BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF033E15

Length=737
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783881.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    151   3e-39   Nicotiana sylvestris
ref|XP_009626648.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    151   3e-39   Nicotiana tomentosiformis
ref|XP_006361583.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    150   9e-39   Solanum tuberosum [potatoes]
emb|CBI40665.3|  unnamed protein product                                149   1e-38   Vitis vinifera
ref|XP_009770718.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    149   3e-38   Nicotiana sylvestris
ref|XP_006360666.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    148   4e-38   Solanum tuberosum [potatoes]
ref|XP_004242864.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    148   6e-38   Solanum lycopersicum
ref|XP_002265606.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    148   6e-38   Vitis vinifera
ref|XP_007014459.1|  Phosphorylethanolamine cytidylyltransferase ...    147   1e-37   
gb|ABX10445.1|  ethanolamine-phosphate cytidylyltransferase 1           146   1e-37   Gossypium hirsutum [American cotton]
gb|KHG01776.1|  Ethanolamine-phosphate cytidylyltransferase             146   2e-37   Gossypium arboreum [tree cotton]
ref|XP_011017741.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    146   3e-37   Populus euphratica
gb|KJB23397.1|  hypothetical protein B456_004G096200                    145   3e-37   Gossypium raimondii
ref|XP_004240130.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    145   5e-37   Solanum lycopersicum
gb|KJB83345.1|  hypothetical protein B456_013G242400                    145   5e-37   Gossypium raimondii
gb|KDP45833.1|  hypothetical protein JCGZ_17440                         145   8e-37   Jatropha curcas
ref|XP_002526236.1|  conserved hypothetical protein                     144   1e-36   
ref|XP_010263306.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    144   1e-36   Nelumbo nucifera [Indian lotus]
emb|CDP20190.1|  unnamed protein product                                144   2e-36   Coffea canephora [robusta coffee]
ref|XP_004149674.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    136   2e-36   
ref|XP_009616437.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    143   3e-36   Nicotiana tomentosiformis
gb|AFK45455.1|  unknown                                                 135   3e-36   Medicago truncatula
ref|XP_011094065.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    143   4e-36   Sesamum indicum [beniseed]
ref|XP_002325231.2|  hypothetical protein POPTR_0018s13260g             142   5e-36   Populus trichocarpa [western balsam poplar]
ref|XP_002308992.1|  hypothetical protein POPTR_0006s07030g             142   6e-36   
ref|XP_011094071.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    141   1e-35   Sesamum indicum [beniseed]
ref|XP_004299778.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    141   1e-35   Fragaria vesca subsp. vesca
ref|XP_007222601.1|  hypothetical protein PRUPE_ppa006288mg             141   2e-35   Prunus persica
ref|XP_008223819.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    141   2e-35   Prunus mume [ume]
ref|XP_010106955.1|  Ethanolamine-phosphate cytidylyltransferase        140   2e-35   Morus notabilis
ref|XP_009770720.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    140   3e-35   Nicotiana sylvestris
ref|XP_011020099.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    140   5e-35   Populus euphratica
gb|KJB23398.1|  hypothetical protein B456_004G096200                    140   5e-35   Gossypium raimondii
gb|EYU25735.1|  hypothetical protein MIMGU_mgv1a007058mg                139   8e-35   Erythranthe guttata [common monkey flower]
gb|KDO54355.1|  hypothetical protein CISIN_1g0144871mg                  138   2e-34   Citrus sinensis [apfelsine]
ref|XP_006428518.1|  hypothetical protein CICLE_v10011809mg             138   2e-34   Citrus clementina [clementine]
ref|XP_004503546.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    138   2e-34   Cicer arietinum [garbanzo]
ref|XP_009616439.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    137   3e-34   
ref|XP_008453525.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    136   9e-34   Cucumis melo [Oriental melon]
ref|XP_009616433.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    136   1e-33   
ref|XP_009616438.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    135   2e-33   Nicotiana tomentosiformis
ref|XP_010048543.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    135   2e-33   Eucalyptus grandis [rose gum]
ref|XP_010688423.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    135   2e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004163014.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    135   3e-33   
ref|XP_009616436.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    135   3e-33   
ref|XP_008351357.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    135   3e-33   
ref|XP_010553187.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    133   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_009341732.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    132   2e-32   Pyrus x bretschneideri [bai li]
ref|XP_003525313.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    132   2e-32   Glycine max [soybeans]
ref|XP_007160226.1|  hypothetical protein PHAVU_002G303400g             132   3e-32   Phaseolus vulgaris [French bean]
ref|XP_009342823.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    132   3e-32   Pyrus x bretschneideri [bai li]
ref|XP_003630619.1|  Ethanolamine-phosphate cytidylyltransferase        132   4e-32   Medicago truncatula
gb|ACJ85759.1|  unknown                                                 132   4e-32   Medicago truncatula
ref|XP_003630620.1|  Ethanolamine-phosphate cytidylyltransferase        132   4e-32   
ref|XP_010505513.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    124   4e-32   
ref|XP_010529959.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    129   3e-31   Tarenaya hassleriana [spider flower]
