BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF033G15

Length=607
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006357263.1|  PREDICTED: probable receptor-like protein ki...    251   4e-77   Solanum tuberosum [potatoes]
ref|XP_004238768.1|  PREDICTED: probable receptor-like protein ki...    250   4e-77   Solanum lycopersicum
ref|XP_010320662.1|  PREDICTED: probable receptor-like protein ki...    250   5e-77   Solanum lycopersicum
ref|XP_009797575.1|  PREDICTED: probable receptor-like protein ki...    250   6e-77   Nicotiana sylvestris
ref|XP_009587494.1|  PREDICTED: probable receptor-like protein ki...    250   8e-77   Nicotiana tomentosiformis
ref|XP_011071028.1|  PREDICTED: probable receptor-like protein ki...    247   1e-75   
ref|XP_009772201.1|  PREDICTED: probable receptor-like protein ki...    246   2e-75   Nicotiana sylvestris
gb|AAU89742.1|  serine/threonine protein kinase-like                    249   2e-75   Solanum tuberosum [potatoes]
ref|XP_011086394.1|  PREDICTED: probable receptor-like protein ki...    243   3e-74   Sesamum indicum [beniseed]
ref|XP_009627248.1|  PREDICTED: probable receptor-like protein ki...    241   2e-73   Nicotiana tomentosiformis
emb|CDP00286.1|  unnamed protein product                                239   9e-73   Coffea canephora [robusta coffee]
ref|XP_006363918.1|  PREDICTED: probable receptor-like protein ki...    234   1e-70   Solanum tuberosum [potatoes]
gb|KDO82763.1|  hypothetical protein CISIN_1g010432mg                   227   5e-70   Citrus sinensis [apfelsine]
ref|XP_003631281.1|  PREDICTED: probable receptor-like protein ki...    232   5e-70   Vitis vinifera
gb|KDO82764.1|  hypothetical protein CISIN_1g010432mg                   227   7e-70   Citrus sinensis [apfelsine]
ref|XP_004228384.1|  PREDICTED: probable receptor-like protein ki...    231   1e-69   Solanum lycopersicum
emb|CAN82516.1|  hypothetical protein VITISV_008843                     231   1e-69   Vitis vinifera
ref|XP_007157391.1|  hypothetical protein PHAVU_002G066400g             231   2e-69   Phaseolus vulgaris [French bean]
gb|KDO82762.1|  hypothetical protein CISIN_1g010432mg                   228   3e-69   Citrus sinensis [apfelsine]
ref|XP_009594394.1|  PREDICTED: probable receptor-like protein ki...    230   4e-69   Nicotiana tomentosiformis
ref|XP_009594393.1|  PREDICTED: probable receptor-like protein ki...    230   4e-69   Nicotiana tomentosiformis
ref|XP_007222609.1|  hypothetical protein PRUPE_ppa004933mg             230   4e-69   Prunus persica
ref|XP_003551987.1|  PREDICTED: probable receptor-like protein ki...    230   5e-69   Glycine max [soybeans]
ref|XP_010096340.1|  putative receptor-like protein kinase              229   5e-69   Morus notabilis
ref|XP_009798207.1|  PREDICTED: probable receptor-like protein ki...    229   1e-68   Nicotiana sylvestris
ref|XP_009798208.1|  PREDICTED: probable receptor-like protein ki...    228   1e-68   Nicotiana sylvestris
gb|KDO82759.1|  hypothetical protein CISIN_1g010432mg                   228   2e-68   Citrus sinensis [apfelsine]
gb|KDO82757.1|  hypothetical protein CISIN_1g010432mg                   228   2e-68   Citrus sinensis [apfelsine]
ref|XP_006438612.1|  hypothetical protein CICLE_v10031362mg             228   2e-68   Citrus clementina [clementine]
ref|XP_006483236.1|  PREDICTED: probable receptor-like protein ki...    228   2e-68   Citrus sinensis [apfelsine]
ref|NP_001235470.1|  serine/threonine protein kinase-like protein       228   3e-68   Glycine max [soybeans]
ref|XP_003532048.1|  PREDICTED: probable receptor-like protein ki...    228   3e-68   Glycine max [soybeans]
gb|KEH19837.1|  receptor-like kinase plant                              228   4e-68   Medicago truncatula
gb|KDO82758.1|  hypothetical protein CISIN_1g010432mg                   228   5e-68   Citrus sinensis [apfelsine]
ref|XP_006574323.1|  PREDICTED: serine/threonine protein kinase-l...    228   6e-68   
ref|XP_008389526.1|  PREDICTED: probable receptor-like protein ki...    227   7e-68   
ref|XP_011463101.1|  PREDICTED: probable receptor-like protein ki...    226   1e-67   Fragaria vesca subsp. vesca
ref|XP_004297338.1|  PREDICTED: probable receptor-like protein ki...    226   2e-67   Fragaria vesca subsp. vesca
ref|XP_009360398.1|  PREDICTED: probable receptor-like protein ki...    226   2e-67   Pyrus x bretschneideri [bai li]
ref|XP_007157381.1|  hypothetical protein PHAVU_002G065500g             225   2e-67   Phaseolus vulgaris [French bean]
ref|XP_003517927.1|  PREDICTED: probable receptor-like protein ki...    225   4e-67   
ref|XP_007046228.1|  Kinase superfamily protein                         225   6e-67   
ref|XP_006378157.1|  hypothetical protein POPTR_0010s04270g             223   1e-66   
ref|XP_008339937.1|  PREDICTED: probable receptor-like protein ki...    223   3e-66   Malus domestica [apple tree]
ref|XP_004509947.1|  PREDICTED: probable receptor-like protein ki...    222   5e-66   Cicer arietinum [garbanzo]
ref|XP_004489995.1|  PREDICTED: probable receptor-like protein ki...    222   5e-66   
ref|XP_009338575.1|  PREDICTED: probable receptor-like protein ki...    211   1e-65   Pyrus x bretschneideri [bai li]
ref|XP_002520138.1|  Protein kinase APK1B, chloroplast precursor,...    221   1e-65   Ricinus communis
gb|KHG18602.1|  hypothetical protein F383_24083                         218   1e-64   Gossypium arboreum [tree cotton]
gb|KJB80036.1|  hypothetical protein B456_013G077800                    218   2e-64   Gossypium raimondii
gb|EYU28703.1|  hypothetical protein MIMGU_mgv1a005501mg                217   5e-64   Erythranthe guttata [common monkey flower]
gb|KDP21228.1|  hypothetical protein JCGZ_21699                         217   6e-64   Jatropha curcas
ref|XP_010066959.1|  PREDICTED: probable receptor-like protein ki...    217   6e-64   Eucalyptus grandis [rose gum]
ref|XP_010066960.1|  PREDICTED: probable receptor-like protein ki...    217   7e-64   Eucalyptus grandis [rose gum]
ref|XP_010683263.1|  PREDICTED: probable receptor-like protein ki...    216   1e-63   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB80035.1|  hypothetical protein B456_013G077800                    216   1e-63   Gossypium raimondii
ref|XP_010683262.1|  PREDICTED: probable receptor-like protein ki...    216   1e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002311801.1|  hypothetical protein POPTR_0008s19920g             214   3e-63   
ref|XP_011034212.1|  PREDICTED: probable receptor-like protein ki...    213   8e-63   Populus euphratica
ref|XP_003613590.1|  Serine/threonine protein kinase-like protein       213   2e-62   Medicago truncatula
gb|EYU22440.1|  hypothetical protein MIMGU_mgv1a005991mg                208   6e-61   Erythranthe guttata [common monkey flower]
ref|XP_004135195.1|  PREDICTED: probable receptor-like protein ki...    205   2e-59   Cucumis sativus [cucumbers]
ref|XP_004155324.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    204   3e-59   
ref|XP_008446315.1|  PREDICTED: probable receptor-like protein ki...    204   3e-59   Cucumis melo [Oriental melon]
ref|XP_006482531.1|  PREDICTED: probable receptor-like protein ki...    203   8e-59   Citrus sinensis [apfelsine]
ref|XP_003633841.1|  PREDICTED: probable receptor-like protein ki...    203   8e-59   Vitis vinifera
ref|XP_006431068.1|  hypothetical protein CICLE_v10011575mg             203   8e-59   Citrus clementina [clementine]
ref|XP_006431066.1|  hypothetical protein CICLE_v10011575mg             203   9e-59   Citrus clementina [clementine]
ref|XP_006431067.1|  hypothetical protein CICLE_v10011575mg             203   9e-59   Citrus clementina [clementine]
dbj|BAC57958.1|  serine/threonine protein kinase                        199   1e-57   Tripolium pannonicum [sea starwort]
ref|XP_002517468.1|  Protein kinase APK1B, chloroplast precursor,...    194   1e-55   Ricinus communis
gb|KDP45472.1|  hypothetical protein JCGZ_09721                         194   2e-55   Jatropha curcas
ref|XP_008459298.1|  PREDICTED: probable receptor-like protein ki...    192   7e-55   Cucumis melo [Oriental melon]
ref|XP_004148688.1|  PREDICTED: probable receptor-like protein ki...    192   8e-55   
gb|KGN52446.1|  hypothetical protein Csa_5G635410                       192   8e-55   Cucumis sativus [cucumbers]
ref|XP_008459299.1|  PREDICTED: probable receptor-like protein ki...    192   8e-55   Cucumis melo [Oriental melon]
ref|XP_010242357.1|  PREDICTED: probable receptor-like protein ki...    192   1e-54   Nelumbo nucifera [Indian lotus]
ref|XP_011003187.1|  PREDICTED: probable receptor-like protein ki...    189   9e-54   Populus euphratica
ref|XP_011003188.1|  PREDICTED: probable receptor-like protein ki...    189   9e-54   Populus euphratica
ref|XP_002323829.2|  hypothetical protein POPTR_0017s11370g             189   2e-53   Populus trichocarpa [western balsam poplar]
ref|XP_002323831.2|  hypothetical protein POPTR_0017s11370g             189   2e-53   Populus trichocarpa [western balsam poplar]
ref|XP_010256394.1|  PREDICTED: probable receptor-like protein ki...    189   2e-53   Nelumbo nucifera [Indian lotus]
ref|XP_010256402.1|  PREDICTED: probable receptor-like protein ki...    189   2e-53   Nelumbo nucifera [Indian lotus]
ref|XP_010242353.1|  PREDICTED: probable receptor-like protein ki...    188   4e-53   
ref|XP_010242355.1|  PREDICTED: probable receptor-like protein ki...    188   5e-53   Nelumbo nucifera [Indian lotus]
ref|XP_010242356.1|  PREDICTED: probable receptor-like protein ki...    188   5e-53   Nelumbo nucifera [Indian lotus]
ref|XP_002305368.1|  kinase family protein                              187   5e-53   
ref|XP_011009452.1|  PREDICTED: probable receptor-like protein ki...    187   6e-53   Populus euphratica
ref|XP_011009453.1|  PREDICTED: probable receptor-like protein ki...    187   6e-53   Populus euphratica
gb|KCW52800.1|  hypothetical protein EUGRSUZ_J02135                     187   8e-53   Eucalyptus grandis [rose gum]
gb|KFK25744.1|  hypothetical protein AALP_AA8G154000                    187   1e-52   Arabis alpina [alpine rockcress]
ref|XP_010033218.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    187   1e-52   Eucalyptus grandis [rose gum]
ref|XP_008230724.1|  PREDICTED: probable receptor-like protein ki...    186   2e-52   Prunus mume [ume]
ref|XP_010931968.1|  PREDICTED: probable receptor-like protein ki...    185   2e-52   
ref|XP_007217722.1|  hypothetical protein PRUPE_ppa005147mg             186   2e-52   Prunus persica
ref|XP_010524324.1|  PREDICTED: probable receptor-like protein ki...    185   4e-52   Tarenaya hassleriana [spider flower]
ref|XP_010931889.1|  PREDICTED: probable receptor-like protein ki...    185   4e-52   Elaeis guineensis
ref|XP_010931806.1|  PREDICTED: probable receptor-like protein ki...    185   5e-52   
ref|XP_009131434.1|  PREDICTED: probable receptor-like protein ki...    185   6e-52   Brassica rapa
ref|XP_004302358.1|  PREDICTED: probable receptor-like protein ki...    184   7e-52   Fragaria vesca subsp. vesca
ref|XP_008793500.1|  PREDICTED: probable receptor-like protein ki...    184   8e-52   Phoenix dactylifera
ref|NP_197012.1|  probable receptor-like protein kinase                 184   9e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006400026.1|  hypothetical protein EUTSA_v10013316mg             184   1e-51   Eutrema salsugineum [saltwater cress]
ref|XP_010915107.1|  PREDICTED: probable receptor-like protein ki...    184   1e-51   
ref|XP_010915102.1|  PREDICTED: probable receptor-like protein ki...    184   1e-51   
ref|XP_010915105.1|  PREDICTED: probable receptor-like protein ki...    184   2e-51   
ref|XP_008808482.1|  PREDICTED: probable receptor-like protein ki...    183   2e-51   
ref|XP_008808474.1|  PREDICTED: probable receptor-like protein ki...    183   2e-51   
ref|XP_008808442.1|  PREDICTED: probable receptor-like protein ki...    184   2e-51   
ref|XP_008808456.1|  PREDICTED: probable receptor-like protein ki...    184   2e-51   
dbj|BAJ91316.1|  predicted protein                                      182   2e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006842103.1|  hypothetical protein AMTR_s00078p00087780          183   3e-51   Amborella trichopoda
emb|CDX70589.1|  BnaC03g06730D                                          183   3e-51   
emb|CDM83073.1|  unnamed protein product                                183   3e-51   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008230745.1|  PREDICTED: probable receptor-like protein ki...    182   5e-51   Prunus mume [ume]
gb|KJB40826.1|  hypothetical protein B456_007G078700                    182   7e-51   Gossypium raimondii
gb|KJB40825.1|  hypothetical protein B456_007G078700                    182   8e-51   Gossypium raimondii
gb|AAL14379.1|  AT3g01300/T22N4_7                                       174   8e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009335822.1|  PREDICTED: probable receptor-like protein ki...    181   9e-51   Pyrus x bretschneideri [bai li]
ref|XP_008379338.1|  PREDICTED: probable receptor-like protein ki...    181   1e-50   
ref|XP_008357761.1|  PREDICTED: probable receptor-like protein ki...    181   1e-50   
ref|XP_009386615.1|  PREDICTED: probable receptor-like protein ki...    181   1e-50   
ref|XP_009400522.1|  PREDICTED: probable receptor-like protein ki...    181   1e-50   
gb|EMT24219.1|  Protein kinase APK1A, chloroplastic                     180   1e-50   
ref|XP_002871647.1|  hypothetical protein ARALYDRAFT_909477             181   4e-50   Arabidopsis lyrata subsp. lyrata
ref|XP_003569281.1|  PREDICTED: probable receptor-like protein ki...    180   4e-50   Brachypodium distachyon [annual false brome]
ref|XP_010420160.1|  PREDICTED: probable receptor-like protein ki...    180   5e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010492331.1|  PREDICTED: probable receptor-like protein ki...    180   5e-50   Camelina sativa [gold-of-pleasure]
ref|XP_004489164.1|  PREDICTED: probable receptor-like protein ki...    179   8e-50   Cicer arietinum [garbanzo]
ref|XP_007032485.1|  Kinase superfamily protein isoform 2               179   9e-50   
ref|XP_004489165.1|  PREDICTED: probable receptor-like protein ki...    179   1e-49   Cicer arietinum [garbanzo]
ref|XP_007032484.1|  Kinase superfamily protein isoform 1               179   1e-49   Theobroma cacao [chocolate]
gb|EAZ12511.1|  hypothetical protein OsJ_02407                          177   2e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003621108.1|  Protein kinase 2B                                  177   3e-49   
gb|AES77326.2|  receptor-like kinase plant                              177   3e-49   Medicago truncatula
ref|XP_006646050.1|  PREDICTED: probable receptor-like protein ki...    177   3e-49   
ref|NP_001043435.1|  Os01g0588500                                       177   3e-49   
ref|XP_008357756.1|  PREDICTED: probable receptor-like protein ki...    177   3e-49   
ref|XP_008357757.1|  PREDICTED: probable receptor-like protein ki...    177   4e-49   
gb|EAY74738.1|  hypothetical protein OsI_02628                          177   4e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_010485514.1|  PREDICTED: receptor-like serine/threonine-pr...    177   4e-49   
ref|XP_006286494.1|  hypothetical protein CARUB_v10000765mg             177   4e-49   Capsella rubella
ref|XP_010463545.1|  PREDICTED: receptor-like serine/threonine-pr...    176   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010510371.1|  PREDICTED: receptor-like serine/threonine-pr...    176   1e-48   
ref|XP_006408482.1|  hypothetical protein EUTSA_v10020609mg             176   1e-48   Eutrema salsugineum [saltwater cress]
ref|XP_007217345.1|  hypothetical protein PRUPE_ppa019180mg             176   2e-48   Prunus persica
dbj|BAD23327.1|  putative serine/threonine protein kinase               172   2e-48   Oryza sativa Japonica Group [Japonica rice]
emb|CDY59664.1|  BnaCnng35380D                                          174   5e-48   Brassica napus [oilseed rape]
ref|NP_186779.1|  receptor-like serine/threonine-protein kinase         174   6e-48   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64595.1|  putative protein kinase                                 174   6e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001062980.1|  Os09g0361100                                       172   7e-48   
ref|XP_007139605.1|  hypothetical protein PHAVU_008G043900g             173   1e-47   Phaseolus vulgaris [French bean]
ref|XP_006297525.1|  hypothetical protein CARUB_v10013549mg             174   1e-47   Capsella rubella
ref|XP_007139604.1|  hypothetical protein PHAVU_008G043900g             173   1e-47   Phaseolus vulgaris [French bean]
ref|XP_004969384.1|  PREDICTED: probable receptor-like protein ki...    173   1e-47   Setaria italica
ref|XP_007151194.1|  hypothetical protein PHAVU_004G026000g             172   2e-47   Phaseolus vulgaris [French bean]
ref|XP_004956652.1|  PREDICTED: probable receptor-like protein ki...    173   3e-47   Setaria italica
ref|XP_004956653.1|  PREDICTED: probable receptor-like protein ki...    172   3e-47   Setaria italica
ref|XP_006431137.1|  hypothetical protein CICLE_v10011638mg             172   3e-47   Citrus clementina [clementine]
gb|ABR18367.1|  unknown                                                 172   4e-47   Picea sitchensis
ref|XP_010108963.1|  putative receptor-like protein kinase              172   4e-47   
ref|NP_001150552.1|  LOC100284184                                       172   4e-47   Zea mays [maize]
ref|XP_010925061.1|  PREDICTED: probable receptor-like protein ki...    172   4e-47   Elaeis guineensis
gb|ACN35886.1|  unknown                                                 172   4e-47   Zea mays [maize]
ref|XP_010925062.1|  PREDICTED: probable receptor-like protein ki...    172   5e-47   Elaeis guineensis
ref|XP_010531802.1|  PREDICTED: probable receptor-like protein ki...    171   5e-47   Tarenaya hassleriana [spider flower]
ref|XP_010531804.1|  PREDICTED: probable receptor-like protein ki...    171   5e-47   Tarenaya hassleriana [spider flower]
ref|XP_010531801.1|  PREDICTED: probable receptor-like protein ki...    171   5e-47   Tarenaya hassleriana [spider flower]
tpg|DAA58731.1|  TPA: putative protein kinase superfamily protein       172   5e-47   
emb|CDP02215.1|  unnamed protein product                                172   6e-47   Coffea canephora [robusta coffee]
ref|XP_009121617.1|  PREDICTED: probable receptor-like protein ki...    172   7e-47   Brassica rapa
ref|XP_008341552.1|  PREDICTED: probable receptor-like protein ki...    171   7e-47   
ref|XP_010550086.1|  PREDICTED: probable receptor-like protein ki...    169   7e-47   Tarenaya hassleriana [spider flower]
ref|XP_009125034.1|  PREDICTED: receptor-like serine/threonine-pr...    171   8e-47   Brassica rapa
ref|XP_008341551.1|  PREDICTED: probable receptor-like protein ki...    171   8e-47   
ref|NP_001167795.1|  uncharacterized LOC100381489                       166   1e-46   
emb|CDY65043.1|  BnaA10g29770D                                          176   1e-46   Brassica napus [oilseed rape]
emb|CDY28689.1|  BnaCnng05750D                                          171   1e-46   Brassica napus [oilseed rape]
ref|XP_002458067.1|  hypothetical protein SORBIDRAFT_03g026370          171   1e-46   Sorghum bicolor [broomcorn]
ref|XP_006661159.1|  PREDICTED: probable receptor-like protein ki...    171   2e-46   Oryza brachyantha
ref|XP_009147414.1|  PREDICTED: receptor-like serine/threonine-pr...    170   2e-46   Brassica rapa
emb|CDY37534.1|  BnaA05g33990D                                          170   2e-46   Brassica napus [oilseed rape]
gb|EAZ44450.1|  hypothetical protein OsJ_29062                          170   2e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010550085.1|  PREDICTED: probable receptor-like protein ki...    169   3e-46   Tarenaya hassleriana [spider flower]
gb|EEC84434.1|  hypothetical protein OsI_31048                          170   3e-46   Oryza sativa Indica Group [Indian rice]
dbj|BAK03050.1|  predicted protein                                      169   4e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008341535.1|  PREDICTED: probable receptor-like protein ki...    169   5e-46   
ref|XP_003534465.1|  PREDICTED: probable receptor-like protein ki...    169   5e-46   Glycine max [soybeans]
ref|XP_006587767.1|  PREDICTED: probable receptor-like protein ki...    169   6e-46   Glycine max [soybeans]
ref|XP_009347056.1|  PREDICTED: probable receptor-like protein ki...    168   1e-45   
emb|CDY49042.1|  BnaC05g48700D                                          168   1e-45   Brassica napus [oilseed rape]
ref|XP_009347057.1|  PREDICTED: probable receptor-like protein ki...    167   1e-45   Pyrus x bretschneideri [bai li]
ref|XP_002460108.1|  hypothetical protein SORBIDRAFT_02g022880          168   1e-45   Sorghum bicolor [broomcorn]
gb|KHN13655.1|  Putative receptor-like protein kinase                   167   2e-45   Glycine soja [wild soybean]
gb|KDO72560.1|  hypothetical protein CISIN_1g011851mg                   167   2e-45   Citrus sinensis [apfelsine]
ref|XP_010528316.1|  PREDICTED: probable receptor-like protein ki...    167   2e-45   Tarenaya hassleriana [spider flower]
ref|XP_010528314.1|  PREDICTED: probable receptor-like protein ki...    167   2e-45   Tarenaya hassleriana [spider flower]
ref|XP_010528317.1|  PREDICTED: probable receptor-like protein ki...    167   2e-45   Tarenaya hassleriana [spider flower]
ref|XP_006601719.1|  PREDICTED: serine/threonine protein kinase-l...    167   2e-45   Glycine max [soybeans]
ref|XP_010554040.1|  PREDICTED: probable receptor-like protein ki...    167   2e-45   Tarenaya hassleriana [spider flower]
gb|KJB75753.1|  hypothetical protein B456_012G055500                    167   2e-45   Gossypium raimondii
ref|NP_001238522.1|  serine/threonine protein kinase-like protein       167   3e-45   Glycine max [soybeans]
ref|XP_006482585.1|  PREDICTED: probable receptor-like protein ki...    167   3e-45   Citrus sinensis [apfelsine]
gb|KHG05986.1|  hypothetical protein F383_32908                         167   3e-45   Gossypium arboreum [tree cotton]
tpg|DAA61160.1|  TPA: putative protein kinase superfamily protein       166   3e-45   
gb|KHG16091.1|  hypothetical protein F383_07681                         166   6e-45   Gossypium arboreum [tree cotton]
ref|XP_004489370.1|  PREDICTED: probable receptor-like protein ki...    166   6e-45   Cicer arietinum [garbanzo]
ref|XP_003578019.1|  PREDICTED: probable receptor-like protein ki...    166   8e-45   Brachypodium distachyon [annual false brome]
ref|XP_010238085.1|  PREDICTED: probable receptor-like protein ki...    166   9e-45   Brachypodium distachyon [annual false brome]
ref|NP_189510.2|  putative protein kinase                               163   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008651616.1|  PREDICTED: uncharacterized protein LOC100381...    165   2e-44   
ref|XP_008651617.1|  PREDICTED: uncharacterized protein LOC100381...    165   2e-44   Zea mays [maize]
ref|NP_001154651.1|  putative protein kinase                            163   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008667770.1|  PREDICTED: uncharacterized LOC100279298 isof...    164   3e-44   Zea mays [maize]
ref|NP_001145791.1|  uncharacterized LOC100279298                       164   3e-44   Zea mays [maize]
ref|XP_011013709.1|  PREDICTED: probable receptor-like protein ki...    163   4e-44   Populus euphratica
ref|XP_006395351.1|  hypothetical protein EUTSA_v10004125mg             164   4e-44   Eutrema salsugineum [saltwater cress]
ref|XP_011098600.1|  PREDICTED: probable receptor-like protein ki...    164   4e-44   Sesamum indicum [beniseed]
dbj|BAB02184.1|  protein kinase                                         164   4e-44   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001030790.2|  putative protein kinase                            163   4e-44   
ref|XP_011013708.1|  PREDICTED: probable receptor-like protein ki...    163   7e-44   Populus euphratica
ref|XP_010087809.1|  putative receptor-like protein kinase              163   7e-44   
ref|XP_002305322.2|  hypothetical protein POPTR_0004s13410g             162   2e-43   Populus trichocarpa [western balsam poplar]
emb|CDY47249.1|  BnaA02g29350D                                          162   2e-43   Brassica napus [oilseed rape]
ref|XP_009129365.1|  PREDICTED: probable receptor-like protein ki...    162   2e-43   Brassica rapa
ref|XP_009129364.1|  PREDICTED: probable receptor-like protein ki...    162   2e-43   Brassica rapa
gb|KFK33749.1|  hypothetical protein AALP_AA5G055100                    161   3e-43   Arabis alpina [alpine rockcress]
ref|XP_007032445.1|  Kinase superfamily protein isoform 1               160   6e-43   
emb|CDY20019.1|  BnaA09g02320D                                          152   3e-42   Brassica napus [oilseed rape]
ref|XP_011462440.1|  PREDICTED: probable receptor-like protein ki...    159   3e-42   Fragaria vesca subsp. vesca
ref|XP_004297955.1|  PREDICTED: probable receptor-like protein ki...    159   3e-42   Fragaria vesca subsp. vesca
ref|XP_011462439.1|  PREDICTED: probable receptor-like protein ki...    159   4e-42   Fragaria vesca subsp. vesca
ref|XP_011462438.1|  PREDICTED: probable receptor-like protein ki...    159   4e-42   Fragaria vesca subsp. vesca
ref|XP_011462437.1|  PREDICTED: probable receptor-like protein ki...    159   4e-42   Fragaria vesca subsp. vesca
ref|XP_009342879.1|  PREDICTED: probable receptor-like protein ki...    158   4e-42   Pyrus x bretschneideri [bai li]
ref|XP_009342878.1|  PREDICTED: probable receptor-like protein ki...    158   5e-42   Pyrus x bretschneideri [bai li]
ref|XP_006291019.1|  hypothetical protein CARUB_v10017133mg             158   6e-42   Capsella rubella
ref|XP_006291020.1|  hypothetical protein CARUB_v10017133mg             158   6e-42   Capsella rubella
gb|KHN45478.1|  Putative receptor-like protein kinase                   158   6e-42   Glycine soja [wild soybean]
ref|XP_006603648.1|  PREDICTED: serine/threonine protein kinase-l...    158   7e-42   Glycine max [soybeans]
emb|CDY04026.1|  BnaC02g37410D                                          157   7e-42   
ref|NP_001237700.1|  serine/threonine protein kinase-like protein       157   7e-42   Glycine max [soybeans]
ref|XP_010425648.1|  PREDICTED: probable receptor-like protein ki...    157   8e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010425649.1|  PREDICTED: probable receptor-like protein ki...    157   9e-42   Camelina sativa [gold-of-pleasure]
gb|KHG03635.1|  hypothetical protein F383_28355                         157   1e-41   Gossypium arboreum [tree cotton]
gb|KJB33658.1|  hypothetical protein B456_006G024600                    156   2e-41   Gossypium raimondii
gb|EYU34094.1|  hypothetical protein MIMGU_mgv1a005466mg                156   3e-41   Erythranthe guttata [common monkey flower]
gb|KJB33655.1|  hypothetical protein B456_006G024600                    156   5e-41   Gossypium raimondii
ref|XP_002875462.1|  kinase                                             155   5e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_010514576.1|  PREDICTED: probable receptor-like protein ki...    155   5e-41   Camelina sativa [gold-of-pleasure]
gb|KJB33656.1|  hypothetical protein B456_006G024600                    156   6e-41   Gossypium raimondii
gb|EMT18319.1|  Protein kinase APK1B, chloroplastic                     152   6e-40   
ref|XP_009111604.1|  PREDICTED: probable receptor-like protein ki...    151   2e-39   Brassica rapa
gb|EPS73632.1|  hypothetical protein M569_01122                         149   2e-39   Genlisea aurea
gb|KEH24967.1|  receptor-like kinase plant                              150   5e-39   Medicago truncatula
gb|EPS68546.1|  hypothetical protein M569_06221                         141   1e-36   Genlisea aurea
gb|ABR16311.1|  unknown                                                 139   2e-35   Picea sitchensis
emb|CDY00122.1|  BnaC09g01790D                                          140   1e-34   
gb|AGJ95079.1|  RPG5                                                    141   2e-34   Hordeum vulgare subsp. spontaneum [wild barley]
gb|AGJ95077.1|  RPG5                                                    140   2e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004961024.1|  PREDICTED: probable receptor-like protein ki...    136   5e-34   Setaria italica
gb|ABK24429.1|  unknown                                                 135   1e-33   Picea sitchensis
gb|KDP30451.1|  hypothetical protein JCGZ_17139                         127   6e-33   Jatropha curcas
gb|EPS60576.1|  hypothetical protein M569_14225                         133   6e-33   Genlisea aurea
ref|XP_002882187.1|  hypothetical protein ARALYDRAFT_896131             133   7e-33   
ref|XP_010456541.1|  PREDICTED: probable receptor-like protein ki...    131   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_002440373.1|  hypothetical protein SORBIDRAFT_09g030520          130   3e-32   
ref|XP_009393969.1|  PREDICTED: probable receptor-like protein ki...    127   1e-30   
ref|XP_002963908.1|  hypothetical protein SELMODRAFT_79963              120   9e-29   
ref|XP_002988311.1|  hypothetical protein SELMODRAFT_127709             120   1e-28   
ref|XP_009783876.1|  PREDICTED: probable receptor-like protein ki...    119   6e-28   Nicotiana sylvestris
ref|XP_001758139.1|  predicted protein                                  119   7e-28   
ref|XP_001776496.1|  predicted protein                                  117   3e-27   
emb|CBI22184.3|  unnamed protein product                                116   4e-27   Vitis vinifera
ref|XP_010250180.1|  PREDICTED: probable receptor-like protein ki...    114   2e-26   Nelumbo nucifera [Indian lotus]
gb|EPS68381.1|  hypothetical protein M569_06386                         112   8e-26   Genlisea aurea
ref|XP_010047978.1|  PREDICTED: probable receptor-like protein ki...    110   5e-25   Eucalyptus grandis [rose gum]
ref|XP_010047979.1|  PREDICTED: probable receptor-like protein ki...    110   5e-25   
ref|XP_009624443.1|  PREDICTED: probable receptor-like protein ki...    110   7e-25   Nicotiana tomentosiformis
ref|XP_009762091.1|  PREDICTED: probable receptor-like protein ki...    109   9e-25   
ref|XP_010112470.1|  Receptor-like serine/threonine-protein kinase      109   1e-24   
ref|XP_009762090.1|  PREDICTED: probable receptor-like protein ki...    109   1e-24   
ref|XP_009599240.1|  PREDICTED: probable receptor-like protein ki...    108   2e-24   
gb|ABK94948.1|  unknown                                                 103   2e-24   
ref|XP_003609389.1|  Protein kinase 2B                                  108   3e-24   
ref|XP_007202128.1|  hypothetical protein PRUPE_ppa006069mg             108   3e-24   
ref|XP_007155041.1|  hypothetical protein PHAVU_003G168000g             107   3e-24   
ref|XP_002527168.1|  Protein kinase APK1B, chloroplast precursor,...    108   4e-24   
ref|XP_007155042.1|  hypothetical protein PHAVU_003G168000g             107   4e-24   
ref|XP_008367837.1|  PREDICTED: probable receptor-like protein ki...    107   5e-24   
ref|XP_004508467.1|  PREDICTED: probable receptor-like protein ki...    107   5e-24   
emb|CDP10443.1|  unnamed protein product                                107   7e-24   
gb|KDP30253.1|  hypothetical protein JCGZ_17035                         107   9e-24   
gb|AGJ95073.1|  RPG5                                                    110   9e-24   
gb|KHG19731.1|  hypothetical protein F383_25550                         107   9e-24   
gb|ABR16273.1|  unknown                                                 107   9e-24   
gb|ACG68417.1|  stem rust resistance protein                            110   9e-24   
gb|ACH69774.1|  NBS-LRR-S/TPK stem rust resistance protein              110   9e-24   
gb|KJB06472.1|  hypothetical protein B456_001G044200                    107   9e-24   
gb|KJB06473.1|  hypothetical protein B456_001G044200                    106   1e-23   
ref|XP_010927374.1|  PREDICTED: probable receptor-like protein ki...    106   2e-23   
gb|AFK35549.1|  unknown                                                 102   2e-23   
ref|XP_010927375.1|  PREDICTED: probable receptor-like protein ki...    105   2e-23   
ref|XP_002285390.2|  PREDICTED: receptor-like serine/threonine-pr...    105   2e-23   
ref|XP_010656462.1|  PREDICTED: receptor-like serine/threonine-pr...    105   2e-23   
ref|XP_006593328.1|  PREDICTED: protein kinase isoform X2               105   2e-23   
ref|NP_001235445.1|  protein kinase                                     105   2e-23   
ref|XP_006593327.1|  PREDICTED: protein kinase isoform X1               105   3e-23   
ref|XP_003609833.1|  Protein kinase                                     102   3e-23   
ref|XP_004150205.1|  PREDICTED: probable receptor-like protein ki...    105   4e-23   
ref|XP_007013526.1|  Receptor serine/threonine-protein kinase           105   4e-23   
ref|XP_008443961.1|  PREDICTED: probable receptor-like protein ki...    105   4e-23   
ref|XP_006600745.1|  PREDICTED: probable receptor-like protein ki...    104   5e-23   
ref|XP_006600744.1|  PREDICTED: probable receptor-like protein ki...    104   6e-23   
gb|KHN15066.1|  Putative receptor-like protein kinase                   104   6e-23   
ref|XP_010227983.1|  PREDICTED: receptor-like serine/threonine-pr...    103   7e-23   
ref|XP_003564253.2|  PREDICTED: receptor-like serine/threonine-pr...    103   7e-23   
gb|KDO73502.1|  hypothetical protein CISIN_1g014202mg                   103   1e-22   
ref|XP_010687930.1|  PREDICTED: probable receptor-like protein ki...    103   1e-22   
gb|AFG70415.1|  hypothetical protein 2_10236_01                       99.4    1e-22   
gb|AFG70414.1|  hypothetical protein 2_10236_01                       99.4    1e-22   
gb|AEW08452.1|  hypothetical protein 2_10236_01                       99.4    1e-22   
ref|XP_004242763.1|  PREDICTED: probable receptor-like protein ki...    103   1e-22   
ref|XP_006453077.1|  hypothetical protein CICLE_v10008365mg             103   1e-22   
ref|XP_006474421.1|  PREDICTED: probable receptor-like protein ki...    103   1e-22   
ref|XP_011078389.1|  PREDICTED: receptor-like serine/threonine-pr...    103   1e-22   
ref|XP_006856462.1|  hypothetical protein AMTR_s00046p00017580          101   2e-22   
ref|XP_010687929.1|  PREDICTED: probable receptor-like protein ki...    103   2e-22   
ref|XP_008457019.1|  PREDICTED: probable receptor-like protein ki...    103   2e-22   
ref|XP_004159424.1|  PREDICTED: probable receptor-like protein ki...    102   2e-22   
ref|XP_008457027.1|  PREDICTED: probable serine/threonine-protein...    102   3e-22   
gb|EYU34980.1|  hypothetical protein MIMGU_mgv1a0051511mg             98.2    3e-22   
ref|XP_004139295.1|  PREDICTED: receptor-like serine/threonine-pr...    102   3e-22   
gb|EEC80094.1|  hypothetical protein OsI_21831                          102   3e-22   
ref|NP_001056928.1|  Os06g0168800                                       102   3e-22   
gb|EEE65169.1|  hypothetical protein OsJ_20272                          102   4e-22   
ref|XP_006358299.1|  PREDICTED: probable receptor-like protein ki...    102   4e-22   
gb|EMT06543.1|  Protein kinase APK1A, chloroplastic                     102   4e-22   
ref|XP_006655833.1|  PREDICTED: probable receptor-like protein ki...    102   4e-22   
gb|AFW85654.1|  putative protein kinase superfamily protein           99.4    5e-22   
dbj|BAJ98008.1|  predicted protein                                      102   5e-22   
ref|XP_002324636.2|  hypothetical protein POPTR_0018s12740g             102   5e-22   
ref|XP_002308064.1|  hypothetical protein POPTR_0006s06500g             101   6e-22   
ref|XP_011020169.1|  PREDICTED: probable receptor-like protein ki...    101   7e-22   
ref|XP_006381117.1|  hypothetical protein POPTR_0006s06500g             101   7e-22   
gb|ABK93629.1|  unknown                                                 101   8e-22   
ref|XP_004287283.1|  PREDICTED: probable receptor-like protein ki...    101   8e-22   
ref|XP_008669554.1|  PREDICTED: receptor-like serine/threonine-pr...  98.6    8e-22   
ref|XP_011020168.1|  PREDICTED: receptor-like serine/threonine-pr...    101   9e-22   
gb|AFG70413.1|  hypothetical protein 2_10236_01                       96.3    2e-21   
gb|KJB54000.1|  hypothetical protein B456_009G015800                    100   2e-21   
ref|XP_008669553.1|  PREDICTED: protein STRUBBELIG-like isoform X1    97.8    3e-21   
ref|XP_004964735.1|  PREDICTED: receptor-like serine/threonine-pr...  99.0    5e-21   
ref|XP_010541906.1|  PREDICTED: probable serine/threonine-protein...  99.4    6e-21   
gb|AGT16920.1|  hypothetical protein SHCRBa_201_A23_R_220             98.6    6e-21   
ref|XP_010541905.1|  PREDICTED: probable serine/threonine-protein...  99.0    8e-21   
ref|XP_002437918.1|  hypothetical protein SORBIDRAFT_10g004793        97.8    1e-20   
ref|XP_006429091.1|  hypothetical protein CICLE_v10011895mg           96.3    5e-20   
gb|KDO51148.1|  hypothetical protein CISIN_1g015909mg                 96.3    5e-20   
ref|XP_008387769.1|  PREDICTED: probable serine/threonine-protein...  95.5    7e-20   
ref|XP_002979837.1|  hypothetical protein SELMODRAFT_153518           95.9    1e-19   
ref|XP_002976449.1|  hypothetical protein SELMODRAFT_151233           95.9    1e-19   
ref|XP_006854945.1|  hypothetical protein AMTR_s00052p00149280        91.7    1e-19   
ref|XP_004302742.1|  PREDICTED: probable serine/threonine-protein...  94.7    2e-19   
ref|XP_009393735.1|  PREDICTED: receptor-like serine/threonine-pr...  93.2    4e-19   
ref|XP_010090162.1|  Serine/threonine-protein kinase                  94.4    4e-19   
ref|XP_010256925.1|  PREDICTED: protein kinase APK1A, chloroplastic   93.6    4e-19   
ref|XP_008357182.1|  PREDICTED: protein kinase APK1A, chloroplastic   94.0    4e-19   
ref|XP_009610452.1|  PREDICTED: probable serine/threonine-protein...  93.6    5e-19   
ref|XP_009610451.1|  PREDICTED: probable serine/threonine-protein...  93.6    5e-19   
ref|XP_007016403.1|  Kinase 1B isoform 1                              93.2    5e-19   
ref|XP_009393734.1|  PREDICTED: receptor-like serine/threonine-pr...  93.2    6e-19   
ref|XP_010693044.1|  PREDICTED: serine/threonine-protein kinase A...  92.4    7e-19   
ref|XP_004141072.1|  PREDICTED: putative receptor-like protein ki...  92.4    8e-19   
ref|XP_006849707.1|  hypothetical protein AMTR_s00024p00242070        93.2    8e-19   
dbj|BAJ95924.1|  predicted protein                                    93.2    8e-19   
ref|XP_004157966.1|  PREDICTED: putative receptor-like protein ki...  92.0    8e-19   
ref|XP_008240890.1|  PREDICTED: probable serine/threonine-protein...  92.8    8e-19   
ref|XP_008459841.1|  PREDICTED: serine/threonine-protein kinase A...  92.4    8e-19   
ref|XP_008784589.1|  PREDICTED: protein kinase APK1A, chloroplast...  92.8    9e-19   
ref|XP_009772470.1|  PREDICTED: probable serine/threonine-protein...  92.8    1e-18   
gb|EMT28395.1|  Putative serine/threonine-protein kinase NAK          91.7    1e-18   
gb|KGN60504.1|  hypothetical protein Csa_2G000130                     92.0    1e-18   
ref|XP_008784588.1|  PREDICTED: protein kinase APK1A, chloroplast...  92.8    1e-18   
ref|XP_008804652.1|  PREDICTED: serine/threonine-protein kinase A...  92.4    1e-18   
ref|XP_002280196.1|  PREDICTED: serine/threonine-protein kinase A...  92.8    1e-18   
emb|CBI16124.3|  unnamed protein product                              92.0    1e-18   
gb|KDO72843.1|  hypothetical protein CISIN_1g046897mg                 92.0    1e-18   
ref|XP_010693043.1|  PREDICTED: serine/threonine-protein kinase A...  92.8    1e-18   
ref|XP_006424836.1|  hypothetical protein CICLE_v10028570mg           92.0    1e-18   
ref|XP_009414323.1|  PREDICTED: probable serine/threonine-protein...  92.4    1e-18   
gb|AEW08298.1|  hypothetical protein 2_5961_01                        89.0    2e-18   
ref|XP_009414322.1|  PREDICTED: probable serine/threonine-protein...  92.4    2e-18   
gb|KJB33657.1|  hypothetical protein B456_006G024600                  92.4    2e-18   
gb|AFG51956.1|  hypothetical protein 2_5961_01                        88.6    2e-18   
gb|AEW08299.1|  hypothetical protein 2_5961_01                        88.6    2e-18   
gb|ABD95976.1|  serine/threonine kinase                               89.0    2e-18   
ref|XP_009364395.1|  PREDICTED: protein kinase APK1A, chloroplast...  91.7    2e-18   
ref|XP_010920578.1|  PREDICTED: protein kinase APK1B, chloroplast...  91.7    2e-18   
ref|XP_010922837.1|  PREDICTED: serine/threonine-protein kinase A...  91.7    2e-18   
ref|XP_009414410.1|  PREDICTED: probable serine/threonine-protein...  91.7    2e-18   
ref|XP_010273843.1|  PREDICTED: serine/threonine-protein kinase A...  92.4    3e-18   
ref|XP_010922836.1|  PREDICTED: serine/threonine-protein kinase A...  91.7    3e-18   
ref|XP_008360478.1|  PREDICTED: serine/threonine-protein kinase A...  91.7    3e-18   
ref|XP_009353659.1|  PREDICTED: protein kinase APK1A, chloroplast...  91.3    3e-18   
ref|XP_010941423.1|  PREDICTED: probable serine/threonine-protein...  91.7    3e-18   
ref|XP_009390859.1|  PREDICTED: serine/threonine-protein kinase A...  91.7    3e-18   
ref|XP_009390860.1|  PREDICTED: serine/threonine-protein kinase A...  91.7    3e-18   
ref|XP_009392329.1|  PREDICTED: probable serine/threonine-protein...  91.3    3e-18   
dbj|BAK05812.1|  predicted protein                                    91.3    3e-18   
ref|XP_002283646.2|  PREDICTED: protein kinase APK1A, chloroplastic   91.7    3e-18   
ref|XP_009362032.1|  PREDICTED: serine/threonine-protein kinase A...  91.3    3e-18   
ref|XP_009362034.1|  PREDICTED: serine/threonine-protein kinase A...  91.3    3e-18   
ref|XP_008442306.1|  PREDICTED: serine/threonine-protein kinase A...  91.3    3e-18   
ref|XP_008388407.1|  PREDICTED: serine/threonine-protein kinase A...  91.3    3e-18   
emb|CDY68189.1|  BnaCnng57950D                                        90.9    4e-18   
ref|XP_009337839.1|  PREDICTED: serine/threonine-protein kinase A...  90.9    4e-18   
ref|XP_004252518.1|  PREDICTED: putative receptor-like protein ki...  90.9    4e-18   
ref|XP_004160326.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  90.9    5e-18   
emb|CDX83496.1|  BnaA03g20100D                                        90.9    5e-18   
ref|XP_009133583.1|  PREDICTED: serine/threonine-protein kinase A...  90.9    5e-18   
ref|XP_004137666.1|  PREDICTED: serine/threonine-protein kinase A...  90.9    5e-18   
ref|NP_001274846.1|  protein kinase APK1B, chloroplastic-like         90.9    5e-18   
ref|XP_010553184.1|  PREDICTED: serine/threonine-protein kinase A...  90.9    5e-18   
ref|XP_007032291.1|  Kinase superfamily protein isoform 2             90.5    5e-18   
ref|XP_010490480.1|  PREDICTED: serine/threonine-protein kinase A...  89.0    6e-18   
ref|XP_007032290.1|  Kinase superfamily protein isoform 1             90.9    6e-18   
ref|XP_010264446.1|  PREDICTED: protein kinase APK1A, chloroplastic   90.5    6e-18   
ref|XP_003579009.1|  PREDICTED: serine/threonine-protein kinase A...  90.5    6e-18   
ref|XP_007205264.1|  hypothetical protein PRUPE_ppa006390mg           90.5    7e-18   
ref|XP_004294513.1|  PREDICTED: protein kinase APK1A, chloroplastic   90.1    7e-18   
ref|XP_008223637.1|  PREDICTED: protein kinase APK1A, chloroplast...  90.1    7e-18   
ref|XP_008451160.1|  PREDICTED: serine/threonine-protein kinase A...  89.0    8e-18   
ref|XP_010931422.1|  PREDICTED: serine/threonine-protein kinase A...  90.1    8e-18   
ref|XP_002266032.1|  PREDICTED: probable serine/threonine-protein...  90.1    9e-18   
gb|KJB27595.1|  hypothetical protein B456_005G001500                  88.6    9e-18   
ref|XP_009370852.1|  PREDICTED: serine/threonine-protein kinase A...  90.1    1e-17   
gb|KCW88491.1|  hypothetical protein EUGRSUZ_A00879                   88.6    1e-17   
dbj|BAJ98795.1|  predicted protein                                    88.6    1e-17   
gb|KCW88487.1|  hypothetical protein EUGRSUZ_A00879                   88.6    1e-17   
ref|XP_009766459.1|  PREDICTED: probable serine/threonine-protein...  89.7    1e-17   
emb|CDP06608.1|  unnamed protein product                              89.7    1e-17   
ref|XP_010685751.1|  PREDICTED: protein kinase APK1B, chloroplast...  89.4    1e-17   
gb|EAZ44107.1|  hypothetical protein OsJ_28734                        86.7    1e-17   
gb|KCW88490.1|  hypothetical protein EUGRSUZ_A00879                   88.2    1e-17   
ref|XP_008812270.1|  PREDICTED: probable serine/threonine-protein...  89.7    1e-17   
ref|XP_008244257.1|  PREDICTED: serine/threonine-protein kinase A...  89.4    1e-17   
ref|XP_009769768.1|  PREDICTED: serine/threonine-protein kinase A...  89.7    1e-17   
ref|XP_008370313.1|  PREDICTED: serine/threonine-protein kinase A...  89.4    2e-17   
gb|KGN58674.1|  hypothetical protein Csa_3G727920                     90.5    2e-17   
ref|XP_010685750.1|  PREDICTED: protein kinase APK1B, chloroplast...  89.4    2e-17   
ref|XP_007205277.1|  hypothetical protein PRUPE_ppa006509mg           89.4    2e-17   
ref|XP_009588344.1|  PREDICTED: probable serine/threonine-protein...  89.4    2e-17   
gb|KJB27592.1|  hypothetical protein B456_005G001500                  88.2    2e-17   
ref|XP_007222079.1|  hypothetical protein PRUPE_ppa007540mg           88.6    2e-17   
gb|KFK24698.1|  hypothetical protein AALP_AA8G013200                  89.0    2e-17   
ref|XP_004249535.1|  PREDICTED: probable serine/threonine-protein...  89.4    2e-17   
ref|XP_006339025.1|  PREDICTED: protein kinase APK1A, chloroplast...  89.0    2e-17   
ref|NP_195722.2|  serine/threonine-protein kinase                     89.0    2e-17   
ref|XP_003577860.1|  PREDICTED: serine/threonine-protein kinase A...  89.0    2e-17   
ref|XP_004246420.1|  PREDICTED: probable serine/threonine-protein...  89.0    2e-17   
ref|XP_002872982.1|  kinase family protein                            89.0    2e-17   
gb|KJB36715.1|  hypothetical protein B456_006G172600                  89.0    2e-17   
ref|XP_010424023.1|  PREDICTED: serine/threonine-protein kinase A...  89.0    2e-17   
ref|XP_006381619.1|  kinase family protein                            89.4    2e-17   
ref|XP_011077648.1|  PREDICTED: protein kinase APK1A, chloroplast...  89.0    2e-17   
emb|CAB99493.1|  protein kinase-like protein                          89.0    2e-17   
ref|XP_006279336.1|  hypothetical protein CARUB_v10012732mg           89.0    2e-17   
gb|EMS53821.1|  putative serine/threonine-protein kinase NAK          89.7    2e-17   
ref|XP_004144034.1|  PREDICTED: serine/threonine-protein kinase A...  89.0    2e-17   
gb|ABK93253.1|  unknown                                               85.9    2e-17   
emb|CDP00097.1|  unnamed protein product                              88.6    2e-17   
ref|XP_010325852.1|  PREDICTED: probable serine/threonine-protein...  89.0    2e-17   
gb|KCW88489.1|  hypothetical protein EUGRSUZ_A00879                   87.8    3e-17   
gb|KCW88488.1|  hypothetical protein EUGRSUZ_A00879                   87.4    3e-17   
ref|XP_010047712.1|  PREDICTED: protein kinase APK1B, chloroplast...  88.6    3e-17   
ref|XP_010928728.1|  PREDICTED: serine/threonine-protein kinase A...  88.2    3e-17   
ref|XP_010049350.1|  PREDICTED: serine/threonine-protein kinase A...  89.0    3e-17   
ref|XP_002519978.1|  Protein kinase APK1B, chloroplast precursor,...  89.7    3e-17   
gb|KJB27594.1|  hypothetical protein B456_005G001500                  88.6    3e-17   
ref|NP_001150204.1|  protein kinase APK1B                             89.0    3e-17   
ref|XP_010928727.1|  PREDICTED: serine/threonine-protein kinase A...  88.2    3e-17   
emb|CDP06356.1|  unnamed protein product                              89.0    3e-17   
ref|XP_010047703.1|  PREDICTED: probable serine/threonine-protein...  88.6    3e-17   
ref|XP_006365700.1|  PREDICTED: protein kinase APK1A, chloroplast...  88.2    3e-17   
gb|KCW88940.1|  hypothetical protein EUGRSUZ_A01268                   88.2    3e-17   
gb|ADE76633.1|  unknown                                               85.5    3e-17   
gb|KJB27593.1|  hypothetical protein B456_005G001500                  88.2    3e-17   
gb|KJB27591.1|  hypothetical protein B456_005G001500                  88.6    4e-17   
gb|EEC68754.1|  hypothetical protein OsI_37277                        88.2    4e-17   
ref|XP_004249015.1|  PREDICTED: serine/threonine-protein kinase A...  88.6    4e-17   
ref|XP_010922319.1|  PREDICTED: probable serine/threonine-protein...  88.2    4e-17   
ref|XP_006662686.1|  PREDICTED: serine/threonine-protein kinase A...  88.2    4e-17   
ref|NP_001065612.1|  Os11g0121400                                     88.2    4e-17   
ref|XP_010666301.1|  PREDICTED: serine/threonine-protein kinase A...  88.6    4e-17   
ref|XP_010913798.1|  PREDICTED: serine/threonine-protein kinase A...  88.6    4e-17   
ref|XP_009606106.1|  PREDICTED: serine/threonine-protein kinase A...  88.2    4e-17   
ref|XP_011078207.1|  PREDICTED: serine/threonine-protein kinase A...  88.2    4e-17   
ref|XP_011006228.1|  PREDICTED: serine/threonine-protein kinase A...  88.2    5e-17   
ref|XP_006842637.1|  hypothetical protein AMTR_s00077p00187600        88.2    5e-17   



