTD+
Sbjct  22   RTPLRKLVIVGLDRSKQGRGPLVXKSVGGTILVFFSSTIYSVFSVQKRLSEAGFVNPTDE  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+A ++L+ASL+GF LFL+++IDRLH+YI+EL LLR+ +E  K   + +++ K+    E
Sbjct  82   VLMAHRLLEASLIGFSLFLAMIIDRLHYYIKELHLLRERVEEVKNLKKDYEHKKSTDPAE  141

Query  172  VNSLKEEIA  146
            V    + I+
Sbjct  142  VKKATQRIS  150



>ref|XP_008229970.1| PREDICTED: B-cell receptor-associated protein 31-like [Prunus 
mume]
Length=241

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 114/177 (64%), Gaps = 6/177 (3%)
 Frame = -1

Query  523  TPLRKLLIISLDRAK--RGRGPLVVKSVAATVFVLMIYTVYSV--QEIQSRPLES--INP  362
            TP+ K  I  LD  K  +G+G L+VK V  T+F++++   YS+    +++R  E   +NP
Sbjct  34   TPVTKTAISELDSLKLNQGKGLLLVKIVTGTLFLVVMANFYSLLRMNMKNRTNEGSGLNP  93

Query  361  TDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGG  182
            T++VL +  ILQ SL+G VLFL LMID LHHYI+ L  L  AMEAAK  ++ F   K G 
Sbjct  94   TEEVLKSMNILQISLIGIVLFLVLMIDSLHHYIKGLPSLVMAMEAAKTQNQSFRKEKTGS  153

Query  181  VEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  11
            V+++N++ +E  ++++K+K LESECE++  E    +  +E+ + +SE  L EY +LL
Sbjct  154  VQKLNTMVQEKDTLRTKLKYLESECESEANEANKARAEAEALRQESEGFLKEYDRLL  210



>ref|XP_007215894.1| hypothetical protein PRUPE_ppa010667mg [Prunus persica]
 gb|EMJ17093.1| hypothetical protein PRUPE_ppa010667mg [Prunus persica]
Length=241

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 114/176 (65%), Gaps = 6/176 (3%)
 Frame = -1

Query  520  PLRKLLIISLDRAK--RGRGPLVVKSVAATVFVLMIYTVYSVQEI--QSRPLES--INPT  359
            P+ K  I+ LD  K  +G+G L+VK V  T+F++++   YSV  I  ++R  E   +NPT
Sbjct  35   PMTKTAILELDSLKLNQGKGLLIVKIVTGTLFLVLMANFYSVLRITMKNRTNEGGGLNPT  94

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  179
            ++VL +  ILQ SL+G VLFL LMID LHHYIR L  L  AMEAAK  ++ F   K   V
Sbjct  95   EEVLKSMNILQISLIGIVLFLVLMIDSLHHYIRGLPSLVMAMEAAKTQNQSFRKEKTESV  154

Query  178  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  11
            +++N++ +E  ++++K+K LESEC+++  E    +  +E+ + +SE+ L EY +LL
Sbjct  155  QKLNTMVQEKDTLRTKLKYLESECKSEANEANKARAEAEALRQESEEFLKEYDRLL  210



>ref|XP_008226862.1| PREDICTED: uncharacterized protein LOC103326424 [Prunus mume]
Length=153

 Score =   126 bits (316),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 83/119 (70%), Gaps = 2/119 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            +TPLR L+I+ LDR+K+GRGPLV KSV  TV V    T+Y V  +Q R  E+  +NPTD+
Sbjct  22   RTPLRTLVIVGLDRSKQGRGPLVAKSVGGTVLVFFSSTLYGVFSVQKRLTEAGFVNPTDE  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  176
            VL+A ++L+ASL+GF LFL L+IDRLH+YI+EL LLRK  E  K     F+  KN   E
Sbjct  82   VLMAHRLLEASLIGFSLFLVLIIDRLHYYIKELNLLRKFNEEIKNLKNDFEQRKNADAE  140



>ref|XP_010247234.1| PREDICTED: B-cell receptor-associated protein 31-like [Nelumbo 
nucifera]
Length=218

 Score =   128 bits (321),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 115/180 (64%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L++ +LD+ K G+GP  VK++A T+ V++  ++ S+ +IQ+R   L ++ P DQVL
Sbjct  25   PLRELVMKALDQLKTGKGPATVKTIAGTMSVILASSITSLLKIQNRGTKLGTVTPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKN  188
                +L+ASLMG+ LFL  +IDRLHHY+++L  LR     +K       K        + 
Sbjct  85   WRTHLLEASLMGYSLFLGFVIDRLHHYLQKLGGLRTTARYSKQEVEKLHKDHLQLKEKEV  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               EE+  L+EEI+S+K  IKKL+ ECE K ++V++ + +  + + Q+E LLLEY +LL+
Sbjct  145  KASEEIKLLQEEISSLKENIKKLKLECEEKDKQVQSAEAHVTALQKQAEDLLLEYDRLLE  204



>ref|XP_008385961.1| PREDICTED: uncharacterized protein LOC103448478 [Malus domestica]
Length=155

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 83/104 (80%), Gaps = 2/104 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            +TP+RKL+I+ LDR+K+GRGPLV KSV  T+ V    T+YSV  +Q+R  E+  +NPTD+
Sbjct  22   QTPVRKLVIVGLDRSKQGRGPLVAKSVGGTILVFFSSTIYSVFSVQNRLTETGFVNPTDE  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  221
            VL+A ++L+ASL+GF LFL+++IDRLH+YI+EL LLRK +E  K
Sbjct  82   VLMAHRLLEASLIGFSLFLAMVIDRLHYYIKELXLLRKRVEEVK  125



>ref|XP_009381320.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009381321.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009381322.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009381323.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
Length=218

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 115/180 (64%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L +  LD+ K G+GP  VK++A T+ V++  +V S+ +IQ+R   L ++ P DQVL
Sbjct  25   PLRELAMRGLDQLKTGKGPATVKTLACTMSVILASSVASILKIQNRGAKLGTVTPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKN  188
                +++ASL+G+ LFL+L+IDRLHHY+R+L  LR+        +E  KK  + F   + 
Sbjct  85   WRTHLVEASLIGYTLFLALVIDRLHHYLRKLINLRRTANSSQEEVENLKKEQQRFKEKEE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
              + E+  L EE+AS+K +++KL+SE     +  +  + +  + + QSE+LLLEY +LL+
Sbjct  145  TSLNEIKKLHEEVASLKERLQKLKSESAEHEKRAETAEAHVTALQKQSEELLLEYDRLLE  204



>ref|XP_006479253.1| PREDICTED: B-cell receptor-associated protein 31-like isoform 
X1 [Citrus sinensis]
 gb|KDO65964.1| hypothetical protein CISIN_1g027820mg [Citrus sinensis]
Length=218

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 117/180 (65%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L+I SLD+ K G+GP  VK++A T+FV+++ ++ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQLKMGKGPATVKTIAGTMFVILLSSLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKN  188
                +L+ASL+GF LFL  +IDR+HHY+ +L  LR       + +E  +K      + + 
Sbjct  85   WRTHLLEASLIGFTLFLGFIIDRMHHYLTKLIRLRSNAGSSKEEVEQLQKEKMQLKDKEE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +E+  L+EEI+++   +KKL+SECE K ++++    +  + + QS  LLLEY +LL+
Sbjct  145  KASKELKRLQEEISTLSVNLKKLKSECEQKDKQLETADAHVIALQKQSADLLLEYDRLLE  204



>ref|XP_006452411.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
 ref|XP_006475037.1| PREDICTED: uncharacterized protein LOC102621381 [Citrus sinensis]
 gb|ESR65651.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
Length=131

 Score =   124 bits (311),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 81/108 (75%), Gaps = 2/108 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQ  353
            + PLRK +I+ LDR KRGRGPLV KSV ATV V++   VYS  EIQ R  E  +INPT++
Sbjct  22   RNPLRKFVIMGLDRLKRGRGPLVAKSVGATVLVVLCSAVYSAMEIQRRAREGGAINPTEE  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  209
            VL+A  +LQASLMGF LFL+++ DRLH+YI+EL L+R+ +E  K  ++
Sbjct  82   VLMANLLLQASLMGFSLFLAMITDRLHYYIKELHLVRQTLEGLKNLNK  129



>ref|NP_001051893.1| Os03g0848400 [Oryza sativa Japonica Group]
 gb|AAO37960.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF99895.1| B-cell receptor-associated protein 31-like containing protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF13807.1| Os03g0848400 [Oryza sativa Japonica Group]
 gb|EAZ29303.1| hypothetical protein OsJ_13364 [Oryza sativa Japonica Group]
 dbj|BAG90494.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87435.1| unnamed protein product [Oryza sativa Japonica Group]
Length=217

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 116/180 (64%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  347
            PLR++ +  +++AK G+GP  VK++A T+ V+++ +V S+ +IQ+R L+  +++P DQVL
Sbjct  25   PLREVAMRGVEQAKTGKGPATVKTLACTLSVILMSSVASILKIQNRGLKLGTVSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK-------HDRGFDNGKN  188
                +L+ASL+GF LFL+ +IDRLHHY+R+L  LRKA   +++        +R F   + 
Sbjct  85   WRTHLLEASLIGFTLFLAFVIDRLHHYLRKLITLRKAANTSREEVEKLQMENRLFREKEE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
                E+  L +EIA +   +KKL+SE E    +V   + +  + + QSE+LLLEY +LL+
Sbjct  145  KSSSEIKKLHQEIAKLNESMKKLKSESEDHERKVLEAEAHVNALQKQSEELLLEYDRLLE  204



>ref|XP_009361097.1| PREDICTED: uncharacterized protein LOC103951454 [Pyrus x bretschneideri]
Length=153

 Score =   124 bits (312),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 92/129 (71%), Gaps = 2/129 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            +TPLRKL+I+ LDR+K+GRGPLVVKSV  T+ V    T+YSV  +Q R  E+  +NPTD+
Sbjct  22   RTPLRKLVIVGLDRSKQGRGPLVVKSVGGTILVFFSSTIYSVFSVQKRLSEAGFVNPTDE  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  173
            VL+A ++L+ASL+GF LFL+++IDRLH+ I+ELRLLR  +E  K   +  ++ K+    E
Sbjct  82   VLMAHRLLEASLIGFSLFLAMIIDRLHYSIKELRLLRGLVEEVKNLKKDDEHRKSTAPAE  141

Query  172  VNSLKEEIA  146
            V    + I+
Sbjct  142  VKKATQMIS  150



>ref|XP_006650891.1| PREDICTED: B-cell receptor-associated protein 31-like [Oryza 
brachyantha]
Length=217

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 116/180 (64%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  347
            PLR+  +  +++AK+G+GP  VK++A T+ V+++ +V S+ +IQ+R L+  +++P DQVL
Sbjct  25   PLREAAMRGVEQAKQGKGPATVKTLACTLSVILMSSVASILKIQNRGLKLGTVSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK-------HDRGFDNGKN  188
                +L+ASL+GF LFL+ +IDRLHHY+R+L  LRKA   +++        +R F   + 
Sbjct  85   WRTHLLEASLIGFTLFLAFVIDRLHHYLRKLVTLRKAANTSREEVEKLQMENRSFHEKEE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
                E+  L++EIA +   +KKL+SE E   +     + +  + + QSE+LLLEY +LL+
Sbjct  145  KSSGEIKKLQQEIAKLNESMKKLKSESEDHEKAALEAEAHVNALQKQSEELLLEYDRLLE  204