gb|EEE51553.1|  hypothetical protein OsJ_32765                          129   3e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003530503.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    129   3e-31   Glycine max [soybeans]
gb|ABA91254.1|  phosphoethanolamine cytidylyltransferase, putativ...    128   3e-31   Oryza sativa Japonica Group [Japonica rice]
gb|AFW57038.1|  hypothetical protein ZEAMMB73_658422                    128   6e-31   
ref|NP_001066024.1|  Os12g0121300                                       128   6e-31   
gb|EEC67567.1|  hypothetical protein OsI_34911                          128   6e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_006663169.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    123   9e-31   Oryza brachyantha
ref|XP_009606107.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    128   1e-30   Nicotiana tomentosiformis
emb|CDP06353.1|  unnamed protein product                                127   2e-30   Coffea canephora [robusta coffee]
ref|XP_002450173.1|  hypothetical protein SORBIDRAFT_05g001470          127   2e-30   Sorghum bicolor [broomcorn]
ref|XP_011101976.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    127   2e-30   Sesamum indicum [beniseed]
ref|XP_004302493.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    127   2e-30   Fragaria vesca subsp. vesca
emb|CCW28789.1|  putative cytidylyltransferase                          127   2e-30   Arachis duranensis
ref|XP_010931423.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    126   3e-30   Elaeis guineensis
ref|XP_006293474.1|  hypothetical protein CARUB_v10023288mg             126   5e-30   Capsella rubella
ref|XP_010913784.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    125   6e-30   Elaeis guineensis
ref|XP_008788034.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    125   7e-30   Phoenix dactylifera
ref|XP_007140015.1|  hypothetical protein PHAVU_008G077100g             125   8e-30   Phaseolus vulgaris [French bean]
dbj|BAD03428.1|  putative phosphoethanolamine cytidylyltransferase      125   9e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008355152.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   1e-29   
ref|XP_004977412.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    125   1e-29   Setaria italica
ref|XP_009143367.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    125   1e-29   Brassica rapa
ref|XP_009801689.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    124   1e-29   Nicotiana sylvestris
ref|XP_006362326.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    124   1e-29   Solanum tuberosum [potatoes]
ref|XP_004249014.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    124   1e-29   Solanum lycopersicum
ref|XP_006659222.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    124   2e-29   Oryza brachyantha
ref|XP_004171635.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   2e-29   
ref|XP_010505515.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    124   2e-29   
ref|XP_004972545.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    124   2e-29   
gb|EMS66153.1|  Ethanolamine-phosphate cytidylyltransferase             122   3e-29   Triticum urartu
ref|XP_010517175.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    123   4e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010509160.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    123   4e-29   Camelina sativa [gold-of-pleasure]
ref|XP_008679350.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    123   4e-29   Zea mays [maize]
ref|NP_001170703.1|  hypothetical protein                               123   4e-29   Zea mays [maize]
gb|EPS71148.1|  hypothetical protein M569_03610                         122   6e-29   Genlisea aurea
gb|EMT02889.1|  Ethanolamine-phosphate cytidylyltransferase             122   6e-29   
ref|XP_006664291.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    123   6e-29   Oryza brachyantha
gb|KFK36771.1|  hypothetical protein AALP_AA4G168400                    123   6e-29   Arabis alpina [alpine rockcress]
ref|NP_181401.1|  ethanolamine-phosphate cytidylyltransferase           122   9e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008355786.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   1e-28   
ref|XP_008244222.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    122   1e-28   Prunus mume [ume]
ref|XP_006411085.1|  hypothetical protein EUTSA_v10016709mg             122   1e-28   Eutrema salsugineum [saltwater cress]
ref|XP_003573570.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    122   2e-28   Brachypodium distachyon [annual false brome]
ref|XP_008804653.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    121   2e-28   Phoenix dactylifera
dbj|BAJ95410.1|  predicted protein                                      121   2e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010928770.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    121   2e-28   
ref|XP_010928769.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    121   2e-28   Elaeis guineensis
ref|XP_002990148.1|  hypothetical protein SELMODRAFT_131236             121   3e-28   
ref|XP_009133281.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    121   3e-28   Brassica rapa
ref|XP_003564627.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    120   3e-28   
ref|XP_002992541.1|  hypothetical protein SELMODRAFT_162424             120   3e-28   Selaginella moellendorffii
ref|XP_007207330.1|  hypothetical protein PRUPE_ppa006076mg             120   3e-28   Prunus persica
ref|XP_002879759.1|  hypothetical protein ARALYDRAFT_903103             120   4e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_010922838.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    120   6e-28   Elaeis guineensis
gb|EEC66861.1|  hypothetical protein OsI_33354                          119   7e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_009410481.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   8e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009337844.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   8e-28   Pyrus x bretschneideri [bai li]