>ref|XP_006357263.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
[Solanum tuberosum]
Length=477

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 130/141 (92%), Gaps = 5/141 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRL+DPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMS+V
Sbjct  337  GEHNLVEWARPHLGERRRFYRLVDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSDV  396

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VEALKPLPNLKDMASSSYYFQTMQADR+ SSP+TKNG+     FS+NGQQ+PRSLSIPNG
Sbjct  397  VEALKPLPNLKDMASSSYYFQTMQADRVGSSPSTKNGVRTQGSFSRNGQQHPRSLSIPNG  456

Query  257  SHASPY-RQFSQNSPKPNGKA  198
            SHASPY +QF QNSPKPNGK 
Sbjct  457  SHASPYHQQFPQNSPKPNGKT  477



>ref|XP_004238768.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Solanum lycopersicum]
Length=478

 Score =   250 bits (639),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 129/141 (91%), Gaps = 5/141 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRL+DPRLEGHFSIKGAQKAAQLAARCLSRDPK RPMMSEV
Sbjct  338  GEHNLVEWARPHLGERRRFYRLVDPRLEGHFSIKGAQKAAQLAARCLSRDPKVRPMMSEV  397

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VEALKPLPNLKDMASSSYYFQTMQADR+ SSP+TKNG+     FS+NGQQ+PRSLSIPNG
Sbjct  398  VEALKPLPNLKDMASSSYYFQTMQADRVGSSPSTKNGVRTQGSFSRNGQQHPRSLSIPNG  457

Query  257  SHASPY-RQFSQNSPKPNGKA  198
            SHASPY +QF QNSPKPNGK 
Sbjct  458  SHASPYHQQFPQNSPKPNGKT  478



>ref|XP_010320662.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Solanum lycopersicum]
Length=479

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 129/141 (91%), Gaps = 5/141 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRL+DPRLEGHFSIKGAQKAAQLAARCLSRDPK RPMMSEV
Sbjct  339  GEHNLVEWARPHLGERRRFYRLVDPRLEGHFSIKGAQKAAQLAARCLSRDPKVRPMMSEV  398

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VEALKPLPNLKDMASSSYYFQTMQADR+ SSP+TKNG+     FS+NGQQ+PRSLSIPNG
Sbjct  399  VEALKPLPNLKDMASSSYYFQTMQADRVGSSPSTKNGVRTQGSFSRNGQQHPRSLSIPNG  458

Query  257  SHASPY-RQFSQNSPKPNGKA  198
            SHASPY +QF QNSPKPNGK 
Sbjct  459  SHASPYHQQFPQNSPKPNGKT  479



>ref|XP_009797575.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Nicotiana 
sylvestris]
Length=482

 Score =   250 bits (639),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 129/141 (91%), Gaps = 5/141 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRL+DPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV
Sbjct  342  GEHNLVEWARPHLGERRRFYRLVDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  401

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VEALKPLPNLKDMASSSYYFQTMQADR+ SSP+T+NG+     FS+NGQQ+PRSLSIPNG
Sbjct  402  VEALKPLPNLKDMASSSYYFQTMQADRVGSSPSTRNGVRTQGSFSRNGQQHPRSLSIPNG  461

Query  257  SHASPY-RQFSQNSPKPNGKA  198
            SHASPY  QF QNSPKPNGK 
Sbjct  462  SHASPYHHQFPQNSPKPNGKT  482



>ref|XP_009587494.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Nicotiana 
tomentosiformis]
Length=482

 Score =   250 bits (638),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 129/140 (92%), Gaps = 5/140 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRL+DPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV
Sbjct  342  GEHNLVEWARPHLGERRRFYRLVDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  401

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VEALKPLPNLKDMASSSYYFQTMQADR+ SSP+T+NG+     FS+NGQQ+PRSLSIPNG
Sbjct  402  VEALKPLPNLKDMASSSYYFQTMQADRVGSSPSTRNGVRTQGSFSRNGQQHPRSLSIPNG  461

Query  257  SHASPY-RQFSQNSPKPNGK  201
            SHASPY  QF QNSPKPNGK
Sbjct  462  SHASPYHHQFPQNSPKPNGK  481



>ref|XP_011071028.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Sesamum 
indicum]
Length=477

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 127/139 (91%), Gaps = 4/139 (3%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARP+MSEV
Sbjct  338  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPLMSEV  397

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            V+ALKPLPNLKDMASSSYYFQTMQADR++SSPN KNG+     F +NGQQ+PRSLSIPNG
Sbjct  398  VDALKPLPNLKDMASSSYYFQTMQADRVSSSPNGKNGLRNQFTFPRNGQQHPRSLSIPNG  457

Query  257  SHASPYRQFSQNSPKPNGK  201
            SHASPY Q + NSPKPNGK
Sbjct  458  SHASPYHQHAHNSPKPNGK  476



>ref|XP_009772201.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Nicotiana 
sylvestris]
 ref|XP_009772202.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Nicotiana 
sylvestris]
Length=472

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 127/141 (90%), Gaps = 5/141 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFY+LIDPRLEGHFSIKGAQKAAQLAARCLSRD KARPMMSEV
Sbjct  332  GEHNLVEWARPHLGERRRFYKLIDPRLEGHFSIKGAQKAAQLAARCLSRDSKARPMMSEV  391

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VEALKPLPNLK MASSSYYFQTMQADRI SSPNT+NG+     FS+NGQQ PRSLSIPNG
Sbjct  392  VEALKPLPNLKGMASSSYYFQTMQADRIGSSPNTRNGLKTQGSFSRNGQQQPRSLSIPNG  451

Query  257  SHASPYR-QFSQNSPKPNGKA  198
            SHASPYR Q  QNSPKPNG+A
Sbjct  452  SHASPYRHQLPQNSPKPNGEA  472



>gb|AAU89742.1| serine/threonine protein kinase-like [Solanum tuberosum]
Length=603

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 130/141 (92%), Gaps = 5/141 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRL+DPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMS+V
Sbjct  463  GEHNLVEWARPHLGERRRFYRLVDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSDV  522

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VEALKPLPNLKDMASSSYYFQTMQADR+ SSP+TKNG+     FS+NGQQ+PRSLSIPNG
Sbjct  523  VEALKPLPNLKDMASSSYYFQTMQADRVGSSPSTKNGVRTQGSFSRNGQQHPRSLSIPNG  582

Query  257  SHASPY-RQFSQNSPKPNGKA  198
            SHASPY +QF QNSPKPNGK 
Sbjct  583  SHASPYHQQFPQNSPKPNGKT  603



>ref|XP_011086394.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Sesamum 
indicum]
Length=477

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 126/139 (91%), Gaps = 4/139 (3%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARP+MSEV
Sbjct  338  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPLMSEV  397

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VEALKPLPNLKDMASSSYYFQTMQADR +SSPN KN +     FS+NGQQNPRSLSIP+G
Sbjct  398  VEALKPLPNLKDMASSSYYFQTMQADRASSSPNGKNSLRTQGSFSRNGQQNPRSLSIPSG  457

Query  257  SHASPYRQFSQNSPKPNGK  201
            ++ASPY QF+ NSPKPN K
Sbjct  458  TNASPYHQFAHNSPKPNSK  476



>ref|XP_009627248.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Nicotiana 
tomentosiformis]
Length=478

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 125/141 (89%), Gaps = 5/141 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFY+LIDPRLEGHFSIKGAQKAAQLAARCL RD KARPMMSEV
Sbjct  338  GEHNLVEWARPHLGERRRFYKLIDPRLEGHFSIKGAQKAAQLAARCLCRDSKARPMMSEV  397

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VEALKPLPNLKDMASSSYYFQTMQADR+ SSPNT+NG+     FS+ GQQ PRSLSIPNG
Sbjct  398  VEALKPLPNLKDMASSSYYFQTMQADRVGSSPNTRNGLKTQGSFSRYGQQQPRSLSIPNG  457

Query  257  SHASP-YRQFSQNSPKPNGKA  198
            SHASP + Q  QNSPKPNGKA
Sbjct  458  SHASPHHHQLPQNSPKPNGKA  478



>emb|CDP00286.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   239 bits (610),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 126/141 (89%), Gaps = 7/141 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARP+MSEV
Sbjct  342  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPLMSEV  401

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEAL+PLP LKDMASSSYYFQTMQ DR+ SSPNT+NGI      F++NG Q+PRSLSIPN
Sbjct  402  VEALRPLPALKDMASSSYYFQTMQTDRVGSSPNTRNGIRSQVASFTRNG-QHPRSLSIPN  460

Query  260  GSHASPY-RQFSQNSPKPNGK  201
            GSHASPY  QF QNSPKPNGK
Sbjct  461  GSHASPYHHQFPQNSPKPNGK  481



>ref|XP_006363918.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
[Solanum tuberosum]
Length=482

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 126/144 (88%), Gaps = 9/144 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFY+LIDPRLEGHFSIKGAQKAAQLAARCLSRDPK RPMMS+V
Sbjct  338  GEHNLVEWARPHLGERRRFYKLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKVRPMMSDV  397

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIAS--SPNTKNGI----VFSKNG--QQNPRSLS  270
            VEALKPLPNLKDMASSSYYFQTMQADR+ S  SPNT+N +     FS+NG  QQ PRSLS
Sbjct  398  VEALKPLPNLKDMASSSYYFQTMQADRVGSSPSPNTRNVLRTQGSFSRNGQQQQQPRSLS  457

Query  269  IPNGSHASPYR-QFSQNSPKPNGK  201
            IPNG+HASPYR Q SQNSP PNGK
Sbjct  458  IPNGAHASPYRHQLSQNSPNPNGK  481



>gb|KDO82763.1| hypothetical protein CISIN_1g010432mg [Citrus sinensis]
Length=304

 Score =   227 bits (579),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 122/141 (87%), Gaps = 9/141 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLAA CLSRDPKARP+MSEV
Sbjct  166  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAAHCLSRDPKARPLMSEV  225

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQTMQA+RI SSPNT+NGI       S+NGQ   RSLSIPN
Sbjct  226  VEALKPLPNLKDMASSSYYFQTMQAERIGSSPNTRNGIRAQGGSLSRNGQ---RSLSIPN  282

Query  260  GSHASPY-RQFSQNSPKPNGK  201
            GS+ASPY  QF   SPKPNGK
Sbjct  283  GSYASPYHHQFPHPSPKPNGK  303



>ref|XP_003631281.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Vitis 
vinifera]
 emb|CBI32020.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   232 bits (592),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 121/142 (85%), Gaps = 7/142 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLAA CLSRDPK RP+MSEV
Sbjct  339  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAAHCLSRDPKVRPLMSEV  398

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQTMQA+RI SSPN +NG+     + S+NG Q  RSLSIPN
Sbjct  399  VEALKPLPNLKDMASSSYYFQTMQAERIGSSPNARNGVRTQQGILSRNGHQQQRSLSIPN  458

Query  260  GSHASPYR--QFSQNSPKPNGK  201
            GSHASPY   Q+   SPKPNGK
Sbjct  459  GSHASPYHQNQYPYQSPKPNGK  480



>gb|KDO82764.1| hypothetical protein CISIN_1g010432mg [Citrus sinensis]
Length=306

 Score =   227 bits (578),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 122/141 (87%), Gaps = 9/141 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLAA CLSRDPKARP+MSEV
Sbjct  168  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAAHCLSRDPKARPLMSEV  227

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQTMQA+RI SSPNT+NGI       S+NGQ   RSLSIPN
Sbjct  228  VEALKPLPNLKDMASSSYYFQTMQAERIGSSPNTRNGIRAQGGSLSRNGQ---RSLSIPN  284

Query  260  GSHASPY-RQFSQNSPKPNGK  201
            GS+ASPY  QF   SPKPNGK
Sbjct  285  GSYASPYHHQFPHPSPKPNGK  305



>ref|XP_004228384.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Solanum 
lycopersicum]
Length=481

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 125/143 (87%), Gaps = 8/143 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFY+LIDPRLEGHFSIKGAQKAAQLAARCLSRDPK RPMMS+V
Sbjct  338  GEHNLVEWARPHLGERRRFYKLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKVRPMMSDV  397

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIAS--SPNTKNGI----VFSKNGQQ-NPRSLSI  267
            VEALKPLPNLKDMASSSYYFQT QADR+ S  SPNT+N +     FS+NGQQ  PRSLSI
Sbjct  398  VEALKPLPNLKDMASSSYYFQTTQADRVGSSPSPNTRNVLRTQGSFSRNGQQPPPRSLSI  457

Query  266  PNGSHASPYR-QFSQNSPKPNGK  201
            PNGSHASPYR Q SQNSP PNGK
Sbjct  458  PNGSHASPYRHQLSQNSPNPNGK  480



>emb|CAN82516.1| hypothetical protein VITISV_008843 [Vitis vinifera]
Length=495

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 121/142 (85%), Gaps = 7/142 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLAA CLSRDPK RP+MSEV
Sbjct  353  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAAHCLSRDPKVRPLMSEV  412

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQTMQA+RI SSPN +NG+     + S+NG Q  RSLSIPN
Sbjct  413  VEALKPLPNLKDMASSSYYFQTMQAERIGSSPNARNGVRTQQGILSRNGHQQQRSLSIPN  472

Query  260  GSHASPYR--QFSQNSPKPNGK  201
            GSHASPY   Q+   SPKPNGK
Sbjct  473  GSHASPYHQNQYPYQSPKPNGK  494



>ref|XP_007157391.1| hypothetical protein PHAVU_002G066400g [Phaseolus vulgaris]
 ref|XP_007157392.1| hypothetical protein PHAVU_002G066400g [Phaseolus vulgaris]
 ref|XP_007157393.1| hypothetical protein PHAVU_002G066400g [Phaseolus vulgaris]
 gb|ESW29385.1| hypothetical protein PHAVU_002G066400g [Phaseolus vulgaris]
 gb|ESW29386.1| hypothetical protein PHAVU_002G066400g [Phaseolus vulgaris]
 gb|ESW29387.1| hypothetical protein PHAVU_002G066400g [Phaseolus vulgaris]
Length=484

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 123/140 (88%), Gaps = 5/140 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFY+LIDPRLEGHFS+KGAQKAAQLAA CL RDPKARP+MSEV
Sbjct  346  GEHNLVEWARPHLGERRRFYKLIDPRLEGHFSVKGAQKAAQLAAHCLCRDPKARPLMSEV  405

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKN----GIVFSKNGQQNPRSLSIPNG  258
            VEALKPLPNLKDMASSSYY+QTMQADRI +SPNT+N    G + ++NG Q  RSLSIPNG
Sbjct  406  VEALKPLPNLKDMASSSYYYQTMQADRIGASPNTRNGRTQGALLTRNGHQQ-RSLSIPNG  464

Query  257  SHASPYRQFSQNSPKPNGKA  198
            ++ASPY QF Q SPKPNGKA
Sbjct  465  TYASPYHQFPQPSPKPNGKA  484



>gb|KDO82762.1| hypothetical protein CISIN_1g010432mg [Citrus sinensis]
Length=422

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 122/141 (87%), Gaps = 9/141 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLAA CLSRDPKARP+MSEV
Sbjct  284  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAAHCLSRDPKARPLMSEV  343

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQTMQA+RI SSPNT+NGI       S+NGQ   RSLSIPN
Sbjct  344  VEALKPLPNLKDMASSSYYFQTMQAERIGSSPNTRNGIRAQGGSLSRNGQ---RSLSIPN  400

Query  260  GSHASPY-RQFSQNSPKPNGK  201
            GS+ASPY  QF   SPKPNGK
Sbjct  401  GSYASPYHHQFPHPSPKPNGK  421



>ref|XP_009594394.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Nicotiana tomentosiformis]
Length=482

 Score =   230 bits (586),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 125/143 (87%), Gaps = 7/143 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E+RRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPK RPMMSEV
Sbjct  340  GEHNLVEWARPQLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKVRPMMSEV  399

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VEALKPLP+LKDMASSSYYFQTMQADR+  SPNTK+G+     FS+NGQ  PRSLSIPNG
Sbjct  400  VEALKPLPSLKDMASSSYYFQTMQADRVGFSPNTKDGLRTQRSFSRNGQLPPRSLSIPNG  459

Query  257  SHASPYR-QFSQNS--PKPNGKA  198
            SHASP+  QF QNS  PKP+GK+
Sbjct  460  SHASPHHYQFPQNSPKPKPDGKS  482



>ref|XP_009594393.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Nicotiana tomentosiformis]
Length=483

 Score =   230 bits (586),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 125/143 (87%), Gaps = 7/143 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E+RRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPK RPMMSEV
Sbjct  341  GEHNLVEWARPQLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKVRPMMSEV  400

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VEALKPLP+LKDMASSSYYFQTMQADR+  SPNTK+G+     FS+NGQ  PRSLSIPNG
Sbjct  401  VEALKPLPSLKDMASSSYYFQTMQADRVGFSPNTKDGLRTQRSFSRNGQLPPRSLSIPNG  460