>gb|KHG09837.1| hypothetical protein F383_09194 [Gossypium arboreum]
Length=218

 Score =   125 bits (314),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 118/180 (66%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L+I S+D+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSIDQLKMGKGPATVKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK-------N  188
                +L+ASL+GF LFL  +IDR+HHYI++L  LR  + ++K+     +  +       +
Sbjct  85   WRTHLLEASLIGFTLFLGFIIDRMHHYIKKLIGLRSRVGSSKEEAERIEKERIQLKEKDD  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +E+  LKEEI+++   +KKL+SE E K +++K  + +  S + QS  LLLEY +LL+
Sbjct  145  KASKEIKLLKEEISTLSENLKKLKSESEEKDKKIKTAEAHVASLQKQSADLLLEYDRLLE  204



>gb|KDO62065.1| hypothetical protein CISIN_1g045614mg, partial [Citrus sinensis]
Length=123

 Score =   122 bits (305),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 78/102 (76%), Gaps = 2/102 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQ  353
            + PLRK +I+ LDR KRGRGPLV KSV ATV V++   VYS  EIQ R  E  +INPT++
Sbjct  22   RNPLRKFVIMGLDRLKRGRGPLVAKSVGATVLVVLCSAVYSAMEIQRRAREGGAINPTEE  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEA  227
            VL+A  +LQASLMGF LFL+++ DRLH+YI+EL L+R+ +E 
Sbjct  82   VLMANLLLQASLMGFSLFLAMITDRLHYYIKELHLVRQTLEG  123



>gb|EAZ03537.1| hypothetical protein OsI_25672 [Oryza sativa Indica Group]
 gb|EAZ39454.1| hypothetical protein OsJ_23885 [Oryza sativa Japonica Group]
Length=214

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 113/176 (64%), Gaps = 5/176 (3%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L +  +++AK G+GP  VK++A T+ V+ + +V S+  IQ+R   L +++P DQVL
Sbjct  25   PLRELAMRGVEQAKDGKGPAAVKTLACTLLVIFMSSVASILRIQNRGIKLGTVSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD---NGKNGGVE  176
                +L+ASL+G++LFL+ +IDRLHHY R+L +L+K    +++          GK    +
Sbjct  85   WRTHLLEASLIGYILFLAFVIDRLHHYHRKLTILKKTANTSREEVEKLQIELQGKEDKSK  144

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            EV  L+ E+AS+  K+KKL+SE E    +    + +  + + QSE+LLLEY +LL+
Sbjct  145  EVKKLRAELASLSEKMKKLKSESEEHERQRLEAEAHVNALQKQSEELLLEYDRLLE  200



>gb|EAY92582.1| hypothetical protein OsI_14323 [Oryza sativa Indica Group]
Length=217

 Score =   124 bits (310),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 114/180 (63%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  347
            PLR+  +  +++AK G+GP  VK++A T+ V+++ +V S+ +IQ+R L+  +++P DQVL
Sbjct  25   PLREAAMRGVEQAKTGKGPATVKTLACTLSVILMSSVASILKIQNRGLKLGTVSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK-------HDRGFDNGKN  188
                +L+ASL+GF LFL+ +IDRLHHY+R+L  LRKA   +++        +R F   + 
Sbjct  85   WRTHLLEASLIGFTLFLAFVIDRLHHYLRKLITLRKAANTSREEVEKLQMENRLFREKEE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
                E+  L +EIA +   +KKL+SE E    +    + +  + + QSE+LLLEY +LL+
Sbjct  145  KSSSEIKKLHQEIAKLNESMKKLKSESEDHERKALEAEAHVNALQKQSEELLLEYDRLLE  204



>emb|CDP15777.1| unnamed protein product [Coffea canephora]
Length=134

 Score =   121 bits (304),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 85/111 (77%), Gaps = 2/111 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQ  353
            +TPLRK  ++ +D+ K+GRGP+V K+VA T+F++ I T+ ++ +IQ+R +E  +INPTDQ
Sbjct  22   RTPLRKPTVMMVDKMKQGRGPVVAKTVAGTLFMIFISTLNNIMKIQNRAVEAGTINPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD  200
            +LL   IL+A L+GF LFL +MIDRLH+YI+EL  LRK++EA KK +   D
Sbjct  82   ILLVNHILEAILLGFSLFLGVMIDRLHYYIKELHRLRKSLEATKKSNYETD  132



>gb|EYU27354.1| hypothetical protein MIMGU_mgv1a015673mg [Erythranthe guttata]
Length=149

 Score =   122 bits (305),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 95/126 (75%), Gaps = 8/126 (6%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            +TPLRK L+I LDR K+GRGP+V  +   T+FV+M+  +Y++  IQ+R LE+  +NPTDQ
Sbjct  22   RTPLRKPLLILLDRLKQGRGPVVATTAGGTLFVIMVSLLYNITTIQNRSLEAGGVNPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF------DNGK  191
            VLLA Q+L+ASL+GF LFL+LMIDR+H+YIRE+R+LRK MEA KK D+        D GK
Sbjct  82   VLLANQLLEASLLGFALFLALMIDRIHYYIREVRMLRKHMEAIKKSDQESEELKIKDKGK  141

Query  190  NGGVEE  173
            N  VE+
Sbjct  142  NKVVED  147



>ref|XP_010927692.1| PREDICTED: B-cell receptor-associated protein 31-like [Elaeis 
guineensis]
Length=218

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 113/180 (63%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR++ +  LD+ K G+GP  VK++A T+ V+++ +V S+ +IQ+R   L ++ P DQVL
Sbjct  25   PLREMAMKGLDQLKSGKGPATVKTLACTLAVILVSSVTSILKIQNRGVKLGTVTPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKN  188
                +L+ASL+G+ LFL+L+IDRLHHY R+L  LRK        +E  KK   GF   + 
Sbjct  85   WRTHLLEASLIGYTLFLALVIDRLHHYHRKLITLRKIVGTSSEEVEKLKKEHHGFKEKEE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +E+  L+ E++++  K++KL+ E E + +     +    + + QSE+LLLEY +LL+
Sbjct  145  KSSDEIKELQMEVSNLTEKLQKLKCEFEEQEKRAITAEAYVTALQKQSEELLLEYDRLLE  204



>ref|XP_006830526.1| hypothetical protein AMTR_s00117p00045900 [Amborella trichopoda]
 gb|ERM97942.1| hypothetical protein AMTR_s00117p00045900 [Amborella trichopoda]
Length=220

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 116/180 (64%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  347
            PLR+L +  LD+ K GRGP  VK++A T+ V+M  ++ S+ +IQ+R L+  ++ P DQVL
Sbjct  25   PLRELTMKGLDQLKMGRGPATVKTLACTMAVIMASSITSILKIQNRGLKIGTVTPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD-------NGKN  188
                +L+ASL+G+ LFL+L+IDR+H+Y+ +L   +K +  +K+  + F          + 
Sbjct  85   WRTHLLEASLIGYSLFLALVIDRMHNYLSKLSGSKKTLGNSKQQAKKFQEEYALLKEKQE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               EE+ +LKEEI+S+  +++KL+ E + K +  +A + N  + + QSE LLLEY +LL+
Sbjct  145  KASEEIRALKEEISSLTERLQKLKLESDEKEKRAQAAEANVIALQKQSEDLLLEYDRLLE  204



>ref|XP_004987306.1| PREDICTED: uncharacterized protein LOC101775823 [Setaria italica]
Length=163

 Score =   121 bits (304),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 99/142 (70%), Gaps = 9/142 (6%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--------LES  371
            KTPLRKL +++LDR KRGRGP++V++VAATV V++  +++S+ +I+ R         +  
Sbjct  22   KTPLRKLAVLALDRLKRGRGPVMVRTVAATVLVVLASSLHSMAQIRGRAEGELDGAGVVG  81

Query  370  INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG-FDNG  194
            + PTDQVLLA+ +L+ASLMG+ LFL+L+IDRLH+Y++E+R L+K +EA  K ++   +  
Sbjct  82   LTPTDQVLLARHLLEASLMGYSLFLALVIDRLHNYVKEIRRLKKNLEAVSKQNKTMLEEA  141

Query  193  KNGGVEEVNSLKEEIASMKSKI  128
             +G  EE     ++I+  K  +
Sbjct  142  THGRSEESERDLKDISDAKKDV  163



>gb|ACG43219.1| B-cell receptor-associated protein 31-like containing protein 
[Zea mays]
 gb|ACG44967.1| B-cell receptor-associated protein 31-like containing protein 
[Zea mays]
 tpg|DAA52496.1| TPA: b-cell receptor-associated protein 31-like containing protein 
[Zea mays]
Length=217

 Score =   123 bits (308),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 112/180 (62%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  347
            PLR+L +  +D+ K G+GP  VK++A T+ V+++ +V S+ +IQ+R L+  +++P DQVL
Sbjct  25   PLRELAMRGVDQVKTGKGPATVKTLACTLSVILMSSVASILKIQNRGLKLGTVSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKN  188
                +L+ASL+G+ LFL+ +IDRLHHY+R+L  LRK        +E  +  +R     + 
Sbjct  85   WRTHLLEASLIGYTLFLAFVIDRLHHYLRKLMTLRKTSSTSREEVEKLQMENRSLREKEE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
                E   L+ EIA +   +KKL+SE E    +    + + ++ + QSE+LLLEY +LL+
Sbjct  145  KSSSETKRLQREIARLNEGMKKLKSETEEHERKASVAEAHVDALQKQSEELLLEYDRLLE  204



>gb|KHN38264.1| hypothetical protein glysoja_003929 [Glycine soja]
Length=154

 Score =   121 bits (303),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 86/116 (74%), Gaps = 2/116 (2%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPT  359
            S   P+RKL++I LD  K+GRGPLV K+VAAT+ V++  TVY++ +IQ R  ++  +NPT
Sbjct  20   SFANPIRKLVVIGLDLLKQGRGPLVTKTVAATMCVVLSSTVYTITKIQKRSKDASIVNPT  79

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK  191
            D+VL+A ++L+A+ +GF LFL L+IDR H+YIRE+ LLRK +E  KK +   D+ K
Sbjct  80   DEVLMAHRLLEAAFLGFSLFLGLVIDRQHYYIREINLLRKNLETWKKRNHNHDSLK  135



>ref|XP_002463520.1| hypothetical protein SORBIDRAFT_01g001290 [Sorghum bicolor]
 gb|EER90518.1| hypothetical protein SORBIDRAFT_01g001290 [Sorghum bicolor]
Length=217

 Score =   123 bits (308),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 110/180 (61%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  347
            PLR+L +  +D+ K G+GP  VK++A T+ V+++  V S+ +IQ+R L+  +++P DQVL
Sbjct  25   PLRELAMRGVDQVKTGKGPATVKTLACTLSVILMSNVASILKIQNRGLKLGTVSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKN  188
                +L+ASL+G+ LFL+ +IDRLHHY+R+L  LRK        +E  +  +R     + 
Sbjct  85   WRTHLLEASLIGYTLFLAFVIDRLHHYLRKLMTLRKTSSTSREEVEKLQMENRSLREKEE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
                E   L+ EIA +   +KKL+SE E    +    + +  + + QSE+LLLEY +LL+
Sbjct  145  KSSSETKKLQREIAKLNESMKKLKSETEEHERKASVAEAHVNALQKQSEELLLEYDRLLE  204



>gb|KJB26033.1| hypothetical protein B456_004G226500 [Gossypium raimondii]
Length=202

 Score =   122 bits (307),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 114/180 (63%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L+I SLD+ K G+GP  VK++A T+  +++ +  S+ +IQ++   L +++P DQVL
Sbjct  11   PLRELVIKSLDQLKMGKGPATVKTIAGTMSAILLSSFMSILKIQNKGAKLGTMSPMDQVL  70

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAM-----EAAKKHD--RGFDNGKN  188
                +L+ASL+GF LFL  +IDR+HHYI++L  LR ++     E  + H+  +      +
Sbjct  71   WRTHLLEASLIGFTLFLGFIIDRIHHYIKKLIRLRSSIGSSTEEVQRLHEERKQLKEKDD  130

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
                E+  LKEEI+++   +KKL+SE E K  +++  + +  S + QS  LLLEY +LL+
Sbjct  131  KASLEIKKLKEEISTLSQNLKKLKSESEEKDRKIETAEAHVASLQKQSADLLLEYDRLLE  190



>ref|XP_009371858.1| PREDICTED: B-cell receptor-associated protein 31 [Pyrus x bretschneideri]
Length=219

 Score =   123 bits (308),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 115/180 (64%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L+I SLD+ K G+GP  +K++A T+ V++I    S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQIKMGKGPATIKTIAGTMSVILISDFISIVKIQNKGVKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH-DR------GFDNGKN  188
                +L+ASLMGF LFL  +IDR+HHY+ +L  LR ++ A+K+  DR           +N
Sbjct  85   WRTHLLEASLMGFTLFLGFVIDRMHHYLSKLIGLRSSVGASKEELDRLQKEKIQLKEKEN  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +E+  L+++I+++   +KKL+ EC  K + ++  + +  S + Q+  LLLEY +LL+
Sbjct  145  KSSQEIKELQDKISTLTEDLKKLKLECAEKDKSIETAESHVASLQKQAADLLLEYDRLLE  204



>ref|XP_008809940.1| PREDICTED: B-cell receptor-associated protein 31-like [Phoenix 
dactylifera]
Length=218

 Score =   122 bits (307),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 117/180 (65%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L++  LD+ K G+GP  VK++A T+ VL+  ++ S+ +IQ+R   L ++ P DQVL
Sbjct  25   PLRELVMRGLDQLKTGKGPATVKTLACTLSVLLASSITSILKIQNRGVKLGTVTPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAA-------KKHDRGFDNGKN  188
                +L+ASL+G+ LFL L+IDRLHHY+R++  L+K +  +       KK    F + ++
Sbjct  85   WRTHLLEASLIGYTLFLGLVIDRLHHYLRKMVSLKKTVGTSKEEVEKLKKEHHYFKDKED  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
                E++ L+ E+ S+  K++KL++ECE + +   + + +  S + QSE+LLLEY +LL+
Sbjct  145  KVSSEIHKLQGEVGSLTEKLQKLKTECEQQEKRAVSAEAHVVSLQKQSEELLLEYDRLLE  204



>ref|XP_006657620.1| PREDICTED: B-cell receptor-associated protein 31-like [Oryza 
brachyantha]
Length=214

 Score =   122 bits (307),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 112/176 (64%), Gaps = 5/176 (3%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L +  +++AK G+GP  VK++A T+ V+ + +V S+  IQ+R   L +++P DQVL
Sbjct  25   PLRELAMRGVEQAKDGKGPAAVKTLACTLLVIFMSSVTSILRIQNRGAKLGTVSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDN---GKNGGVE  176
                +L+ASL+G++LFL+ +IDRLHHY R+L +L+K    +++      N   GK    +
Sbjct  85   WRTHLLEASLIGYILFLAFVIDRLHHYHRKLTILKKTANTSREEVEKLQNELQGKEDNSK  144

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            E+  L+ E+A++  K+KKL+ E E         + +  + + QSE+LLLEY +LL+
Sbjct  145  EIKKLRGELATLSEKMKKLKFESEEHERRRLEAEAHVNALQKQSEELLLEYDRLLE  200



>gb|KJB26032.1| hypothetical protein B456_004G226500 [Gossypium raimondii]
Length=216

 Score =   122 bits (306),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 114/180 (63%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L+I SLD+ K G+GP  VK++A T+  +++ +  S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQLKMGKGPATVKTIAGTMSAILLSSFMSILKIQNKGAKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAM-----EAAKKHD--RGFDNGKN  188
                +L+ASL+GF LFL  +IDR+HHYI++L  LR ++     E  + H+  +      +
Sbjct  85   WRTHLLEASLIGFTLFLGFIIDRIHHYIKKLIRLRSSIGSSTEEVQRLHEERKQLKEKDD  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
                E+  LKEEI+++   +KKL+SE E K  +++  + +  S + QS  LLLEY +LL+
Sbjct  145  KASLEIKKLKEEISTLSQNLKKLKSESEEKDRKIETAEAHVASLQKQSADLLLEYDRLLE  204



>gb|KJB10919.1| hypothetical protein B456_001G232500 [Gossypium raimondii]
Length=218

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 117/180 (65%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L+I S+D+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSIDQLKMGKGPATVKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK-------N  188
                +L+ASL+GF LFL  +IDR+HHYI++L  LR  + ++K      +  +       +
Sbjct  85   WRTHLLEASLIGFTLFLGFIIDRMHHYIKKLIGLRSRVGSSKDEAERIEKERIQLKEKDD  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +E+  LKEEI+++   +KKL+SE E K ++++  + +  S + QS  LLLEY +LL+
Sbjct  145  KASKEIKLLKEEISTLSENLKKLKSESEEKDKKIEIAEAHVASLQKQSADLLLEYDRLLE  204



>ref|XP_006452412.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
 gb|ESR65652.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
Length=129

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 80/108 (74%), Gaps = 2/108 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQ  353
            + PLRK +I+ LDR KRGRGPLV KSV ATV V++   VYS  EIQ R  E  +INPT++
Sbjct  22   RNPLRKFVIMGLDRLKRGRGPLVAKSVGATVLVVLCSAVYSAMEIQRRAREGGAINPTEE  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  209
            VL+A  +LQASLMGF LFL++M+DRLH YI+  ++L + +   K+H++
Sbjct  82   VLMANLLLQASLMGFSLFLAVMMDRLHSYIKRKQILEEVINPNKQHNQ  129



>ref|NP_001141677.1| uncharacterized protein LOC100273803 precursor [Zea mays]
 gb|ACF86841.1| unknown [Zea mays]
Length=217

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 111/180 (62%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  347
            PLR+L +  +D+ K G+GP  VK++A T+ V+++  V S+ +IQ+R L+  +++P DQVL
Sbjct  25   PLRELAMRGVDQVKTGKGPATVKTLACTLSVILMSGVASILKIQNRGLKLGTVSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKN  188
                +L+ASL+G+ LFL+ +IDRLHHY+R+L  LRK        +E  +  +R     + 
Sbjct  85   WRTHLLEASLIGYTLFLAFVIDRLHHYLRKLMTLRKTSSTSREEVEKLQMENRSLREKEE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
                E   L+ EIA +   +KKL+SE E    +    + + ++ + QSE+LLLEY +LL+
Sbjct  145  KSSSETKRLQREIARLNEGMKKLKSETEEHERKASVAEAHVDALQKQSEELLLEYDRLLE  204



>ref|XP_010069636.1| PREDICTED: B-cell receptor-associated protein 31 [Eucalyptus 
grandis]
 gb|KCW58050.1| hypothetical protein EUGRSUZ_H00780 [Eucalyptus grandis]
Length=218

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 117/180 (65%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L++ SL++ K G+GP  VK++A T+ V+++ +  S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVMKSLEQLKMGKGPATVKTIAGTMSVILLSSFMSIVKIQNKGAKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKN  188
                +L+ASLMGF LFL  +IDR+HHY+++L  LR       + +E+ +K        + 
Sbjct  85   WRTHLLEASLMGFTLFLGFVIDRVHHYLQKLITLRSKEGVSKEEVESLRKEQLELKEKEG  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
              ++E+  L++EI++M   +KKL+ ECE K ++V+  + +  + + QS  LLLEY +LL+
Sbjct  145  KSLKEIKQLQKEISNMLEGLKKLKLECEEKDKKVETAESHVAALQKQSADLLLEYDRLLE  204



>ref|XP_009370674.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
 ref|XP_009334907.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
Length=218

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 112/180 (62%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L+I SLD+ K G+GP  VK++A T+ V++I +  S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQVKMGKGPATVKTIAGTMSVILISSFISIVKIQNKGVKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKN  188
                +L+ASLMGF LFL  +IDR+HHY+ +L  LR ++ A+K       K        + 
Sbjct  85   WRTHLLEASLMGFTLFLGFIIDRMHHYLSKLIGLRSSVGASKEELDRLQKETMQLKKQEE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +EV  L+ +I+++   +KKL+ EC  K + ++  + +  S + Q+  LLLEY +LL+
Sbjct  145  KASQEVKQLQAKISTLTEDLKKLKLECAEKDKSIETAECHVASLQKQAADLLLEYDRLLE  204



>gb|KHN11907.1| hypothetical protein glysoja_019880 [Glycine soja]
Length=139

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 82/107 (77%), Gaps = 2/107 (2%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPT  359
            S   PLRKL++  LD  K+GRGPLV K+VAAT+ V++  TVY++ +IQ R  ++  +NPT
Sbjct  20   SFANPLRKLVVKGLDLLKQGRGPLVTKTVAATMCVVLSSTVYTITKIQKRSKDAGIVNPT  79

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  218
            D+VL+A ++L+A+ +GF LFL L+IDR H+YIRE+ LLRK ME AKK
Sbjct  80   DEVLMAHRLLEAAFLGFSLFLGLVIDRQHYYIREINLLRKNMETAKK  126



>ref|NP_001143481.1| hypothetical protein [Zea mays]
 gb|ACF83647.1| unknown [Zea mays]
 gb|ACG32480.1| hypothetical protein [Zea mays]
 gb|AFW77082.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_955327 [Zea 
mays]
Length=161

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 90/126 (71%), Gaps = 8/126 (6%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--------LES  371
            KTPLR+L +++LD  KRGRGP++V+++AATV V++  +++S+ +I+           +  
Sbjct  22   KTPLRRLAVLALDHLKRGRGPVMVRTIAATVLVVLASSLHSMAKIRGHAEGELDGSGVVG  81

Query  370  INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK  191
            + PTDQVLLA+ +L+ASLMG+ LFL+L+IDRLH+Y++E R LRK +E   K ++  +   
Sbjct  82   LTPTDQVLLARHLLEASLMGYSLFLALVIDRLHNYVKENRRLRKKLEEVLKQNKALEEAT  141

Query  190  NGGVEE  173
            NG +EE
Sbjct  142  NGKLEE  147



>ref|XP_007049723.1| B-cell receptor-associated protein 31-like [Theobroma cacao]
 gb|EOX93880.1| B-cell receptor-associated protein 31-like [Theobroma cacao]
Length=213

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 115/180 (64%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L+I SLD+ K G+GP  +K++A T+ V+++ ++ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQLKMGKGPATMKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKN  188
                +L+ASLMGF LFL  +IDR+HHY+R+L  LR  + ++K       K         +
Sbjct  85   WRTHLLEASLMGFTLFLGFIIDRMHHYLRKLIGLRSKVGSSKEEVERLQKERIELKEKDD  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +E+  LKEEI+++   +KKL+ E E K ++++  + +  S + Q+  LLLEY +LL+
Sbjct  145  KASKEIKLLKEEISTLSENLKKLKLESEEKDKKIETAEAHVASLQKQAADLLLEYDRLLE  204



>ref|XP_011095414.1| PREDICTED: uncharacterized protein LOC105174881 [Sesamum indicum]
Length=149

 Score =   119 bits (297),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 81/110 (74%), Gaps = 8/110 (7%)
 Frame = -1