Query  257  SHASPYR-QFSQNS--PKPNGKA  198
            SHASP+  QF QNS  PKP+GK+
Sbjct  461  SHASPHHYQFPQNSPKPKPDGKS  483



>ref|XP_007222609.1| hypothetical protein PRUPE_ppa004933mg [Prunus persica]
 ref|XP_008221681.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Prunus 
mume]
 gb|EMJ23808.1| hypothetical protein PRUPE_ppa004933mg [Prunus persica]
Length=485

 Score =   230 bits (586),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 120/141 (85%), Gaps = 6/141 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKG QKAAQLAA CLSRDPKARP+MSEV
Sbjct  344  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGVQKAAQLAAHCLSRDPKARPLMSEV  403

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQTMQADR+ SSPNT+NG+     + ++NG    RSLSIPN
Sbjct  404  VEALKPLPNLKDMASSSYYFQTMQADRVGSSPNTRNGVRTQAGLLTRNGHHQQRSLSIPN  463

Query  260  GSHASPY-RQFSQNSPKPNGK  201
            GSHASPY  Q+   SPKPN K
Sbjct  464  GSHASPYHHQYPHQSPKPNSK  484



>ref|XP_003551987.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
[Glycine max]
 gb|KHN30520.1| Putative receptor-like protein kinase [Glycine soja]
Length=487

 Score =   230 bits (586),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 124/141 (88%), Gaps = 6/141 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAA LAA CLSRDPKARP+MSEV
Sbjct  348  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAHLAAHCLSRDPKARPLMSEV  407

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKN----GIVFSKNGQQNPRSLSIPNG  258
            VEALKPLPNLKDMASSSYYFQTMQADR ++SPNT+N    G + ++NGQQ  RSLSIP+G
Sbjct  408  VEALKPLPNLKDMASSSYYFQTMQADRFSASPNTRNGRTQGALLTRNGQQQ-RSLSIPHG  466

Query  257  SHASPY-RQFSQNSPKPNGKA  198
            +HASPY  QF Q SPKPNGKA
Sbjct  467  THASPYHHQFPQPSPKPNGKA  487



>ref|XP_010096340.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXB63815.1| putative receptor-like protein kinase [Morus notabilis]
Length=483

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 123/142 (87%), Gaps = 7/142 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+R+FY+LIDPRLEGHFSIKGAQKAAQLAA CL RDPKARP+MSEV
Sbjct  343  GEHNLVEWARPHLGERRKFYKLIDPRLEGHFSIKGAQKAAQLAAHCLCRDPKARPLMSEV  402

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQTM ADR+ASSPN +NG+     +  +NGQQ  RSLSIPN
Sbjct  403  VEALKPLPNLKDMASSSYYFQTMHADRVASSPNARNGVRTQGGLMLRNGQQ-VRSLSIPN  461

Query  260  GSHASPY-RQFSQNSPKPNGKA  198
            G+HASPY  QF Q SPKPNGKA
Sbjct  462  GTHASPYHHQFPQQSPKPNGKA  483



>ref|XP_009798207.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Nicotiana sylvestris]
Length=480

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 120/137 (88%), Gaps = 5/137 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E+RRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRD K RPMMSEV
Sbjct  338  GEHNLVEWARPQLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDSKVRPMMSEV  397

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VEALKPLP+LKDMASSSYYFQTMQADR+  SPNTK+G+     FS+NGQ  PRSLSIPNG
Sbjct  398  VEALKPLPSLKDMASSSYYFQTMQADRVGFSPNTKDGLRTQRTFSRNGQLPPRSLSIPNG  457

Query  257  SHASPYR-QFSQNSPKP  210
            SHASP+  QF QNSPKP
Sbjct  458  SHASPHHYQFPQNSPKP  474



>ref|XP_009798208.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Nicotiana sylvestris]
Length=479

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 120/137 (88%), Gaps = 5/137 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E+RRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRD K RPMMSEV
Sbjct  337  GEHNLVEWARPQLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDSKVRPMMSEV  396

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VEALKPLP+LKDMASSSYYFQTMQADR+  SPNTK+G+     FS+NGQ  PRSLSIPNG
Sbjct  397  VEALKPLPSLKDMASSSYYFQTMQADRVGFSPNTKDGLRTQRTFSRNGQLPPRSLSIPNG  456

Query  257  SHASPYR-QFSQNSPKP  210
            SHASP+  QF QNSPKP
Sbjct  457  SHASPHHYQFPQNSPKP  473



>gb|KDO82759.1| hypothetical protein CISIN_1g010432mg [Citrus sinensis]
Length=486

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 122/141 (87%), Gaps = 9/141 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLAA CLSRDPKARP+MSEV
Sbjct  348  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAAHCLSRDPKARPLMSEV  407

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQTMQA+RI SSPNT+NGI       S+NGQ   RSLSIPN
Sbjct  408  VEALKPLPNLKDMASSSYYFQTMQAERIGSSPNTRNGIRAQGGSLSRNGQ---RSLSIPN  464

Query  260  GSHASPY-RQFSQNSPKPNGK  201
            GS+ASPY  QF   SPKPNGK
Sbjct  465  GSYASPYHHQFPHPSPKPNGK  485



>gb|KDO82757.1| hypothetical protein CISIN_1g010432mg [Citrus sinensis]
Length=487

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 122/141 (87%), Gaps = 9/141 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLAA CLSRDPKARP+MSEV
Sbjct  349  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAAHCLSRDPKARPLMSEV  408

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQTMQA+RI SSPNT+NGI       S+NGQ   RSLSIPN
Sbjct  409  VEALKPLPNLKDMASSSYYFQTMQAERIGSSPNTRNGIRAQGGSLSRNGQ---RSLSIPN  465

Query  260  GSHASPY-RQFSQNSPKPNGK  201
            GS+ASPY  QF   SPKPNGK
Sbjct  466  GSYASPYHHQFPHPSPKPNGK  486



>ref|XP_006438612.1| hypothetical protein CICLE_v10031362mg [Citrus clementina]
 ref|XP_006483237.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X2 [Citrus sinensis]
 gb|ESR51852.1| hypothetical protein CICLE_v10031362mg [Citrus clementina]
Length=486

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 122/141 (87%), Gaps = 9/141 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLAA CLSRDPKARP+MSEV
Sbjct  348  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAAHCLSRDPKARPLMSEV  407

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQTMQA+RI SSPNT+NGI       S+NGQ   RSLSIPN
Sbjct  408  VEALKPLPNLKDMASSSYYFQTMQAERIGSSPNTRNGIRAQGGSLSRNGQ---RSLSIPN  464

Query  260  GSHASPY-RQFSQNSPKPNGK  201
            GS+ASPY  QF   SPKPNGK
Sbjct  465  GSYASPYHHQFPHPSPKPNGK  485



>ref|XP_006483236.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X1 [Citrus sinensis]
Length=487

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 122/141 (87%), Gaps = 9/141 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLAA CLSRDPKARP+MSEV
Sbjct  349  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAAHCLSRDPKARPLMSEV  408

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQTMQA+RI SSPNT+NGI       S+NGQ   RSLSIPN
Sbjct  409  VEALKPLPNLKDMASSSYYFQTMQAERIGSSPNTRNGIRAQGGSLSRNGQ---RSLSIPN  465

Query  260  GSHASPY-RQFSQNSPKPNGK  201
            GS+ASPY  QF   SPKPNGK
Sbjct  466  GSYASPYHHQFPHPSPKPNGK  486



>ref|NP_001235470.1| serine/threonine protein kinase-like protein [Glycine max]
 ref|XP_006574324.1| PREDICTED: serine/threonine protein kinase-like protein isoform 
X2 [Glycine max]
 gb|ACM89580.1| serine/threonine protein kinase-like protein [Glycine max]
 gb|KHN08713.1| Putative receptor-like protein kinase [Glycine soja]
Length=485

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 123/141 (87%), Gaps = 6/141 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFS+KGAQKAA LAA CLSRDPKARP+MSEV
Sbjct  346  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSVKGAQKAALLAAHCLSRDPKARPLMSEV  405

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKN----GIVFSKNGQQNPRSLSIPNG  258
            VEALKPLPNLKDMASSSYYFQ MQADRI +SPNT+N    G + ++NGQQ  RSLSIPNG
Sbjct  406  VEALKPLPNLKDMASSSYYFQAMQADRIGASPNTRNGRMQGALLTRNGQQQ-RSLSIPNG  464

Query  257  SHASPY-RQFSQNSPKPNGKA  198
            ++ASPY  QF Q SPKPNGKA
Sbjct  465  TYASPYHHQFPQPSPKPNGKA  485



>ref|XP_003532048.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
[Glycine max]
 gb|KHN13485.1| Putative receptor-like protein kinase [Glycine soja]
Length=487

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 123/141 (87%), Gaps = 6/141 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFY+LIDPRLEGHFSIKGAQKAA LAA CLSRDPKARP+MSEV
Sbjct  348  GEHNLVEWARPHLGERRRFYKLIDPRLEGHFSIKGAQKAAHLAAHCLSRDPKARPLMSEV  407

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKN----GIVFSKNGQQNPRSLSIPNG  258
            VEALKPLPNLKDMASSSYYFQTMQADR + SPNT+N    G + ++NGQQ  RSLSIP+G
Sbjct  408  VEALKPLPNLKDMASSSYYFQTMQADRFSVSPNTRNGRTQGALLTRNGQQQ-RSLSIPHG  466

Query  257  SHASPY-RQFSQNSPKPNGKA  198
            +HASPY  QF Q SPKPNGKA
Sbjct  467  THASPYHHQFPQPSPKPNGKA  487



>gb|KEH19837.1| receptor-like kinase plant [Medicago truncatula]
Length=489

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 123/140 (88%), Gaps = 5/140 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAA LAA CLSRDPKARP+MSEV
Sbjct  349  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAHLAAHCLSRDPKARPLMSEV  408

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIV---FSKNGQQNPRSLSIPNGS  255
            VEALKPLPNLKDMASSSYYFQTMQADR ++SPNT+NG     F++NGQQ  RSLSI +G+
Sbjct  409  VEALKPLPNLKDMASSSYYFQTMQADRFSASPNTRNGRTQGAFTRNGQQQ-RSLSISHGT  467

Query  254  HASPY-RQFSQNSPKPNGKA  198
            HASP+  Q+ QNSPKP GKA
Sbjct  468  HASPFHHQYPQNSPKPTGKA  487



>gb|KDO82758.1| hypothetical protein CISIN_1g010432mg [Citrus sinensis]
Length=511

 Score =   228 bits (581),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 122/141 (87%), Gaps = 9/141 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLAA CLSRDPKARP+MSEV
Sbjct  373  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAAHCLSRDPKARPLMSEV  432

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQTMQA+RI SSPNT+NGI       S+NGQ   RSLSIPN
Sbjct  433  VEALKPLPNLKDMASSSYYFQTMQAERIGSSPNTRNGIRAQGGSLSRNGQ---RSLSIPN  489

Query  260  GSHASPY-RQFSQNSPKPNGK  201
            GS+ASPY  QF   SPKPNGK
Sbjct  490  GSYASPYHHQFPHPSPKPNGK  510



>ref|XP_006574323.1| PREDICTED: serine/threonine protein kinase-like protein isoform 
X1 [Glycine max]
Length=508

 Score =   228 bits (580),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 123/141 (87%), Gaps = 6/141 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFS+KGAQKAA LAA CLSRDPKARP+MSEV
Sbjct  369  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSVKGAQKAALLAAHCLSRDPKARPLMSEV  428

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKN----GIVFSKNGQQNPRSLSIPNG  258
            VEALKPLPNLKDMASSSYYFQ MQADRI +SPNT+N    G + ++NGQQ  RSLSIPNG
Sbjct  429  VEALKPLPNLKDMASSSYYFQAMQADRIGASPNTRNGRMQGALLTRNGQQQ-RSLSIPNG  487

Query  257  SHASPY-RQFSQNSPKPNGKA  198
            ++ASPY  QF Q SPKPNGKA
Sbjct  488  TYASPYHHQFPQPSPKPNGKA  508



>ref|XP_008389526.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Malus 
domestica]
Length=491

 Score =   227 bits (578),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 120/142 (85%), Gaps = 6/142 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKG QKAAQLAA CLSRDPKARP+MSEV
Sbjct  350  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGVQKAAQLAAHCLSRDPKARPLMSEV  409

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLP LKDMASSSYYFQTMQ DR+ SSPNT+NG+     + ++NG    RSLSIPN
Sbjct  410  VEALKPLPALKDMASSSYYFQTMQGDRVGSSPNTRNGVRPQGGLLTRNGHNQQRSLSIPN  469

Query  260  GSHASPYR-QFSQNSPKPNGKA  198
            G+HASPY  Q  Q SPKPNGK+
Sbjct  470  GTHASPYHLQHPQPSPKPNGKS  491



>ref|XP_011463101.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=482

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 120/142 (85%), Gaps = 9/142 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL ++RRFYRLIDPRLEGHFSIKG QKAAQLAA CLSRDPKARP+MSEV
Sbjct  344  GEHNLVEWARPHLGDRRRFYRLIDPRLEGHFSIKGVQKAAQLAAHCLSRDPKARPLMSEV  403

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQTMQ DR+ SSPNT+NG+     + ++NG    RSLSIPN
Sbjct  404  VEALKPLPNLKDMASSSYYFQTMQGDRVGSSPNTRNGVRTQGGLLTRNGH---RSLSIPN  460

Query  260  GSHASPY-RQFSQNSPKPNGKA  198
            GSHASPY  QF   SPKPNGK 
Sbjct  461  GSHASPYHHQFPHPSPKPNGKT  482



>ref|XP_004297338.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=488

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 120/142 (85%), Gaps = 9/142 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL ++RRFYRLIDPRLEGHFSIKG QKAAQLAA CLSRDPKARP+MSEV
Sbjct  350  GEHNLVEWARPHLGDRRRFYRLIDPRLEGHFSIKGVQKAAQLAAHCLSRDPKARPLMSEV  409

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQTMQ DR+ SSPNT+NG+     + ++NG    RSLSIPN
Sbjct  410  VEALKPLPNLKDMASSSYYFQTMQGDRVGSSPNTRNGVRTQGGLLTRNGH---RSLSIPN  466

Query  260  GSHASPY-RQFSQNSPKPNGKA  198
            GSHASPY  QF   SPKPNGK 
Sbjct  467  GSHASPYHHQFPHPSPKPNGKT  488



>ref|XP_009360398.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Pyrus 
x bretschneideri]
Length=491

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 119/142 (84%), Gaps = 6/142 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKG QKAAQLAA CLSRDPKARP+MSEV
Sbjct  350  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGVQKAAQLAAHCLSRDPKARPLMSEV  409

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLP LKDMASSSYYFQTMQ DR+ SSPNT+NG+     +  +NG    RSLSIPN
Sbjct  410  VEALKPLPALKDMASSSYYFQTMQGDRVGSSPNTRNGVRPQGGLLMRNGHNQQRSLSIPN  469

Query  260  GSHASPYR-QFSQNSPKPNGKA  198
            G+HASPY  Q  Q SPKPNGK+
Sbjct  470  GTHASPYHLQHPQPSPKPNGKS  491



>ref|XP_007157381.1| hypothetical protein PHAVU_002G065500g [Phaseolus vulgaris]
 gb|ESW29375.1| hypothetical protein PHAVU_002G065500g [Phaseolus vulgaris]
Length=485

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 123/141 (87%), Gaps = 6/141 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL EKRRFY+LIDPRLEGHFS+KGAQKAAQLAA CL RDPKARP+MSEV
Sbjct  346  GEHNLVEWARPHLGEKRRFYKLIDPRLEGHFSVKGAQKAAQLAAHCLCRDPKARPLMSEV  405

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKN----GIVFSKNGQQNPRSLSIPNG  258
            VEALKPLPNLKDMASSSYY+QTMQADRI +SPNT+N    G + ++NG Q  RSLSIPNG
Sbjct  406  VEALKPLPNLKDMASSSYYYQTMQADRIGASPNTRNGRTQGALLTRNGHQQ-RSLSIPNG  464

Query  257  SHASPY-RQFSQNSPKPNGKA  198
            ++ASPY  +F Q SPKPNGKA
Sbjct  465  TYASPYHHRFPQPSPKPNGKA  485



>ref|XP_003517927.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X1 [Glycine max]
 ref|XP_006573089.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X2 [Glycine max]
 gb|KHN01169.1| Putative receptor-like protein kinase [Glycine soja]
Length=491

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 123/141 (87%), Gaps = 6/141 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFS+KGAQKAAQLAA CLSRDPK+RP+MSEV
Sbjct  352  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSVKGAQKAAQLAAHCLSRDPKSRPLMSEV  411

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKN----GIVFSKNGQQNPRSLSIPNG  258
            VEALKPLP+LKDMASSSYYFQ MQADR  +SPNT+N    G + ++NGQQ  RSLSIPNG
Sbjct  412  VEALKPLPSLKDMASSSYYFQAMQADRFGASPNTRNGRMQGALLTRNGQQQ-RSLSIPNG  470

Query  257  SHASPY-RQFSQNSPKPNGKA  198
            ++ASPY  QF Q SPKPNGKA
Sbjct  471  TYASPYHHQFPQPSPKPNGKA  491



>ref|XP_007046228.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY02060.1| Kinase superfamily protein [Theobroma cacao]
Length=517

 Score =   225 bits (573),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 120/139 (86%), Gaps = 9/139 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLAA CLSRDPKARP+MSEV
Sbjct  348  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAAHCLSRDPKARPLMSEV  407

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQTMQA+RI SSPN +NGI     + S+NGQ   RSLSIPN
Sbjct  408  VEALKPLPNLKDMASSSYYFQTMQAERIGSSPNARNGIRTQAGLLSRNGQ---RSLSIPN  464

Query  260  GSHASPY-RQFSQNSPKPN  207
            GSHASPY  Q+   SPKPN
Sbjct  465  GSHASPYHHQYPYQSPKPN  483



>ref|XP_006378157.1| hypothetical protein POPTR_0010s04270g [Populus trichocarpa]
 gb|ERP55954.1| hypothetical protein POPTR_0010s04270g [Populus trichocarpa]
Length=480

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 121/141 (86%), Gaps = 7/141 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLAA CLSRDPKARP+MSEV
Sbjct  340  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAAHCLSRDPKARPLMSEV  399

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            V ALKPLPNLKDMAS+SYYFQTMQA+R+ SSPN +NG+     + S+NG Q  RSLSIP+
Sbjct  400  VNALKPLPNLKDMASTSYYFQTMQAERVGSSPNARNGVRSQAGLLSRNGHQQ-RSLSIPH  458

Query  260  GSHASPYR-QFSQNSPKPNGK  201
            GSHASPY  Q+   SPKPNGK
Sbjct  459  GSHASPYHYQYPHKSPKPNGK  479



>ref|XP_008339937.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Malus 
domestica]
Length=491

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 118/141 (84%), Gaps = 6/141 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKG QKAAQLAA CLSRDPKARP+MSEV
Sbjct  350  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGVQKAAQLAAHCLSRDPKARPLMSEV  409

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLP LKDMASSSYYFQTMQ DR+ SSPNT+NG+     + ++NG    RSLSIPN
Sbjct  410  VEALKPLPALKDMASSSYYFQTMQGDRVGSSPNTRNGVRPQGGLLTRNGHHQQRSLSIPN  469

Query  260  GSHASPY-RQFSQNSPKPNGK  201
            G+HASPY  Q+   SPKPN K
Sbjct  470  GTHASPYHHQYPHPSPKPNVK  490



>ref|XP_004509947.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
[Cicer arietinum]
Length=488

 Score =   222 bits (565),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 123/141 (87%), Gaps = 7/141 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKA  LAA CLSRDPKARP+MSEV
Sbjct  348  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKATHLAAHCLSRDPKARPLMSEV  407

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKN----GIVFSKNGQQNPRSLSIPNG  258
            VEALKPLPNLKDMASSSYYFQTMQADR ++SPNT+N    G + ++NGQQ  RSLSI +G
Sbjct  408  VEALKPLPNLKDMASSSYYFQTMQADRFSASPNTRNGRTQGALLARNGQQ--RSLSISHG  465

Query  257  SHASPY-RQFSQNSPKPNGKA  198
            +HASP+  Q+ Q+SPKP+GKA
Sbjct  466  THASPFHHQYPQHSPKPSGKA  486



>ref|XP_004489995.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X1 [Cicer arietinum]
 ref|XP_004489996.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X2 [Cicer arietinum]
Length=490

 Score =   222 bits (565),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 122/140 (87%), Gaps = 5/140 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLAA CLSRDPKARP+MSEV
Sbjct  352  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAAHCLSRDPKARPLMSEV  411

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIV---FSKNGQQNPRSLSIPNGS  255
            VEALKPLPNLKDMASSSYYFQTMQA+R  +SPN+++      F++NGQQ  R+LSIPNG+
Sbjct  412  VEALKPLPNLKDMASSSYYFQTMQAERFGASPNSRSVHAQGPFARNGQQR-RTLSIPNGT  470

Query  254  HASPY-RQFSQNSPKPNGKA  198
            H SPY  +F Q SPKPNGKA
Sbjct  471  HVSPYHHKFPQQSPKPNGKA  490



>ref|XP_009338575.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Pyrus 
x bretschneideri]
Length=176

 Score =   211 bits (538),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 113/141 (80%), Gaps = 6/141 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN  EWARPHL E+RRFY+LIDPRLEGHFSIKG QKAAQLAA CLSRDPKARP+MSEV
Sbjct  35   GEHNLAEWARPHLGERRRFYQLIDPRLEGHFSIKGVQKAAQLAAHCLSRDPKARPLMSEV  94

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKN-----GIVFSKNGQQNPRSLSIPN  261
            VE LKPLP LKDMASSSYYFQTMQ DR+ SSPNT+N     G +  +NG    RSLSIPN
Sbjct  95   VEVLKPLPALKDMASSSYYFQTMQGDRVGSSPNTRNNVRPQGGLLMRNGHHQQRSLSIPN  154

Query  260  GSHASPY-RQFSQNSPKPNGK  201
            G+HASPY  Q    SPKPN K
Sbjct  155  GTHASPYHHQHPHPSPKPNVK  175



>ref|XP_002520138.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF42193.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=495

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 122/142 (86%), Gaps = 10/142 (7%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLAA CLSRDPKARP+MSEV
Sbjct  356  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAAHCLSRDPKARPLMSEV  415

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPN------TKNGIVFSKNGQQNPRSLSIP  264
            VE LKPLPNLKDMASSSYYFQ+MQAD+IASSPN      T+ G++  +NGQQ  RSLSIP
Sbjct  416  VEVLKPLPNLKDMASSSYYFQSMQADKIASSPNAKSSNRTQGGLL--RNGQQQ-RSLSIP  472

Query  263  NGSHASPY-RQFSQNSPKPNGK  201
            NGSHASPY  Q+   SPKPNGK
Sbjct  473  NGSHASPYHHQYPFQSPKPNGK  494



>gb|KHG18602.1| hypothetical protein F383_24083 [Gossypium arboreum]
Length=485

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 117/140 (84%), Gaps = 9/140 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLAA CLSRDPKARP+MSEV
Sbjct  348  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAAHCLSRDPKARPLMSEV  407

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VE LKPLPNLKDMASSSYYFQTMQA+R+ SSP T+NG        S+NG    RSLSIPN
Sbjct  408  VEVLKPLPNLKDMASSSYYFQTMQAERVGSSPLTRNGTRAQASSLSRNGH---RSLSIPN  464

Query  260  GSHASPY-RQFSQNSPKPNG  204
            GSHASPY  Q+   SPKPNG
Sbjct  465  GSHASPYHHQYPYQSPKPNG  484



>gb|KJB80036.1| hypothetical protein B456_013G077800 [Gossypium raimondii]
Length=486

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 117/141 (83%), Gaps = 9/141 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLAA CLSRDPKARP+MSEV
Sbjct  348  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAAHCLSRDPKARPLMSEV  407

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VE LKPLPNLKDMASSSYYFQTMQA+R+ SSP  +NG        S+NG    RSLSIPN
Sbjct  408  VEVLKPLPNLKDMASSSYYFQTMQAERVGSSPLARNGTRAPASSLSRNGH---RSLSIPN  464

Query  260  GSHASPY-RQFSQNSPKPNGK  201
            GSHASPY  Q+   SPKPNGK
Sbjct  465  GSHASPYHHQYPYQSPKPNGK  485



>gb|EYU28703.1| hypothetical protein MIMGU_mgv1a005501mg [Erythranthe guttata]
Length=481

 Score =   217 bits (552),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 122/142 (86%), Gaps = 7/142 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQ+AA LAARCLSRD K+RP+MSEV
Sbjct  339  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQRAAHLAARCLSRDSKSRPLMSEV  398

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQN-PRSLSIPN  261
            VEALKPLP+LKDMASSSYYFQTMQADR+ SSPN KNG+     FS+N  QN  R LSIPN
Sbjct  399  VEALKPLPSLKDMASSSYYFQTMQADRVNSSPNGKNGLRTNGSFSRNSHQNIQRRLSIPN  458

Query  260  -GSHASP-YRQFSQNSPKPNGK  201
             G+HASP + QF+ NSPKP+GK
Sbjct  459  GGAHASPLFHQFTNNSPKPSGK  480



>gb|KDP21228.1| hypothetical protein JCGZ_21699 [Jatropha curcas]
Length=494

 Score =   217 bits (552),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 119/143 (83%), Gaps = 10/143 (7%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLAA CLSRDPKARP+MS V
Sbjct  355  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAAHCLSRDPKARPLMSAV  414

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPN------TKNGIVFSKNGQQNPRSLSIP  264
            VE LKPLPNLKDMASSSYYFQTMQADR  SSPN      T+ G++  +NGQQ+ RSLSIP
Sbjct  415  VEVLKPLPNLKDMASSSYYFQTMQADRTLSSPNAKSSSRTQGGLL--RNGQQH-RSLSIP  471

Query  263  NGSHASPY-RQFSQNSPKPNGKA  198
            NGSHASPY  Q+   SPKP  KA
Sbjct  472  NGSHASPYHHQYPHQSPKPTSKA  494



>ref|XP_010066959.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Eucalyptus grandis]
 gb|KCW65013.1| hypothetical protein EUGRSUZ_G02551 [Eucalyptus grandis]
Length=513

 Score =   217 bits (553),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 114/136 (84%), Gaps = 1/136 (1%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLAA CLSRDPKARP+MS+V
Sbjct  377  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAAHCLSRDPKARPLMSDV  436

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNGSHAS  246
            VEALKPLPNLKDMASSSYYFQTM+A+RI SSPN + GI          RSLSIPNG+HAS
Sbjct  437  VEALKPLPNLKDMASSSYYFQTMRAERIGSSPNARYGIQSQAGANARNRSLSIPNGTHAS  496

Query  245  PY-RQFSQNSPKPNGK  201
            PY  Q+   SPKPN K
Sbjct  497  PYHHQYPHQSPKPNSK  512



>ref|XP_010066960.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Eucalyptus grandis]
Length=512

 Score =   217 bits (552),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 114/136 (84%), Gaps = 1/136 (1%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLAA CLSRDPKARP+MS+V
Sbjct  376  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAAHCLSRDPKARPLMSDV  435

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNGSHAS  246
            VEALKPLPNLKDMASSSYYFQTM+A+RI SSPN + GI          RSLSIPNG+HAS
Sbjct  436  VEALKPLPNLKDMASSSYYFQTMRAERIGSSPNARYGIQSQAGANARNRSLSIPNGTHAS  495

Query  245  PY-RQFSQNSPKPNGK  201
            PY  Q+   SPKPN K
Sbjct  496  PYHHQYPHQSPKPNSK  511



>ref|XP_010683263.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=480

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 120/141 (85%), Gaps = 5/141 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL ++RRFYRLIDPRLEGHFSIKGAQKA QLAA CLSRDPKARP+MSEV
Sbjct  340  GEHNLVEWARPHLGDRRRFYRLIDPRLEGHFSIKGAQKAVQLAAHCLSRDPKARPLMSEV  399

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFS---KNGQQ-NPRSLSIPNG  258
            V++LKPLPNLKDMASSSYYFQTMQADRI +SPN +NG +     +NGQQ   RSLSIP+G
Sbjct  400  VDSLKPLPNLKDMASSSYYFQTMQADRIRASPNARNGQLIGPHQRNGQQPALRSLSIPHG  459

Query  257  SHASPYRQFS-QNSPKPNGKA  198
            SHASPY     Q SPKP+GK+
Sbjct  460  SHASPYHHHQYQPSPKPSGKS  480



>gb|KJB80035.1| hypothetical protein B456_013G077800 [Gossypium raimondii]
Length=485

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 116/140 (83%), Gaps = 9/140 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLAA CLSRDPKARP+MSEV
Sbjct  348  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAAHCLSRDPKARPLMSEV  407

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VE LKPLPNLKDMASSSYYFQTMQA+R+ SSP  +NG        S+NG    RSLSIPN
Sbjct  408  VEVLKPLPNLKDMASSSYYFQTMQAERVGSSPLARNGTRAPASSLSRNGH---RSLSIPN  464

Query  260  GSHASPY-RQFSQNSPKPNG  204
            GSHASPY  Q+   SPKPNG
Sbjct  465  GSHASPYHHQYPYQSPKPNG  484



>ref|XP_010683262.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=484

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 120/141 (85%), Gaps = 5/141 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL ++RRFYRLIDPRLEGHFSIKGAQKA QLAA CLSRDPKARP+MSEV
Sbjct  344  GEHNLVEWARPHLGDRRRFYRLIDPRLEGHFSIKGAQKAVQLAAHCLSRDPKARPLMSEV  403

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFS---KNGQQ-NPRSLSIPNG  258
            V++LKPLPNLKDMASSSYYFQTMQADRI +SPN +NG +     +NGQQ   RSLSIP+G
Sbjct  404  VDSLKPLPNLKDMASSSYYFQTMQADRIRASPNARNGQLIGPHQRNGQQPALRSLSIPHG  463

Query  257  SHASPYRQFS-QNSPKPNGKA  198
            SHASPY     Q SPKP+GK+
Sbjct  464  SHASPYHHHQYQPSPKPSGKS  484



>ref|XP_002311801.1| hypothetical protein POPTR_0008s19920g [Populus trichocarpa]
 gb|EEE89168.1| hypothetical protein POPTR_0008s19920g [Populus trichocarpa]
Length=478

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 118/141 (84%), Gaps = 7/141 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L E+RRFYRLIDPRL+GHFSIKGAQKAAQLAA CLSRDPKARP+MSEV
Sbjct  338  GEHNLVEWARPYLGERRRFYRLIDPRLQGHFSIKGAQKAAQLAAHCLSRDPKARPLMSEV  397

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            V+ LKPLPNLKDMASSSYYFQTMQ DR+ SSPN KNG+     + S+NG Q  RS SIP+
Sbjct  398  VDTLKPLPNLKDMASSSYYFQTMQGDRVGSSPNAKNGVRSQAGLLSRNGHQQ-RSFSIPH  456

Query  260  GSHASPY-RQFSQNSPKPNGK  201
            G HASP+  Q+   SPKP+GK
Sbjct  457  GPHASPFHHQYPHQSPKPSGK  477



>ref|XP_011034212.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Populus 
euphratica]
Length=477

 Score =   213 bits (543),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 117/141 (83%), Gaps = 7/141 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L E+RRFYRLIDPRLEGHFSIKGAQKAAQLAA CLSRDPK RP+MSEV
Sbjct  337  GEHNLVEWARPYLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAAYCLSRDPKTRPLMSEV  396

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            V+ LKPLPNLKDMASSSYYFQTMQADR+ SSPN KNG+     + S+NG Q  RS SIP+
Sbjct  397  VDTLKPLPNLKDMASSSYYFQTMQADRVGSSPNAKNGVRAQAGLLSRNGHQQ-RSFSIPH  455

Query  260  GSHASPY-RQFSQNSPKPNGK  201
            G HASP+  Q+   SP+P GK
Sbjct  456  GPHASPFHHQYPHQSPRPCGK  476



>ref|XP_003613590.1| Serine/threonine protein kinase-like protein [Medicago truncatula]
 gb|AES96548.1| receptor-like kinase plant [Medicago truncatula]
Length=492

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 119/141 (84%), Gaps = 6/141 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFS+KGAQKAAQLA  CLSRDPKARP+MSEV
Sbjct  353  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSVKGAQKAAQLAHHCLSRDPKARPLMSEV  412

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKN----GIVFSKNGQQNPRSLSIPNG  258
            VEAL PLPNLKDMASSSYYFQ+MQA+R  +SPN+++    G   ++NGQQ  RSLSIPNG
Sbjct  413  VEALMPLPNLKDMASSSYYFQSMQAERFGASPNSRSVHAQGASLARNGQQR-RSLSIPNG  471

Query  257  SHASPY-RQFSQNSPKPNGKA  198
            +H SPY  ++ Q SPKPN KA
Sbjct  472  AHVSPYHHKYPQQSPKPNVKA  492



>gb|EYU22440.1| hypothetical protein MIMGU_mgv1a005991mg [Erythranthe guttata]
Length=462

 Score =   208 bits (529),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 118/144 (82%), Gaps = 10/144 (7%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E+RRFYR+IDPRLEGHFSIKGAQKAAQLAARCLSRDPK RP+MS+V
Sbjct  319  GEHNLVEWARPQLGERRRFYRIIDPRLEGHFSIKGAQKAAQLAARCLSRDPKVRPLMSQV  378

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPN-  261
            VE LKPLPNLKDMASSSYYFQT+Q DR  S PN KNGI     FS+N   +PRSLSIPN 
Sbjct  379  VETLKPLPNLKDMASSSYYFQTLQTDRAGSGPNGKNGIRMNGSFSRN-HHHPRSLSIPNG  437

Query  260  -GSH-ASPYRQ--FSQNSPKPNGK  201
             GSH ASPY     +++SPKPNGK
Sbjct  438  GGSHAASPYHHEVAARDSPKPNGK  461



>ref|XP_004135195.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
[Cucumis sativus]
 gb|KGN51887.1| hypothetical protein Csa_5G604320 [Cucumis sativus]
Length=488

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 115/142 (81%), Gaps = 7/142 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L EK+RFYRLIDPRLEGHFSIKGAQKA QLAA+CLSRD K RP+MSEV
Sbjct  348  GEHNLVEWARPYLGEKKRFYRLIDPRLEGHFSIKGAQKAVQLAAQCLSRDQKVRPLMSEV  407

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFS-----KNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQTMQADR+ SSP  +NG   +     KNGQQ  RS SI N
Sbjct  408  VEALKPLPNLKDMASSSYYFQTMQADRVRSSPMARNGYHTAAGQVPKNGQQ-LRSYSIAN  466

Query  260  GSHASPY-RQFSQNSPKPNGKA  198
            GSHASPY  Q    SPKPN KA
Sbjct  467  GSHASPYHHQQPHPSPKPNVKA  488



>ref|XP_004155324.1| PREDICTED: LOW QUALITY PROTEIN: probable receptor-like protein 
kinase At5g15080-like [Cucumis sativus]
Length=488