Query  478  RGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQILQASLMGFV  305
            +GRGP+V  + A T+FV+M+  ++++  IQ R +ES  +NPTDQVLLA Q+L+ASL+GF 
Sbjct  38   QGRGPIVSSTAAGTLFVIMVSILFNITSIQKRSMESASVNPTDQVLLANQLLEASLLGFA  97

Query  304  LFLSLMIDRLHHYIRELRLLRKAMEAAKKHD------RGFDNGKNGGVEE  173
            LFL LMIDR+H+YI+E+R+LRK +EA K+ D      R  + GK+  VEE
Sbjct  98   LFLWLMIDRIHYYIKEVRMLRKHLEAVKRMDQKSEEVRSKEKGKSKAVEE  147



>ref|XP_008372494.1| PREDICTED: B-cell receptor-associated protein 31-like [Malus 
domestica]
Length=219

 Score =   120 bits (300),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 115/180 (64%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L+I SLD+ K G+GP  +K++A T+ V++I    S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQIKMGKGPATIKTIAGTMSVILISDFISIVKIQNKGVKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH-DR------GFDNGKN  188
                +L+ASL+GF LFL  +IDR+HHY+ +L  LR ++ A+K+  DR           ++
Sbjct  85   WRTHLLEASLLGFTLFLGFIIDRMHHYLSKLIGLRSSVGASKEELDRLQKEKIQLKEKED  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +E+  L+++I+++   +KKL+ EC  K + ++  + +  S + Q+  LLLEY +LL+
Sbjct  145  KSSQEIKQLQDKISTLTEDLKKLKLECAEKDKSIETAESHVASLQKQAADLLLEYDRLLE  204



>ref|XP_003532279.1| PREDICTED: B-cell receptor-associated protein 31 [Glycine max]
 gb|KHN10978.1| hypothetical protein glysoja_026713 [Glycine soja]
Length=218

 Score =   120 bits (300),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 115/183 (63%), Gaps = 15/183 (8%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR L+I SLD+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRDLVIKSLDQLKMGKGPATVKTIAGTMSVILLSSLMSIIKIQNKGAKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE---  176
                +L+ASLMGF LFL  +IDR HHY+++L  LR    A+K+     +N K   V+   
Sbjct  85   WRSHLLEASLMGFTLFLGFLIDRTHHYLQKLINLRSNAGASKEE---LENLKKETVQLKE  141

Query  175  -------EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQ  17
                   E+  LKEE++ +   ++K++SE E K ++V+  + +  S + Q+  LLLEY +
Sbjct  142  KDEKASKEIKQLKEELSCLSKSLEKIKSESEEKDKKVETAEAHVASLQKQAADLLLEYDR  201

Query  16   LLD  8
            LL+
Sbjct  202  LLE  204



>ref|XP_008382607.1| PREDICTED: B-cell receptor-associated protein 31-like [Malus 
domestica]
Length=218

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 113/180 (63%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L+I SLD+ K G+GP  VK++A T+ V++I +  S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQVKMGKGPATVKTIAGTMSVILISSFISIVKIQNKGVKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH-DR------GFDNGKN  188
                +L+ASLMGF LFL  +IDR+HHY+ +L  LR ++  +K+  DR           + 
Sbjct  85   WRTHLLEASLMGFTLFLGFIIDRMHHYLSKLIGLRXSVGXSKEELDRLQKETIQLKEKEE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +EV  L+ +I+++   +KKL+ EC  K + V+  + +  S + Q+  LLLEY +LL+
Sbjct  145  KASQEVKQLQAKISTLTEDLKKLKLECAEKDKSVETAECHVASLQKQAADLLLEYDRLLE  204



>ref|XP_009410623.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410624.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410625.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410626.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410627.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410629.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
Length=218

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 111/180 (62%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--LESINPTDQVL  347
            PLR+L +  LD+ K G+GP  VK++A T+ V++  +V S+ +IQ+R   L ++ P DQVL
Sbjct  25   PLRELAMRGLDQLKTGKGPATVKTLACTMSVILASSVASILKIQNRAAKLGTVTPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLL-------RKAMEAAKKHDRGFDNGKN  188
                +L+ASL+G+ LFL+L+IDRLHHY+R+L  L       R+ ++  KK  + F   + 
Sbjct  85   WRTHLLEASLIGYTLFLALVIDRLHHYLRKLVSLKTTVGTSREEVDNLKKEQQSFKEKEK  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
              + E   L EE+  +K +++KL+ + E   +  +  + +  + + QSE+LLLEY  LL+
Sbjct  145  TSLSERKKLHEEVTRLKERLQKLKLDSEEHEKRAQTAEAHVAALQKQSEELLLEYDHLLE  204



>ref|XP_004981056.1| PREDICTED: B-cell receptor-associated protein 31-like [Setaria 
italica]
Length=217

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 111/180 (62%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  347
            PLR+L +  +D+ K G+GP  VK++A T+ V+++  V S+ +IQ+R L+  S++P DQVL
Sbjct  25   PLRELAMRVVDQVKTGKGPATVKTLACTLTVILMSDVASILKIQNRGLKLGSVSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKN  188
                +L+ASL+G+ LFL+ +IDRLHHY+R+L  LRK        +E  +  ++     + 
Sbjct  85   WRTHLLEASLIGYTLFLAFVIDRLHHYLRKLMTLRKTSSTSREEVEKLQMENQSLREKEG  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
                E+  L+ EIA +   +KKL+ E E    +  A + +  + + QSE+LLLEY +LL+
Sbjct  145  NSSGEMKKLQREIAKLNESMKKLKFENEEHERKASAAEAHVNALQKQSEELLLEYDRLLE  204



>ref|XP_008794596.1| PREDICTED: B-cell receptor-associated protein 31 [Phoenix dactylifera]
Length=218

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 116/181 (64%), Gaps = 11/181 (6%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR++ +  LD+ K G+GP  VK++A T+ V+++ +V ++ +IQ+R   L ++ P DQVL
Sbjct  25   PLREMAMKGLDQLKSGKGPATVKTLACTLSVILVSSVATILKIQNRGVKLGTVTPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK--------KHDRGFDNGK  191
                +L+ASL+G+ LFL+L+IDRLHHY+++L  LRK +  ++        +H R F   +
Sbjct  85   WRTHLLEASLIGYSLFLALVIDRLHHYLQKLINLRKTVGTSREEVEKLKMEHHR-FKEKE  143

Query  190  NGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  11
                +E+  L+ E++++  K++KL+SE E + +     +    S + QSE+LLLEY +LL
Sbjct  144  EKSSDEIKKLQVEVSNLTEKLQKLKSEFEEQEQRAITAEAYVASLRKQSEELLLEYDRLL  203

Query  10   D  8
            +
Sbjct  204  E  204



>ref|XP_002437063.1| hypothetical protein SORBIDRAFT_10g020520 [Sorghum bicolor]
 gb|EER88430.1| hypothetical protein SORBIDRAFT_10g020520 [Sorghum bicolor]
Length=160

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--------LES  371
            KTPLR+L +++LDR K+GRGP++V+++AATV V++  +++S+ +I+SR         +  
Sbjct  22   KTPLRRLSVVALDRLKQGRGPVMVRTIAATVLVVLASSLHSMTKIRSRADGELDGAGIVG  81

Query  370  INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK  191
            + PTDQVLLA+ +L+ASLMG+ LFL+L+IDRLH+Y++E R LRK +E   K +       
Sbjct  82   LTPTDQVLLARHVLEASLMGYSLFLALVIDRLHNYVKENRRLRKKLEEVSKQNETMLEAT  141

Query  190  NG  185
            +G
Sbjct  142  HG  143



>ref|XP_008802267.1| PREDICTED: B-cell receptor-associated protein 29-like [Phoenix 
dactylifera]
Length=221

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 111/180 (62%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  347
            PLR+L +  LD+ K G+GP +VK++A T+ V++  ++  +  IQ+R L+  S+ PTDQVL
Sbjct  25   PLRELAMKGLDKLKTGKGPAMVKALACTLSVILASSITGILRIQNRGLKLGSVTPTDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKN  188
                +L+ASL+G+ LFL+L+IDRLHH ++++  LRK        +E  KK    F + + 
Sbjct  85   WRTHLLEASLIGYTLFLALLIDRLHHCLQKVINLRKTVGTSRDEVEKLKKEHHHFKDEEE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
                E   L+EE+ ++  K++KL+SE E   +     + +  + + Q EKLLLEY +LL+
Sbjct  145  KSSNERTELREEVCNLTEKLQKLKSEIEELKKRALTAEAHVAALQKQFEKLLLEYDRLLE  204



>gb|KDP26363.1| hypothetical protein JCGZ_17521 [Jatropha curcas]
Length=216

 Score =   117 bits (294),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 115/180 (64%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L++ SLD+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVLKSLDQVKMGKGPATVKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK---NGGVE  176
                +L+ASLMGF LFL  +IDR+HHY+ +L  LR  + ++K+        K    G  E
Sbjct  85   WRTHLLEASLMGFTLFLGFIIDRMHHYLTKLISLRSNIGSSKEEVERLQKEKMQLKGKAE  144

Query  175  ----EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
                E+  L+E+I+++   +KKL+ E E K ++++  + +  + + QS  LLLEY +LL+
Sbjct  145  KASTEIKQLQEQISTLSESLKKLKLENEEKDKQIETAEAHVVALQKQSADLLLEYDRLLE  204



>ref|XP_003562352.1| PREDICTED: B-cell receptor-associated protein 31 [Brachypodium 
distachyon]
Length=217

 Score =   117 bits (294),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 114/180 (63%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  347
            PLR+L + ++++ K G+GP  VK++A T+ V+ + +V S+ +IQ+R L+  +++P DQVL
Sbjct  25   PLRELAMRTVEQVKTGKGPATVKTLACTLSVIFMSSVASILKIQNRGLKLGTVSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK-------HDRGFDNGKN  188
                +L+ASL+G+ LFL+ +IDRLHHY+++L  LRK    +++        +R F   + 
Sbjct  85   WRTHLLEASLIGYTLFLAFVIDRLHHYLQKLITLRKTANTSREEVEKLQMENRSFREKEE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
                E+  L+++IA +   +KK++SE +    +    + +  + + QSE+LLLEY +LL+
Sbjct  145  KSSSEIKKLQQDIAKLTEGMKKMKSESDDNERKALEAEAHVNALQKQSEELLLEYDRLLE  204



>gb|EMS49195.1| hypothetical protein TRIUR3_29235 [Triticum urartu]
Length=183

 Score =   116 bits (291),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 104/158 (66%), Gaps = 7/158 (4%)
 Frame = -1

Query  460  VVKSVAATVFVLMIYTVYSVQEIQSRPLE-------SINPTDQVLLAQQILQASLMGFVL  302
            +V++VAATV V++  +++S+ +I             +++PTDQVLLA+ +L+ASLMG++L
Sbjct  1    MVRTVAATVLVVLASSLHSMAKIHGHAGAGELDAPGALSPTDQVLLARHLLEASLMGYIL  60

Query  301  FLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKK  122
            FL+L+IDRLH YIRE+R L+K +EA  K ++  +  K+G  +E      +IAS+  +IKK
Sbjct  61   FLALVIDRLHSYIREMRGLKKNLEAVSKQNKTLEEAKSGRSDESKPHHNDIASLNEEIKK  120

Query  121  LESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            L+ + + K EE K  +  + + + QSE L  +Y +LL+
Sbjct  121  LKRQLKEKAEEAKDAEAKALAAQTQSEGLARKYDRLLE  158



>gb|KDO62066.1| hypothetical protein CISIN_1g046403mg [Citrus sinensis]
Length=117

 Score =   114 bits (286),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 82/108 (76%), Gaps = 2/108 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            ++PLRKLLI+ LD+ K+GRGPLV KSV ATV V++   VY+V EI  R  ES  +NPT++
Sbjct  10   ESPLRKLLILGLDKLKQGRGPLVAKSVGATVLVVLSSAVYNVVEIHKRSRESGALNPTEE  69

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  209
            VL+A  +L+ASLMGF LFL++M+DRLH YI+  ++L + +   K+H++
Sbjct  70   VLMADLLLEASLMGFSLFLAVMMDRLHSYIKRKQILEEVINPNKQHNQ  117



>gb|EMT32966.1| hypothetical protein F775_31670 [Aegilops tauschii]
Length=183

 Score =   116 bits (290),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 103/158 (65%), Gaps = 7/158 (4%)
 Frame = -1

Query  460  VVKSVAATVFVLMIYTVYSVQEIQSRP-------LESINPTDQVLLAQQILQASLMGFVL  302
            +V++VAATV V++  +++S+ +I             +++PTDQVLLA+ +L+ASLMG++L
Sbjct  1    MVRTVAATVLVVLASSLHSMAKIHGHAGAGELDAPAALSPTDQVLLARHLLEASLMGYIL  60

Query  301  FLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKK  122
            FL+L+IDRLH YIRE+R L+K +EA  K ++  +  K G  +E      +IAS+  +IKK
Sbjct  61   FLALVIDRLHSYIREMRGLKKNLEAVSKQNKTLEEAKPGRSDESKPHHNDIASLNEEIKK  120

Query  121  LESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            L+ + + K EE K  +  + + + QSE L  +Y +LL+
Sbjct  121  LKRQLKEKAEEAKDAEAKALAAQTQSEGLARKYDRLLE  158



>ref|XP_007140653.1| hypothetical protein PHAVU_008G130500g [Phaseolus vulgaris]
 gb|ESW12647.1| hypothetical protein PHAVU_008G130500g [Phaseolus vulgaris]
Length=218

 Score =   117 bits (293),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 111/180 (62%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR L+I SLD+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRDLVIKSLDQLKMGKGPATVKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAA-------KKHDRGFDNGKN  188
                +L+ASLMGF LFL  +IDR+HHY+++L  LR +  A+       +K          
Sbjct  85   WRTHLLEASLMGFALFLGFLIDRIHHYLQKLVNLRSSTRASNEDLENLRKETVQLKGKGE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +E+  LKEE++ +   +K ++ E E K ++V+  + +  S + Q+  LLLEY +LL+
Sbjct  145  KASKEIKQLKEELSRVSESLKNIKLESEEKDKKVETAEAHVASLQKQAADLLLEYDRLLE  204



>ref|XP_003552124.1| PREDICTED: B-cell receptor-associated protein 31-like [Glycine 
max]
 gb|KHN41384.1| hypothetical protein glysoja_032570 [Glycine soja]
Length=218

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 114/183 (62%), Gaps = 15/183 (8%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR L+I SLD+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRDLVIKSLDQLKMGKGPATVKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE---  176
                +L+ASLMGF LFL  +IDR HHY+++L  LR    A+K+     +N K   V+   
Sbjct  85   WRTHLLEASLMGFTLFLGFLIDRTHHYLQKLINLRSNAGASKEE---LENLKKETVQLKE  141

Query  175  -------EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQ  17
                   E+  LKEE++ +   ++K++ E E K ++V+  + +  S + Q+  LLLEY +
Sbjct  142  KDEKASKEIKQLKEELSHLSKSLEKIKLESEEKDKKVETAEAHVASLQKQAADLLLEYDR  201

Query  16   LLD  8
            LL+
Sbjct  202  LLE  204



>ref|XP_004491413.1| PREDICTED: uncharacterized protein LOC101509893 [Cicer arietinum]
Length=140

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 79/107 (74%), Gaps = 2/107 (2%)
 Frame = -1

Query  532  SSKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPT  359
            S   P+RK+++  LD  KRG+GPL+ K+VA+TVFV+   T+Y++ +I  R  ++  INPT
Sbjct  20   SFANPIRKMMVRVLDVLKRGKGPLITKTVASTVFVVFGSTIYTILKIHKRSKDAGMINPT  79

Query  358  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  218
            ++VL+A  +L+ASLMGF LF  LMIDR H+Y++E+  LRK ME AKK
Sbjct  80   EEVLMAHHLLEASLMGFSLFFGLMIDRQHYYVKEITSLRKNMEIAKK  126



>gb|KDP39157.1| hypothetical protein JCGZ_00914 [Jatropha curcas]
Length=104

 Score =   113 bits (283),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 80/102 (78%), Gaps = 2/102 (2%)
 Frame = -1

Query  517  LRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLL  344
            +RK+L++ +D  KRGRG LV K+VAAT+F +    +YSV +IQ R LES  +NPTD+VLL
Sbjct  1    MRKVLMVGIDYMKRGRGQLVAKTVAATLFGVFSAILYSVMQIQKRTLESGVVNPTDEVLL  60

Query  343  AQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  218
            A+++L+A+LMGF LFL++M DRLH+YI+EL  +RK +E  K+
Sbjct  61   AERLLEATLMGFSLFLAMMADRLHYYIKELYRVRKEVEQLKR  102



>ref|XP_006452413.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
 ref|XP_006475036.1| PREDICTED: uncharacterized protein LOC102621108 [Citrus sinensis]
 gb|ESR65653.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
Length=129

 Score =   114 bits (284),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 82/108 (76%), Gaps = 2/108 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            ++PLRKLLI+ LD+ K+GRGPLV KSV ATV V++   VY+V EI  R  ES  +NPT++
Sbjct  22   ESPLRKLLILGLDKLKQGRGPLVAKSVGATVLVVLSSAVYNVVEIHKRSRESGALNPTEE  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  209
            VL+A  +L+ASLMGF LFL++M+DRLH YI+  ++L + +   K+H++
Sbjct  82   VLMADLLLEASLMGFSLFLAVMMDRLHSYIKRKQILEEVINPNKQHNQ  129



>ref|XP_002303054.2| hypothetical protein POPTR_0002s24670g [Populus trichocarpa]
 gb|ABK95486.1| unknown [Populus trichocarpa]
 gb|EEE82327.2| hypothetical protein POPTR_0002s24670g [Populus trichocarpa]
Length=218

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 113/180 (63%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L+I SLD+ K G+ P  VK++A T+ V++ +++ ++ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQVKMGKRPATVKTIAGTMSVILFFSLMNIVKIQNKGAKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKN  188
                +L+ASLMGF LFL  +IDR+HHY+ +L  LR+++ ++K       K        ++
Sbjct  85   WRTHLLEASLMGFTLFLGFLIDRMHHYLSKLIGLRRSVGSSKEEVERLQKEKMQLKEKED  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
                E+  L E+I+++   +KKL+ E E K +++K  + +  S + Q   LLLEY +LL+
Sbjct  145  KASMEIKLLLEQISTLSENLKKLKLESENKDKQIKTAEAHVVSLQKQCADLLLEYDRLLE  204



>ref|XP_007134124.1| hypothetical protein PHAVU_010G021100g [Phaseolus vulgaris]
 gb|ESW06118.1| hypothetical protein PHAVU_010G021100g [Phaseolus vulgaris]
Length=219

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 110/180 (61%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR L+I +LD+ K G+GP  VK++A T+ V++  ++ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRDLVIKTLDQMKMGKGPATVKTIAGTMSVILFSSLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF-------DNGKN  188
                +L+ASLMGF LFL  +IDR+HHY+++L  LR    A+K+               + 
Sbjct  85   WRTHLLEASLMGFTLFLGFIIDRVHHYLQKLNKLRSNAGASKEEVESIEKEKVELKEKEE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +E+  LKE+I+ +   +KK + ECE K + V+  + +  S + Q+  LLLEY +LL+
Sbjct  145  KASKEIMQLKEQISGLSESLKKTKVECEEKDKRVETAEVHVTSLQKQAADLLLEYDRLLE  204



>ref|XP_002266257.2| PREDICTED: B-cell receptor-associated protein 31 [Vitis vinifera]
Length=218

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 111/180 (62%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L++  LD+ K G+GP  VK++A T+ V+++ +V S+ +IQ++   L ++ P DQVL
Sbjct  25   PLRELVMKGLDQVKMGKGPATVKTIAGTMSVILLSSVTSILKIQNKGAKLGTMTPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKN  188
                +L+ SLMGF LFL  +IDR+HHY+++L  LR    A+K       K        + 
Sbjct  85   WRTHLLETSLMGFSLFLGFLIDRMHHYLQKLNRLRGNAGASKEEFEKLQKERAQLKEKEE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +E+  L+E+I+++   +KKL+ E E K ++V+  + +  S + Q+  LLLEY +LL+
Sbjct  145  QASKEIKLLQEQISTLTQDLKKLKLEAEEKDKKVETAEAHVVSLQKQAADLLLEYDRLLE  204



>gb|ACG37455.1| B-cell receptor-associated protein 31-like containing protein 
[Zea mays]
Length=216

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 109/179 (61%), Gaps = 8/179 (4%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-SINPTDQVLL  344
            PLR+L +  +D+ K G+GP  VK++A T+ V+++  V S+ +IQ+R L+ +++P DQVL 
Sbjct  25   PLRELAMRVVDQVKTGKGPATVKTLACTLSVILMSNVASILKIQNRGLKLTVSPMDQVLW  84

Query  343  AQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKNG  185
               +L+ASL+G+ LFL+ +IDRLHHY+++L  LRK        +E  +  +R     +  
Sbjct  85   RTHLLEASLIGYTLFLAFVIDRLHHYLQKLMTLRKTSSTSREEVEKLQMENRSLREKEEK  144

Query  184  GVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               E   L+ E+  +   +KKL+SE +    +    + +  + + QSE+LLLEY +LL+
Sbjct  145  SSGETKRLQREVVRLNESMKKLKSEAKEHERKASVAEAHVNALQKQSEELLLEYDRLLE  203



>gb|ACN36491.1| unknown [Zea mays]
Length=157

 Score =   113 bits (283),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = -1

Query  367  NPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKN  188
             PTDQVL ++ +L+A LMG+ LFL+L+IDRLH YIR+LR  +K +EA +KH++  +  K+
Sbjct  18   TPTDQVLFSRHLLEACLMGYSLFLALVIDRLHQYIRDLRRFKKDLEAVRKHNKMLEEAKH  77

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            G  EE    +EEIA++  ++KKL+ + + K EEV   +D + + + QSE LL EY +LL+
Sbjct  78   GNSEEAKKYQEEIATLNKEMKKLKLQVQEKTEEVHVSEDKALAIQKQSEGLLTEYDRLLE  137



>ref|NP_001136567.1| uncharacterized LOC100216689 precursor [Zea mays]
 ref|XP_008645522.1| PREDICTED: LOW QUALITY PROTEIN: B-cell receptor-associated protein 
31-like [Zea mays]
 gb|ACF82188.1| unknown [Zea mays]
 gb|AFW66986.1| b-cell receptor-associated protein 31-like containing protein 
[Zea mays]
Length=217

 Score =   115 bits (287),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 109/180 (61%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  347
            PLR+L +  +D+ K G+GP  VK++A T+ V+++  V S+ +IQ+R L+  +++P DQVL
Sbjct  25   PLRELAMRVVDQVKTGKGPATVKTLACTLSVILMSNVASILKIQNRGLKLGTVSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKN  188
                +L+ASL+G+ LFL+ +IDRLHHY+++L  LRK        +E  +  +R     + 
Sbjct  85   WRTHLLEASLIGYTLFLAFVIDRLHHYLQKLMTLRKTSSTSREEVEKLQMENRSLREKEE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
                E   L+ E+  +   +KKL+SE +    +    + +  + + QSE+LLLEY +LL+
Sbjct  145  KSSGETKRLQREVVRLNESMKKLKSEAKEHERKASVAEAHVNALQKQSEELLLEYDRLLE  204