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 115/142 (81%), Gaps = 7/142 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L EK+RFYRLIDPRLEGHFSIKGAQKA QLAA+CLSRD K RP+MSEV
Sbjct  348  GEHNLVEWARPYLGEKKRFYRLIDPRLEGHFSIKGAQKAVQLAAQCLSRDQKVRPLMSEV  407

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFS-----KNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQTMQADR+ SSP  +NG   +     KNGQQ  RS SI N
Sbjct  408  VEALKPLPNLKDMASSSYYFQTMQADRVRSSPMARNGYHTAAGQVPKNGQQ-LRSYSIAN  466

Query  260  GSHASPY-RQFSQNSPKPNGKA  198
            GSHASPY  Q    SPKPN KA
Sbjct  467  GSHASPYHHQQPHPSPKPNVKA  488



>ref|XP_008446315.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Cucumis 
melo]
Length=488

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 115/142 (81%), Gaps = 7/142 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L EK+RFYRLIDPRLEGHFSIKGAQKA QLAA+CLSRD K RP+MSEV
Sbjct  348  GEHNLVEWARPYLGEKKRFYRLIDPRLEGHFSIKGAQKAVQLAAQCLSRDQKVRPLMSEV  407

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFS-----KNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQTMQADR+ SSP  +NG   +     KNGQQ  RS SI N
Sbjct  408  VEALKPLPNLKDMASSSYYFQTMQADRVRSSPMARNGYHTAAGPAPKNGQQ-LRSYSIAN  466

Query  260  GSHASPY-RQFSQNSPKPNGKA  198
            GSHASPY  Q    SPKPN KA
Sbjct  467  GSHASPYHHQQPHPSPKPNVKA  488



>ref|XP_006482531.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X4 [Citrus sinensis]
Length=489

 Score =   203 bits (516),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 113/140 (81%), Gaps = 7/140 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRFYRL+DPRLEGHFSIKG+QKA QLAA+CLSRDPKARP MSEV
Sbjct  351  GEHNLVEWARPHLGDKRRFYRLLDPRLEGHFSIKGSQKATQLAAQCLSRDPKARPRMSEV  410

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VE LKPL NLKDMASSSYYFQTMQAD   S  N+KNGI       ++NGQ   R+LS PN
Sbjct  411  VETLKPLQNLKDMASSSYYFQTMQADNTWSIRNSKNGIRTQGGFMTRNGQP-LRTLSHPN  469

Query  260  GSHASPYRQFSQNSPKPNGK  201
            G HASPYR   Q SPKPNGK
Sbjct  470  GPHASPYRH-PQQSPKPNGK  488



>ref|XP_003633841.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Vitis 
vinifera]
Length=475

 Score =   203 bits (516),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 115/138 (83%), Gaps = 7/138 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRL+DPRLEG FSIKGAQKAAQLAA CLSRDPKARP+MSEV
Sbjct  339  GEHNLVEWARPHLGERRRFYRLLDPRLEGRFSIKGAQKAAQLAAHCLSRDPKARPLMSEV  398

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSS +FQTMQA+R  S+PN+++GI       S+NGQ N RSLS+PN
Sbjct  399  VEALKPLPNLKDMASSSSFFQTMQAERTGSTPNSRSGIRAQAGFLSRNGQPN-RSLSMPN  457

Query  260  GSHASPYRQFS-QNSPKP  210
            G HASPY   +   SPKP
Sbjct  458  GPHASPYNHNNPHRSPKP  475



>ref|XP_006431068.1| hypothetical protein CICLE_v10011575mg [Citrus clementina]
 ref|XP_006482530.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X3 [Citrus sinensis]
 gb|ESR44308.1| hypothetical protein CICLE_v10011575mg [Citrus clementina]
 gb|KDO72477.1| hypothetical protein CISIN_1g011180mg [Citrus sinensis]
Length=490

 Score =   203 bits (516),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 113/140 (81%), Gaps = 7/140 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRFYRL+DPRLEGHFSIKG+QKA QLAA+CLSRDPKARP MSEV
Sbjct  352  GEHNLVEWARPHLGDKRRFYRLLDPRLEGHFSIKGSQKATQLAAQCLSRDPKARPRMSEV  411

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VE LKPL NLKDMASSSYYFQTMQAD   S  N+KNGI       ++NGQ   R+LS PN
Sbjct  412  VETLKPLQNLKDMASSSYYFQTMQADNTWSIRNSKNGIRTQGGFMTRNGQP-LRTLSHPN  470

Query  260  GSHASPYRQFSQNSPKPNGK  201
            G HASPYR   Q SPKPNGK
Sbjct  471  GPHASPYRH-PQQSPKPNGK  489



>ref|XP_006431066.1| hypothetical protein CICLE_v10011575mg [Citrus clementina]
 ref|XP_006482528.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X1 [Citrus sinensis]
 gb|ESR44306.1| hypothetical protein CICLE_v10011575mg [Citrus clementina]
 gb|KDO72476.1| hypothetical protein CISIN_1g011180mg [Citrus sinensis]
Length=491

 Score =   203 bits (516),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 113/140 (81%), Gaps = 7/140 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRFYRL+DPRLEGHFSIKG+QKA QLAA+CLSRDPKARP MSEV
Sbjct  353  GEHNLVEWARPHLGDKRRFYRLLDPRLEGHFSIKGSQKATQLAAQCLSRDPKARPRMSEV  412

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VE LKPL NLKDMASSSYYFQTMQAD   S  N+KNGI       ++NGQ   R+LS PN
Sbjct  413  VETLKPLQNLKDMASSSYYFQTMQADNTWSIRNSKNGIRTQGGFMTRNGQP-LRTLSHPN  471

Query  260  GSHASPYRQFSQNSPKPNGK  201
            G HASPYR   Q SPKPNGK
Sbjct  472  GPHASPYRH-PQQSPKPNGK  490



>ref|XP_006431067.1| hypothetical protein CICLE_v10011575mg [Citrus clementina]
 ref|XP_006482529.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X2 [Citrus sinensis]
 gb|ESR44307.1| hypothetical protein CICLE_v10011575mg [Citrus clementina]
 gb|KDO72478.1| hypothetical protein CISIN_1g011180mg [Citrus sinensis]
Length=490

 Score =   203 bits (516),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 113/140 (81%), Gaps = 7/140 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRFYRL+DPRLEGHFSIKG+QKA QLAA+CLSRDPKARP MSEV
Sbjct  352  GEHNLVEWARPHLGDKRRFYRLLDPRLEGHFSIKGSQKATQLAAQCLSRDPKARPRMSEV  411

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VE LKPL NLKDMASSSYYFQTMQAD   S  N+KNGI       ++NGQ   R+LS PN
Sbjct  412  VETLKPLQNLKDMASSSYYFQTMQADNTWSIRNSKNGIRTQGGFMTRNGQP-LRTLSHPN  470

Query  260  GSHASPYRQFSQNSPKPNGK  201
            G HASPYR   Q SPKPNGK
Sbjct  471  GPHASPYRH-PQQSPKPNGK  489



>dbj|BAC57958.1| serine/threonine protein kinase [Aster tripolium]
Length=439

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 113/138 (82%), Gaps = 6/138 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLA+RCLSRDPKARP+MSEV
Sbjct  304  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLASRCLSRDPKARPLMSEV  363

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIV--FSKNGQQNPRSLSIPNGSH  252
            V+ LKPLP LKDMA  SYY QT+Q +R  SSP+     V  FS+NG Q+PR+LSIPN   
Sbjct  364  VDCLKPLPALKDMAGPSYYLQTVQPERAGSSPDPNRTRVGSFSRNGSQHPRTLSIPN---  420

Query  251  ASP-YRQFSQNSPKPNGK  201
            ASP + QF Q+SP PNGK
Sbjct  421  ASPRHNQFLQDSPNPNGK  438



>ref|XP_002517468.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF45010.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=479

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 113/140 (81%), Gaps = 7/140 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPH  ++RRFYRL+DPRLEGHFSIKGAQKA QLA++CLSRDPKARP MSEV
Sbjct  340  GEHNLVEWARPHFGDRRRFYRLLDPRLEGHFSIKGAQKAIQLASQCLSRDPKARPRMSEV  399

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VE LKPLPNLKDMASSSYYFQTMQADR  S+ +TKNGI       ++NGQ   RSLS  +
Sbjct  400  VETLKPLPNLKDMASSSYYFQTMQADRNKSNMHTKNGIRTQAGFVTRNGQP-LRSLSSLS  458

Query  260  GSHASPYRQFSQNSPKPNGK  201
             + ASPY Q  Q SPKPNGK
Sbjct  459  DTRASPYNQPYQ-SPKPNGK  477



>gb|KDP45472.1| hypothetical protein JCGZ_09721 [Jatropha curcas]
Length=481

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 113/140 (81%), Gaps = 7/140 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPH  ++RRFYRL+DPRLEGHFSIKGAQKA QLA++CLSRDPKARP MSEV
Sbjct  342  GEHNLVEWARPHFGDRRRFYRLLDPRLEGHFSIKGAQKAIQLASQCLSRDPKARPRMSEV  401

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VE LKPLPNLKDMASSSYYFQTMQADR  S+ +TKNGI       ++NGQ   RSLS  +
Sbjct  402  VETLKPLPNLKDMASSSYYFQTMQADRNKSNVHTKNGIRTQGGFVTRNGQP-LRSLSSLS  460

Query  260  GSHASPYRQFSQNSPKPNGK  201
             + ASPY Q  Q SPKPNGK
Sbjct  461  DTRASPYNQPYQ-SPKPNGK  479



>ref|XP_008459298.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Cucumis melo]
Length=490

 Score =   192 bits (489),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 110/137 (80%), Gaps = 5/137 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L +KR+FYRLIDPRLE HFSIKGAQKAA+LAA CLSRDPKARP MSEV
Sbjct  353  GEHNLVEWARPLLGDKRKFYRLIDPRLECHFSIKGAQKAAELAAHCLSRDPKARPPMSEV  412

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VE LKPLPNLKDMASSSYYFQTMQADR  S+PN K+ +    +F     Q+ RSLS PNG
Sbjct  413  VEILKPLPNLKDMASSSYYFQTMQADRARSTPNAKSVVRTQSMFVARNGQHIRSLSSPNG  472

Query  257  SHASPYRQFSQNSPKPN  207
             HASPY   +Q SPKP+
Sbjct  473  PHASPYNHPNQ-SPKPD  488



>ref|XP_004148688.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
[Cucumis sativus]
 ref|XP_004162587.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
[Cucumis sativus]
Length=490

 Score =   192 bits (489),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 110/137 (80%), Gaps = 5/137 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L +KR+FYRLIDPRLE HFSIKGAQKAA+LAA CLSRDPKARP MSEV
Sbjct  353  GEHNLVEWARPLLGDKRKFYRLIDPRLECHFSIKGAQKAAELAAHCLSRDPKARPPMSEV  412

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VE LKPLPNLKDMASSSYYFQTMQADR  S+PN K+ +    +F     Q+ RSLS PNG
Sbjct  413  VEILKPLPNLKDMASSSYYFQTMQADRARSTPNAKSVVRTQSMFVARNGQHIRSLSSPNG  472

Query  257  SHASPYRQFSQNSPKPN  207
             HASPY   +Q SPKP+
Sbjct  473  PHASPYNHPNQ-SPKPD  488



>gb|KGN52446.1| hypothetical protein Csa_5G635410 [Cucumis sativus]
Length=489

 Score =   192 bits (489),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 110/137 (80%), Gaps = 5/137 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L +KR+FYRLIDPRLE HFSIKGAQKAA+LAA CLSRDPKARP MSEV
Sbjct  352  GEHNLVEWARPLLGDKRKFYRLIDPRLECHFSIKGAQKAAELAAHCLSRDPKARPPMSEV  411

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VE LKPLPNLKDMASSSYYFQTMQADR  S+PN K+ +    +F     Q+ RSLS PNG
Sbjct  412  VEILKPLPNLKDMASSSYYFQTMQADRARSTPNAKSVVRTQSMFVARNGQHIRSLSSPNG  471

Query  257  SHASPYRQFSQNSPKPN  207
             HASPY   +Q SPKP+
Sbjct  472  PHASPYNHPNQ-SPKPD  487



>ref|XP_008459299.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Cucumis melo]
Length=489

 Score =   192 bits (489),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 110/137 (80%), Gaps = 5/137 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L +KR+FYRLIDPRLE HFSIKGAQKAA+LAA CLSRDPKARP MSEV
Sbjct  352  GEHNLVEWARPLLGDKRKFYRLIDPRLECHFSIKGAQKAAELAAHCLSRDPKARPPMSEV  411

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VE LKPLPNLKDMASSSYYFQTMQADR  S+PN K+ +    +F     Q+ RSLS PNG
Sbjct  412  VEILKPLPNLKDMASSSYYFQTMQADRARSTPNAKSVVRTQSMFVARNGQHIRSLSSPNG  471

Query  257  SHASPYRQFSQNSPKPN  207
             HASPY   +Q SPKP+
Sbjct  472  PHASPYNHPNQ-SPKPD  487



>ref|XP_010242357.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X4 [Nelumbo nucifera]
Length=480

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 112/141 (79%), Gaps = 8/141 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRL+DPRLEGHFSIKG QKAAQLA  CLSRDPKARP+MSEV
Sbjct  340  GEHNLVEWARPHLGERRRFYRLMDPRLEGHFSIKGVQKAAQLAQHCLSRDPKARPLMSEV  399

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPL +LKDMASSS YF+ MQA+R  S+PN +NG+       S+NGQ   RSLSI +
Sbjct  400  VEALKPLLHLKDMASSSDYFKAMQAERTGSNPNARNGLRTQAGSMSRNGQPT-RSLSI-H  457

Query  260  GSHASPYRQFS-QNSPKPNGK  201
            GSHASPY       SPKPNGK
Sbjct  458  GSHASPYHHHQPLQSPKPNGK  478



>ref|XP_011003187.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Populus euphratica]
Length=482

 Score =   189 bits (481),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 110/140 (79%), Gaps = 10/140 (7%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPH  +KRRFYR++DPRLEGHFSIKGAQKA QLAA+CLSRDP++RP MSEV
Sbjct  346  GEHNLVEWARPHFGDKRRFYRILDPRLEGHFSIKGAQKAIQLAAQCLSRDPRSRPRMSEV  405

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQTMQADR  SS N KNGI       ++NGQ   RSLS   
Sbjct  406  VEALKPLPNLKDMASSSYYFQTMQADRNKSSMNAKNGIRTNAGFITRNGQA-LRSLS---  461

Query  260  GSHASPYRQFSQNSPKPNGK  201
               ASPY Q  Q SPKP GK
Sbjct  462  DVRASPYNQPRQ-SPKPRGK  480



>ref|XP_011003188.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Populus euphratica]
Length=481

 Score =   189 bits (481),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 110/140 (79%), Gaps = 10/140 (7%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPH  +KRRFYR++DPRLEGHFSIKGAQKA QLAA+CLSRDP++RP MSEV
Sbjct  345  GEHNLVEWARPHFGDKRRFYRILDPRLEGHFSIKGAQKAIQLAAQCLSRDPRSRPRMSEV  404

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQTMQADR  SS N KNGI       ++NGQ   RSLS   
Sbjct  405  VEALKPLPNLKDMASSSYYFQTMQADRNKSSMNAKNGIRTNAGFITRNGQA-LRSLS---  460

Query  260  GSHASPYRQFSQNSPKPNGK  201
               ASPY Q  Q SPKP GK
Sbjct  461  DVRASPYNQPRQ-SPKPRGK  479



>ref|XP_002323829.2| hypothetical protein POPTR_0017s11370g [Populus trichocarpa]
 gb|EEF03962.2| hypothetical protein POPTR_0017s11370g [Populus trichocarpa]
Length=482

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 110/140 (79%), Gaps = 10/140 (7%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPH  +KRRFYR++DPRLEGHFSIKGAQKA QLAA+CLSRDPK+RP MSEV
Sbjct  346  GEHNLVEWARPHFGDKRRFYRILDPRLEGHFSIKGAQKAIQLAAQCLSRDPKSRPRMSEV  405

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQTMQADR  S+ N KNGI       ++NGQ   RSLS   
Sbjct  406  VEALKPLPNLKDMASSSYYFQTMQADRNKSNMNAKNGIRTNAGFITRNGQP-LRSLS---  461

Query  260  GSHASPYRQFSQNSPKPNGK  201
               ASPY Q  Q SPKP GK
Sbjct  462  DVRASPYNQPRQ-SPKPRGK  480



>ref|XP_002323831.2| hypothetical protein POPTR_0017s11370g [Populus trichocarpa]
 gb|EEF03964.2| hypothetical protein POPTR_0017s11370g [Populus trichocarpa]
Length=481

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 110/140 (79%), Gaps = 10/140 (7%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPH  +KRRFYR++DPRLEGHFSIKGAQKA QLAA+CLSRDPK+RP MSEV
Sbjct  345  GEHNLVEWARPHFGDKRRFYRILDPRLEGHFSIKGAQKAIQLAAQCLSRDPKSRPRMSEV  404

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQTMQADR  S+ N KNGI       ++NGQ   RSLS   
Sbjct  405  VEALKPLPNLKDMASSSYYFQTMQADRNKSNMNAKNGIRTNAGFITRNGQP-LRSLS---  460

Query  260  GSHASPYRQFSQNSPKPNGK  201
               ASPY Q  Q SPKP GK
Sbjct  461  DVRASPYNQPRQ-SPKPRGK  479



>ref|XP_010256394.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Nelumbo nucifera]
Length=485

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 115/144 (80%), Gaps = 11/144 (8%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLI-DPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSE  429
            GEHN VEWARP+L EK+RFYRLI DPRLEGHFSIKGA+KAAQLA RCLSRDPKARP+MSE
Sbjct  342  GEHNLVEWARPYLGEKKRFYRLIIDPRLEGHFSIKGAEKAAQLAHRCLSRDPKARPLMSE  401

Query  428  VVEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIP  264
            VVEALKPL NL+DMASSSYY+QTM A+R  S+  T+NG+        +NGQ   RSLS+P
Sbjct  402  VVEALKPLQNLRDMASSSYYYQTMLAERTGSNL-TRNGLRTQGGSLLRNGQPT-RSLSMP  459

Query  263  NGSHASPY---RQFSQNSPKPNGK  201
            NGSHASPY      S  SPKPNGK
Sbjct  460  NGSHASPYHHHHHQSHQSPKPNGK  483



>ref|XP_010256402.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Nelumbo nucifera]
Length=484

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 115/144 (80%), Gaps = 11/144 (8%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLI-DPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSE  429
            GEHN VEWARP+L EK+RFYRLI DPRLEGHFSIKGA+KAAQLA RCLSRDPKARP+MSE
Sbjct  341  GEHNLVEWARPYLGEKKRFYRLIIDPRLEGHFSIKGAEKAAQLAHRCLSRDPKARPLMSE  400

Query  428  VVEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIP  264
            VVEALKPL NL+DMASSSYY+QTM A+R  S+  T+NG+        +NGQ   RSLS+P
Sbjct  401  VVEALKPLQNLRDMASSSYYYQTMLAERTGSNL-TRNGLRTQGGSLLRNGQPT-RSLSMP  458

Query  263  NGSHASPY---RQFSQNSPKPNGK  201
            NGSHASPY      S  SPKPNGK
Sbjct  459  NGSHASPYHHHHHQSHQSPKPNGK  482



>ref|XP_010242353.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010242354.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Nelumbo nucifera]
Length=491

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 110/139 (79%), Gaps = 8/139 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRL+DPRLEGHFSIKG QKAAQLA  CLSRDPKARP+MSEV
Sbjct  341  GEHNLVEWARPHLGERRRFYRLMDPRLEGHFSIKGVQKAAQLAQHCLSRDPKARPLMSEV  400

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPL +LKDMASSS YF+ MQA+R  S+PN +NG+       S+NGQ   RSLSI +
Sbjct  401  VEALKPLLHLKDMASSSDYFKAMQAERTGSNPNARNGLRTQAGSMSRNGQPT-RSLSI-H  458

Query  260  GSHASPYRQFS-QNSPKPN  207
            GSHASPY       SPKPN
Sbjct  459  GSHASPYHHHQPLQSPKPN  477



>ref|XP_010242355.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Nelumbo nucifera]
Length=490

 Score =   188 bits (477),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 110/139 (79%), Gaps = 8/139 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRL+DPRLEGHFSIKG QKAAQLA  CLSRDPKARP+MSEV
Sbjct  340  GEHNLVEWARPHLGERRRFYRLMDPRLEGHFSIKGVQKAAQLAQHCLSRDPKARPLMSEV  399

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPL +LKDMASSS YF+ MQA+R  S+PN +NG+       S+NGQ   RSLSI +
Sbjct  400  VEALKPLLHLKDMASSSDYFKAMQAERTGSNPNARNGLRTQAGSMSRNGQPT-RSLSI-H  457

Query  260  GSHASPYRQFS-QNSPKPN  207
            GSHASPY       SPKPN
Sbjct  458  GSHASPYHHHQPLQSPKPN  476



>ref|XP_010242356.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X3 [Nelumbo nucifera]
Length=485

 Score =   188 bits (477),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 110/139 (79%), Gaps = 8/139 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRL+DPRLEGHFSIKG QKAAQLA  CLSRDPKARP+MSEV
Sbjct  335  GEHNLVEWARPHLGERRRFYRLMDPRLEGHFSIKGVQKAAQLAQHCLSRDPKARPLMSEV  394

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPL +LKDMASSS YF+ MQA+R  S+PN +NG+       S+NGQ   RSLSI +
Sbjct  395  VEALKPLLHLKDMASSSDYFKAMQAERTGSNPNARNGLRTQAGSMSRNGQPT-RSLSI-H  452

Query  260  GSHASPYRQFS-QNSPKPN  207
            GSHASPY       SPKPN
Sbjct  453  GSHASPYHHHQPLQSPKPN  471



>ref|XP_002305368.1| kinase family protein [Populus trichocarpa]
 gb|EEE85879.1| kinase family protein [Populus trichocarpa]
Length=480

 Score =   187 bits (476),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 109/141 (77%), Gaps = 10/141 (7%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPH  +KRRFYRL+DPRLEGHFSIKGAQK  QLAA+CLSRDPKARP MSEV
Sbjct  344  GEHNLVEWARPHFGDKRRFYRLLDPRLEGHFSIKGAQKGIQLAAQCLSRDPKARPQMSEV  403

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQ+MQADR  S+ N KNG        ++NGQ   RSLS   
Sbjct  404  VEALKPLPNLKDMASSSYYFQSMQADRNKSNMNAKNGTRTQAGFVTRNGQP-LRSLS---  459

Query  260  GSHASPYRQFSQNSPKPNGKA  198
               ASPY Q  Q SPKP G++
Sbjct  460  DVRASPYNQ-PQQSPKPKGRS  479



>ref|XP_011009452.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Populus euphratica]
Length=485

 Score =   187 bits (476),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 110/141 (78%), Gaps = 10/141 (7%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+  +KRRFYRL+DPRLEGHFSIKGAQKA QLAA+CLSRDPKARP MSEV
Sbjct  349  GEHNLVEWARPNFGDKRRFYRLLDPRLEGHFSIKGAQKAIQLAAQCLSRDPKARPQMSEV  408

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQ+MQADR  SS N KNG        ++NGQ   RSLS   
Sbjct  409  VEALKPLPNLKDMASSSYYFQSMQADRNKSSMNAKNGTRTQAGFVTRNGQP-LRSLS---  464

Query  260  GSHASPYRQFSQNSPKPNGKA  198
               ASPY Q  Q SP+P GK+
Sbjct  465  DVRASPYNQ-PQQSPRPKGKS  484



>ref|XP_011009453.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Populus euphratica]
Length=484

 Score =   187 bits (476),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 110/141 (78%), Gaps = 10/141 (7%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+  +KRRFYRL+DPRLEGHFSIKGAQKA QLAA+CLSRDPKARP MSEV
Sbjct  348  GEHNLVEWARPNFGDKRRFYRLLDPRLEGHFSIKGAQKAIQLAAQCLSRDPKARPQMSEV  407

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VEALKPLPNLKDMASSSYYFQ+MQADR  SS N KNG        ++NGQ   RSLS   
Sbjct  408  VEALKPLPNLKDMASSSYYFQSMQADRNKSSMNAKNGTRTQAGFVTRNGQP-LRSLS---  463

Query  260  GSHASPYRQFSQNSPKPNGKA  198
               ASPY Q  Q SP+P GK+
Sbjct  464  DVRASPYNQ-PQQSPRPKGKS  483



>gb|KCW52800.1| hypothetical protein EUGRSUZ_J02135 [Eucalyptus grandis]
Length=466

 Score =   187 bits (474),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 111/142 (78%), Gaps = 8/142 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWA+P L ++RRFYRLIDPRLEGHFSIKGAQKA+QLAA CL RD KARP MSEV
Sbjct  327  GEHNLVEWAKPFLEDRRRFYRLIDPRLEGHFSIKGAQKASQLAAHCLRRDQKARPRMSEV  386

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI------VFSKNGQQNPRSLSIP  264
            VEAL+PL NLKDMASSSY+FQ MQA+R  S+PN KNGI      V  +NGQ   RSLSIP
Sbjct  387  VEALEPLLNLKDMASSSYFFQAMQAERSRSNPNAKNGIRTQGGFVVIRNGQP-VRSLSIP  445

Query  263  NGSHASPYRQFSQNSPKPNGKA  198
            +G+H SP     + SPKPNGK 
Sbjct  446  HGTHPSP-NNIPRLSPKPNGKV  466



>gb|KFK25744.1| hypothetical protein AALP_AA8G154000 [Arabis alpina]
Length=506

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 112/139 (81%), Gaps = 6/139 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRFYRL+DPRLEGHFSIKGAQK  QLAA+CLSRDPK RP MS+V
Sbjct  366  GEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSIKGAQKVTQLAAQCLSRDPKIRPKMSDV  425

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIAS-SPNTKNGIVF-SKNGQQNP--RSLSIPNG  258
            VEALKPLP+LKDMASSSYYFQTMQA+R+ + S  ++ G  F S+N QQ P  R+LS P+G
Sbjct  426  VEALKPLPHLKDMASSSYYFQTMQAERLKNGSMRSQGGSGFGSRNAQQQPMFRTLSSPHG  485

Query  257  SH-ASPYRQFSQNSPKPNG  204
             H ASPYR     SPKP G
Sbjct  486  HHGASPYRH-QIPSPKPKG  503



>ref|XP_010033218.1| PREDICTED: LOW QUALITY PROTEIN: probable receptor-like protein 
kinase At5g15080 [Eucalyptus grandis]
Length=485

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 111/142 (78%), Gaps = 8/142 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWA+P L ++RRFYRLIDPRLEGHFSIKGAQKA+QLAA CL RD KARP MSEV
Sbjct  346  GEHNLVEWAKPFLEDRRRFYRLIDPRLEGHFSIKGAQKASQLAAHCLRRDQKARPRMSEV  405

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI------VFSKNGQQNPRSLSIP  264
            VEAL+PL NLKDMASSSY+FQ MQA+R  S+PN KNGI      V  +NGQ   RSLSIP
Sbjct  406  VEALEPLLNLKDMASSSYFFQAMQAERSRSNPNAKNGIRTQGGFVVIRNGQP-VRSLSIP  464

Query  263  NGSHASPYRQFSQNSPKPNGKA  198
            +G+H SP     + SPKPNGK 
Sbjct  465  HGTHPSP-NNIPRLSPKPNGKV  485



>ref|XP_008230724.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Prunus 
mume]
Length=475

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 105/140 (75%), Gaps = 6/140 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWAR    +KRR ++LIDPRLEGHFSIKGAQKA QLAA CLSRDPKARPMMSEV
Sbjct  338  GEHNLVEWARQLFGDKRRLFQLIDPRLEGHFSIKGAQKAIQLAAHCLSRDPKARPMMSEV  397

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VEALKPLPNLKDMASSSY+FQTMQA R  S+ N KNGI    VF        RSLS PNG
Sbjct  398  VEALKPLPNLKDMASSSYHFQTMQAARSRSTSNAKNGIRTQAVFVPRNGHPVRSLSSPNG  457

Query  257  SHASPYRQFSQNSPKPNGKA  198
              ASPY  +   SPKPN K 
Sbjct  458  PPASPY--YPHKSPKPNSKG  475



>ref|XP_010931968.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X3 [Elaeis guineensis]
Length=439

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 110/142 (77%), Gaps = 13/142 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRF+RLIDPRL+G+FSIKGA KAAQLA  CLSRDPK+RP+MSEV
Sbjct  302  GEHNLVEWARPHLGERRRFFRLIDPRLDGNFSIKGALKAAQLAHACLSRDPKSRPLMSEV  361

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNG-------IVFSKNGQQNPRSLSI  267
            VE LKPL NLKDMASSSY+FQ+MQA+R A++ N + G         F +NG Q  RSLS 
Sbjct  362  VEVLKPLINLKDMASSSYFFQSMQAERAAANSNNQTGRNGLKSQASFPRNGHQPVRSLS-  420

Query  266  PNGSHASPYRQFSQNSPKPNGK  201
             NGSH SPYRQ    SPKPN K
Sbjct  421  -NGSHPSPYRQ----SPKPNDK  437



>ref|XP_007217722.1| hypothetical protein PRUPE_ppa005147mg [Prunus persica]
 gb|EMJ18921.1| hypothetical protein PRUPE_ppa005147mg [Prunus persica]
Length=475

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 105/139 (76%), Gaps = 6/139 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWAR    +KRR ++LIDPRLEGHFSIKGAQKA QLAA CLSRDPKARPMMSEV
Sbjct  338  GEHNLVEWARQLFGDKRRLFQLIDPRLEGHFSIKGAQKAIQLAAHCLSRDPKARPMMSEV  397

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VEALKPLPNLKDMASSSY+FQTMQA R  S+ N KNGI    VF        RSLS PNG
Sbjct  398  VEALKPLPNLKDMASSSYHFQTMQAARSRSTSNAKNGIRTQAVFVPRNGHPIRSLSSPNG  457

Query  257  SHASPYRQFSQNSPKPNGK  201
              ASPY  +   SPKPN K
Sbjct  458  PPASPY--YPHKSPKPNSK  474



>ref|XP_010524324.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Tarenaya 
hassleriana]
Length=481

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 106/134 (79%), Gaps = 7/134 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL ++RRFYRL+DPRLEGHFSIKGAQKA QLA +CLSRDPK RP MSEV
Sbjct  352  GEHNLVEWARPHLHDRRRFYRLLDPRLEGHFSIKGAQKATQLAVKCLSRDPKVRPKMSEV  411

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNGSHAS  246
            VEALKPLP+LKDMASSSYYFQTMQ DR+ S     +  + S+NGQ   R+LS P+GS  S
Sbjct  412  VEALKPLPHLKDMASSSYYFQTMQTDRLKSG----SARLASRNGQHVFRTLSSPHGS--S  465

Query  245  PYRQFSQNSPKPNG  204
            PYR     SPKP G
Sbjct  466  PYRH-QIPSPKPKG  478



>ref|XP_010931889.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Elaeis guineensis]
Length=483

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 110/142 (77%), Gaps = 13/142 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRF+RLIDPRL+G+FSIKGA KAAQLA  CLSRDPK+RP+MSEV
Sbjct  346  GEHNLVEWARPHLGERRRFFRLIDPRLDGNFSIKGALKAAQLAHACLSRDPKSRPLMSEV  405

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNG-------IVFSKNGQQNPRSLSI  267
            VE LKPL NLKDMASSSY+FQ+MQA+R A++ N + G         F +NG Q  RSLS 
Sbjct  406  VEVLKPLINLKDMASSSYFFQSMQAERAAANSNNQTGRNGLKSQASFPRNGHQPVRSLS-  464

Query  266  PNGSHASPYRQFSQNSPKPNGK  201
             NGSH SPYRQ    SPKPN K
Sbjct  465  -NGSHPSPYRQ----SPKPNDK  481



>ref|XP_010931806.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Elaeis guineensis]
Length=484

 Score =   185 bits (470),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 110/142 (77%), Gaps = 13/142 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRF+RLIDPRL+G+FSIKGA KAAQLA  CLSRDPK+RP+MSEV
Sbjct  347  GEHNLVEWARPHLGERRRFFRLIDPRLDGNFSIKGALKAAQLAHACLSRDPKSRPLMSEV  406

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNG-------IVFSKNGQQNPRSLSI  267
            VE LKPL NLKDMASSSY+FQ+MQA+R A++ N + G         F +NG Q  RSLS 
Sbjct  407  VEVLKPLINLKDMASSSYFFQSMQAERAAANSNNQTGRNGLKSQASFPRNGHQPVRSLS-  465

Query  266  PNGSHASPYRQFSQNSPKPNGK  201
             NGSH SPYRQ    SPKPN K
Sbjct  466  -NGSHPSPYRQ----SPKPNDK  482



>ref|XP_009131434.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Brassica 
rapa]
 emb|CDX78606.1| BnaA03g05180D [Brassica napus]
Length=504

 Score =   185 bits (470),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 111/140 (79%), Gaps = 7/140 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRFYRL+DPRLEGHFSIKGAQK  QLAA+CLSRDPK RP MS+V
Sbjct  363  GEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSIKGAQKVTQLAAQCLSRDPKVRPKMSDV  422

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRI--ASSPNTKNGIVF-SKNGQQNP--RSLSIPN  261
            VEALKPLP+LKDMASSSYYFQTMQA+R+   SS +   G  F S+NGQ  P  R+LS P+
Sbjct  423  VEALKPLPHLKDMASSSYYFQTMQAERLKNGSSRSQGGGNGFGSRNGQPQPVFRTLSSPH  482

Query  260  GSH-ASPYRQFSQNSPKPNG  204
            G H +SPYR     SPKP G
Sbjct  483  GQHGSSPYRH-QVPSPKPKG  501



>ref|XP_004302358.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Fragaria 
vesca subsp. vesca]
Length=473

 Score =   184 bits (468),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 106/139 (76%), Gaps = 6/139 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWAR    +KRR ++LIDPRLEGHFSIKGAQKA  LAARCLSRDPKARPMMSEV
Sbjct  336  GEHNLVEWARQLFGDKRRLFQLIDPRLEGHFSIKGAQKAILLAARCLSRDPKARPMMSEV  395

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VEALKPLP+LKDMA SSY+FQTMQA R  S+ N KNGI    VF +   Q  RSLS P G
Sbjct  396  VEALKPLPSLKDMAISSYHFQTMQAARTRSNLNAKNGIRTQAVFVQRNGQPVRSLSSPKG  455

Query  257  SHASPYRQFSQNSPKPNGK  201
              ASPY  + Q SPKPN K
Sbjct  456  PPASPY--YPQKSPKPNSK  472



>ref|XP_008793500.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Phoenix 
dactylifera]
Length=478

 Score =   184 bits (468),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 111/142 (78%), Gaps = 13/142 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            G+HN VEWARPHL E+RRFYRLIDPRL+GHFS+KGAQKAA+LA RCLSRDPKARP+MSEV
Sbjct  341  GQHNLVEWARPHLGERRRFYRLIDPRLQGHFSVKGAQKAAELAHRCLSRDPKARPLMSEV  400