>ref|XP_009779153.1| PREDICTED: B-cell receptor-associated protein 31-like, partial 
[Nicotiana sylvestris]
Length=150

 Score =   113 bits (282),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = -1

Query  313  GFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASMKS  134
            GF LFL+ MIDRLHHYIREL + RK MEA +K +R F++GK+G  EE+ +L+EE ++++ 
Sbjct  24   GFSLFLAFMIDRLHHYIRELSMRRKTMEAVRKQNRAFEDGKSGASEEIKTLEEEASALRG  83

Query  133  KIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            KIK+LESE + K +E    + N+ + K QSE  LLEY +LL+
Sbjct  84   KIKQLESELQVKAKEASGAEANAVALKKQSEGFLLEYDRLLE  125



>ref|XP_004295837.1| PREDICTED: uncharacterized protein LOC101305253 [Fragaria vesca 
subsp. vesca]
Length=152

 Score =   113 bits (282),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 76/99 (77%), Gaps = 3/99 (3%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQS-RPLES--INPTD  356
            ++PLR+L+I+ LD +K+GRGPLV KSV  T+ V  I T+YSV  +   R  E+  INPT+
Sbjct  22   RSPLRQLVIMGLDCSKQGRGPLVAKSVGGTILVFFISTIYSVFNVHKKRSTEAGFINPTN  81

Query  355  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRK  239
            +VL+A +IL+ASL GF LFL+LMIDRLH+YI+EL  LRK
Sbjct  82   EVLMAHRILEASLTGFSLFLALMIDRLHYYIKELYRLRK  120



>ref|XP_011011172.1| PREDICTED: uncharacterized protein LOC105115831 [Populus euphratica]
Length=218

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 113/180 (63%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR L+I SLD+ K G+GP  VK++A T+ V++  ++ S+ +IQS+   L +++P DQVL
Sbjct  25   PLRDLVIKSLDQVKMGKGPATVKTIAGTMSVILFSSLMSIVKIQSKGAKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK------NG  185
                +L+ASLMGF LFL  +IDR+HHY+ +L  LR ++ ++K+        K       G
Sbjct  85   WRTHLLEASLMGFTLFLGFLIDRMHHYLSKLIGLRSSVGSSKEEVERLQKEKMQLKEEEG  144

Query  184  GV-EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
             V +E+  L+E+ +++   +KKL+ E E K ++++  + +  +   +S  LLLEY +LL+
Sbjct  145  KVSKEMKLLQEQFSTLSENLKKLKLESEQKDKQIETAEAHVVALHKRSADLLLEYDRLLE  204



>ref|XP_009388739.1| PREDICTED: uncharacterized protein LOC103975489 [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 83/116 (72%), Gaps = 2/116 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQ  353
             TPLRKLL++ LDR KRGR  ++VK++AAT  +++  ++YS+ EI+ R   L +  PTDQ
Sbjct  22   NTPLRKLLVLGLDRLKRGRSTVMVKTLAATAVLVLASSIYSMAEIRLRFAELGAPTPTDQ  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNG  185
            +L+++ +L+ASL+G+ LFL+L+IDRLH YI EL  LR +M+A  K +R     K G
Sbjct  82   ILMSRHLLEASLLGYSLFLALIIDRLHLYIGELHGLRNSMKAVMKQNRVIGTAKTG  137



>ref|XP_010099686.1| hypothetical protein L484_025117 [Morus notabilis]
 gb|EXB80263.1| hypothetical protein L484_025117 [Morus notabilis]
Length=216

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 114/180 (63%), Gaps = 11/180 (6%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L+I SLD+ K  RG ++  ++A T+F + + + +S+ +IQ+R   L S++P DQVL
Sbjct  25   PLRELVIKSLDQLKMKRGTVL--TIAGTMFAIFMSSFFSIVKIQNRGAKLGSMSPMDQVL  82

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKN  188
                +L+ASLMGF LFL  +IDR+HHYIR+L  LR ++ ++K       K        + 
Sbjct  83   WRTHLLEASLMGFTLFLGFIIDRMHHYIRKLIGLRSSVGSSKEELEKLQKEKMQLKEKEQ  142

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +E+  LK+E++++   +KKL+ + E K ++V+  + + ++ + Q+  LLLEY +LL+
Sbjct  143  KYSKEIKLLKDEVSTLSESLKKLKIKSEEKDKKVETAEAHVQALQKQAADLLLEYDRLLE  202



>ref|XP_010685051.1| PREDICTED: B-cell receptor-associated protein 31-like [Beta vulgaris 
subsp. vulgaris]
Length=217

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 117/180 (65%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L++ SLD+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVMKSLDQVKMGKGPATVKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAA-------KKHDRGFDNGKN  188
                +L+ASLMGF LFL  +IDR+HHY+R+L  +R  + ++       +K  +   + + 
Sbjct  85   WRTHLLEASLMGFTLFLGFLIDRMHHYLRKLINIRSKVGSSKEEVEKLEKEKQQLKDKEE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +E+ +L++E++ + +++KKL+ E + K + ++    +  + + Q+  LLLEY +LL+
Sbjct  145  KASKEITALQDELSKVSNEVKKLKIESQEKDKTIETADAHVVALQKQAADLLLEYDRLLE  204



>ref|XP_010274041.1| PREDICTED: B-cell receptor-associated protein 31-like [Nelumbo 
nucifera]
Length=218

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 109/180 (61%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR L++  +D+ K G+G   +K++A T+ V++  ++ S+  IQ++   L ++ P DQVL
Sbjct  25   PLRDLVMKGMDQLKTGKGSATLKTIAGTMSVILASSIISLLNIQNKGTKLGTVTPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD-------NGKN  188
                +L+ASLMG  LFL  +IDR+HHY+++L  LR A  ++KK               + 
Sbjct  85   WRSHLLEASLMGCSLFLGFVIDRIHHYLQKLIALRTAARSSKKEVEKLQIEHIQLKEKEE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
                E+  L+EEI+S+K  +K L+ + + K +++K+ + +  + + Q+E LLLEY +LLD
Sbjct  145  KASYEIKLLQEEISSLKENLKNLKLQSDEKDKQIKSAESHVTALEKQTEDLLLEYDRLLD  204



>ref|XP_008674143.1| PREDICTED: B-cell receptor-associated protein 31-like [Zea mays]
Length=270

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 109/183 (60%), Gaps = 14/183 (8%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  347
            PLR+L +  +D+ K G+GP  VK++A T+ V+++ +V S+ +IQ+R L+  +++P DQVL
Sbjct  25   PLRELAMRGVDQVKTGKGPATVKTLACTLSVILMSSVASILKIQNRGLKLGTVSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK-------HDRGFDNGKN  188
                +L+ASL+G+ LFL+ +IDRLHHY+R+L  LRK    +++        +R     + 
Sbjct  85   WRTHLLEASLIGYTLFLAFVIDRLHHYLRKLLTLRKTSSTSREEVEKLQMENRSLREKEE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY-----  23
                E   L+ EIA +   +KKL+SE E    +    + + ++ + QSE+LL  +     
Sbjct  145  KSSSETKRLQREIARLNEGMKKLKSETEEHERKASVAEAHVDALQKQSEELLHSFLAARH  204

Query  22   GQL  14
            GQL
Sbjct  205  GQL  207



>ref|XP_008460368.1| PREDICTED: B-cell receptor-associated protein 31-like [Cucumis 
melo]
Length=219

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 112/179 (63%), Gaps = 9/179 (5%)
 Frame = -1

Query  517  LRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLL  344
            LR+ +I SLD+ K G+GP  VK++AAT+ V+++ ++ ++ +IQ++   L +++P DQVL 
Sbjct  26   LREFVIKSLDQLKMGKGPATVKTIAATMSVILLSSLMNIVKIQNKGAKLGTMSPMDQVLW  85

Query  343  AQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNG  185
              Q+L+ASL+GF LFL  +IDR+HHY ++L  LR+ + ++K       K        +  
Sbjct  86   RTQLLEASLIGFTLFLGFIIDRMHHYFQKLIGLRENIGSSKEEVERLQKEKTELAQKEEK  145

Query  184  GVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
              +++  L+EEI+ +   +KK++ E E K + ++    +  S + Q+  LLLEY +LL+
Sbjct  146  CSKQIKELREEISILSENLKKVKQESEEKDKRIETADAHVTSLQKQAADLLLEYDRLLE  204



>ref|XP_002521067.1| bcr-associated protein, bap, putative [Ricinus communis]
 gb|EEF41218.1| bcr-associated protein, bap, putative [Ricinus communis]
Length=292

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 115/180 (64%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L+I SLD+ K G+GP  VK++A+T+ V+++ ++ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQLKMGKGPATVKTIASTMSVILLSSLMSIIKIQNKGAKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKN  188
                +L+ASL+GF LFL  +IDR+HHY+ +L  LR  + ++K       K        ++
Sbjct  85   WRTHLLEASLIGFTLFLGFIIDRMHHYLTKLIGLRINIGSSKEEVERLQKEKMQLKEKED  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
                E+  L+++++++   ++KL+ E E K ++++  + +  S + QS  LLLEY +LL+
Sbjct  145  KSSMEIEQLRKQVSTLSENLEKLKLENEQKDKQIETAEAHVVSLQKQSADLLLEYDRLLE  204



>ref|XP_007020770.1| F-box family protein with a domain of Uncharacterized protein 
function, putative [Theobroma cacao]
 gb|EOY12295.1| F-box family protein with a domain of Uncharacterized protein 
function, putative [Theobroma cacao]
Length=543

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 77/104 (74%), Gaps = 2/104 (2%)
 Frame = -1

Query  523  TPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQV  350
            +PLR L+I  LD+ K GRGP++ K+VA T+FV+ I   Y+  EIQ R LE   INPTD+V
Sbjct  410  SPLRNLVIKVLDKIKEGRGPVISKTVAGTLFVVFISISYNAIEIQKRALEGGVINPTDEV  469

Query  349  LLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  218
            LLA +IL+ASLMGF LFL+L+  RLH++I+EL   R+ +EA +K
Sbjct  470  LLANRILEASLMGFALFLALVTYRLHYHIKELNPARRRLEADEK  513



>ref|XP_006281079.1| hypothetical protein CARUB_v10027107mg [Capsella rubella]
 gb|EOA13977.1| hypothetical protein CARUB_v10027107mg [Capsella rubella]
Length=217

 Score =   109 bits (273),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 114/180 (63%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L+I SLD+ K G+GP  VK++A T+ V++   + ++ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQMKMGKGPATVKTIAGTMSVILFSNLMNIVKIQNKGAKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKN-------  188
                +L+ASL+G VLFL  +IDR+HHY+ +L  LR    ++K+     +  +        
Sbjct  85   WRTHLLEASLLGVVLFLGFIIDRMHHYLSKLINLRSNAGSSKEELEQLEKERTELKEKDE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +E+  L+E ++S+  K+KK E+E + K ++++  + + E+ + QS +LLLEY +LL+
Sbjct  145  KASKEIKKLQENLSSILEKLKKAEAESKEKDKKLETAETHVEALQKQSAELLLEYDRLLE  204



>ref|XP_004491710.1| PREDICTED: B-cell receptor-associated protein 31-like [Cicer 
arietinum]
Length=218

 Score =   109 bits (273),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 111/180 (62%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR L++ SLD+ K G+GP  VK++A T+ V+++ +  S+ +IQ++   L +++P DQVL
Sbjct  25   PLRDLVMKSLDQLKMGKGPATVKTIAGTMSVILLSSFMSIVKIQNKGAKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF-------DNGKN  188
                +L+ASL+GF LFL  +IDR+HHY+++L  LR  M A+K+               + 
Sbjct  85   WRTHLLEASLIGFTLFLGFLIDRMHHYLQKLINLRSNMGASKEEVENLKKETMEFKEKEE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +E+  LK+E++++   +KK + E E K + V+  + +  S + Q+  LLLEY +LL+
Sbjct  145  KASKEIKQLKKELSTLSEGLKKAKMESEEKDKRVETAESHVASLQKQAADLLLEYDRLLE  204



>ref|XP_010913045.1| PREDICTED: B-cell receptor-associated protein 29-like [Elaeis 
guineensis]
Length=218

 Score =   109 bits (273),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 96/148 (65%), Gaps = 9/148 (6%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L++  LD+ K G+GP  VK++A T+ VL+  ++ S+ +IQ+R   L ++ P DQVL
Sbjct  25   PLRELVMRGLDQLKTGKGPATVKTLACTLSVLLASSITSILKIQNRGTKLGTVTPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG-------FDNGKN  188
                +L+ASL+G+ LFL L+IDRLHHY+R++  L+K +  +K+           F + ++
Sbjct  85   WRTHLLEASLIGYTLFLGLVIDRLHHYLRKMVTLKKTVGTSKEEVEKLKKEHLHFKDKED  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECE  104
                E+  L+ E+ S+  K++KL++ECE
Sbjct  145  KASSEMQKLQREVGSLTEKLQKLKTECE  172



>gb|KEH22623.1| B-cell receptor-associated-like protein [Medicago truncatula]
Length=218

 Score =   109 bits (272),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 112/180 (62%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR L++ SLD+ K G+ P  VK++A T+FV+++ ++ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRDLVMKSLDQLKMGKAPATVKTIAGTMFVILLSSLMSLVKIQNKGAKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF-------DNGKN  188
                +L+A L+GF LFL  +IDR+HHY+++L  LR  M A+K+               + 
Sbjct  85   WRTHLLEAYLLGFTLFLGFLIDRMHHYLQKLINLRSNMGASKEEVENLKKENVELKEKEE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +E+  LK+E++++   +KK++ E E K + V+  + +  S + Q+  LLLEY +LL+
Sbjct  145  KASKEIKQLKKELSTLTEGLKKVKMESEEKDKRVETAEAHVASLQKQAADLLLEYDRLLE  204



>ref|XP_010552045.1| PREDICTED: B-cell receptor-associated protein 31 [Tarenaya hassleriana]
Length=219

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 115/180 (64%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L++ SLD+ K G+GP  VK++A T+ V+++ T+ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVMKSLDQLKMGKGPATVKTIAGTMSVILLSTLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD-------NGKN  188
                +L+ASLMG VLFL  +IDR+HHY+ +L  LR  +  +K+               + 
Sbjct  85   WRTHLLEASLMGVVLFLGFVIDRMHHYLTKLLYLRSNIGMSKEELEKLQKERTELKEKEE  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +E+  L+E+++S+   ++KLE+E + K ++++  + +  + + QS +LLLEY +LL+
Sbjct  145  KASKEMKQLQEKLSSLSQNLEKLEAESKDKDKKLETAEAHVSALQKQSAELLLEYDRLLE  204



>ref|XP_004144386.1| PREDICTED: uncharacterized protein LOC101213598 [Cucumis sativus]
 ref|XP_004162649.1| PREDICTED: uncharacterized LOC101213598 [Cucumis sativus]
 gb|KGN58366.1| hypothetical protein Csa_3G629240 [Cucumis sativus]
Length=219

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 111/178 (62%), Gaps = 9/178 (5%)
 Frame = -1

Query  514  RKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLA  341
            R+ +I SLD+ K G+GP  VK++AAT+ V+++ ++ ++ +IQ++   L +++P DQVL  
Sbjct  27   REFVIKSLDQLKMGKGPATVKTIAATMSVILLSSLMNIVKIQNKGAKLGTMSPMDQVLWR  86

Query  340  QQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGG  182
             Q+L+ASL+GF LFL  +IDR+HHY ++L  LR+ + ++K       K        +   
Sbjct  87   TQLLEASLIGFTLFLGFIIDRMHHYFQKLIGLRENIGSSKEEVERLQKEKTELAQKEEKC  146

Query  181  VEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
             +++  L+EEI+ + + +KK++ E   K + ++    +  S + Q+  LLLEY +LL+
Sbjct  147  SKQIKELREEISILSANLKKVKQESVEKDKRIETADAHVTSLQKQAADLLLEYDRLLE  204



>gb|EMS58132.1| hypothetical protein TRIUR3_00710 [Triticum urartu]
Length=190

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 104/173 (60%), Gaps = 22/173 (13%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L +  +++ K G+GP  VK++A T+ V+++ +V ++  IQ R   + +++P DQVL
Sbjct  25   PLRELAMRGVEQVKTGKGPATVKTLACTLSVILMSSVAAIVRIQDRGHKIGNVSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVN  167
                +L+ASL+G+ LFL+ +IDRLHHY+R+L  LRK+   ++                  
Sbjct  85   WRTHLLEASLIGYTLFLAFVIDRLHHYLRKLITLRKSANTSR------------------  126

Query  166  SLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
              +E++A +   +KKL+SE E    +    + +  + + QSE+LLLEY +LL+
Sbjct  127  --EEDMAKLSEDMKKLKSESEDHQRKASDAEAHVNALQKQSEELLLEYDRLLE  177



>emb|CDX86287.1| BnaA06g30040D [Brassica napus]
Length=217

 Score =   107 bits (267),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 118/180 (66%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L+I SLD+ K G+GP  VK++A T+ V+++  + S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQMKMGKGPATVKTIAGTMSVILLSNLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKN  188
                +L+ASLMG VLFL  +IDR+HHY+R+L  LR       + +E  +K    F   ++
Sbjct  85   WRTHLLEASLMGVVLFLGFIIDRMHHYLRKLINLRGNVGSSKEELEQLQKERNEFKEKED  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +E+  L+E+++S+  ++KK E+E + K ++++  + +  + + QS +LLLEY +LL+
Sbjct  145  KASKEIKQLQEKLSSVSERLKKAETESKEKEKKLETAETHVTALQKQSAELLLEYDRLLE  204



>ref|XP_009151666.1| PREDICTED: uncharacterized protein LOC103874978 [Brassica rapa]
Length=217

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 118/180 (66%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L+I SLD+ K G+GP  VK++A T+ V+++  + S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQMKMGKGPATVKTIAGTMSVILLSNLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKN  188
                +L+ASLMG VLFL  +IDR+HHY+R+L  LR       + +E  +K    F   ++
Sbjct  85   WRTHLLEASLMGVVLFLGFIIDRMHHYLRKLINLRGNVGSSKEELEQLQKERTEFKEKED  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +E+  L+E+++S+  ++KK E+E + K ++++  + +  + + QS +LLLEY +LL+
Sbjct  145  KASKEIKQLQEKLSSVSERLKKAETESKEKEKKLETAETHVTALQKQSAELLLEYDRLLE  204



>emb|CDX85356.1| BnaC07g26670D [Brassica napus]
Length=217

 Score =   107 bits (266),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 117/180 (65%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L+I SLD+ K G+GP  VK++A T+ V+++  + S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQMKMGKGPATVKTIAGTMSVILLSNLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKN  188
                +L+ASLMG VLFL  +IDR+HHY+R+L  LR       + +E  +K    F   ++
Sbjct  85   WRTHLLEASLMGVVLFLGFIIDRMHHYLRKLINLRGNVGSSKEELEQLQKERNEFKEKED  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +E+  L+E ++S+  ++KK E+E + K ++++  + +  + + QS +LLLEY +LL+
Sbjct  145  KASKEIKQLQETLSSVSERLKKAETESKEKEKKLETAETHVTALQKQSAELLLEYDRLLE  204



>ref|XP_002863915.1| hypothetical protein ARALYDRAFT_494932 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40174.1| hypothetical protein ARALYDRAFT_494932 [Arabidopsis lyrata subsp. 
lyrata]
Length=219

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 117/180 (65%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L+I SLD+ K G+GP  VK++A T+ V++   + S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQMKMGKGPATVKTIAGTMSVILFSNLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKN  188
                +L+ASL+G VLFL  +IDR+HHY+R+L  LR  + ++K       K   G    ++
Sbjct  85   WRTHLLEASLLGVVLFLGFIIDRMHHYLRKLINLRSNVGSSKDELEQLQKERAGLKEKED  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +E+  L+EE++S+  ++KK E+E + K ++++  + +  + + QS +LLLEY +LL+
Sbjct  145  KASKEIKQLQEELSSILERLKKAETESKEKEKKLETAETHVTALQKQSAELLLEYDRLLE  204



>ref|XP_009778813.1| PREDICTED: uncharacterized protein LOC104228107 [Nicotiana sylvestris]
Length=108

 Score =   103 bits (256),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 64/78 (82%), Gaps = 3/78 (4%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPTD  356
            KTPLRKL+I+ LDR KRGRGP++VK+VA TVFV+M+ T+YS+  I++R ++    I PTD
Sbjct  22   KTPLRKLVIMGLDRVKRGRGPIIVKTVAGTVFVVMLSTIYSIASIRTRWMDEGGDITPTD  81

Query  355  QVLLAQQILQASLMGFVL  302
            Q+LLAQ +L+ASLMG VL
Sbjct  82   QILLAQHLLEASLMGIVL  99



>ref|XP_010063029.1| PREDICTED: uncharacterized protein LOC104450251 isoform X1 [Eucalyptus 
grandis]
 gb|KCW70201.1| hypothetical protein EUGRSUZ_F03480 [Eucalyptus grandis]
Length=155

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 75/109 (69%), Gaps = 2/109 (2%)
 Frame = -1

Query  523  TPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQV  350
            +PLR LL++ LDR KRG+G L+  +VA T+ V+   TVY++  +Q R  ++  I+PTDQ+
Sbjct  23   SPLRTLLMLGLDRLKRGQGQLIAGTVATTMVVVFSATVYNLLGVQRRLTDATMISPTDQI  82

Query  349  LLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  203
            LLA  +L+ASLMGF LFL ++IDRLH+Y  EL  LR  +E  K   R +
Sbjct  83   LLANSLLEASLMGFSLFLGILIDRLHYYASELYRLRNHLEETKSKQRDY  131



>emb|CDY29829.1| BnaC05g31610D [Brassica napus]
Length=137

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 78/108 (72%), Gaps = 3/108 (3%)
 Frame = -1

Query  523  TPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTDQ  353
            TP+R++++  LD  K+GRGPLV K+VAAT+ VL    ++S  +I +R  ES    NPTDQ
Sbjct  27   TPVRRVVVKLLDLLKQGRGPLVTKTVAATMLVLFGSVLFSTIQINTRVSESGGVANPTDQ  86

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  209
            V+ A +IL++ LMG VLFL+L++DR+H+Y REL++ R+ +E A K  +
Sbjct  87   VMFANRILESFLMGTVLFLALVMDRMHYYTRELQITRRNLEVAVKKTK  134



>emb|CDP03896.1| unnamed protein product [Coffea canephora]
Length=216

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 106/180 (59%), Gaps = 11/180 (6%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L++  LD+ K  +G   V ++A T   +++   +S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVMKGLDQVKMRKGT--VLTIAGTFAAILLSNFFSIVKIQNKGAKLGTMSPMDQVL  82