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIA---SSPNTKNG----IVFSKNGQQNPRSLSI  267
            VEALKPL NLKDMASSSYYFQT+Q D  A   S+ + +NG    I FSKNGQQ  RSLS 
Sbjct  401  VEALKPLLNLKDMASSSYYFQTVQGDHGAANSSNSSIRNGLKKQISFSKNGQQPMRSLS-  459

Query  266  PNGSHASPYRQFSQNSPKPNGK  201
             N +  SPY Q    SPK N +
Sbjct  460  -NSTINSPYHQ----SPKINAE  476



>ref|NP_197012.1| probable receptor-like protein kinase [Arabidopsis thaliana]
 sp|Q9LFP7.1|Y5158_ARATH RecName: Full=Probable receptor-like protein kinase At5g15080 
[Arabidopsis thaliana]
 emb|CAC01827.1| serine/threonine specific protein kinase-like [Arabidopsis thaliana]
 gb|AAL32598.1| serine/threonine specific protein kinase-like [Arabidopsis thaliana]
 gb|AAO00937.1| serine/threonine specific protein kinase-like [Arabidopsis thaliana]
 gb|AED92114.1| probable receptor-like protein kinase [Arabidopsis thaliana]
Length=493

 Score =   184 bits (468),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 107/136 (79%), Gaps = 6/136 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRFYRL+DPRLEGHFSIKGAQK  QLAA+CLSRDPK RP MS+V
Sbjct  359  GEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSIKGAQKVTQLAAQCLSRDPKIRPKMSDV  418

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFSKNGQQNP--RSLSIPNGSH  252
            VEALKPLP+LKDMASSSYYFQTMQA+R+ +      G   S+NGQ  P  R+LS P+GS 
Sbjct  419  VEALKPLPHLKDMASSSYYFQTMQAERLKNGSGRSQGFG-SRNGQHQPVFRTLSSPHGS-  476

Query  251  ASPYRQFSQNSPKPNG  204
             SPYR     SPKP G
Sbjct  477  -SPYRH-QIPSPKPKG  490



>ref|XP_006400026.1| hypothetical protein EUTSA_v10013316mg [Eutrema salsugineum]
 gb|ESQ41479.1| hypothetical protein EUTSA_v10013316mg [Eutrema salsugineum]
Length=503

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 112/139 (81%), Gaps = 6/139 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRFYRL+DPRLEGHFSIKG+QK  QLAA+CLSRDPK RP MS+V
Sbjct  363  GEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSIKGSQKVTQLAAQCLSRDPKIRPKMSDV  422

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIAS-SPNTKNGIVF-SKNGQQNP--RSLSIPNG  258
            VEALKPLP+LKDMASSSYYFQTMQA+R+ + S  ++ G  F S+NG Q P  R+LS P+G
Sbjct  423  VEALKPLPHLKDMASSSYYFQTMQAERLKNGSGRSQGGNGFGSRNGHQQPVFRTLSSPHG  482

Query  257  SH-ASPYRQFSQNSPKPNG  204
             H +SPYR     SPKP G
Sbjct  483  QHGSSPYRH-QIPSPKPKG  500



>ref|XP_010915107.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X3 [Elaeis guineensis]
Length=464

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 112/142 (79%), Gaps = 13/142 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            G+HN VEWARPHL E+RRFYRLIDPRL+GHFS+KGAQKAA++A RCLSRDPKARP+MSEV
Sbjct  327  GQHNLVEWARPHLGERRRFYRLIDPRLQGHFSVKGAQKAAEVAHRCLSRDPKARPLMSEV  386

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIA---SSPNTKNG----IVFSKNGQQNPRSLSI  267
            VEALKPL NLKDMASSSYYFQT+Q D  A   S+ +++NG    I FSKNGQQ  RSLS 
Sbjct  387  VEALKPLLNLKDMASSSYYFQTIQGDHGAATGSNSSSRNGLKKQISFSKNGQQPMRSLS-  445

Query  266  PNGSHASPYRQFSQNSPKPNGK  201
             N +  SPY Q    SPK N +
Sbjct  446  -NSTIDSPYNQ----SPKINAE  462



>ref|XP_010915102.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Elaeis guineensis]
 ref|XP_010915103.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Elaeis guineensis]
 ref|XP_010915104.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Elaeis guineensis]
Length=479

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 112/142 (79%), Gaps = 13/142 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            G+HN VEWARPHL E+RRFYRLIDPRL+GHFS+KGAQKAA++A RCLSRDPKARP+MSEV
Sbjct  342  GQHNLVEWARPHLGERRRFYRLIDPRLQGHFSVKGAQKAAEVAHRCLSRDPKARPLMSEV  401

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIA---SSPNTKNG----IVFSKNGQQNPRSLSI  267
            VEALKPL NLKDMASSSYYFQT+Q D  A   S+ +++NG    I FSKNGQQ  RSLS 
Sbjct  402  VEALKPLLNLKDMASSSYYFQTIQGDHGAATGSNSSSRNGLKKQISFSKNGQQPMRSLS-  460

Query  266  PNGSHASPYRQFSQNSPKPNGK  201
             N +  SPY Q    SPK N +
Sbjct  461  -NSTIDSPYNQ----SPKINAE  477



>ref|XP_010915105.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Elaeis guineensis]
 ref|XP_010915106.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Elaeis guineensis]
Length=478

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 112/142 (79%), Gaps = 13/142 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            G+HN VEWARPHL E+RRFYRLIDPRL+GHFS+KGAQKAA++A RCLSRDPKARP+MSEV
Sbjct  341  GQHNLVEWARPHLGERRRFYRLIDPRLQGHFSVKGAQKAAEVAHRCLSRDPKARPLMSEV  400

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIA---SSPNTKNG----IVFSKNGQQNPRSLSI  267
            VEALKPL NLKDMASSSYYFQT+Q D  A   S+ +++NG    I FSKNGQQ  RSLS 
Sbjct  401  VEALKPLLNLKDMASSSYYFQTIQGDHGAATGSNSSSRNGLKKQISFSKNGQQPMRSLS-  459

Query  266  PNGSHASPYRQFSQNSPKPNGK  201
             N +  SPY Q    SPK N +
Sbjct  460  -NSTIDSPYNQ----SPKINAE  476



>ref|XP_008808482.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X4 [Phoenix dactylifera]
Length=481

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 109/142 (77%), Gaps = 13/142 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRF+RL+DPRL+G+FS+KGAQKAAQLA  CLSRDPKARP+MSEV
Sbjct  344  GEHNLVEWARPHLGERRRFFRLVDPRLDGNFSVKGAQKAAQLAHACLSRDPKARPLMSEV  403

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNG-------IVFSKNGQQNPRSLSI  267
            VE LKPL NLKDMASSSY FQ+MQA+R AS+ N +           F +NGQQ  RSLS 
Sbjct  404  VEVLKPLINLKDMASSSYLFQSMQAERAASNTNNQTARHVLKLQASFPRNGQQPVRSLS-  462

Query  266  PNGSHASPYRQFSQNSPKPNGK  201
             NGS  SPY Q    SPKPNGK
Sbjct  463  -NGSLPSPYHQ----SPKPNGK  479



>ref|XP_008808474.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X3 [Phoenix dactylifera]
Length=482

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 109/142 (77%), Gaps = 13/142 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRF+RL+DPRL+G+FS+KGAQKAAQLA  CLSRDPKARP+MSEV
Sbjct  345  GEHNLVEWARPHLGERRRFFRLVDPRLDGNFSVKGAQKAAQLAHACLSRDPKARPLMSEV  404

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNG-------IVFSKNGQQNPRSLSI  267
            VE LKPL NLKDMASSSY FQ+MQA+R AS+ N +           F +NGQQ  RSLS 
Sbjct  405  VEVLKPLINLKDMASSSYLFQSMQAERAASNTNNQTARHVLKLQASFPRNGQQPVRSLS-  463

Query  266  PNGSHASPYRQFSQNSPKPNGK  201
             NGS  SPY Q    SPKPNGK
Sbjct  464  -NGSLPSPYHQ----SPKPNGK  480



>ref|XP_008808442.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008808449.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Phoenix dactylifera]
Length=506

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 109/142 (77%), Gaps = 13/142 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRF+RL+DPRL+G+FS+KGAQKAAQLA  CLSRDPKARP+MSEV
Sbjct  369  GEHNLVEWARPHLGERRRFFRLVDPRLDGNFSVKGAQKAAQLAHACLSRDPKARPLMSEV  428

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNG-------IVFSKNGQQNPRSLSI  267
            VE LKPL NLKDMASSSY FQ+MQA+R AS+ N +           F +NGQQ  RSLS 
Sbjct  429  VEVLKPLINLKDMASSSYLFQSMQAERAASNTNNQTARHVLKLQASFPRNGQQPVRSLS-  487

Query  266  PNGSHASPYRQFSQNSPKPNGK  201
             NGS  SPY Q    SPKPNGK
Sbjct  488  -NGSLPSPYHQ----SPKPNGK  504



>ref|XP_008808456.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Phoenix dactylifera]
 ref|XP_008808466.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Phoenix dactylifera]
Length=505

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 109/142 (77%), Gaps = 13/142 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRF+RL+DPRL+G+FS+KGAQKAAQLA  CLSRDPKARP+MSEV
Sbjct  368  GEHNLVEWARPHLGERRRFFRLVDPRLDGNFSVKGAQKAAQLAHACLSRDPKARPLMSEV  427

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNG-------IVFSKNGQQNPRSLSI  267
            VE LKPL NLKDMASSSY FQ+MQA+R AS+ N +           F +NGQQ  RSLS 
Sbjct  428  VEVLKPLINLKDMASSSYLFQSMQAERAASNTNNQTARHVLKLQASFPRNGQQPVRSLS-  486

Query  266  PNGSHASPYRQFSQNSPKPNGK  201
             NGS  SPY Q    SPKPNGK
Sbjct  487  -NGSLPSPYHQ----SPKPNGK  503



>dbj|BAJ91316.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=455

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 111/141 (79%), Gaps = 12/141 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L E+RRFYRL+DPRLEG+FSIKGAQK AQLA  CLSRDPKARP+MS+V
Sbjct  319  GEHNLVEWARPYLGERRRFYRLVDPRLEGNFSIKGAQKTAQLAHACLSRDPKARPLMSQV  378

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIAS--SPNTKNGI----VFSKNGQQNPRSLSIP  264
            VE LKPLPNLKDMASSSY+FQ+M+ +R AS  +PN    +     F++NG Q  RSLS  
Sbjct  379  VEVLKPLPNLKDMASSSYFFQSMRQERAASLNNPNGSQSMKAQSTFARNGVQPMRSLSY-  437

Query  263  NGSHASPYRQFSQNSPKPNGK  201
             G HASPYRQ    SP+PNGK
Sbjct  438  -GPHASPYRQ----SPRPNGK  453



>ref|XP_006842103.1| hypothetical protein AMTR_s00078p00087780 [Amborella trichopoda]
 gb|ERN03778.1| hypothetical protein AMTR_s00078p00087780 [Amborella trichopoda]
Length=473

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 111/137 (81%), Gaps = 6/137 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEGHFSIKGAQKAAQLA  CLSRDPKARP+MSEV
Sbjct  339  GEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAYHCLSRDPKARPLMSEV  398

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRI-ASSPNTKNGIVFS-KNGQQNPRSLSIPNGSH  252
            VEAL+PL NLKDMASSS+ +Q +QA+R  A++  T++   ++ KNGQQ  RSLS  +  H
Sbjct  399  VEALQPLLNLKDMASSSFNYQAIQAERAGANNGRTQHAAHYALKNGQQPARSLSNGSHYH  458

Query  251  ASPYRQFSQNSPKPNGK  201
             SPYRQ    SPKPNGK
Sbjct  459  PSPYRQ----SPKPNGK  471



>emb|CDX70589.1| BnaC03g06730D [Brassica napus]
Length=504

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 110/140 (79%), Gaps = 7/140 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRFYRL+DPRLEGHFSIKGAQK  QLAA+CLSRDPK RP MS+V
Sbjct  363  GEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSIKGAQKVTQLAAQCLSRDPKIRPKMSDV  422

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRI--ASSPNTKNGIVF-SKNGQQNP--RSLSIPN  261
            VEALKPLP+LKDMASSSYYFQTMQA+R+   S  +   G  F S+NGQ  P  R+LS P+
Sbjct  423  VEALKPLPHLKDMASSSYYFQTMQAERLKNGSGRSQGGGNGFGSRNGQPQPVFRTLSSPH  482

Query  260  GSH-ASPYRQFSQNSPKPNG  204
            G H +SPYR     SPKP G
Sbjct  483  GQHGSSPYRH-QVPSPKPKG  501



>emb|CDM83073.1| unnamed protein product [Triticum aestivum]
Length=477

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 111/141 (79%), Gaps = 12/141 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L E+RRFYRL+DPRLEG+FSIKGAQK AQLA  CLSRDPKARP+MS+V
Sbjct  341  GEHNLVEWARPYLGERRRFYRLVDPRLEGNFSIKGAQKTAQLAHACLSRDPKARPLMSQV  400

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIAS--SPNTKNGI----VFSKNGQQNPRSLSIP  264
            VE LKPLPNLKDMASSSY+FQ+M+ +R AS  +PN    +     F++NG Q  RSLS  
Sbjct  401  VEVLKPLPNLKDMASSSYFFQSMRQERAASLGNPNGSQSMKAQSTFARNGVQPMRSLSY-  459

Query  263  NGSHASPYRQFSQNSPKPNGK  201
             G HASPYRQ    SP+PNGK
Sbjct  460  -GPHASPYRQ----SPRPNGK  475



>ref|XP_008230745.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Prunus 
mume]
Length=478

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 106/137 (77%), Gaps = 6/137 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEWARPHL ++RRFYRL+DPRLEG FSIKGAQKA QLAARCLSRDPKARP+MSEV
Sbjct  339  GEVNLVEWARPHLGDRRRFYRLVDPRLEGRFSIKGAQKALQLAARCLSRDPKARPLMSEV  398

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNG----IVFSKNGQQNPRSLSIPNG  258
            VE LKPLP LKDMASSS YFQ +Q +R  S+PN++NG       S+NGQ   RS S+PNG
Sbjct  399  VEVLKPLPTLKDMASSSSYFQALQVERPGSNPNSRNGSRGQAGVSRNGQPT-RSRSMPNG  457

Query  257  SHASPYR-QFSQNSPKP  210
             HASPY       SPKP
Sbjct  458  PHASPYHLNHPHRSPKP  474



>gb|KJB40826.1| hypothetical protein B456_007G078700 [Gossypium raimondii]
Length=476

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 108/141 (77%), Gaps = 8/141 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRF+R++DPRLEGHFSIKGA KA QLAA+CLSRDPKARP MSEV
Sbjct  336  GEHNLVEWARPHLGDKRRFFRILDPRLEGHFSIKGALKAVQLAAQCLSRDPKARPRMSEV  395

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNT-KNGI-----VFSKNGQQNPRSLSIP  264
            VE LKPLPNL DMASSSYYFQTMQ+DR  SS  T KNGI       ++NGQ   RSLS  
Sbjct  396  VETLKPLPNLNDMASSSYYFQTMQSDRSRSSNITAKNGIRVQAGFVTRNGQPM-RSLSSL  454

Query  263  NGSHASPYRQFSQNSPKPNGK  201
            NG  ASP+ Q    SPKP  K
Sbjct  455  NGPQASPFHQHPP-SPKPKAK  474



>gb|KJB40825.1| hypothetical protein B456_007G078700 [Gossypium raimondii]
Length=475

 Score =   182 bits (461),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 108/141 (77%), Gaps = 8/141 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRF+R++DPRLEGHFSIKGA KA QLAA+CLSRDPKARP MSEV
Sbjct  335  GEHNLVEWARPHLGDKRRFFRILDPRLEGHFSIKGALKAVQLAAQCLSRDPKARPRMSEV  394

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNT-KNGI-----VFSKNGQQNPRSLSIP  264
            VE LKPLPNL DMASSSYYFQTMQ+DR  SS  T KNGI       ++NGQ   RSLS  
Sbjct  395  VETLKPLPNLNDMASSSYYFQTMQSDRSRSSNITAKNGIRVQAGFVTRNGQPM-RSLSSL  453

Query  263  NGSHASPYRQFSQNSPKPNGK  201
            NG  ASP+ Q    SPKP  K
Sbjct  454  NGPQASPFHQHPP-SPKPKAK  473



>gb|AAL14379.1| AT3g01300/T22N4_7 [Arabidopsis thaliana]
Length=184

 Score =   174 bits (440),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 106/136 (78%), Gaps = 3/136 (2%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRFYRL+DPRLEGHFS+KGAQK  QLAA+CLSRD K RP MSEV
Sbjct  47   GEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSVKGAQKVTQLAAQCLSRDSKIRPKMSEV  106

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRI-ASSPNTKNGIVFSKNGQQNPRSLSIPNG-SH  252
            VE LKPLP+LKDMAS+SYYFQTMQA+R+ A S +       S+NGQ   R+LS P+G + 
Sbjct  107  VEVLKPLPHLKDMASASYYFQTMQAERLKAGSGSGSGRGFGSRNGQPVFRTLSSPHGQAG  166

Query  251  ASPYRQFSQNSPKPNG  204
            +SPYR     SPKP G
Sbjct  167  SSPYRH-QIPSPKPKG  181



>ref|XP_009335822.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Pyrus 
x bretschneideri]
Length=476

 Score =   181 bits (460),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 106/139 (76%), Gaps = 6/139 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN V+WAR    +KRR ++LIDPRLEGHFSIKGAQKA QLAA CLSRDPKARPMMSEV
Sbjct  339  GEHNLVQWARQLFGDKRRLFQLIDPRLEGHFSIKGAQKAVQLAAHCLSRDPKARPMMSEV  398

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VEALKPLPNLKDMASSSY+FQT+QA R  S  + KNGI    VF     Q  RSLS PNG
Sbjct  399  VEALKPLPNLKDMASSSYHFQTIQAARSRSHSSYKNGIRTQAVFMPRNGQPVRSLSSPNG  458

Query  257  SHASPYRQFSQNSPKPNGK  201
              ASPY  + + SPKPN K
Sbjct  459  PPASPY--YPRKSPKPNSK  475



>ref|XP_008379338.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Malus 
domestica]
Length=478

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 109/137 (80%), Gaps = 8/137 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +++RFYRLIDPRLEGHFSIKGAQKA  LAARCLSRDPKARP+MSEV
Sbjct  338  GEHNLVEWARPHLGDRQRFYRLIDPRLEGHFSIKGAQKAFHLAARCLSRDPKARPLMSEV  397

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNG----IVFSKNGQQNPRSLSIPNG  258
            VE LKPLP+L DMA SSYY+Q +QA    S+PN++NG    +  S+NGQ   R+ S+PNG
Sbjct  398  VEVLKPLPDLNDMARSSYYYQALQAP--GSNPNSRNGGRGLVRVSRNGQPT-RTRSMPNG  454

Query  257  SHASPYRQFSQN-SPKP  210
             HASP+  +  N SP+P
Sbjct  455  PHASPFHLYHLNRSPRP  471



>ref|XP_008357761.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Malus 
domestica]
Length=478

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 109/137 (80%), Gaps = 8/137 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +++RFYRLIDPRLEGHFSIKGAQKA  LAARCLSRDPKARP+MSEV
Sbjct  338  GEHNLVEWARPHLGDRQRFYRLIDPRLEGHFSIKGAQKAFHLAARCLSRDPKARPLMSEV  397

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNG----IVFSKNGQQNPRSLSIPNG  258
            VE LKPLP+L DMA SSYY+Q +QA    S+PN++NG    +  S+NGQ   R+ S+PNG
Sbjct  398  VEVLKPLPDLNDMARSSYYYQALQAP--GSNPNSRNGGRGLVRVSRNGQPT-RTRSMPNG  454

Query  257  SHASPYRQFSQN-SPKP  210
             HASP+  +  N SP+P
Sbjct  455  PHASPFHLYHLNRSPRP  471



>ref|XP_009386615.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009386616.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Musa 
acuminata subsp. malaccensis]
Length=487

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 110/142 (77%), Gaps = 13/142 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL E+RRFYRLIDPRLEG+FS+KGAQK +QLA  CLSRD KARPMMSEV
Sbjct  352  GEHNLVEWARPHLGERRRFYRLIDPRLEGNFSVKGAQKVSQLAYACLSRDSKARPMMSEV  411

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNT---KNGI----VFSKNGQQNPRSLSI  267
            VEALKPL NLKDMASSSY+FQTMQ +R  +  N+   +NG      F +NGQQ  RSLS 
Sbjct  412  VEALKPLVNLKDMASSSYFFQTMQTERAMAHSNSLGARNGSKLQGSFGRNGQQPMRSLS-  470

Query  266  PNGSHASPYRQFSQNSPKPNGK  201
             +G+HAS Y Q    SPKP+G+
Sbjct  471  -HGAHASSYHQ----SPKPSGR  487



>ref|XP_009400522.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Musa 
acuminata subsp. malaccensis]
Length=486

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 111/142 (78%), Gaps = 13/142 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L E+RRFYRLIDPRLEG+FSIKGAQKA+QLA  CLSRDPKARP+MSEV
Sbjct  351  GEHNLVEWARPNLRERRRFYRLIDPRLEGNFSIKGAQKASQLAHACLSRDPKARPLMSEV  410

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNT---KNGI----VFSKNGQQNPRSLSI  267
            VE LKPL NLKDMASSSY+FQTMQ +R  +  N+   +NG+     F +NGQ   RSLS 
Sbjct  411  VEVLKPLINLKDMASSSYFFQTMQTERTMAHSNSVGARNGMKPQGSFGRNGQPPTRSLS-  469

Query  266  PNGSHASPYRQFSQNSPKPNGK  201
             +G+HASPY Q    SPKPN +
Sbjct  470  -HGAHASPYHQ----SPKPNAR  486



>gb|EMT24219.1| Protein kinase APK1A, chloroplastic [Aegilops tauschii]
Length=421

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 110/141 (78%), Gaps = 12/141 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L E+RRFYRL+DPRLEG+FSIKGAQK AQLA  CLSRDPKARP+MS+V
Sbjct  285  GEHNLVEWARPYLGERRRFYRLVDPRLEGNFSIKGAQKTAQLAHACLSRDPKARPLMSQV  344

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIAS--SPNTKNGI----VFSKNGQQNPRSLSIP  264
            VE LKPLPNLKDMASSSY+FQ+M+ +R AS  +PN    +     F++NG Q  RSLS  
Sbjct  345  VEVLKPLPNLKDMASSSYFFQSMRQERAASLGNPNGSQSMKAQSTFARNGVQPMRSLSY-  403

Query  263  NGSHASPYRQFSQNSPKPNGK  201
             G HASPYRQ    SP+PN K
Sbjct  404  -GPHASPYRQ----SPRPNDK  419



>ref|XP_002871647.1| hypothetical protein ARALYDRAFT_909477 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47906.1| hypothetical protein ARALYDRAFT_909477 [Arabidopsis lyrata subsp. 
lyrata]
Length=502

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 108/139 (78%), Gaps = 6/139 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRFYRL+DPRLEGHFSIKGAQK  QLAA+CLSRDPK RP MS+V
Sbjct  362  GEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSIKGAQKVTQLAAQCLSRDPKIRPKMSDV  421

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIAS--SPNTKNGIVFSKNGQQNP--RSLSIPNG  258
            VEALKPLP+LKDMASSSYYFQTMQA+R+ +    +       S+NGQ  P  R+LS P+G
Sbjct  422  VEALKPLPHLKDMASSSYYFQTMQAERLKNGSGRSQGGSGFGSRNGQHQPVFRTLSSPHG  481

Query  257  SH-ASPYRQFSQNSPKPNG  204
             H +SPYR     SPKP G
Sbjct  482  QHGSSPYRH-QIPSPKPKG  499



>ref|XP_003569281.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Brachypodium 
distachyon]
Length=480

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 109/141 (77%), Gaps = 12/141 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L E+RRFYRL+DPRLEG+FSIKGAQK AQLA  CLSRDPK RP+MS+V
Sbjct  344  GEHNLVEWARPYLGERRRFYRLVDPRLEGNFSIKGAQKTAQLAHACLSRDPKVRPLMSQV  403

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIAS------SPNTKNGIVFSKNGQQNPRSLSIP  264
            VE LKPLPNLKDMASSSY+FQ+M+ +R AS      S + K    F++NG Q  RSLS  
Sbjct  404  VEILKPLPNLKDMASSSYFFQSMRQERGASLVNQNGSQSMKAQSTFARNGVQPMRSLSY-  462

Query  263  NGSHASPYRQFSQNSPKPNGK  201
             G HASPYRQ    SP+PNGK
Sbjct  463  -GPHASPYRQ----SPRPNGK  478



>ref|XP_010420160.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Camelina 
sativa]
Length=511

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 109/139 (78%), Gaps = 6/139 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRFYRL+DPRLEGHFSIKGAQK  QLAA+CLSRDPK RP MS+V
Sbjct  371  GEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSIKGAQKVTQLAAQCLSRDPKIRPKMSDV  430

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRI--ASSPNTKNGIVFSKNGQQNP--RSLSIPNG  258
            VEALKPLP+LKDMAS+SYYFQTMQA+R+   S  +       S+NGQQ P  R+LS P+G
Sbjct  431  VEALKPLPHLKDMASASYYFQTMQAERLKNGSGRSQGGSGFGSRNGQQQPVFRTLSSPHG  490

Query  257  SH-ASPYRQFSQNSPKPNG  204
             H +SP+R     SPKP G
Sbjct  491  QHGSSPFRH-QIPSPKPKG  508



>ref|XP_010492331.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Camelina 
sativa]
Length=509

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 109/139 (78%), Gaps = 6/139 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRFYRL+DPRLEGHFSIKGAQK  QLAA+CLSRDPK RP MS+V
Sbjct  369  GEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSIKGAQKVTQLAAQCLSRDPKIRPKMSDV  428

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRI--ASSPNTKNGIVFSKNGQQNP--RSLSIPNG  258
            VEALKPLP+LKDMAS+SYYFQTMQA+R+   S  +       S+NGQQ P  R+LS P+G
Sbjct  429  VEALKPLPHLKDMASASYYFQTMQAERLKNGSGRSQGGSGFGSRNGQQQPVFRTLSSPHG  488

Query  257  SH-ASPYRQFSQNSPKPNG  204
             H +SP+R     SPKP G
Sbjct  489  QHGSSPFRH-QIPSPKPKG  506



>ref|XP_004489164.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X1 [Cicer arietinum]
Length=476

 Score =   179 bits (454),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 108/139 (78%), Gaps = 7/139 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L ++R  +++IDPRLEGHFSIKGAQK+AQLAA+CLSRDPK RPMMS+V
Sbjct  340  GEHNLVEWARPVLGDRRLLFQIIDPRLEGHFSIKGAQKSAQLAAQCLSRDPKVRPMMSQV  399

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            V+ALKPL NLKDMA +SY+FQ ++ DR  S PN+KN +       S+ GQ   R LS PN
Sbjct  400  VQALKPLQNLKDMAIASYHFQVVRVDRTMSMPNSKNSMQKQLTSLSRKGQP-VRILSSPN  458

Query  260  GSHASPYRQFSQNSPKPNG  204
            G H SPYR +++ SPKPNG
Sbjct  459  GQHGSPYRHYTK-SPKPNG  476



>ref|XP_007032485.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY03411.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
Length=474

 Score =   179 bits (453),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 101/138 (73%), Gaps = 5/138 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L E+RRFYRLIDPRLEG FSIKGAQKA QLAA CL RDPKARP+MSEV
Sbjct  333  GEHNLVEWARPYLGERRRFYRLIDPRLEGRFSIKGAQKAIQLAAHCLGRDPKARPLMSEV  392

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNG----IVFSKNGQQNPRSLSIPNG  258
            VEALKPLPNLKDMA SS +FQ +Q +R+ SS  ++ G       S    Q  RSLS PNG
Sbjct  393  VEALKPLPNLKDMACSSSHFQAIQIERVGSSSKSRTGSRVQAGLSIRDGQPTRSLSTPNG  452

Query  257  SHASPYR-QFSQNSPKPN  207
             H SPY       SPKPN
Sbjct  453  PHVSPYHNNHLHRSPKPN  470



>ref|XP_004489165.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X2 [Cicer arietinum]
Length=475

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 108/139 (78%), Gaps = 7/139 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L ++R  +++IDPRLEGHFSIKGAQK+AQLAA+CLSRDPK RPMMS+V
Sbjct  339  GEHNLVEWARPVLGDRRLLFQIIDPRLEGHFSIKGAQKSAQLAAQCLSRDPKVRPMMSQV  398

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            V+ALKPL NLKDMA +SY+FQ ++ DR  S PN+KN +       S+ GQ   R LS PN
Sbjct  399  VQALKPLQNLKDMAIASYHFQVVRVDRTMSMPNSKNSMQKQLTSLSRKGQP-VRILSSPN  457

Query  260  GSHASPYRQFSQNSPKPNG  204
            G H SPYR +++ SPKPNG
Sbjct  458  GQHGSPYRHYTK-SPKPNG  475



>ref|XP_007032484.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY03410.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=489

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 101/138 (73%), Gaps = 5/138 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L E+RRFYRLIDPRLEG FSIKGAQKA QLAA CL RDPKARP+MSEV
Sbjct  348  GEHNLVEWARPYLGERRRFYRLIDPRLEGRFSIKGAQKAIQLAAHCLGRDPKARPLMSEV  407

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNG----IVFSKNGQQNPRSLSIPNG  258
            VEALKPLPNLKDMA SS +FQ +Q +R+ SS  ++ G       S    Q  RSLS PNG
Sbjct  408  VEALKPLPNLKDMACSSSHFQAIQIERVGSSSKSRTGSRVQAGLSIRDGQPTRSLSTPNG  467

Query  257  SHASPYR-QFSQNSPKPN  207
             H SPY       SPKPN
Sbjct  468  PHVSPYHNNHLHRSPKPN  485



>gb|EAZ12511.1| hypothetical protein OsJ_02407 [Oryza sativa Japonica Group]
Length=456

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 108/139 (78%), Gaps = 12/139 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L E+RRFYRL+DPRLEG+FSI+GAQK AQLA  CL+RDPKARP+MS+V
Sbjct  319  GEHNLVEWARPYLGERRRFYRLVDPRLEGNFSIRGAQKTAQLACACLNRDPKARPLMSQV  378

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIAS------SPNTKNGIVFSKNGQQNPRSLSIP  264
            VE LKPL NLKDMASSSY+FQ+MQ +R AS      S + K    F++NGQQ  RSLS  
Sbjct  379  VEVLKPLLNLKDMASSSYFFQSMQQERAASLGNPIGSQSMKAQGTFARNGQQPMRSLSY-  437

Query  263  NGSHASPYRQFSQNSPKPN  207
             G HASPYRQ    SP+PN
Sbjct  438  -GPHASPYRQ----SPRPN  451



>ref|XP_003621108.1| Protein kinase 2B [Medicago truncatula]
Length=478

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 106/137 (77%), Gaps = 7/137 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E+R  +++IDPRLEGHFS+KGAQK+AQLAA+CL+RDPKARPMMSEV
Sbjct  341  GEHNLVEWARPVLGERRLLFQIIDPRLEGHFSVKGAQKSAQLAAQCLNRDPKARPMMSEV  400

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            V+ALKPL NLKDMA +SY+FQ ++ DR  S PN+KNG        SK GQ   R LS PN
Sbjct  401  VQALKPLQNLKDMAIASYHFQVVRVDRTMSMPNSKNGTQTQVASLSKKGQPM-RILSSPN  459

Query  260  GSHASPYRQFSQNSPKP  210
            G H SPYR + + SPKP
Sbjct  460  GQHGSPYRHYIK-SPKP  475



>gb|AES77326.2| receptor-like kinase plant [Medicago truncatula]
Length=477

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 106/137 (77%), Gaps = 7/137 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E+R  +++IDPRLEGHFS+KGAQK+AQLAA+CL+RDPKARPMMSEV
Sbjct  340  GEHNLVEWARPVLGERRLLFQIIDPRLEGHFSVKGAQKSAQLAAQCLNRDPKARPMMSEV  399

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            V+ALKPL NLKDMA +SY+FQ ++ DR  S PN+KNG        SK GQ   R LS PN
Sbjct  400  VQALKPLQNLKDMAIASYHFQVVRVDRTMSMPNSKNGTQTQVASLSKKGQPM-RILSSPN  458

Query  260  GSHASPYRQFSQNSPKP  210
            G H SPYR + + SPKP
Sbjct  459  GQHGSPYRHYIK-SPKP  474



>ref|XP_006646050.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
[Oryza brachyantha]
Length=443

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 107/139 (77%), Gaps = 12/139 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L E+RRFYRL+DPRLEG+FSIKGAQK AQLA  CLSRDPKARP+MS+V
Sbjct  308  GEHNLVEWARPYLGERRRFYRLVDPRLEGNFSIKGAQKTAQLAHACLSRDPKARPLMSQV  367

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIAS------SPNTKNGIVFSKNGQQNPRSLSIP  264
            VE LKPL NLKDMA+SSY+FQ+MQ +R AS      S + K    F++NGQQ  RSLS  
Sbjct  368  VEVLKPLVNLKDMANSSYFFQSMQQERAASLGHPTGSQSMKAQSTFARNGQQPMRSLSY-  426

Query  263  NGSHASPYRQFSQNSPKPN  207
             G HASPYRQ    SP+P 
Sbjct  427  -GPHASPYRQ----SPRPG  440



>ref|NP_001043435.1| Os01g0588500 [Oryza sativa Japonica Group]
 dbj|BAB89924.1| putative serine/threonine-specific protein kinase NAK [Oryza 
sativa Japonica Group]
 dbj|BAF05349.1| Os01g0588500 [Oryza sativa Japonica Group]
 dbj|BAG95848.1| unnamed protein product [Oryza sativa Japonica Group]
Length=494

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 108/139 (78%), Gaps = 12/139 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L E+RRFYRL+DPRLEG+FSI+GAQK AQLA  CL+RDPKARP+MS+V
Sbjct  357  GEHNLVEWARPYLGERRRFYRLVDPRLEGNFSIRGAQKTAQLACACLNRDPKARPLMSQV  416

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIAS------SPNTKNGIVFSKNGQQNPRSLSIP  264
            VE LKPL NLKDMASSSY+FQ+MQ +R AS      S + K    F++NGQQ  RSLS  
Sbjct  417  VEVLKPLLNLKDMASSSYFFQSMQQERAASLGNPIGSQSMKAQGTFARNGQQPMRSLSY-  475

Query  263  NGSHASPYRQFSQNSPKPN  207
             G HASPYRQ    SP+PN
Sbjct  476  -GPHASPYRQ----SPRPN  489



>ref|XP_008357756.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Malus domestica]
Length=476

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 103/139 (74%), Gaps = 6/139 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWAR    +K+R ++LIDPRLEGHFSIKGAQKA QLAA CLSRDPKARPMMSEV
Sbjct  339  GEHNLVEWARQRFGDKKRLFQLIDPRLEGHFSIKGAQKAVQLAAHCLSRDPKARPMMSEV  398