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK-------N  188
                +L+ASLMGF LFL  +IDR+HHY+R+L  LR    A +K +   +  K        
Sbjct  83   WRTNLLEASLMGFCLFLGFLIDRMHHYLRKLIGLRSTAGALRKENERLEKDKLQLKEKAE  142

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               EE+  +K+EI+S+   + KLE E   K ++V+  + +  + + Q+  LLLEY +LL+
Sbjct  143  KADEEIKVMKKEISSLTENLNKLEMESAEKDKKVETAEAHVAALQKQAADLLLEYDRLLE  202



>ref|XP_002317336.1| hypothetical protein POPTR_0011s09140g [Populus trichocarpa]
 gb|EEE97948.1| hypothetical protein POPTR_0011s09140g [Populus trichocarpa]
Length=128

 Score =   102 bits (255),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 81/105 (77%), Gaps = 2/105 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            +TP+RKL+I+++D+ K+G+GPLV K+VA T+ V+    +++  +I+ R L++  +N  D+
Sbjct  22   RTPVRKLVIMAIDQLKQGKGPLVAKTVATTLIVVFTSVLHNALQIRKRLLDAGAVNSADE  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  218
            VL+ ++IL+ASL+GF LFL++MIDRLH YI+EL  +R  +EA K+
Sbjct  82   VLMVERILEASLLGFSLFLAMMIDRLHCYIKELLQVRNELEAVKR  126



>gb|EYU40619.1| hypothetical protein MIMGU_mgv1a013665mg [Erythranthe guttata]
Length=213

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 112/184 (61%), Gaps = 19/184 (10%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  347
            PLR+L +  LD+ K  R    V ++AATVFV+++  ++S+ +IQ++  +  ++ P DQVL
Sbjct  25   PLRELGMKGLDQVKMRRAT--VLTIAATVFVILLSDLFSIFKIQNKGAKHGAMTPMDQVL  82

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD-----------  200
                +L+A+LMGF LFL L+IDR+HH++R+L  L+ +   +K+    FD           
Sbjct  83   WRTNVLEATLMGFFLFLGLLIDRMHHHMRKLDELKSSNGVSKEE---FDRVEREKLQLKE  139

Query  199  NGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYG  20
            N +  G+ EV  L++EI+ +   +KKL+ E   K + VK+ +    S + Q+ +LLLEY 
Sbjct  140  NQEKTGL-EVERLRKEISGLTENVKKLKLESTEKDKSVKSAEARVASLQKQTAELLLEYD  198

Query  19   QLLD  8
            +LL+
Sbjct  199  RLLE  202



>ref|XP_006298783.1| hypothetical protein CARUB_v10014885mg [Capsella rubella]
 gb|EOA31681.1| hypothetical protein CARUB_v10014885mg [Capsella rubella]
Length=137

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 77/108 (71%), Gaps = 3/108 (3%)
 Frame = -1

Query  523  TPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTDQ  353
            TP R++++  LD +K+GR PLV K+VAAT+ VL    +YS  +I +R  ES    NPTDQ
Sbjct  27   TPARRVVVKLLDLSKQGRAPLVAKTVAATMLVLFGSVMYSTIQINTRVSESGGAANPTDQ  86

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  209
            V+ A ++L+A LMG +LFL+++IDR+H+Y REL++ R+ +E A K  +
Sbjct  87   VMFANRLLEAFLMGTILFLAMVIDRMHYYTRELQITRRNLEIAVKKSK  134



>ref|XP_008235454.1| PREDICTED: B-cell receptor-associated protein 31 [Prunus mume]
Length=218

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 114/180 (63%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L+I SLD+ K G+GP  VK++A T+ V+++ +  S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQLKMGKGPATVKTIACTMSVILLSSFISIVKIQNKGVKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKN  188
                +L+ASLMGF LFL  +IDR+HHY+ +L  LR  + A+K       K        ++
Sbjct  85   WRTHLLEASLMGFTLFLGFIIDRMHHYLSKLIGLRSNVGASKEEVDRLQKETMQLKEKED  144

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               +E+  L+E+I+++   +KKL+ EC+ K + ++  + +  + + Q+  LLLEY +LL+
Sbjct  145  KSSQEIKQLQEKISTLSEDLKKLKLECKEKDKNIETAEAHVAALQKQAADLLLEYDRLLE  204



>ref|XP_009145629.1| PREDICTED: uncharacterized protein LOC103869321 [Brassica rapa]
 emb|CDY54648.1| BnaA05g36130D [Brassica napus]
Length=137

 Score =   102 bits (254),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 78/108 (72%), Gaps = 3/108 (3%)
 Frame = -1

Query  523  TPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTDQ  353
            TP+R++++  LD  K+GRGPLV K+VAAT+ VL    ++S  +I +R  ES    NPTDQ
Sbjct  27   TPVRRVVVKLLDLLKQGRGPLVTKTVAATMLVLFGSVLFSTIQINTRVSESGGVANPTDQ  86

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  209
            V+ A ++L++ LMG VLFL+L++DR+H+Y REL++ R+ +E A K  +
Sbjct  87   VMFANRLLESFLMGTVLFLALVMDRMHYYTRELQITRRNLEVAVKKTK  134



>ref|XP_011089080.1| PREDICTED: uncharacterized protein LOC105170143 [Sesamum indicum]
Length=216

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 107/180 (59%), Gaps = 11/180 (6%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  347
            PLR+L+I  LD+ K  R    V ++A T+FV+++  ++S+ +IQ++  +  ++ P DQVL
Sbjct  25   PLRELVIKGLDQVKMRRAT--VLTIAGTIFVILLSNLFSILKIQNKGAKHGTMTPMDQVL  82

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKN  188
                +L+A+LMGF LFL  +IDR+HHY+R+L  LR       + +E  +K        + 
Sbjct  83   WRTNLLEATLMGFSLFLGFLIDRMHHYMRKLIKLRSNTGVSKQEVEMLEKEKLQLKEKEE  142

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
                EV  L++E++S+   + KL SE   K ++V+  + +  + + Q+  LLLEY +LL+
Sbjct  143  KAAGEVKRLQKEMSSLTENLNKLRSESAEKDKKVETAEAHVAALQKQAADLLLEYDRLLE  202



>ref|XP_010488019.1| PREDICTED: uncharacterized protein LOC104765923 [Camelina sativa]
Length=138

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 76/105 (72%), Gaps = 3/105 (3%)
 Frame = -1

Query  523  TPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTDQ  353
            TP R++++  LD +K+GRGPLV K+VAAT+ VL    +YS  +I +R  ES    N TDQ
Sbjct  27   TPARRVVVKLLDISKQGRGPLVAKTVAATMLVLFGSVMYSTIQINTRVSESGGVANSTDQ  86

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  218
            V+ A ++L+A LMG +LFL+++IDR+H+Y REL++ R+ +E A K
Sbjct  87   VMFANRLLEAFLMGTILFLAMVIDRMHYYTRELQITRRNLEIAVK  131



>ref|XP_010508923.1| PREDICTED: uncharacterized protein LOC104785412 [Camelina sativa]
Length=138

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 76/105 (72%), Gaps = 3/105 (3%)
 Frame = -1

Query  523  TPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTDQ  353
            TP R++++  LD +K+GRGPLV K+VAAT+ VL    +YS  +I +R  ES    N TDQ
Sbjct  27   TPARRVVVKLLDISKQGRGPLVAKTVAATMLVLFGSVMYSTIQINTRVSESGGVANSTDQ  86

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  218
            V+ A ++L+A LMG +LFL+++IDR+H+Y REL++ R+ +E A K
Sbjct  87   VMFANRLLEAFLMGTILFLAMVIDRMHYYTRELQITRRNLEIAVK  131



>ref|XP_004290194.1| PREDICTED: B-cell receptor-associated protein 31 [Fragaria vesca 
subsp. vesca]
 ref|XP_011458169.1| PREDICTED: B-cell receptor-associated protein 31 [Fragaria vesca 
subsp. vesca]
Length=214

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 105/176 (60%), Gaps = 5/176 (3%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L++  LD+ K GRGP+ +  +A T+ V+++    S+ ++Q++   L +++P DQVL
Sbjct  25   PLRELVLKILDQLKVGRGPVTLIGIAGTMGVILLSRFISIVKMQNKGEKLGTMSPMDQVL  84

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLL---RKAMEAAKKHDRGFDNGKNGGVE  176
                IL+ASLM F +FL  +IDR H Y+ +L  L   ++ +E  +K        +    +
Sbjct  85   YRTHILEASLMSFAVFLGFIIDRTHDYLTKLDGLTSTKEEVERLQKEKVQLTEKEEKSSK  144

Query  175  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
            E+  L+E+IA++   +KKL+ EC  K + V+  + +  S + Q+  LLLEY  LL+
Sbjct  145  EIKQLQEKIATLSEDLKKLKLECAEKDKAVETAESHVTSLQKQAADLLLEYDHLLE  200



>ref|XP_010466234.1| PREDICTED: uncharacterized protein LOC104746450 [Camelina sativa]
Length=138

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 76/105 (72%), Gaps = 3/105 (3%)
 Frame = -1

Query  523  TPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTDQ  353
            TP R++++  LD +K+GRGPLV K+VAAT+ VL    +YS  +I +R  ES    N TDQ
Sbjct  27   TPARRVVVKLLDISKQGRGPLVAKTVAATMLVLFGSVMYSTIQINTRVSESGGVANSTDQ  86

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  218
            V+ A ++L+A LMG +LFL+++IDR+H+Y REL++ R+ +E A K
Sbjct  87   VMFANRLLEAFLMGTILFLAMVIDRMHYYTRELQITRRNLEIAVK  131



>ref|XP_004142754.1| PREDICTED: uncharacterized protein LOC101213037 [Cucumis sativus]
 ref|XP_004171530.1| PREDICTED: uncharacterized protein LOC101227390 [Cucumis sativus]
 gb|KGN51300.1| hypothetical protein Csa_5G515050 [Cucumis sativus]
Length=129

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 72/101 (71%), Gaps = 2/101 (2%)
 Frame = -1

Query  526  KTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQ  353
            K PLR L++  LDR K+GRGPLVVKSVAAT+ V+    +Y+   I  R  E+  +N TD+
Sbjct  22   KNPLRNLIVKGLDRLKQGRGPLVVKSVAATMLVVFASALYNAAAINRRVAEAGILNQTDE  81

Query  352  VLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAME  230
            +L+A ++L+   +GF LFL+L+IDR+H+YIREL  LR  +E
Sbjct  82   ILVAYRLLETYTIGFSLFLALIIDRIHNYIRELHRLRATLE  122



>ref|XP_009775442.1| PREDICTED: uncharacterized protein LOC104225364 [Nicotiana sylvestris]
Length=216

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 106/180 (59%), Gaps = 11/180 (6%)
 Frame = -1

Query  520  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  347
            PLR+L++  LD+ K  +G   V ++A T+  ++     S+ +IQ++   L ++ P DQVL
Sbjct  25   PLRELVMKCLDQVKMRKGT--VLTIAGTIAAILFSNFISIIKIQNKGAKLGTMTPMDQVL  82

Query  346  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKN  188
                +L+A+LMGF LFL  +IDR+HHY+R+L +LR       K  E+ +K    F    +
Sbjct  83   WRTNLLEATLMGFSLFLGFLIDRMHHYLRKLIVLRNNAGSSKKEFESLEKEKLQFKEKAD  142

Query  187  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLD  8
               EE+   ++EI+S+   +KK++ + E K + V+  + +  + + Q+  LLLEY +LL+
Sbjct  143  KAAEEMKQSQKEISSLTESLKKVKLQLEQKNKLVETAEAHVAALQKQAADLLLEYDRLLE  202



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880