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VE LKPL NLKDMASSSY+FQTMQ  R  S  ++KNGI    VF     Q  RSLS PNG
Sbjct  399  VEVLKPLQNLKDMASSSYHFQTMQEARSRSHSSSKNGIRTQPVFMPRNGQPVRSLSSPNG  458

Query  257  SHASPYRQFSQNSPKPNGK  201
              ASPY  +   SPKPN K
Sbjct  459  PPASPY--YPGKSPKPNSK  475



>ref|XP_008357757.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Malus domestica]
Length=475

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 103/139 (74%), Gaps = 6/139 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWAR    +K+R ++LIDPRLEGHFSIKGAQKA QLAA CLSRDPKARPMMSEV
Sbjct  338  GEHNLVEWARQRFGDKKRLFQLIDPRLEGHFSIKGAQKAVQLAAHCLSRDPKARPMMSEV  397

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VE LKPL NLKDMASSSY+FQTMQ  R  S  ++KNGI    VF     Q  RSLS PNG
Sbjct  398  VEVLKPLQNLKDMASSSYHFQTMQEARSRSHSSSKNGIRTQPVFMPRNGQPVRSLSSPNG  457

Query  257  SHASPYRQFSQNSPKPNGK  201
              ASPY  +   SPKPN K
Sbjct  458  PPASPY--YPGKSPKPNSK  474



>gb|EAY74738.1| hypothetical protein OsI_02628 [Oryza sativa Indica Group]
Length=494

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 108/139 (78%), Gaps = 12/139 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L E+RRFYRL+DPRLEG+FSI+GAQK AQLA  CL+RDPKARP+MS+V
Sbjct  357  GEHNLVEWARPYLGERRRFYRLVDPRLEGNFSIRGAQKTAQLACACLNRDPKARPLMSQV  416

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIAS------SPNTKNGIVFSKNGQQNPRSLSIP  264
            VE LKPL NLKDMASSSY+FQ+MQ +R AS      S + K    F++NGQQ  RSLS  
Sbjct  417  VEVLKPLLNLKDMASSSYFFQSMQQERAASLGNPIGSQSMKAQGTFARNGQQPMRSLSY-  475

Query  263  NGSHASPYRQFSQNSPKPN  207
             G HASPYRQ    SP+PN
Sbjct  476  -GPHASPYRQ----SPRPN  489



>ref|XP_010485514.1| PREDICTED: receptor-like serine/threonine-protein kinase At3g01300 
isoform X1 [Camelina sativa]
 ref|XP_010485515.1| PREDICTED: receptor-like serine/threonine-protein kinase At3g01300 
isoform X2 [Camelina sativa]
Length=491

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 107/136 (79%), Gaps = 3/136 (2%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRFYRL+DPRLEGHFS+KGAQK  QLAA+CLSRDPK RP MSEV
Sbjct  354  GEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSVKGAQKVTQLAAKCLSRDPKIRPKMSEV  413

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRI-ASSPNTKNGIVFSKNGQQNPRSLSIPNG-SH  252
            VE LKPLP+LKDMAS+SYYFQTMQA+R+ + S +       S+NGQ   R+LS P+G + 
Sbjct  414  VEILKPLPHLKDMASTSYYFQTMQAERLKSVSGSGSGRGFGSRNGQPVVRTLSSPHGQAG  473

Query  251  ASPYRQFSQNSPKPNG  204
            +SPYR     SPKP G
Sbjct  474  SSPYRH-QIPSPKPKG  488



>ref|XP_006286494.1| hypothetical protein CARUB_v10000765mg [Capsella rubella]
 gb|EOA19392.1| hypothetical protein CARUB_v10000765mg [Capsella rubella]
Length=507

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 107/139 (77%), Gaps = 6/139 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRFYRL+DPRLEGHFSIKGAQK  QLAA+CLSRDPK RP MS+V
Sbjct  367  GEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSIKGAQKVTQLAAQCLSRDPKIRPKMSDV  426

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRI--ASSPNTKNGIVFSKNGQQNP--RSLSIPNG  258
            V ALKPLP+LKDMASSSYYFQTMQA+R+   S  +       S+NGQ  P  R+LS P+G
Sbjct  427  VGALKPLPHLKDMASSSYYFQTMQAERLKNGSGRSQGGSGFGSRNGQHQPVFRTLSSPHG  486

Query  257  SH-ASPYRQFSQNSPKPNG  204
             H +SPYR     SPKP G
Sbjct  487  QHGSSPYRH-QIPSPKPKG  504



>ref|XP_010463545.1| PREDICTED: receptor-like serine/threonine-protein kinase At3g01300 
[Camelina sativa]
Length=489

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 108/136 (79%), Gaps = 3/136 (2%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRFYRL+DPRLEGHFS+KGAQK  QLAA+CLSRDPK RP MSEV
Sbjct  352  GEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSVKGAQKVTQLAAKCLSRDPKIRPKMSEV  411

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRI-ASSPNTKNGIVFSKNGQQNPRSLSIPNG-SH  252
            VE LKPLP+LKDMAS+SYYFQTMQA+R+ + S +     + S+NGQ   R+LS P+G + 
Sbjct  412  VEILKPLPHLKDMASTSYYFQTMQAERLKSVSGSGSGRGLGSRNGQPVFRTLSSPHGQAG  471

Query  251  ASPYRQFSQNSPKPNG  204
            +SPYR     SPKP G
Sbjct  472  SSPYRH-QIPSPKPKG  486



>ref|XP_010510371.1| PREDICTED: receptor-like serine/threonine-protein kinase At3g01300 
[Camelina sativa]
Length=491

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 107/136 (79%), Gaps = 3/136 (2%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRFYRL+DPRLEGHFS+KGAQK  QLAA+CLSRDPK RP MSEV
Sbjct  354  GEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSVKGAQKVTQLAAKCLSRDPKIRPKMSEV  413

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRI-ASSPNTKNGIVFSKNGQQNPRSLSIPNG-SH  252
            VE LKPLP+LKDMAS+SYYFQTMQA+R+ + S +       S+NGQ   R+LS P+G + 
Sbjct  414  VEILKPLPHLKDMASTSYYFQTMQAERLKSVSGSGSGRGFGSRNGQPVFRTLSSPHGQAG  473

Query  251  ASPYRQFSQNSPKPNG  204
            +SPYR     SPKP G
Sbjct  474  SSPYRH-QIPSPKPKG  488



>ref|XP_006408482.1| hypothetical protein EUTSA_v10020609mg [Eutrema salsugineum]
 gb|ESQ49935.1| hypothetical protein EUTSA_v10020609mg [Eutrema salsugineum]
Length=487

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 106/136 (78%), Gaps = 3/136 (2%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRFYRL+DPRLEGHFSIKGAQK  QLAA+CLSRD K RP MSEV
Sbjct  350  GEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSIKGAQKVTQLAAQCLSRDSKIRPKMSEV  409

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRI-ASSPNTKNGIVFSKNGQQNPRSLSIPNG-SH  252
            VE LKPLP+LKDMASSSYYFQTMQA+R+ A S +       S+NGQ   R+LS P+G + 
Sbjct  410  VEVLKPLPHLKDMASSSYYFQTMQAERLKAGSGSGSGRGFGSRNGQPVFRTLSSPHGQTG  469

Query  251  ASPYRQFSQNSPKPNG  204
            +SPYR     SPKP G
Sbjct  470  SSPYRH-QIPSPKPKG  484



>ref|XP_007217345.1| hypothetical protein PRUPE_ppa019180mg [Prunus persica]
 gb|EMJ18544.1| hypothetical protein PRUPE_ppa019180mg [Prunus persica]
Length=478

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 104/137 (76%), Gaps = 6/137 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEWARPHL ++RRFYRL+DPRLEG FSIKGAQKA QLAARCLSRDPKARP MSEV
Sbjct  339  GEVNLVEWARPHLGDRRRFYRLVDPRLEGRFSIKGAQKALQLAARCLSRDPKARPQMSEV  398

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNG----IVFSKNGQQNPRSLSIPNG  258
            VE L+PLP LKDMASSS YFQ +Q +R  S+ N++NG       S+NGQ   RS S+PNG
Sbjct  399  VEVLQPLPTLKDMASSSSYFQALQIERPGSNLNSRNGSRGQAGVSRNGQPT-RSRSMPNG  457

Query  257  SHASPYR-QFSQNSPKP  210
             HASPY       SPKP
Sbjct  458  PHASPYHLNHPHRSPKP  474



>dbj|BAD23327.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
Length=326

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 112/142 (79%), Gaps = 13/142 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E++RFY+LIDPRLEG+FS+KGAQKAAQLA  CL+RDPKARP+MS+V
Sbjct  191  GEHNLVEWARPLLGERQRFYKLIDPRLEGNFSVKGAQKAAQLARACLNRDPKARPLMSQV  250

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIA--SSPNTKNGIV-----FSKNGQQNPRSLSI  267
            VE LKPL NLKDMASSSY++QTMQA+R+A  SS N ++  +     F++NGQQ  RSLS 
Sbjct  251  VEVLKPLLNLKDMASSSYFYQTMQAERMAHSSSMNGRSHALKVQGSFARNGQQPMRSLS-  309

Query  266  PNGSHASPYRQFSQNSPKPNGK  201
             +G  ASP+R     SPKPN K
Sbjct  310  -DGPRASPFRY----SPKPNVK  326



>emb|CDY59664.1| BnaCnng35380D [Brassica napus]
Length=479

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 103/135 (76%), Gaps = 14/135 (10%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRFY+L+DPRLEGHFSIKGAQK  QLAA+CLSRDPK RP MS+V
Sbjct  355  GEHNLVEWARPHLLDKRRFYKLLDPRLEGHFSIKGAQKVIQLAAQCLSRDPKVRPKMSDV  414

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNGSH-A  249
            VEALKPLP+LKDMASSSYYFQTMQA+R+      KNG + S +G Q        NG H A
Sbjct  415  VEALKPLPHLKDMASSSYYFQTMQAERL------KNGTLSSPHGSQG------GNGPHGA  462

Query  248  SPYRQFSQNSPKPNG  204
            SPYR     SPKP G
Sbjct  463  SPYRP-QIPSPKPKG  476



>ref|NP_186779.1| receptor-like serine/threonine-protein kinase [Arabidopsis thaliana]
 sp|Q9SRH7.1|Y3130_ARATH RecName: Full=Receptor-like serine/threonine-protein kinase At3g01300 
[Arabidopsis thaliana]
 gb|AAF03496.1|AC010676_6 putative protein kinase [Arabidopsis thaliana]
 gb|AAF26145.1|AC008261_2 putative protein kinase [Arabidopsis thaliana]
 gb|ABI54332.1| At3g01300 [Arabidopsis thaliana]
 gb|AEE73634.1| receptor-like serine/threonine-protein kinase [Arabidopsis thaliana]
Length=490

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 106/136 (78%), Gaps = 3/136 (2%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRFYRL+DPRLEGHFS+KGAQK  QLAA+CLSRD K RP MSEV
Sbjct  353  GEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSVKGAQKVTQLAAQCLSRDSKIRPKMSEV  412

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRI-ASSPNTKNGIVFSKNGQQNPRSLSIPNG-SH  252
            VE LKPLP+LKDMAS+SYYFQTMQA+R+ A S +       S+NGQ   R+LS P+G + 
Sbjct  413  VEVLKPLPHLKDMASASYYFQTMQAERLKAGSGSGSGRGFGSRNGQPVFRTLSSPHGQAG  472

Query  251  ASPYRQFSQNSPKPNG  204
            +SPYR     SPKP G
Sbjct  473  SSPYRH-QIPSPKPKG  487



>gb|AAM64595.1| putative protein kinase [Arabidopsis thaliana]
Length=482

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 106/136 (78%), Gaps = 3/136 (2%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRFYRL+DPRLEGHFS+KGAQK  QLAA+CLSRD K RP MSEV
Sbjct  345  GEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSVKGAQKVTQLAAQCLSRDSKIRPKMSEV  404

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRI-ASSPNTKNGIVFSKNGQQNPRSLSIPNG-SH  252
            VE LKPLP+LKDMAS+SYYFQTMQA+R+ A S +       S+NGQ   R+LS P+G + 
Sbjct  405  VEVLKPLPHLKDMASASYYFQTMQAERLKAGSGSGSGRGFGSRNGQPVFRTLSSPHGQAG  464

Query  251  ASPYRQFSQNSPKPNG  204
            +SPYR     SPKP G
Sbjct  465  SSPYRH-QIPSPKPKG  479



>ref|NP_001062980.1| Os09g0361100 [Oryza sativa Japonica Group]
 dbj|BAF24894.1| Os09g0361100, partial [Oryza sativa Japonica Group]
Length=384

 Score =   172 bits (435),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 112/142 (79%), Gaps = 13/142 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E++RFY+LIDPRLEG+FS+KGAQKAAQLA  CL+RDPKARP+MS+V
Sbjct  249  GEHNLVEWARPLLGERQRFYKLIDPRLEGNFSVKGAQKAAQLARACLNRDPKARPLMSQV  308

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIA--SSPNTKNGIV-----FSKNGQQNPRSLSI  267
            VE LKPL NLKDMASSSY++QTMQA+R+A  SS N ++  +     F++NGQQ  RSLS 
Sbjct  309  VEVLKPLLNLKDMASSSYFYQTMQAERMAHSSSMNGRSHALKVQGSFARNGQQPMRSLS-  367

Query  266  PNGSHASPYRQFSQNSPKPNGK  201
             +G  ASP+R     SPKPN K
Sbjct  368  -DGPRASPFRY----SPKPNVK  384



>ref|XP_007139605.1| hypothetical protein PHAVU_008G043900g [Phaseolus vulgaris]
 gb|ESW11599.1| hypothetical protein PHAVU_008G043900g [Phaseolus vulgaris]
Length=475

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 103/138 (75%), Gaps = 6/138 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L ++R   R+IDPRLEGHFS+KG+QKAAQLAA+CL RDPK+RPMMS+V
Sbjct  340  GEHNLVEWARPVLGDRRMILRIIDPRLEGHFSVKGSQKAAQLAAQCLCRDPKSRPMMSDV  399

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNG----IVFSKNGQQNPRSLSIPNG  258
            V+ALK L NLKDMA S+Y+FQ  + DR  S P +KNG    I  SK GQ   RSLS P G
Sbjct  400  VQALKHLQNLKDMAISTYHFQVARVDRTMSMPTSKNGMQAQITISKKGQP-ARSLSSPKG  458

Query  257  SHASPYRQFSQNSPKPNG  204
             H SPY  + + SPKPNG
Sbjct  459  PHGSPYHHYIK-SPKPNG  475



>ref|XP_006297525.1| hypothetical protein CARUB_v10013549mg [Capsella rubella]
 gb|EOA30423.1| hypothetical protein CARUB_v10013549mg [Capsella rubella]
Length=489

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 106/136 (78%), Gaps = 3/136 (2%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRFYRL+DPRLEGHFS+KGAQK  QLAA+CLSRD K RP MSEV
Sbjct  352  GEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSVKGAQKVTQLAAQCLSRDSKIRPKMSEV  411

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRI-ASSPNTKNGIVFSKNGQQNPRSLSIPNG-SH  252
            VE LKPLP+LKDMAS+SYYFQTMQA+R+ A S +       S+NGQ   R+LS P+G + 
Sbjct  412  VEVLKPLPHLKDMASTSYYFQTMQAERLKAVSGSGSGRGFGSRNGQPVFRTLSSPHGQAG  471

Query  251  ASPYRQFSQNSPKPNG  204
            +SPYR     SPKP G
Sbjct  472  SSPYRH-QIPSPKPKG  486



>ref|XP_007139604.1| hypothetical protein PHAVU_008G043900g [Phaseolus vulgaris]
 gb|ESW11598.1| hypothetical protein PHAVU_008G043900g [Phaseolus vulgaris]
Length=476

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 103/138 (75%), Gaps = 6/138 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L ++R   R+IDPRLEGHFS+KG+QKAAQLAA+CL RDPK+RPMMS+V
Sbjct  341  GEHNLVEWARPVLGDRRMILRIIDPRLEGHFSVKGSQKAAQLAAQCLCRDPKSRPMMSDV  400

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNG----IVFSKNGQQNPRSLSIPNG  258
            V+ALK L NLKDMA S+Y+FQ  + DR  S P +KNG    I  SK GQ   RSLS P G
Sbjct  401  VQALKHLQNLKDMAISTYHFQVARVDRTMSMPTSKNGMQAQITISKKGQP-ARSLSSPKG  459

Query  257  SHASPYRQFSQNSPKPNG  204
             H SPY  + + SPKPNG
Sbjct  460  PHGSPYHHYIK-SPKPNG  476



>ref|XP_004969384.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
[Setaria italica]
Length=483

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 110/141 (78%), Gaps = 12/141 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L E+RRFY+L+DP L+G+FSIKGAQK AQLA  CLSRDPKARP+MS+V
Sbjct  347  GEHNLVEWARPYLGERRRFYKLVDPHLDGNFSIKGAQKTAQLAHACLSRDPKARPLMSQV  406

Query  425  VEALKPLPNLKDMASSSYYFQTMQADR---IAS---SPNTKNGIVFSKNGQQNPRSLSIP  264
            VE LKPL NLKDMAS+SY+FQ+MQ +R   +AS   S + K    F++NGQQ  RSLS  
Sbjct  407  VEVLKPLQNLKDMASTSYFFQSMQHERRTALASPQGSQSMKAQSTFARNGQQPLRSLSY-  465

Query  263  NGSHASPYRQFSQNSPKPNGK  201
             G HASPYRQ    SP+P+GK
Sbjct  466  -GPHASPYRQ----SPRPDGK  481



>ref|XP_007151194.1| hypothetical protein PHAVU_004G026000g [Phaseolus vulgaris]
 gb|ESW23188.1| hypothetical protein PHAVU_004G026000g [Phaseolus vulgaris]
Length=488

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 104/138 (75%), Gaps = 5/138 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L ++R FYR+IDPRLEGHFS+KG QKA QLAA+CLSRDPK+RP+MS+V
Sbjct  352  GEHNLVEWARPVLGDRRMFYRIIDPRLEGHFSVKGVQKAVQLAAQCLSRDPKSRPLMSDV  411

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            V+ALKPLP+LKDMA SSY+FQ  + DR  S PN KNGI    V      Q  R+LS  N 
Sbjct  412  VQALKPLPSLKDMAISSYHFQIARVDRTMSMPNHKNGIRTQLVSVPRKGQAVRTLSSSNV  471

Query  257  SHASPYRQFSQNSPKPNG  204
             H SPY ++++ SPKP G
Sbjct  472  PHGSPYIRYTK-SPKPIG  488



>ref|XP_004956652.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X1 [Setaria italica]
Length=499

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 109/141 (77%), Gaps = 12/141 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E++RFY+LIDPRLEG+FS+KGAQKAAQLA  CLSRDPKARP+MS+V
Sbjct  365  GEHNLVEWARPLLGERQRFYKLIDPRLEGNFSVKGAQKAAQLARACLSRDPKARPLMSQV  424

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKN------GIVFSKNGQQNPRSLSIP  264
            VEALKPL NLKDMASSSY++QTMQA+R+A S +         G   ++NGQQ  RSLS  
Sbjct  425  VEALKPLLNLKDMASSSYFYQTMQAERMAHSSSMNGRTLKSQGPFAARNGQQPVRSLS--  482

Query  263  NGSHASPYRQFSQNSPKPNGK  201
            +G  ASP+R     SPKPN K
Sbjct  483  DGPRASPFRY----SPKPNMK  499



>ref|XP_004956653.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X2 [Setaria italica]
Length=498

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 111/141 (79%), Gaps = 12/141 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E++RFY+LIDPRLEG+FS+KGAQKAAQLA  CLSRDPKARP+MS+V
Sbjct  364  GEHNLVEWARPLLGERQRFYKLIDPRLEGNFSVKGAQKAAQLARACLSRDPKARPLMSQV  423

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIA--SSPNTKN----GIVFSKNGQQNPRSLSIP  264
            VEALKPL NLKDMASSSY++QTMQA+R+A  SS N +     G   ++NGQQ  RSLS  
Sbjct  424  VEALKPLLNLKDMASSSYFYQTMQAERMAHSSSMNGRTLKSQGPFAARNGQQPVRSLS--  481

Query  263  NGSHASPYRQFSQNSPKPNGK  201
            +G  ASP+R     SPKPN K
Sbjct  482  DGPRASPFRY----SPKPNMK  498



>ref|XP_006431137.1| hypothetical protein CICLE_v10011638mg [Citrus clementina]
 gb|ESR44377.1| hypothetical protein CICLE_v10011638mg [Citrus clementina]
Length=476

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 101/134 (75%), Gaps = 2/134 (1%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E+RRFYRLIDPRLEG FSIKGA+K  QLAA CL+RD KARP+MSEV
Sbjct  340  GEHNLVEWARPQLGERRRFYRLIDPRLEGCFSIKGAEKTIQLAASCLNRDQKARPLMSEV  399

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNGSHAS  246
            VEALKPLP LKDMASSS Y Q MQA+R+  + N K+G    + GQ   RSLSIPN  H S
Sbjct  400  VEALKPLPYLKDMASSSSYVQAMQAERVRLNLNAKHGSRVPRKGQPT-RSLSIPNAPHVS  458

Query  245  PYRQFS-QNSPKPN  207
            PY   +   SPKPN
Sbjct  459  PYHLNNPHCSPKPN  472



>gb|ABR18367.1| unknown [Picea sitchensis]
 gb|ABR18465.1| unknown [Picea sitchensis]
Length=484

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 106/144 (74%), Gaps = 12/144 (8%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L EKRR YRLIDPRL+G+FSIKGAQKAAQLA  CLSRDPKARP+MSEV
Sbjct  344  GEHNLVEWARPYLGEKRRLYRLIDPRLDGNFSIKGAQKAAQLACHCLSRDPKARPLMSEV  403

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNG-----IVFSKNGQ---QNPRSLS  270
            VEAL+PL NLKDMASSS+++Q +QA+R +      NG      V   NGQ   +N R   
Sbjct  404  VEALRPLLNLKDMASSSFHYQALQAERSSRQQQLANGNGQLKNVAYLNGQLSSKNGRPRV  463

Query  269  IPNGSHASPYRQFSQNSPKPNGKA  198
            I N SHASPYRQ    SP+ NGK 
Sbjct  464  ITNISHASPYRQ----SPRQNGKG  483



>ref|XP_010108963.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXC20603.1| putative receptor-like protein kinase [Morus notabilis]
Length=488

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 101/138 (73%), Gaps = 6/138 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEWARPHL E+RRFYRL+DPRLEG FS+KGAQKA QLAA CLSRD KARP+MSEV
Sbjct  348  GEQNLVEWARPHLGERRRFYRLLDPRLEGRFSMKGAQKALQLAAHCLSRDQKARPLMSEV  407

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNG----IVFSKNGQQNPRSLSIPNG  258
            VE LKPLP+LKDMASSS YFQ +Q +R  S  N +NG       S+ G    RSLS+ NG
Sbjct  408  VEVLKPLPDLKDMASSSSYFQALQVERGGSGANARNGSRMQTGLSRTGHP-IRSLSVSNG  466

Query  257  SHASPYRQFSQN-SPKPN  207
             HASP     +N SPKP 
Sbjct  467  QHASPCHLNHRNRSPKPG  484



>ref|NP_001150552.1| LOC100284184 [Zea mays]
 gb|ACG39536.1| protein kinase APK1A [Zea mays]
Length=481

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 101/130 (78%), Gaps = 8/130 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L E+RRFY+L+DPRL+G+FSIKGAQK AQLA  CLSRDPKARP+MS+V
Sbjct  345  GEHNLVEWARPYLGERRRFYKLVDPRLDGNFSIKGAQKTAQLAHACLSRDPKARPLMSQV  404

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPN------TKNGIVFSKNGQQNPRSLSIP  264
            VE LKPL NLKDMASSSYYFQ+MQ +R  +  N       K    F++NGQQ  RSLS  
Sbjct  405  VEVLKPLQNLKDMASSSYYFQSMQHERRTALANPYGSQSMKAQSTFARNGQQPMRSLSY-  463

Query  263  NGSHASPYRQ  234
             G HASPYRQ
Sbjct  464  -GPHASPYRQ  472



>ref|XP_010925061.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Elaeis guineensis]
Length=484

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 108/145 (74%), Gaps = 16/145 (11%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E+RRF+RLIDPRL+G+FS+KGAQKAAQLA  CLSRDPK RP+MSEV
Sbjct  344  GEHNLVEWARPQLGERRRFFRLIDPRLDGNFSVKGAQKAAQLAHACLSRDPKIRPLMSEV  403

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNG-------IVFSKNGQQNPRSL--  273
            V+ LKPL NLKDMASSSY+FQ+MQA   A++ N +N          F +NGQQ  RS   
Sbjct  404  VKVLKPLINLKDMASSSYFFQSMQAG--AANTNNQNARHVLKLQASFPRNGQQPVRSQPG  461

Query  272  -SIPNGSHASPYRQFSQNSPKPNGK  201
             S+ NGS  SPYRQ    SPKPNGK
Sbjct  462  RSLSNGSLPSPYRQ----SPKPNGK  482



>gb|ACN35886.1| unknown [Zea mays]
 tpg|DAA58730.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=481

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 101/130 (78%), Gaps = 8/130 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L E+RRFY+L+DPRL+G+FSIKGAQK AQLA  CLSRDPKARP+MS+V
Sbjct  345  GEHNLVEWARPYLGERRRFYKLVDPRLDGNFSIKGAQKTAQLAHACLSRDPKARPLMSQV  404

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPN------TKNGIVFSKNGQQNPRSLSIP  264
            VE LKPL NLKDMASSSYYFQ+MQ +R  +  N       K    F++NGQQ  RSLS  
Sbjct  405  VEVLKPLQNLKDMASSSYYFQSMQHERRTALANPYGSQSMKAQSTFARNGQQPMRSLSY-  463

Query  263  NGSHASPYRQ  234
             G HASPYRQ
Sbjct  464  -GPHASPYRQ  472



>ref|XP_010925062.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Elaeis guineensis]
Length=483

 Score =   172 bits (435),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 108/145 (74%), Gaps = 16/145 (11%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E+RRF+RLIDPRL+G+FS+KGAQKAAQLA  CLSRDPK RP+MSEV
Sbjct  343  GEHNLVEWARPQLGERRRFFRLIDPRLDGNFSVKGAQKAAQLAHACLSRDPKIRPLMSEV  402

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNG-------IVFSKNGQQNPRSL--  273
            V+ LKPL NLKDMASSSY+FQ+MQA   A++ N +N          F +NGQQ  RS   
Sbjct  403  VKVLKPLINLKDMASSSYFFQSMQAG--AANTNNQNARHVLKLQASFPRNGQQPVRSQPG  460

Query  272  -SIPNGSHASPYRQFSQNSPKPNGK  201
             S+ NGS  SPYRQ    SPKPNGK
Sbjct  461  RSLSNGSLPSPYRQ----SPKPNGK  481



>ref|XP_010531802.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Tarenaya hassleriana]
Length=471

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 102/135 (76%), Gaps = 3/135 (2%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEWARPHL +K+RFYRL+DPRLEGHFSIKGAQKA QLAA+CLSRD KARP MS+V
Sbjct  338  GEQNLVEWARPHLLDKKRFYRLLDPRLEGHFSIKGAQKATQLAAQCLSRDSKARPKMSDV  397

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNGSHAS  246
            VEALKPLP LKD ASSSY FQTMQ   + +   T+ G   S+NGQ   RSLS  N    S
Sbjct  398  VEALKPLPGLKDFASSSYSFQTMQP-VVKNGFRTQGGGFVSRNGQP-LRSLSSLNLPQGS  455

Query  245  PYRQFSQNSPKPNGK  201
            PYR  S+ SPKP GK
Sbjct  456  PYRN-SRQSPKPKGK  469



>ref|XP_010531804.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X3 [Tarenaya hassleriana]
Length=470

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 102/135 (76%), Gaps = 3/135 (2%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEWARPHL +K+RFYRL+DPRLEGHFSIKGAQKA QLAA+CLSRD KARP MS+V
Sbjct  337  GEQNLVEWARPHLLDKKRFYRLLDPRLEGHFSIKGAQKATQLAAQCLSRDSKARPKMSDV  396

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNGSHAS  246
            VEALKPLP LKD ASSSY FQTMQ   + +   T+ G   S+NGQ   RSLS  N    S
Sbjct  397  VEALKPLPGLKDFASSSYSFQTMQP-VVKNGFRTQGGGFVSRNGQP-LRSLSSLNLPQGS  454

Query  245  PYRQFSQNSPKPNGK  201
            PYR  S+ SPKP GK
Sbjct  455  PYRN-SRQSPKPKGK  468



>ref|XP_010531801.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Tarenaya hassleriana]
Length=472

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 102/135 (76%), Gaps = 3/135 (2%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEWARPHL +K+RFYRL+DPRLEGHFSIKGAQKA QLAA+CLSRD KARP MS+V
Sbjct  339  GEQNLVEWARPHLLDKKRFYRLLDPRLEGHFSIKGAQKATQLAAQCLSRDSKARPKMSDV  398

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNGSHAS  246
            VEALKPLP LKD ASSSY FQTMQ   + +   T+ G   S+NGQ   RSLS  N    S
Sbjct  399  VEALKPLPGLKDFASSSYSFQTMQP-VVKNGFRTQGGGFVSRNGQP-LRSLSSLNLPQGS  456

Query  245  PYRQFSQNSPKPNGK  201
            PYR  S+ SPKP GK
Sbjct  457  PYRN-SRQSPKPKGK  470



>tpg|DAA58731.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=488

 Score =   172 bits (435),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 101/130 (78%), Gaps = 8/130 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L E+RRFY+L+DPRL+G+FSIKGAQK AQLA  CLSRDPKARP+MS+V
Sbjct  352  GEHNLVEWARPYLGERRRFYKLVDPRLDGNFSIKGAQKTAQLAHACLSRDPKARPLMSQV  411

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPN------TKNGIVFSKNGQQNPRSLSIP  264
            VE LKPL NLKDMASSSYYFQ+MQ +R  +  N       K    F++NGQQ  RSLS  
Sbjct  412  VEVLKPLQNLKDMASSSYYFQSMQHERRTALANPYGSQSMKAQSTFARNGQQPMRSLSY-  470

Query  263  NGSHASPYRQ  234
             G HASPYRQ
Sbjct  471  -GPHASPYRQ  479



>emb|CDP02215.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   172 bits (437),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 105/138 (76%), Gaps = 7/138 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L E+RRFYRLIDPRLEG FSI+GAQKA QLAA CL+RD KARP+MSEV
Sbjct  407  GEHNLVEWARPYLRERRRFYRLIDPRLEGQFSIRGAQKAVQLAAHCLTRDAKARPLMSEV  466

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNG-----IVFSKNGQQNPRSLSIPN  261
            VE LKPLP+LKDMASSS YFQ +QA+R + +   KNG      +  KNGQQNP +LS PN
Sbjct  467  VEVLKPLPDLKDMASSSSYFQALQAERASIAQAIKNGGRVQAALPEKNGQQNP-TLSTPN  525

Query  260  GSHASPYRQFS-QNSPKP  210
               ASP  + +   SPKP
Sbjct  526  RPQASPCHENNLHRSPKP  543



>ref|XP_009121617.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Brassica 
rapa]
Length=517

 Score =   172 bits (435),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 101/134 (75%), Gaps = 3/134 (2%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRFY+L+DPRLEGHFSIKGAQK  QLAA+CLSRDPK RP MS+V
Sbjct  357  GEHNLVEWARPHLLDKRRFYKLLDPRLEGHFSIKGAQKVIQLAAQCLSRDPKVRPKMSDV  416

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFSKNGQQNP--RSLSIPNGSH  252
            VEALKPLP+LKDMASSSYYFQTMQA+R+ +      G   S+ GQ  P  R+LS P+GS 
Sbjct  417  VEALKPLPHLKDMASSSYYFQTMQAERLKNGLGRSQGFG-SRKGQPQPVFRTLSSPHGSQ  475

Query  251  ASPYRQFSQNSPKP  210
                    +  P+P
Sbjct  476  GGNGFGSRKGQPQP  489



>ref|XP_008341552.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Malus domestica]
Length=477

 Score =   171 bits (433),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 8/137 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWA PHL ++RRFYRL+DPR+EG FSIKGAQKA  LAARCLSRDPKARP+MSEV
Sbjct  337  GEHNLVEWAHPHLRDRRRFYRLVDPRIEGRFSIKGAQKAFHLAARCLSRDPKARPLMSEV  396

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNG----IVFSKNGQQNPRSLSIPNG  258
            VE LKPLP+LKDMA SS Y+Q +QA    S+PN++NG       S+NGQ   R+ S+PNG
Sbjct  397  VEVLKPLPDLKDMACSSSYYQALQAP--GSNPNSRNGSRGLAGVSRNGQPT-RTRSMPNG  453

Query  257  SHASPYRQFSQN-SPKP  210
             HASPY     N SP+P
Sbjct  454  PHASPYHLNHLNRSPRP  470



>ref|XP_010550086.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Tarenaya hassleriana]
Length=401

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 104/135 (77%), Gaps = 13/135 (10%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL ++RRFYRL+DPRL+GHFSIKGAQKA QLAA+CLSRDPK RP MS+V
Sbjct  276  GEHNLVEWARPHLLDRRRFYRLLDPRLDGHFSIKGAQKATQLAAQCLSRDPKVRPKMSQV  335

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNGSH-A  249
            VEALKPL  LKDMASSSY+FQ MQADR+      +NG     +G+   R+LS P+G H +
Sbjct  336  VEALKPLWLLKDMASSSYHFQMMQADRL------RNG-----SGRGLGRTLSSPHGPHGS  384

Query  248  SPYRQFSQNSPKPNG  204
            SPYR     SPKP G
Sbjct  385  SPYRH-QLPSPKPKG  398



>ref|XP_009125034.1| PREDICTED: receptor-like serine/threonine-protein kinase At3g01300 
[Brassica rapa]
Length=485

 Score =   171 bits (434),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 104/135 (77%), Gaps = 3/135 (2%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL ++RRFYRL+DPRLEGHFSIKGAQK  QLAA+CLSRD K RP MSEV
Sbjct  350  GEHNLVEWARPHLLDRRRFYRLLDPRLEGHFSIKGAQKVTQLAAQCLSRDSKIRPKMSEV  409

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNG-SHA  249
            VE LKPLP+LKDMASSSYYFQTMQA+R+ +   +      S+NGQ   R+ S P+G + +
Sbjct  410  VEVLKPLPHLKDMASSSYYFQTMQAERLKAGSGSGR-GFGSRNGQLVFRTQSSPHGQAGS  468

Query  248  SPYRQFSQNSPKPNG  204
            SPYR     SPKP G
Sbjct  469  SPYRH-QIPSPKPRG  482



>ref|XP_008341551.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Malus domestica]
Length=478

 Score =   171 bits (433),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 8/137 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWA PHL ++RRFYRL+DPR+EG FSIKGAQKA  LAARCLSRDPKARP+MSEV
Sbjct  338  GEHNLVEWAHPHLRDRRRFYRLVDPRIEGRFSIKGAQKAFHLAARCLSRDPKARPLMSEV  397

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNG----IVFSKNGQQNPRSLSIPNG  258
            VE LKPLP+LKDMA SS Y+Q +QA    S+PN++NG       S+NGQ   R+ S+PNG
Sbjct  398  VEVLKPLPDLKDMACSSSYYQALQAP--GSNPNSRNGSRGLAGVSRNGQPT-RTRSMPNG  454

Query  257  SHASPYRQFSQN-SPKP  210
             HASPY     N SP+P
Sbjct  455  PHASPYHLNHLNRSPRP  471



>ref|NP_001167795.1| uncharacterized LOC100381489 [Zea mays]
 gb|ACN26086.1| unknown [Zea mays]
Length=271

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 110/146 (75%), Gaps = 17/146 (12%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E++RFY+LIDPRLEG+FS+KGAQKAAQLA  CLSRDPKARP+MS+V
Sbjct  132  GEHNLVEWARPLLGERQRFYKLIDPRLEGNFSVKGAQKAAQLARVCLSRDPKARPLMSQV  191

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSP-----NTKNGIV-----FSKNGQQNP-R  279
            VE LKPL NLKDMAS+SY+FQTMQA+R+A S      ++ NG       F ++GQ  P R
Sbjct  192  VEVLKPLQNLKDMASASYFFQTMQAERMAHSSSMNGRSSMNGGFKTQSPFGRHGQPPPVR  251

Query  278  SLSIPNGSHASPYRQFSQNSPKPNGK  201
            SLS  +G  ASP+R     SPKPN K
Sbjct  252  SLS--DGPRASPFRY----SPKPNVK  271



>emb|CDY65043.1| BnaA10g29770D [Brassica napus]
Length=1581

 Score =   176 bits (447),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 106/139 (76%), Gaps = 9/139 (6%)
 Frame = -3

Query  605   GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
             GEHN VEWARPHL +KRRFY+L+DPRLEGHFSIKGAQK  QLAA+CLSRDPK RP MS+V
Sbjct  1444  GEHNLVEWARPHLLDKRRFYKLLDPRLEGHFSIKGAQKVIQLAAQCLSRDPKVRPKMSDV  1503

Query  425   VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFSKNGQQNP-----RSLSIPN  261
             VEALKPLP+LKDMASSSYYFQTMQA+R+ +      G   S+ GQ  P     R++S P+
Sbjct  1504  VEALKPLPHLKDMASSSYYFQTMQAERLKNGLGRSQGF-GSRKGQPQPPQPVFRTMSSPH  1562

Query  260   GSHASPYRQFSQNSPKPNG  204
             G  ASPYR     SPKP G
Sbjct  1563  G--ASPYRP-QIPSPKPKG  1578



>emb|CDY28689.1| BnaCnng05750D [Brassica napus]
Length=487

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 104/135 (77%), Gaps = 3/135 (2%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL ++RRFYRL+DPRLEGHFSIKGAQK  QLAA+CLSRD K RP MSEV
Sbjct  352  GEHNLVEWARPHLLDRRRFYRLLDPRLEGHFSIKGAQKVTQLAAQCLSRDSKIRPKMSEV  411

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNG-SHA  249
            VE LKPLP+LKDMASSSYYFQTMQA+R+ +   +      S+NGQ   R+ S P+G + +
Sbjct  412  VEVLKPLPHLKDMASSSYYFQTMQAERLKAGSGSGR-GFGSRNGQLVFRTQSSPHGQAGS  470

Query  248  SPYRQFSQNSPKPNG  204
            SPYR     +PKP G
Sbjct  471  SPYRH-QVPTPKPKG  484



>ref|XP_002458067.1| hypothetical protein SORBIDRAFT_03g026370 [Sorghum bicolor]
 gb|EES03187.1| hypothetical protein SORBIDRAFT_03g026370 [Sorghum bicolor]
Length=492

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 101/130 (78%), Gaps = 8/130 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L E+RRFY+L+DPRL+G+FSIKGAQK AQLA  CLSRDPKARP+MS+V
Sbjct  356  GEHNLVEWARPYLGERRRFYKLVDPRLDGNFSIKGAQKTAQLAHACLSRDPKARPLMSQV  415

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPN------TKNGIVFSKNGQQNPRSLSIP  264
            VE LKPL NLKDMASSSY+FQ+MQ +R  +  N       K    F++NGQQ  RSLS  
Sbjct  416  VEVLKPLQNLKDMASSSYFFQSMQHERRTTLANPHGSQSMKAQSTFARNGQQPMRSLSY-  474

Query  263  NGSHASPYRQ  234
             G HASPYRQ
Sbjct  475  -GPHASPYRQ  483



>ref|XP_006661159.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
[Oryza brachyantha]
Length=510

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 111/142 (78%), Gaps = 13/142 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E++RFY+LIDPRLEG+FS+KGAQKAAQLA  CLSRDPKARP+MS+V
Sbjct  375  GEHNLVEWARPLLGERQRFYKLIDPRLEGNFSVKGAQKAAQLARACLSRDPKARPLMSQV  434

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIA--SSPNTKNGIV-----FSKNGQQNPRSLSI  267
            VE LKPL NLKDMASSSY++QTMQA+R+A  SS N +N  +     F++N QQ  RSLS 
Sbjct  435  VEVLKPLLNLKDMASSSYFYQTMQAERMAHSSSMNGRNHGLKVQGSFARNSQQPMRSLS-  493

Query  266  PNGSHASPYRQFSQNSPKPNGK  201
             +G  ASP+R     SPKPN K
Sbjct  494  -DGPRASPFRY----SPKPNVK  510



>ref|XP_009147414.1| PREDICTED: receptor-like serine/threonine-protein kinase At3g01300 
[Brassica rapa]
Length=486

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 104/135 (77%), Gaps = 3/135 (2%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEWARPHL ++RRFYRL+DPRLEGHFSIKGAQK  QLAA+CLSRD K RP MSEV
Sbjct  351  GEQNLVEWARPHLLDRRRFYRLLDPRLEGHFSIKGAQKVTQLAAQCLSRDSKIRPKMSEV  410

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNG-SHA  249
            VE LKPLP LKDMASSSYYFQTMQA+R+ +   +    + S+NGQ   R+LS P+G + +
Sbjct  411  VEVLKPLPMLKDMASSSYYFQTMQAERLKAGSGSGR-GLGSRNGQPVLRTLSSPHGQAGS  469

Query  248  SPYRQFSQNSPKPNG  204
            SPYR     SPKP G
Sbjct  470  SPYRH-QIPSPKPKG  483



>emb|CDY37534.1| BnaA05g33990D [Brassica napus]
Length=488

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 104/135 (77%), Gaps = 3/135 (2%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEWARPHL ++RRFYRL+DPRLEGHFSIKGAQK  QLAA+CLSRD K RP MSEV
Sbjct  353  GEQNLVEWARPHLLDRRRFYRLLDPRLEGHFSIKGAQKVTQLAAQCLSRDSKIRPKMSEV  412

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNG-SHA  249
            VE LKPLP LKDMASSSYYFQTMQA+R+ +   +    + S+NGQ   R+LS P+G + +
Sbjct  413  VEVLKPLPLLKDMASSSYYFQTMQAERLKAGSGSGR-GLGSRNGQPVLRTLSSPHGQAGS  471

Query  248  SPYRQFSQNSPKPNG  204
            SPYR     SPKP G
Sbjct  472  SPYRH-QIPSPKPKG  485



>gb|EAZ44450.1| hypothetical protein OsJ_29062 [Oryza sativa Japonica Group]
Length=512

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 112/142 (79%), Gaps = 13/142 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E++RFY+LIDPRLEG+FS+KGAQKAAQLA  CL+RDPKARP+MS+V
Sbjct  377  GEHNLVEWARPLLGERQRFYKLIDPRLEGNFSVKGAQKAAQLARACLNRDPKARPLMSQV  436

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIA--SSPNTKNGIV-----FSKNGQQNPRSLSI  267
            VE LKPL NLKDMASSSY++QTMQA+R+A  SS N ++  +     F++NGQQ  RSLS 
Sbjct  437  VEVLKPLLNLKDMASSSYFYQTMQAERMAHSSSMNGRSHALKVQGSFARNGQQPMRSLS-  495

Query  266  PNGSHASPYRQFSQNSPKPNGK  201
             +G  ASP+R     SPKPN K
Sbjct  496  -DGPRASPFRY----SPKPNVK  512



>ref|XP_010550085.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Tarenaya hassleriana]
Length=471

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 104/135 (77%), Gaps = 13/135 (10%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL ++RRFYRL+DPRL+GHFSIKGAQKA QLAA+CLSRDPK RP MS+V
Sbjct  346  GEHNLVEWARPHLLDRRRFYRLLDPRLDGHFSIKGAQKATQLAAQCLSRDPKVRPKMSQV  405

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNGSH-A  249
            VEALKPL  LKDMASSSY+FQ MQADR+      +NG     +G+   R+LS P+G H +
Sbjct  406  VEALKPLWLLKDMASSSYHFQMMQADRL------RNG-----SGRGLGRTLSSPHGPHGS  454

Query  248  SPYRQFSQNSPKPNG  204
            SPYR     SPKP G
Sbjct  455  SPYRH-QLPSPKPKG  468



>gb|EEC84434.1| hypothetical protein OsI_31048 [Oryza sativa Indica Group]
Length=512

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 112/142 (79%), Gaps = 13/142 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E++RFY+LIDPRLEG+FS+KGAQKAAQLA  CL+RDPKARP+MS+V
Sbjct  377  GEHNLVEWARPLLGERQRFYKLIDPRLEGNFSVKGAQKAAQLARACLNRDPKARPLMSQV  436

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIA--SSPNTKNGIV-----FSKNGQQNPRSLSI  267
            VE LKPL NLKDMASSSY++QTMQA+R+A  SS N ++  +     F++NGQQ  RSLS 
Sbjct  437  VEVLKPLLNLKDMASSSYFYQTMQAERMAHSSSMNGRSHALKVQGSFARNGQQPMRSLS-  495

Query  266  PNGSHASPYRQFSQNSPKPNGK  201
             +G  ASP+R     SPKPN K
Sbjct  496  -DGPRASPFRY----SPKPNVK  512



>dbj|BAK03050.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=497

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 110/144 (76%), Gaps = 15/144 (10%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E++RFY+L+DPRLEG+FS+KGAQKAAQLA  CLSRDPKARP+MS+V
Sbjct  360  GEHNLVEWARPLLGERQRFYKLVDPRLEGNFSVKGAQKAAQLARACLSRDPKARPLMSQV  419

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIA--SSPNTKN-------GIVFSKNGQQNPRSL  273
            VEALKPL NLKDMASSSY++QTMQA+R+A  SS N +N       G     NGQQ  RS+
Sbjct  420  VEALKPLLNLKDMASSSYFYQTMQAERMAHSSSMNGRNSHSLKVHGSFARANGQQPMRSM  479

Query  272  SIPNGSHASPYRQFSQNSPKPNGK  201
            S  +G  ASP+R     SPKPN K
Sbjct  480  S--DGPRASPFRY----SPKPNVK  497



>ref|XP_008341535.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Malus 
domestica]
Length=476

 Score =   169 bits (428),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 104/139 (75%), Gaps = 6/139 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN V+WAR    +KRR ++LIDPRLEGHFSIKGAQKA QLAA CLSRDPKARPMMSEV
Sbjct  339  GEHNLVQWARQLFGDKRRLFQLIDPRLEGHFSIKGAQKAVQLAAHCLSRDPKARPMMSEV  398

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VEALKPL NLKDMASSSY+FQ +QA R  S  ++KNGI    VF     Q  RSLS PNG
Sbjct  399  VEALKPLQNLKDMASSSYHFQNIQAARSRSHSSSKNGIRTQAVFMPRNGQPVRSLSSPNG  458

Query  257  SHASPYRQFSQNSPKPNGK  201
              ASP   + + SPKPN K
Sbjct  459  PPASP--XYPRKSPKPNSK  475



>ref|XP_003534465.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X1 [Glycine max]
 gb|KHN11583.1| Putative receptor-like protein kinase [Glycine soja]
Length=474

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 103/139 (74%), Gaps = 9/139 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L ++R   R+IDPRLEGHFS+KG+QKAAQLAA+CLSRDPK+RPMMSEV
Sbjct  340  GEHNLVEWARPVLGDRRMLLRIIDPRLEGHFSVKGSQKAAQLAAQCLSRDPKSRPMMSEV  399

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            V+ALKPL NLKDMA SSY+FQ  + DR  S P  KNG+       S+ GQ   R LS P 
Sbjct  400  VQALKPLQNLKDMAISSYHFQVARVDRTMSMP--KNGMQAQLASLSRKGQP-VRILSSPK  456

Query  260  GSHASPYRQFSQNSPKPNG  204
            G H SPY  + + SPKPNG
Sbjct  457  GPHGSPYHHYIK-SPKPNG  474



>ref|XP_006587767.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X2 [Glycine max]
Length=473

 Score =   169 bits (427),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 103/139 (74%), Gaps = 9/139 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L ++R   R+IDPRLEGHFS+KG+QKAAQLAA+CLSRDPK+RPMMSEV
Sbjct  339  GEHNLVEWARPVLGDRRMLLRIIDPRLEGHFSVKGSQKAAQLAAQCLSRDPKSRPMMSEV  398

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            V+ALKPL NLKDMA SSY+FQ  + DR  S P  KNG+       S+ GQ   R LS P 
Sbjct  399  VQALKPLQNLKDMAISSYHFQVARVDRTMSMP--KNGMQAQLASLSRKGQP-VRILSSPK  455

Query  260  GSHASPYRQFSQNSPKPNG  204
            G H SPY  + + SPKPNG
Sbjct  456  GPHGSPYHHYIK-SPKPNG  473



>ref|XP_009347056.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Pyrus x bretschneideri]
Length=478

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 104/137 (76%), Gaps = 8/137 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWA PHL ++RRFYRL+DPR+EG FSIKGAQKA  LAARCLSRDPKARP+MSEV
Sbjct  338  GEHNLVEWAHPHLRDRRRFYRLVDPRIEGRFSIKGAQKAFHLAARCLSRDPKARPLMSEV  397

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNG----IVFSKNGQQNPRSLSIPNG  258
            VE LKPLP+LKDMA SS Y+Q +QA    S+P ++NG       S+NGQ   R+ S+PNG
Sbjct  398  VEVLKPLPDLKDMACSSSYYQALQAP--GSNPISRNGSRGLAGVSRNGQPT-RTRSMPNG  454

Query  257  SHASPYRQFSQN-SPKP  210
             HASPY     N SP+P
Sbjct  455  PHASPYHLNHLNRSPRP  471



>emb|CDY49042.1| BnaC05g48700D [Brassica napus]
Length=483

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 103/135 (76%), Gaps = 3/135 (2%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEWARPHL ++RRFYRL+DPRLEGHFSIKGAQK  QLAA+CLSRD K RP MSEV
Sbjct  348  GEQNLVEWARPHLLDRRRFYRLLDPRLEGHFSIKGAQKVTQLAAQCLSRDSKIRPKMSEV  407

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNG-SHA  249
            VE LKPLP LKDMASSSYYFQTMQA+R+ +   +    + S+NGQ   R+LS P+G + +
Sbjct  408  VEVLKPLPLLKDMASSSYYFQTMQAERLKAGSGSGR-GLGSRNGQPVLRTLSSPHGQAGS  466

Query  248  SPYRQFSQNSPKPNG  204
            SPYR     SP P G
Sbjct  467  SPYRH-QIPSPMPKG  480



>ref|XP_009347057.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Pyrus x bretschneideri]
Length=477

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 104/137 (76%), Gaps = 8/137 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWA PHL ++RRFYRL+DPR+EG FSIKGAQKA  LAARCLSRDPKARP+MSEV
Sbjct  337  GEHNLVEWAHPHLRDRRRFYRLVDPRIEGRFSIKGAQKAFHLAARCLSRDPKARPLMSEV  396

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNG----IVFSKNGQQNPRSLSIPNG  258
            VE LKPLP+LKDMA SS Y+Q +QA    S+P ++NG       S+NGQ   R+ S+PNG
Sbjct  397  VEVLKPLPDLKDMACSSSYYQALQAP--GSNPISRNGSRGLAGVSRNGQPT-RTRSMPNG  453

Query  257  SHASPYRQFSQN-SPKP  210
             HASPY     N SP+P
Sbjct  454  PHASPYHLNHLNRSPRP  470



>ref|XP_002460108.1| hypothetical protein SORBIDRAFT_02g022880 [Sorghum bicolor]
 gb|EER96629.1| hypothetical protein SORBIDRAFT_02g022880 [Sorghum bicolor]
Length=501

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 106/140 (76%), Gaps = 11/140 (8%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E++RFY+LIDPRLEG+FS+KGAQKAAQLA  CLSRDPKARP+MS+V
Sbjct  368  GEHNLVEWARPLLGERQRFYKLIDPRLEGNFSVKGAQKAAQLARACLSRDPKARPLMSQV  427

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIA-----SSPNTKNGIVFSKNGQQNPRSLSIPN  261
            VE LKPL NLKDMAS+SY+FQTMQA+R +     SS   K    F +NGQ   RSLS  +
Sbjct  428  VEVLKPLQNLKDMASASYFFQTMQAERSSSMNGRSSHGLKTQSPFGRNGQPPMRSLS--D  485

Query  260  GSHASPYRQFSQNSPKPNGK  201
            G  ASP+R     SPKPN K
Sbjct  486  GPRASPFRY----SPKPNVK  501



>gb|KHN13655.1| Putative receptor-like protein kinase [Glycine soja]
Length=453

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 103/139 (74%), Gaps = 9/139 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L ++R   R+IDPRLEGHFS+KG+QKAAQLAA+CL+RDPK+RPMMSEV
Sbjct  319  GEHNLVEWARPVLGDRRMLLRIIDPRLEGHFSVKGSQKAAQLAAQCLNRDPKSRPMMSEV  378

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            V+ALKPL NLKDMA SSY+FQ  + DR  S P  KNG+       S+ GQ   R LS P 
Sbjct  379  VQALKPLQNLKDMAISSYHFQVARVDRTMSMP--KNGMQAQLASLSRKGQP-VRILSSPK  435

Query  260  GSHASPYRQFSQNSPKPNG  204
            G H SPY  + + SPKPNG
Sbjct  436  GPHGSPYHHYIK-SPKPNG  453



>gb|KDO72560.1| hypothetical protein CISIN_1g011851mg [Citrus sinensis]
Length=476

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 99/134 (74%), Gaps = 2/134 (1%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E+RRFYRLIDP LEG FSIKGA+K  QLAA CL+RD KARP MSEV
Sbjct  340  GEHNLVEWARPQLGERRRFYRLIDPCLEGCFSIKGAEKTIQLAASCLNRDQKARPRMSEV  399

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNGSHAS  246
            VEALKPLP LKDMASSS Y Q MQA+R+  + N K+G    + GQ   RSLSIPN  H S
Sbjct  400  VEALKPLPYLKDMASSSSYVQAMQAERVRLNLNAKHGSRVPRKGQPT-RSLSIPNAPHVS  458

Query  245  PYRQFS-QNSPKPN  207
            PY   +   SPKPN
Sbjct  459  PYHLNNPHYSPKPN  472



>ref|XP_010528316.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Tarenaya hassleriana]
Length=477

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 101/140 (72%), Gaps = 15/140 (11%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEWARPHL +K+RFYRL+DPRLEGHFSIKGAQKA QLA++CLSRD KARP MSEV
Sbjct  344  GEQNLVEWARPHLLDKKRFYRLLDPRLEGHFSIKGAQKATQLASQCLSRDSKARPKMSEV  403

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI------VFSKNGQQNPRSLSIP  264
            VEALKPLP LKD ASSS+ FQTMQ       P +KNG         S+NGQ   RSLS  
Sbjct  404  VEALKPLPGLKDFASSSHSFQTMQ-------PMSKNGFRTQGGGFVSRNGQP-LRSLSSL  455

Query  263  NGSHASPYRQFSQNSPKPNG  204
            N   ASPYR  S  SPKP G
Sbjct  456  NVPQASPYRN-SHQSPKPKG  474



>ref|XP_010528314.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010528315.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Tarenaya hassleriana]
Length=478

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 101/140 (72%), Gaps = 15/140 (11%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEWARPHL +K+RFYRL+DPRLEGHFSIKGAQKA QLA++CLSRD KARP MSEV
Sbjct  345  GEQNLVEWARPHLLDKKRFYRLLDPRLEGHFSIKGAQKATQLASQCLSRDSKARPKMSEV  404

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI------VFSKNGQQNPRSLSIP  264
            VEALKPLP LKD ASSS+ FQTMQ       P +KNG         S+NGQ   RSLS  
Sbjct  405  VEALKPLPGLKDFASSSHSFQTMQ-------PMSKNGFRTQGGGFVSRNGQP-LRSLSSL  456

Query  263  NGSHASPYRQFSQNSPKPNG  204
            N   ASPYR  S  SPKP G
Sbjct  457  NVPQASPYRN-SHQSPKPKG  475



>ref|XP_010528317.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X3 [Tarenaya hassleriana]
Length=476

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 101/140 (72%), Gaps = 15/140 (11%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEWARPHL +K+RFYRL+DPRLEGHFSIKGAQKA QLA++CLSRD KARP MSEV
Sbjct  343  GEQNLVEWARPHLLDKKRFYRLLDPRLEGHFSIKGAQKATQLASQCLSRDSKARPKMSEV  402

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI------VFSKNGQQNPRSLSIP  264
            VEALKPLP LKD ASSS+ FQTMQ       P +KNG         S+NGQ   RSLS  
Sbjct  403  VEALKPLPGLKDFASSSHSFQTMQ-------PMSKNGFRTQGGGFVSRNGQP-LRSLSSL  454

Query  263  NGSHASPYRQFSQNSPKPNG  204
            N   ASPYR  S  SPKP G
Sbjct  455  NVPQASPYRN-SHQSPKPKG  473



>ref|XP_006601719.1| PREDICTED: serine/threonine protein kinase-like protein isoform 
X1 [Glycine max]
Length=473

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 103/139 (74%), Gaps = 9/139 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L ++R   R+IDPRLEGHFS+KG+QKAAQLAA+CL+RDPK+RPMMSEV
Sbjct  339  GEHNLVEWARPVLGDRRMLLRIIDPRLEGHFSVKGSQKAAQLAAQCLNRDPKSRPMMSEV  398

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            V+ALKPL NLKDMA SSY+FQ  + DR  S P  KNG+       S+ GQ   R LS P 
Sbjct  399  VQALKPLQNLKDMAISSYHFQVARVDRTMSMP--KNGMQAQLASLSRKGQP-VRILSSPK  455

Query  260  GSHASPYRQFSQNSPKPNG  204
            G H SPY  + + SPKPNG
Sbjct  456  GPHGSPYHHYIK-SPKPNG  473



>ref|XP_010554040.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Tarenaya 
hassleriana]
Length=471

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 100/133 (75%), Gaps = 7/133 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L EKRRFYRLID RLEG FSIKGAQ+A QLAARCLSRDPK+RP+MSEV
Sbjct  341  GEHNLVEWARPYLGEKRRFYRLIDHRLEGRFSIKGAQRAIQLAARCLSRDPKSRPLMSEV  400

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNGSHAS  246
            VE LKPLP+LKDMA SS YFQ MQA+ I+ S +     V ++ G    R+LS+PN  H S
Sbjct  401  VETLKPLPDLKDMACSSSYFQAMQAETISRSGSR----VLARTGHP-ARNLSLPNAPHVS  455

Query  245  PYRQ--FSQNSPK  213
            PY +      SPK
Sbjct  456  PYHRNHLIHRSPK  468



>gb|KJB75753.1| hypothetical protein B456_012G055500 [Gossypium raimondii]
Length=492

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 100/139 (72%), Gaps = 7/139 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L E+RRFYRLIDPRLEGHFSIKGAQ+A QLAA CLSRDPKARP+MS V
Sbjct  349  GEHNLVEWARPYLAERRRFYRLIDPRLEGHFSIKGAQRAIQLAAHCLSRDPKARPLMSGV  408

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VE LKPLPNLKDMA +S  FQ MQ +R+AS+  ++ G      +  +NGQ   RS    N
Sbjct  409  VETLKPLPNLKDMACTSSQFQAMQIERMASTSKSRTGTRAPAALSIRNGQPT-RSPLTQN  467

Query  260  GSHASPYR-QFSQNSPKPN  207
            G   SPY       SPKPN
Sbjct  468  GPQISPYHNNLPYRSPKPN  486



>ref|NP_001238522.1| serine/threonine protein kinase-like protein [Glycine max]
 gb|ACM89484.1| serine/threonine protein kinase-like protein [Glycine max]
Length=474

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 103/139 (74%), Gaps = 9/139 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L ++R   R+IDPRLEGHFS+KG+QKAAQLAA+CL+RDPK+RPMMSEV
Sbjct  340  GEHNLVEWARPVLGDRRMLLRIIDPRLEGHFSVKGSQKAAQLAAQCLNRDPKSRPMMSEV  399

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            V+ALKPL NLKDMA SSY+FQ  + DR  S P  KNG+       S+ GQ   R LS P 
Sbjct  400  VQALKPLQNLKDMAISSYHFQVARVDRTMSMP--KNGMQAQLASLSRKGQP-VRILSSPK  456

Query  260  GSHASPYRQFSQNSPKPNG  204
            G H SPY  + + SPKPNG
Sbjct  457  GPHGSPYHHYIK-SPKPNG  474



>ref|XP_006482585.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
[Citrus sinensis]
Length=476

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 99/134 (74%), Gaps = 2/134 (1%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E+RRFYRLIDP LEG FSIKGA+K  QLAA CL+RD KARP MSEV
Sbjct  340  GEHNLVEWARPQLGERRRFYRLIDPCLEGCFSIKGAEKTIQLAASCLNRDQKARPRMSEV  399

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNGSHAS  246
            VEALKPLP LKDMASSS Y Q MQA+R+  + N K+G    + GQ   RSLSIPN  H S
Sbjct  400  VEALKPLPYLKDMASSSSYVQAMQAERVRLNLNAKHGSRVPRKGQPT-RSLSIPNAPHIS  458

Query  245  PYRQFS-QNSPKPN  207
            PY   +   SPKPN
Sbjct  459  PYHLNNPHYSPKPN  472



>gb|KHG05986.1| hypothetical protein F383_32908 [Gossypium arboreum]
Length=492

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 100/139 (72%), Gaps = 7/139 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L E+RRFYRLIDPRLEGHFSIKGAQ+A QLAA CLSRDPKARP+MS V
Sbjct  349  GEHNLVEWARPYLAERRRFYRLIDPRLEGHFSIKGAQRAIQLAAHCLSRDPKARPLMSGV  408

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VE LKPLPNLKDMA +S  FQ MQ +R+AS+  ++ G      +  +NGQ   RS    N
Sbjct  409  VETLKPLPNLKDMACTSSQFQAMQIERMASTSKSRTGTRAPAALSIRNGQPT-RSPLTQN  467

Query  260  GSHASPYR-QFSQNSPKPN  207
            G   SPY       SPKPN
Sbjct  468  GPQISPYHNNLPYRSPKPN  486



>tpg|DAA61160.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=426

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 110/146 (75%), Gaps = 17/146 (12%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E++RFY+LIDPRLEG+FS+KGAQKAAQLA  CLSRDPKARP+MS+V
Sbjct  287  GEHNLVEWARPLLGERQRFYKLIDPRLEGNFSVKGAQKAAQLARVCLSRDPKARPLMSQV  346

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSP-----NTKNGIV-----FSKNGQQNP-R  279
            VE LKPL NLKDMAS+SY+FQTMQA+R+A S      ++ NG       F ++GQ  P R
Sbjct  347  VEVLKPLQNLKDMASASYFFQTMQAERMAHSSSMNGRSSMNGGFKTQSPFGRHGQPPPVR  406

Query  278  SLSIPNGSHASPYRQFSQNSPKPNGK  201
            SLS  +G  ASP+R     SPKPN K
Sbjct  407  SLS--DGPRASPFRY----SPKPNVK  426



>gb|KHG16091.1| hypothetical protein F383_07681 [Gossypium arboreum]
Length=476

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 109/141 (77%), Gaps = 8/141 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRF+R++DPRLEGHFSIKGA +AAQLAA+CLSRDPKARP MSEV
Sbjct  336  GEHNLVEWARPHLGDKRRFFRILDPRLEGHFSIKGALRAAQLAAQCLSRDPKARPQMSEV  395

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNT-KNGI-----VFSKNGQQNPRSLSIP  264
            VE LKPLPNL DMASSSYYFQ+MQ+DR  SS  T KNGI       ++NGQ   RSLS  
Sbjct  396  VETLKPLPNLNDMASSSYYFQSMQSDRSRSSNITAKNGIRVQAGFVTRNGQPM-RSLSSL  454

Query  263  NGSHASPYRQFSQNSPKPNGK  201
            NG  ASP+ Q    SPKP  K
Sbjct  455  NGPQASPFHQHPP-SPKPKAK  474



>ref|XP_004489370.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
[Cicer arietinum]
Length=491

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 103/137 (75%), Gaps = 7/137 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L ++R FYR+IDPRLEGHFS+KGAQKAA +AA+CLSRDPK+RP+MSEV
Sbjct  355  GEHNLVEWARPVLGDRRTFYRIIDPRLEGHFSVKGAQKAAYVAAQCLSRDPKSRPLMSEV  414

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            V+ LKPLP LKDMA SS+ FQ  + DR  S PN KNGI        K GQ   R+LS  N
Sbjct  415  VQTLKPLPALKDMAISSHQFQVARVDRTMSMPNPKNGIRTGLASLPKKGQP-VRALSSSN  473

Query  260  GSHASPYRQFSQNSPKP  210
              H+SPY ++S+ SPKP
Sbjct  474  YGHSSPYPRYSK-SPKP  489



>ref|XP_003578019.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Brachypodium distachyon]
Length=496

 Score =   166 bits (420),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 108/144 (75%), Gaps = 15/144 (10%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E++RFY+L+DPRLEG+FS+KGAQKAAQLA  CLSRDPKARP+MS+V
Sbjct  359  GEHNLVEWARPLLGERQRFYKLVDPRLEGNFSVKGAQKAAQLARACLSRDPKARPLMSQV  418

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTK---------NGIVFSKNGQQNPRSL  273
            VEALKPL NLKDMASSSY++QTMQA+R+A S +           +G     +GQQ  RS+
Sbjct  419  VEALKPLLNLKDMASSSYFYQTMQAERMAHSSSLNGRSSHSAKAHGSFARASGQQPVRSI  478

Query  272  SIPNGSHASPYRQFSQNSPKPNGK  201
            S  +G  ASP+R     SPKPN K
Sbjct  479  S--DGPRASPFRY----SPKPNMK  496



>ref|XP_010238085.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Brachypodium distachyon]
Length=495

 Score =   166 bits (420),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 108/144 (75%), Gaps = 15/144 (10%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E++RFY+L+DPRLEG+FS+KGAQKAAQLA  CLSRDPKARP+MS+V
Sbjct  358  GEHNLVEWARPLLGERQRFYKLVDPRLEGNFSVKGAQKAAQLARACLSRDPKARPLMSQV  417

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTK---------NGIVFSKNGQQNPRSL  273
            VEALKPL NLKDMASSSY++QTMQA+R+A S +           +G     +GQQ  RS+
Sbjct  418  VEALKPLLNLKDMASSSYFYQTMQAERMAHSSSLNGRSSHSAKAHGSFARASGQQPVRSI  477

Query  272  SIPNGSHASPYRQFSQNSPKPNGK  201
            S  +G  ASP+R     SPKPN K
Sbjct  478  S--DGPRASPFRY----SPKPNMK  495



>ref|NP_189510.2| putative protein kinase [Arabidopsis thaliana]
 gb|ACF20467.1| At3g28690 [Arabidopsis thaliana]
 gb|AEE77475.1| putative protein kinase [Arabidopsis thaliana]
Length=376

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 102/141 (72%), Gaps = 15/141 (11%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEW RPHL +K+RFYRL+DPRLEGH+SIKGAQKA Q+AA+CL+RD KARP MSEV
Sbjct  243  GEQNLVEWVRPHLLDKKRFYRLLDPRLEGHYSIKGAQKATQVAAQCLNRDSKARPKMSEV  302

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI------VFSKNGQQNPRSLSIP  264
            VEALKPLPNLKD ASSS  FQTMQ       P  KNG+        S+NG    RSLS  
Sbjct  303  VEALKPLPNLKDFASSSSSFQTMQ-------PVAKNGVRTQGGGFVSRNGPPM-RSLSSL  354

Query  263  NGSHASPYRQFSQNSPKPNGK  201
            N   ASPYR +++ SPKP GK
Sbjct  355  NLPQASPYR-YARQSPKPKGK  374



>ref|XP_008651616.1| PREDICTED: uncharacterized protein LOC100381489 isoform X1 [Zea 
mays]
 tpg|DAA61158.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=504

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 110/146 (75%), Gaps = 17/146 (12%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E++RFY+LIDPRLEG+FS+KGAQKAAQLA  CLSRDPKARP+MS+V
Sbjct  365  GEHNLVEWARPLLGERQRFYKLIDPRLEGNFSVKGAQKAAQLARVCLSRDPKARPLMSQV  424

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSP-----NTKNGIV-----FSKNGQQNP-R  279
            VE LKPL NLKDMAS+SY+FQTMQA+R+A S      ++ NG       F ++GQ  P R
Sbjct  425  VEVLKPLQNLKDMASASYFFQTMQAERMAHSSSMNGRSSMNGGFKTQSPFGRHGQPPPVR  484

Query  278  SLSIPNGSHASPYRQFSQNSPKPNGK  201
            SLS  +G  ASP+R     SPKPN K
Sbjct  485  SLS--DGPRASPFRY----SPKPNVK  504



>ref|XP_008651617.1| PREDICTED: uncharacterized protein LOC100381489 isoform X2 [Zea 
mays]
 tpg|DAA61159.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=503

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 110/146 (75%), Gaps = 17/146 (12%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E++RFY+LIDPRLEG+FS+KGAQKAAQLA  CLSRDPKARP+MS+V
Sbjct  364  GEHNLVEWARPLLGERQRFYKLIDPRLEGNFSVKGAQKAAQLARVCLSRDPKARPLMSQV  423

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSP-----NTKNGIV-----FSKNGQQNP-R  279
            VE LKPL NLKDMAS+SY+FQTMQA+R+A S      ++ NG       F ++GQ  P R
Sbjct  424  VEVLKPLQNLKDMASASYFFQTMQAERMAHSSSMNGRSSMNGGFKTQSPFGRHGQPPPVR  483

Query  278  SLSIPNGSHASPYRQFSQNSPKPNGK  201
            SLS  +G  ASP+R     SPKPN K
Sbjct  484  SLS--DGPRASPFRY----SPKPNVK  503



>ref|NP_001154651.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEE77477.1| putative protein kinase [Arabidopsis thaliana]
Length=425

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 102/141 (72%), Gaps = 15/141 (11%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEW RPHL +K+RFYRL+DPRLEGH+SIKGAQKA Q+AA+CL+RD KARP MSEV
Sbjct  292  GEQNLVEWVRPHLLDKKRFYRLLDPRLEGHYSIKGAQKATQVAAQCLNRDSKARPKMSEV  351

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI------VFSKNGQQNPRSLSIP  264
            VEALKPLPNLKD ASSS  FQTMQ       P  KNG+        S+NG    RSLS  
Sbjct  352  VEALKPLPNLKDFASSSSSFQTMQ-------PVAKNGVRTQGGGFVSRNGPPM-RSLSSL  403

Query  263  NGSHASPYRQFSQNSPKPNGK  201
            N   ASPYR +++ SPKP GK
Sbjct  404  NLPQASPYR-YARQSPKPKGK  423



>ref|XP_008667770.1| PREDICTED: uncharacterized LOC100279298 isoform X1 [Zea mays]
Length=505

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 109/147 (74%), Gaps = 18/147 (12%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E++RFY+L+DPRLEG+FS+KGAQKAAQLA  CLSRDPKARP+MS+V
Sbjct  365  GEHNLVEWARPLLGERQRFYKLVDPRLEGNFSVKGAQKAAQLARACLSRDPKARPLMSQV  424

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSP-----------NTKNGIVFSKNGQQNP-  282
            VE L+PL NL+DMAS+SY++QTM A+R+A S            ++K    F +NGQQ P 
Sbjct  425  VEVLRPLQNLRDMASASYFYQTMHAERMAHSSSMNGRSSHGHGSSKAQSPFGRNGQQQPV  484

Query  281  RSLSIPNGSHASPYRQFSQNSPKPNGK  201
            RSLS  +G  ASP+R     SPKPN K
Sbjct  485  RSLS--DGPRASPFRY----SPKPNVK  505



>ref|NP_001145791.1| uncharacterized LOC100279298 [Zea mays]
 gb|ACL52593.1| unknown [Zea mays]
 tpg|DAA39947.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=506

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 109/147 (74%), Gaps = 18/147 (12%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L E++RFY+L+DPRLEG+FS+KGAQKAAQLA  CLSRDPKARP+MS+V
Sbjct  366  GEHNLVEWARPLLGERQRFYKLVDPRLEGNFSVKGAQKAAQLARACLSRDPKARPLMSQV  425

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSP-----------NTKNGIVFSKNGQQNP-  282
            VE L+PL NL+DMAS+SY++QTM A+R+A S            ++K    F +NGQQ P 
Sbjct  426  VEVLRPLQNLRDMASASYFYQTMHAERMAHSSSMNGRSSHGHGSSKAQSPFGRNGQQQPV  485

Query  281  RSLSIPNGSHASPYRQFSQNSPKPNGK  201
            RSLS  +G  ASP+R     SPKPN K
Sbjct  486  RSLS--DGPRASPFRY----SPKPNVK  506



>ref|XP_011013709.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Populus euphratica]
Length=421

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 98/126 (78%), Gaps = 5/126 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWA+PHL E+RRFYR+IDPRLEG FSIKGAQKA QLAA CL+RDPKARP+MS+V
Sbjct  286  GEHNLVEWAQPHLGERRRFYRMIDPRLEGRFSIKGAQKAIQLAAHCLNRDPKARPLMSDV  345

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VEALKPLP LKDMA SS YFQ MQ++R +S+P+ +NG      FS+N  Q  +S    NG
Sbjct  346  VEALKPLPYLKDMACSSSYFQAMQSERGSSNPSAQNGNRVRPGFSRN-MQPTKSFPKFNG  404

Query  257  SHASPY  240
             H + Y
Sbjct  405  HHGNSY  410



>ref|XP_006395351.1| hypothetical protein EUTSA_v10004125mg [Eutrema salsugineum]
 gb|ESQ32637.1| hypothetical protein EUTSA_v10004125mg [Eutrema salsugineum]
Length=476

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 100/140 (71%), Gaps = 13/140 (9%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEW RPHL +K+RFYRL+DPRLEGHFSIKGAQKA Q+AA+CL+RD KARP MSEV
Sbjct  343  GEQNLVEWVRPHLLDKKRFYRLLDPRLEGHFSIKGAQKATQVAAQCLNRDSKARPKMSEV  402

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGIVFSKNG---QQNP--RSLSIPN  261
            VEALKPLPNLKD ASSS  FQTMQ       P  KNGI     G   +  P  RSLS  N
Sbjct  403  VEALKPLPNLKDFASSSSSFQTMQ-------PVAKNGIRTQGGGFVARNGPPLRSLSSLN  455

Query  260  GSHASPYRQFSQNSPKPNGK  201
                SPYR +++ SPKP GK
Sbjct  456  LPQGSPYR-YARQSPKPKGK  474



>ref|XP_011098600.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Sesamum 
indicum]
Length=482

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 95/129 (74%), Gaps = 7/129 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L EKRRFYRLIDPRLEG FSIKGAQ A QLAARCL+RD K RP MSEV
Sbjct  346  GEHNLVEWARPYLGEKRRFYRLIDPRLEGRFSIKGAQLAVQLAARCLNRDAKIRPAMSEV  405

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VEAL+PLPNLKDMA S+ YFQ M A R  +S   +NG+     F KNGQ   RS S+PN 
Sbjct  406  VEALEPLPNLKDMACSTSYFQAMHAARANTS--ARNGVRLQPGFLKNGQPT-RSPSMPNR  462

Query  257  SHASPYRQF  231
             H SPY   
Sbjct  463  YHGSPYHHI  471



>dbj|BAB02184.1| protein kinase [Arabidopsis thaliana]
Length=483

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 102/141 (72%), Gaps = 15/141 (11%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEW RPHL +K+RFYRL+DPRLEGH+SIKGAQKA Q+AA+CL+RD KARP MSEV
Sbjct  350  GEQNLVEWVRPHLLDKKRFYRLLDPRLEGHYSIKGAQKATQVAAQCLNRDSKARPKMSEV  409

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI------VFSKNGQQNPRSLSIP  264
            VEALKPLPNLKD ASSS  FQTMQ       P  KNG+        S+NG    RSLS  
Sbjct  410  VEALKPLPNLKDFASSSSSFQTMQ-------PVAKNGVRTQGGGFVSRNGPPM-RSLSSL  461

Query  263  NGSHASPYRQFSQNSPKPNGK  201
            N   ASPYR +++ SPKP GK
Sbjct  462  NLPQASPYR-YARQSPKPKGK  481



>ref|NP_001030790.2| putative protein kinase [Arabidopsis thaliana]
 gb|AEE77476.1| putative protein kinase [Arabidopsis thaliana]
Length=453

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 102/141 (72%), Gaps = 15/141 (11%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEW RPHL +K+RFYRL+DPRLEGH+SIKGAQKA Q+AA+CL+RD KARP MSEV
Sbjct  320  GEQNLVEWVRPHLLDKKRFYRLLDPRLEGHYSIKGAQKATQVAAQCLNRDSKARPKMSEV  379

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI------VFSKNGQQNPRSLSIP  264
            VEALKPLPNLKD ASSS  FQTMQ       P  KNG+        S+NG    RSLS  
Sbjct  380  VEALKPLPNLKDFASSSSSFQTMQ-------PVAKNGVRTQGGGFVSRNGPPM-RSLSSL  431

Query  263  NGSHASPYRQFSQNSPKPNGK  201
            N   ASPYR +++ SPKP GK
Sbjct  432  NLPQASPYR-YARQSPKPKGK  451



>ref|XP_011013708.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Populus euphratica]
Length=474

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 98/126 (78%), Gaps = 5/126 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWA+PHL E+RRFYR+IDPRLEG FSIKGAQKA QLAA CL+RDPKARP+MS+V
Sbjct  339  GEHNLVEWAQPHLGERRRFYRMIDPRLEGRFSIKGAQKAIQLAAHCLNRDPKARPLMSDV  398

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VEALKPLP LKDMA SS YFQ MQ++R +S+P+ +NG      FS+N  Q  +S    NG
Sbjct  399  VEALKPLPYLKDMACSSSYFQAMQSERGSSNPSAQNGNRVRPGFSRN-MQPTKSFPKFNG  457

Query  257  SHASPY  240
             H + Y
Sbjct  458  HHGNSY  463



>ref|XP_010087809.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXB30116.1| putative receptor-like protein kinase [Morus notabilis]
Length=476

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 100/135 (74%), Gaps = 6/135 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N V+WARP L +KRRFYRL+DPRLEGHFSIKGAQKA Q+AA CLSRDPKARP+ SEV
Sbjct  324  GEQNLVQWARPLLGDKRRFYRLMDPRLEGHFSIKGAQKALQIAAHCLSRDPKARPLASEV  383

Query  425  VEALKPLPNLKDMASSSYYFQTMQ-ADRIASSPNTKNGI----VFSKNGQQNPRSLSIPN  261
            VEALKPLP LKDMASSSYYFQ++Q A R  S PN +NGI     F+       R+LS  N
Sbjct  384  VEALKPLPKLKDMASSSYYFQSVQAAARSKSMPNARNGIRTQPTFAPRKGTPARTLSSQN  443

Query  260  GSHASPYRQFSQNSP  216
             + ASP R +   SP
Sbjct  444  RAQASP-RHYPGQSP  457



>ref|XP_002305322.2| hypothetical protein POPTR_0004s13410g [Populus trichocarpa]
 gb|EEE85833.2| hypothetical protein POPTR_0004s13410g [Populus trichocarpa]
Length=474

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 98/126 (78%), Gaps = 5/126 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWA+PHL E+RRFYR+IDPRLEG FSIKGAQKA QLAA CL+RDPKARP+MS+V
Sbjct  339  GEHNLVEWAQPHLGERRRFYRMIDPRLEGRFSIKGAQKAIQLAAHCLNRDPKARPLMSDV  398

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VEALKPLP LKDMA SS YFQ MQ++R +S+P+ +NG      +S+N  Q  +S    NG
Sbjct  399  VEALKPLPCLKDMACSSSYFQAMQSERGSSNPSAQNGSRVRPGYSRN-MQPTKSFPKFNG  457

Query  257  SHASPY  240
             H + Y
Sbjct  458  HHGNSY  463



>emb|CDY47249.1| BnaA02g29350D [Brassica napus]
Length=471

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 101/141 (72%), Gaps = 15/141 (11%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEW +PHL +K++FYRL+DPRLEGHFSIKGAQKA Q+AA+CL+RD KARP MSEV
Sbjct  338  GEQNLVEWVKPHLLDKKKFYRLLDPRLEGHFSIKGAQKATQVAAQCLNRDSKARPKMSEV  397

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI------VFSKNGQQNPRSLSIP  264
            VEALKPLP+LKD ASSS  FQTMQ       P  KNG+        ++NGQ   RSLS  
Sbjct  398  VEALKPLPSLKDFASSSTSFQTMQ-------PVAKNGVRTQGGGFVARNGQP-LRSLSSL  449

Query  263  NGSHASPYRQFSQNSPKPNGK  201
            N   ASPYR   Q SPKP GK
Sbjct  450  NLPQASPYRNARQ-SPKPKGK  469



>ref|XP_009129365.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Brassica rapa]
Length=470

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 102/141 (72%), Gaps = 15/141 (11%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEW +PHL +K++FYRL+DPRLEGHFSIKGAQKA Q+AA+CL+RD KARP MSEV
Sbjct  337  GEQNLVEWVKPHLLDKKKFYRLLDPRLEGHFSIKGAQKATQVAAQCLNRDSKARPKMSEV  396

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI------VFSKNGQQNPRSLSIP  264
            VEALKPLP+LKD ASSS  FQTMQ       P  KNG+        ++NGQ   RSLS  
Sbjct  397  VEALKPLPSLKDFASSSTSFQTMQ-------PVAKNGVRTQGGGFVARNGQP-LRSLSSL  448

Query  263  NGSHASPYRQFSQNSPKPNGK  201
            N   ASPYR  ++ SPKP GK
Sbjct  449  NLPQASPYRN-ARQSPKPKGK  468



>ref|XP_009129364.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Brassica rapa]
Length=471

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 101/141 (72%), Gaps = 15/141 (11%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEW +PHL +K++FYRL+DPRLEGHFSIKGAQKA Q+AA+CL+RD KARP MSEV
Sbjct  338  GEQNLVEWVKPHLLDKKKFYRLLDPRLEGHFSIKGAQKATQVAAQCLNRDSKARPKMSEV  397

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI------VFSKNGQQNPRSLSIP  264
            VEALKPLP+LKD ASSS  FQTMQ       P  KNG+        ++NGQ   RSLS  
Sbjct  398  VEALKPLPSLKDFASSSTSFQTMQ-------PVAKNGVRTQGGGFVARNGQP-LRSLSSL  449

Query  263  NGSHASPYRQFSQNSPKPNGK  201
            N   ASPYR   Q SPKP GK
Sbjct  450  NLPQASPYRNARQ-SPKPKGK  469



>gb|KFK33749.1| hypothetical protein AALP_AA5G055100 [Arabis alpina]
Length=461

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 100/141 (71%), Gaps = 15/141 (11%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEW RPHL +K+RFYRL+DPRLEGHFSIKGAQKA QLAA+CL+RD KARP MSEV
Sbjct  328  GEQNLVEWVRPHLLDKKRFYRLLDPRLEGHFSIKGAQKATQLAAQCLNRDSKARPKMSEV  387

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI------VFSKNGQQNPRSLSIP  264
            VE LKPLP+LKD ASSS  FQTMQ       P  KNGI        S+NG    RSLS  
Sbjct  388  VEVLKPLPSLKDFASSSTSFQTMQ-------PVAKNGIRTQGGGFVSRNGPPM-RSLSSL  439

Query  263  NGSHASPYRQFSQNSPKPNGK  201
            N    SPYR +++ SPKP GK
Sbjct  440  NLPQQSPYR-YARQSPKPKGK  459



>ref|XP_007032445.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007032446.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY03371.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY03372.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=473

 Score =   160 bits (406),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 107/140 (76%), Gaps = 8/140 (6%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRF+R++DPRLEGHFSIKGAQKAAQLAA+CLSRDPKARP MSEV
Sbjct  335  GEHNLVEWARPHLGDKRRFFRILDPRLEGHFSIKGAQKAAQLAAQCLSRDPKARPRMSEV  394

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-----VFSKNGQQNPRSLSIPN  261
            VE LKPL NLKDMASSS YFQTMQ+DR  S+ N KNGI        +NGQ   RSLS  N
Sbjct  395  VETLKPLLNLKDMASSSSYFQTMQSDR-RSNLNAKNGIRTQAGFVVRNGQP-IRSLSSSN  452

Query  260  GSHASPYRQFSQNSPKPNGK  201
            G  ASP+      SPKP  K
Sbjct  453  GPQASPFHH-PHPSPKPKAK  471



>emb|CDY20019.1| BnaA09g02320D [Brassica napus]
Length=211

 Score =   152 bits (385),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 103/143 (72%), Gaps = 19/143 (13%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VE ARPHL +K+RFYRL+DPRLEGH+SIKGAQKA Q+AA+CL+RD KARP MSEV
Sbjct  79   GEQNLVECARPHLLDKKRFYRLLDPRLEGHYSIKGAQKATQVAAQCLNRDCKARPKMSEV  138

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-------VFSKNGQ--QNPRSL  273
            VEALKPLP+LKD ASSS  FQTMQ       P  KNG+         S+NG   ++  SL
Sbjct  139  VEALKPLPSLKDFASSSSSFQTMQ-------PVGKNGVRTQGGGGFVSRNGVPLRSLSSL  191

Query  272  SIPNGSHASPYRQFSQNSPKPNG  204
            ++P GS  SPYR +++ SPK  G
Sbjct  192  NLPQGS--SPYR-YARQSPKAKG  211



>ref|XP_011462440.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X5 [Fragaria vesca subsp. vesca]
Length=497

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 103/135 (76%), Gaps = 3/135 (2%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL ++RR+YRLIDPRLEG FSIKGA+ A QLAA CLSR+PKARP+MSEV
Sbjct  347  GEHNLVEWARPHLGDRRRYYRLIDPRLEGRFSIKGAEMAFQLAAHCLSRNPKARPLMSEV  406

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-VFSKNGQQNPRSLSIPNGSHA  249
            V+ +KPL +LKD A SS + Q M  +R  SSPN +NG+ V ++NGQ + RS S+PNG + 
Sbjct  407  VQVIKPLLHLKDQAYSSSHPQGMHTERPGSSPNFRNGLWVPARNGQPS-RSQSLPNGPNV  465

Query  248  SPYR-QFSQNSPKPN  207
            SPY       SPKP+
Sbjct  466  SPYHLNHPHRSPKPS  480



>ref|XP_004297955.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X3 [Fragaria vesca subsp. vesca]
Length=507

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL ++RR+YRLIDPRLEG FSIKGA+ A QLAA CLSR+PKARP+MSEV
Sbjct  339  GEHNLVEWARPHLGDRRRYYRLIDPRLEGRFSIKGAEMAFQLAAHCLSRNPKARPLMSEV  398

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-VFSKNGQQNPRSLSIPNGSHA  249
            V+ +KPL +LKD A SS + Q M  +R  SSPN +NG+ V ++NGQ + RS S+PNG + 
Sbjct  399  VQVIKPLLHLKDQAYSSSHPQGMHTERPGSSPNFRNGLWVPARNGQPS-RSQSLPNGPNV  457

Query  248  SPYRQFSQNSPKPNG  204
            SPY     +   PNG
Sbjct  458  SPYHLSHPHRSLPNG  472



>ref|XP_011462439.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X4 [Fragaria vesca subsp. vesca]
Length=506

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL ++RR+YRLIDPRLEG FSIKGA+ A QLAA CLSR+PKARP+MSEV
Sbjct  338  GEHNLVEWARPHLGDRRRYYRLIDPRLEGRFSIKGAEMAFQLAAHCLSRNPKARPLMSEV  397

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-VFSKNGQQNPRSLSIPNGSHA  249
            V+ +KPL +LKD A SS + Q M  +R  SSPN +NG+ V ++NGQ + RS S+PNG + 
Sbjct  398  VQVIKPLLHLKDQAYSSSHPQGMHTERPGSSPNFRNGLWVPARNGQPS-RSQSLPNGPNV  456

Query  248  SPYRQFSQNSPKPNG  204
            SPY     +   PNG
Sbjct  457  SPYHLSHPHRSLPNG  471



>ref|XP_011462438.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=514

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL ++RR+YRLIDPRLEG FSIKGA+ A QLAA CLSR+PKARP+MSEV
Sbjct  346  GEHNLVEWARPHLGDRRRYYRLIDPRLEGRFSIKGAEMAFQLAAHCLSRNPKARPLMSEV  405

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-VFSKNGQQNPRSLSIPNGSHA  249
            V+ +KPL +LKD A SS + Q M  +R  SSPN +NG+ V ++NGQ + RS S+PNG + 
Sbjct  406  VQVIKPLLHLKDQAYSSSHPQGMHTERPGSSPNFRNGLWVPARNGQPS-RSQSLPNGPNV  464

Query  248  SPYRQFSQNSPKPNG  204
            SPY     +   PNG
Sbjct  465  SPYHLSHPHRSLPNG  479



>ref|XP_011462437.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=515

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL ++RR+YRLIDPRLEG FSIKGA+ A QLAA CLSR+PKARP+MSEV
Sbjct  347  GEHNLVEWARPHLGDRRRYYRLIDPRLEGRFSIKGAEMAFQLAAHCLSRNPKARPLMSEV  406

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI-VFSKNGQQNPRSLSIPNGSHA  249
            V+ +KPL +LKD A SS + Q M  +R  SSPN +NG+ V ++NGQ + RS S+PNG + 
Sbjct  407  VQVIKPLLHLKDQAYSSSHPQGMHTERPGSSPNFRNGLWVPARNGQPS-RSQSLPNGPNV  465

Query  248  SPYRQFSQNSPKPNG  204
            SPY     +   PNG
Sbjct  466  SPYHLSHPHRSLPNG  480



>ref|XP_009342879.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Pyrus x bretschneideri]
Length=475

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 102/139 (73%), Gaps = 6/139 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWAR    +K+R ++LIDPRLEGHFSIKGAQKA QLAA CLSRDPKARPMMSEV
Sbjct  338  GEHNLVEWARQRFGDKKRLFQLIDPRLEGHFSIKGAQKAVQLAAHCLSRDPKARPMMSEV  397

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VE LKPL NLKDMASSSY FQTMQ  R  S  ++KNGI    VF     Q  RSLS PNG
Sbjct  398  VEVLKPLQNLKDMASSSYQFQTMQEARSRSLSSSKNGIRTQAVFMPRNGQPVRSLSSPNG  457

Query  257  SHASPYRQFSQNSPKPNGK  201
              +SPY  +   SPKPN K
Sbjct  458  PPSSPY--YPSKSPKPNSK  474



>ref|XP_009342878.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Pyrus x bretschneideri]
Length=476

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 102/139 (73%), Gaps = 6/139 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWAR    +K+R ++LIDPRLEGHFSIKGAQKA QLAA CLSRDPKARPMMSEV
Sbjct  339  GEHNLVEWARQRFGDKKRLFQLIDPRLEGHFSIKGAQKAVQLAAHCLSRDPKARPMMSEV  398

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VE LKPL NLKDMASSSY FQTMQ  R  S  ++KNGI    VF     Q  RSLS PNG
Sbjct  399  VEVLKPLQNLKDMASSSYQFQTMQEARSRSLSSSKNGIRTQAVFMPRNGQPVRSLSSPNG  458

Query  257  SHASPYRQFSQNSPKPNGK  201
              +SPY  +   SPKPN K
Sbjct  459  PPSSPY--YPSKSPKPNSK  475



>ref|XP_006291019.1| hypothetical protein CARUB_v10017133mg [Capsella rubella]
 gb|EOA23917.1| hypothetical protein CARUB_v10017133mg [Capsella rubella]
Length=476

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 100/141 (71%), Gaps = 15/141 (11%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEW RPHL +K+R  RL+DPRLEGH+SIKGAQKA Q+AA+CL+RD KARP MSEV
Sbjct  343  GEQNLVEWVRPHLLDKKRLCRLLDPRLEGHYSIKGAQKATQVAAQCLNRDSKARPKMSEV  402

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI------VFSKNGQQNPRSLSIP  264
            VEALKPLPNLKD ASSS  FQTMQ       P  KNG+        S+NG    RSLS  
Sbjct  403  VEALKPLPNLKDFASSSSSFQTMQ-------PVAKNGVRTQGGGFVSRNGPPM-RSLSSL  454

Query  263  NGSHASPYRQFSQNSPKPNGK  201
            N   ASPYR +++ SPKP GK
Sbjct  455  NLPQASPYR-YARQSPKPKGK  474



>ref|XP_006291020.1| hypothetical protein CARUB_v10017133mg [Capsella rubella]
 gb|EOA23918.1| hypothetical protein CARUB_v10017133mg [Capsella rubella]
Length=477

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 100/141 (71%), Gaps = 15/141 (11%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEW RPHL +K+R  RL+DPRLEGH+SIKGAQKA Q+AA+CL+RD KARP MSEV
Sbjct  344  GEQNLVEWVRPHLLDKKRLCRLLDPRLEGHYSIKGAQKATQVAAQCLNRDSKARPKMSEV  403

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI------VFSKNGQQNPRSLSIP  264
            VEALKPLPNLKD ASSS  FQTMQ       P  KNG+        S+NG    RSLS  
Sbjct  404  VEALKPLPNLKDFASSSSSFQTMQ-------PVAKNGVRTQGGGFVSRNGPPM-RSLSSL  455

Query  263  NGSHASPYRQFSQNSPKPNGK  201
            N   ASPYR +++ SPKP GK
Sbjct  456  NLPQASPYR-YARQSPKPKGK  475



>gb|KHN45478.1| Putative receptor-like protein kinase [Glycine soja]
Length=486

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 103/138 (75%), Gaps = 5/138 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L ++R FYR+IDPRLEGHFS+KGAQKAA LAA+CLSRDPK+RP+MSEV
Sbjct  350  GEHNLVEWARPVLGDRRMFYRIIDPRLEGHFSVKGAQKAALLAAQCLSRDPKSRPLMSEV  409

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            V ALKPLP+LKDMA SSY+FQ  + DR  S PN KNGI    V      Q  R+LS PN 
Sbjct  410  VRALKPLPSLKDMAISSYHFQIARVDRTMSMPNHKNGIRTQLVSVPRKGQPVRTLSSPNV  469

Query  257  SHASPYRQFSQNSPKPNG  204
             H SPY   ++ SPKP G
Sbjct  470  PHGSPYLHHTK-SPKPIG  486



>ref|XP_006603648.1| PREDICTED: serine/threonine protein kinase-like protein isoform 
X1 [Glycine max]
 ref|XP_006603649.1| PREDICTED: serine/threonine protein kinase-like protein isoform 
X2 [Glycine max]
Length=487

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 103/138 (75%), Gaps = 5/138 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L ++R FYR+IDPRLEGHFS+KGAQKAA LAA+CLSRDPK+RP+MSEV
Sbjct  351  GEHNLVEWARPVLGDRRMFYRIIDPRLEGHFSVKGAQKAALLAAQCLSRDPKSRPLMSEV  410

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            V ALKPLP+LKDMA SSY+FQ  + DR  S PN KNGI    V      Q  R+LS PN 
Sbjct  411  VRALKPLPSLKDMAISSYHFQIARVDRTMSMPNHKNGIRTQLVSVPRKGQPVRTLSSPNV  470

Query  257  SHASPYRQFSQNSPKPNG  204
             H SPY   ++ SPKP G
Sbjct  471  PHGSPYLHHTK-SPKPIG  487



>emb|CDY04026.1| BnaC02g37410D [Brassica napus]
Length=474

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 100/141 (71%), Gaps = 15/141 (11%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEW +PHL +K++FYRL+D RLEGHFSIKGAQKA Q+AA+CL+RD KARP MSEV
Sbjct  341  GEQNLVEWVKPHLLDKKKFYRLLDHRLEGHFSIKGAQKATQVAAQCLNRDSKARPKMSEV  400

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI------VFSKNGQQNPRSLSIP  264
            VEALKPLP+LKD ASSS  FQTMQ       P  KNG+        ++NGQ   RSLS  
Sbjct  401  VEALKPLPSLKDFASSSTSFQTMQ-------PVAKNGVRTQGGGFVARNGQP-LRSLSSL  452

Query  263  NGSHASPYRQFSQNSPKPNGK  201
            N   ASPYR   Q SPKP GK
Sbjct  453  NLPQASPYRNARQ-SPKPKGK  472



>ref|NP_001237700.1| serine/threonine protein kinase-like protein [Glycine max]
 gb|ACM89574.1| serine/threonine protein kinase-like protein [Glycine max]
Length=476

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 103/138 (75%), Gaps = 5/138 (4%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP L ++R FYR+IDPRLEGHFS+KGAQKAA LAA+CLSRDPK+RP+MSEV
Sbjct  340  GEHNLVEWARPVLGDRRMFYRIIDPRLEGHFSVKGAQKAALLAAQCLSRDPKSRPLMSEV  399

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            V ALKPLP+LKDMA SSY+FQ  + DR  S PN KNGI    V      Q  R+LS PN 
Sbjct  400  VRALKPLPSLKDMAISSYHFQIARVDRTMSMPNHKNGIRTQLVSVPRKGQPVRTLSSPNV  459

Query  257  SHASPYRQFSQNSPKPNG  204
             H SPY   ++ SPKP G
Sbjct  460  PHGSPYLHHTK-SPKPIG  476



>ref|XP_010425648.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Camelina sativa]
Length=477

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 100/141 (71%), Gaps = 15/141 (11%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEW RPHL +K+R  RL+DPRLEGH+SIKGAQKA Q+AA+CL+RD KARP MSE+
Sbjct  344  GEQNLVEWVRPHLLDKKRLCRLLDPRLEGHYSIKGAQKATQVAAQCLNRDSKARPKMSEI  403

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI------VFSKNGQQNPRSLSIP  264
            VEALKPLPNLKD ASSS  FQTMQ       P  KNG+        S+NG    RSLS  
Sbjct  404  VEALKPLPNLKDFASSSSSFQTMQ-------PVAKNGVRTQGGGFVSRNGPPM-RSLSSL  455

Query  263  NGSHASPYRQFSQNSPKPNGK  201
            N   ASPYR +++ SPKP GK
Sbjct  456  NLPQASPYR-YARQSPKPKGK  475



>ref|XP_010425649.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Camelina sativa]
Length=476

 Score =   157 bits (398),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 100/141 (71%), Gaps = 15/141 (11%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEW RPHL +K+R  RL+DPRLEGH+SIKGAQKA Q+AA+CL+RD KARP MSE+
Sbjct  343  GEQNLVEWVRPHLLDKKRLCRLLDPRLEGHYSIKGAQKATQVAAQCLNRDSKARPKMSEI  402

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI------VFSKNGQQNPRSLSIP  264
            VEALKPLPNLKD ASSS  FQTMQ       P  KNG+        S+NG    RSLS  
Sbjct  403  VEALKPLPNLKDFASSSSSFQTMQ-------PVAKNGVRTQGGGFVSRNGPPM-RSLSSL  454

Query  263  NGSHASPYRQFSQNSPKPNGK  201
            N   ASPYR +++ SPKP GK
Sbjct  455  NLPQASPYR-YARQSPKPKGK  474



>gb|KHG03635.1| hypothetical protein F383_28355 [Gossypium arboreum]
Length=464

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 103/139 (74%), Gaps = 10/139 (7%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRF+R++DPRLEGHFSIKGAQKAAQLAA+CLSRDPKARP MSEV
Sbjct  330  GEHNLVEWARPHLGDKRRFFRILDPRLEGHFSIKGAQKAAQLAAQCLSRDPKARPRMSEV  389

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            +E LKPLPNLKDMASSSYYFQTMQ++R  S+ N KNG      F     Q  RSLS    
Sbjct  390  IEILKPLPNLKDMASSSYYFQTMQSNRNRSNVNAKNGTRAQAGFVVRKGQPMRSLS----  445

Query  257  SHASPYRQFSQNSPKPNGK  201
              AS   Q    SPKP  K
Sbjct  446  --ASSNHQAPHPSPKPKAK  462



>gb|KJB33658.1| hypothetical protein B456_006G024600 [Gossypium raimondii]
 gb|KJB33659.1| hypothetical protein B456_006G024600 [Gossypium raimondii]
Length=464

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 103/139 (74%), Gaps = 10/139 (7%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRF+R++DPRLEGHFSIKGAQKAAQLAA+CL+RDPKARP MSEV
Sbjct  330  GEHNLVEWARPHLGDKRRFFRILDPRLEGHFSIKGAQKAAQLAAQCLNRDPKARPRMSEV  389

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VE LKPLPNLKDMASSSYYFQTMQ++R  S+ N KNG      F     Q  RSLS    
Sbjct  390  VEILKPLPNLKDMASSSYYFQTMQSNRNRSNVNAKNGTRAQAGFVVRKGQPMRSLS----  445

Query  257  SHASPYRQFSQNSPKPNGK  201
              AS   Q    SPKP  K
Sbjct  446  --ASSNHQAPHPSPKPKAK  462



>gb|EYU34094.1| hypothetical protein MIMGU_mgv1a005466mg [Erythranthe guttata]
 gb|EYU34095.1| hypothetical protein MIMGU_mgv1a005466mg [Erythranthe guttata]
Length=482

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 95/132 (72%), Gaps = 7/132 (5%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARP+L E+RRFY+LIDPRLEG FSIKGAQ+A QLAARCLSR+ K RP MSEV
Sbjct  346  GEHNLVEWARPYLGERRRFYKLIDPRLEGRFSIKGAQQAVQLAARCLSREAKIRPAMSEV  405

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRI-ASSPNTKNGIVFSKNGQQNP-RSLSIPNGSH  252
            VEAL+PLP L DMASSS YFQ M A R   SS N + G     N  Q P RS S+PN  +
Sbjct  406  VEALEPLPGLTDMASSSSYFQAMSAARAGGSSLNARMG-----NRLQPPARSPSMPNRYY  460

Query  251  ASPYRQFSQNSP  216
             SPY   S N P
Sbjct  461  GSPYHNNSNNVP  472



>gb|KJB33655.1| hypothetical protein B456_006G024600 [Gossypium raimondii]
Length=520

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 103/139 (74%), Gaps = 10/139 (7%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GEHN VEWARPHL +KRRF+R++DPRLEGHFSIKGAQKAAQLAA+CL+RDPKARP MSEV
Sbjct  386  GEHNLVEWARPHLGDKRRFFRILDPRLEGHFSIKGAQKAAQLAAQCLNRDPKARPRMSEV  445

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNG  258
            VE LKPLPNLKDMASSSYYFQTMQ++R  S+ N KNG      F     Q  RSLS    
Sbjct  446  VEILKPLPNLKDMASSSYYFQTMQSNRNRSNVNAKNGTRAQAGFVVRKGQPMRSLS----  501

Query  257  SHASPYRQFSQNSPKPNGK  201
              AS   Q    SPKP  K
Sbjct  502  --ASSNHQAPHPSPKPKAK  518



>ref|XP_002875462.1| kinase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51721.1| kinase [Arabidopsis lyrata subsp. lyrata]
Length=476

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 99/140 (71%), Gaps = 15/140 (11%)
 Frame = -3

Query  602  EHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVV  423
            E N VEW RPHL +K+R  RL+DPRLEGH+SIKGAQKA Q+AA+CL+RD KARP MSEVV
Sbjct  344  EQNLVEWVRPHLLDKKRLCRLLDPRLEGHYSIKGAQKATQVAAQCLNRDSKARPKMSEVV  403

Query  422  EALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI------VFSKNGQQNPRSLSIPN  261
            EALKPLPNLKD ASSS  FQTMQ       P  KNG+        S+NG    RSLS  N
Sbjct  404  EALKPLPNLKDFASSSSSFQTMQ-------PVAKNGVRTQGGGFVSRNGPPM-RSLSSLN  455

Query  260  GSHASPYRQFSQNSPKPNGK  201
               ASPYR +++ SPKP GK
Sbjct  456  LPQASPYR-YARQSPKPKGK  474



>ref|XP_010514576.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Camelina 
sativa]
Length=477

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 98/141 (70%), Gaps = 15/141 (11%)
 Frame = -3

Query  605  GEHNXVEWARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV  426
            GE N VEW RPHL +K+R  RL+DPRLEGH+SIKGAQKA Q+AA+CL+RD KARP MSE+
Sbjct  344  GEQNLVEWVRPHLLDKKRLCRLLDPRLEGHYSIKGAQKATQVAAQCLNRDSKARPKMSEI  403

Query  425  VEALKPLPNLKDMASSSYYFQTMQADRIASSPNTKNGI------VFSKNGQQNPRSLSIP  264
            VEALKPLPN KD ASSS  FQTMQ       P  KNG+        S+NG    RSLS  
Sbjct  404  VEALKPLPNFKDFASSSSSFQTMQ-------PVAKNGVRTQGGGFVSRNGPPM-RSLSSL  455

Query  263  NGSHASPYRQFSQNSPKPNGK  201
            N   ASPYR + + SPKP GK
Sbjct  456  NLPQASPYR-YVRQSPKPKGK  475



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800