ref|XP_009384337.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   8e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008781724.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   9e-28   Phoenix dactylifera
ref|XP_003552337.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   9e-28   Glycine max [soybeans]
ref|XP_009141755.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   1e-27   Brassica rapa
ref|XP_009370855.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   1e-27   Pyrus x bretschneideri [bai li]
ref|XP_004972544.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   1e-27   
ref|XP_003577861.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   1e-27   Brachypodium distachyon [annual false brome]
dbj|BAK04174.1|  predicted protein                                      119   1e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAO43227.1|  phosphoethanolamine cytidylyltransferase                119   1e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006842638.1|  hypothetical protein AMTR_s00077p00187820          119   2e-27   
emb|CDM85025.1|  unnamed protein product                                119   2e-27   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004978492.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   2e-27   Setaria italica
gb|EAZ15919.1|  hypothetical protein OsJ_31340                          119   2e-27   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064493.1|  Os10g0387000                                       118   2e-27   
ref|XP_010278899.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   2e-27   Nelumbo nucifera [Indian lotus]
ref|XP_009381352.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008370315.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   2e-27   
gb|KJB27590.1|  hypothetical protein B456_005G001400                    118   3e-27   Gossypium raimondii
emb|CDX91484.1|  BnaC04g06660D                                          118   3e-27   
emb|CDX74894.1|  BnaA05g06400D                                          118   3e-27   
ref|XP_008358193.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   3e-27   
dbj|BAJ86064.1|  predicted protein                                      118   3e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004972543.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   4e-27   
ref|XP_004137664.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   5e-27   Cucumis sativus [cucumbers]
ref|XP_002323699.2|  hypothetical protein POPTR_0016s15020g             117   6e-27   Populus trichocarpa [western balsam poplar]
gb|EMT24851.1|  Ethanolamine-phosphate cytidylyltransferase             117   6e-27   
gb|EMS51700.1|  Ethanolamine-phosphate cytidylyltransferase             117   6e-27   Triticum urartu
gb|EYU26697.1|  hypothetical protein MIMGU_mgv1a007403mg                117   6e-27   Erythranthe guttata [common monkey flower]
gb|KDP21814.1|  hypothetical protein JCGZ_00601                         117   7e-27   Jatropha curcas
ref|XP_008442304.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    116   8e-27   Cucumis melo [Oriental melon]
ref|XP_011006223.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    116   9e-27   Populus euphratica
ref|XP_010036047.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    116   1e-26   Eucalyptus grandis [rose gum]
ref|XP_008442303.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    116   1e-26   Cucumis melo [Oriental melon]
ref|XP_001759318.1|  predicted protein                                  116   1e-26   
ref|XP_003533643.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    116   1e-26   Glycine max [soybeans]
ref|XP_008442302.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    116   2e-26   Cucumis melo [Oriental melon]
gb|EPS64234.1|  hypothetical protein M569_10547                         115   3e-26   Genlisea aurea
ref|XP_006429675.1|  hypothetical protein CICLE_v10011843mg             115   3e-26   Citrus clementina [clementine]
emb|CDY07710.1|  BnaA03g18010D                                          115   3e-26   Brassica napus [oilseed rape]
emb|CDY14442.1|  BnaC03g21530D                                          115   4e-26   Brassica napus [oilseed rape]
ref|XP_010036048.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    114   5e-26   
ref|XP_003579008.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    114   6e-26   Brachypodium distachyon [annual false brome]
ref|XP_010684667.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    114   8e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006587893.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    113   1e-25   Glycine max [soybeans]
gb|KEH23310.1|  ethanolamine-phosphate cytidylyltransferase             112   2e-25   Medicago truncatula
ref|XP_009151252.1|  PREDICTED: uncharacterized protein LOC103874581    114   2e-25   Brassica rapa
ref|XP_004972546.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    113   2e-25   
gb|KHN29458.1|  Ethanolamine-phosphate cytidylyltransferase             112   3e-25   Glycine soja [wild soybean]
ref|XP_001780359.1|  predicted protein                                  112   3e-25   
ref|XP_004972542.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    112   4e-25   
ref|XP_003623695.1|  Ethanolamine-phosphate cytidylyltransferase        111   5e-25   
gb|AES79913.2|  ethanolamine-phosphate cytidylyltransferase             111   5e-25   Medicago truncatula
ref|XP_011018911.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   5e-25   Populus euphratica
gb|AFK43034.1|  unknown                                                 111   5e-25   Medicago truncatula
ref|XP_006381291.1|  hypothetical protein POPTR_0006s11470g             111   8e-25   
emb|CBI31131.3|  unnamed protein product                                110   9e-25   Vitis vinifera
ref|XP_002265169.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   2e-24   Vitis vinifera
emb|CAQ58636.1|  Ethanolamine-phosphate cytidylyltransferase            110   2e-24   Vitis vinifera
ref|XP_002519980.1|  Ethanolamine-phosphate cytidylyltransferase,...    109   3e-24   Ricinus communis
ref|XP_004492610.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    108   8e-24   Cicer arietinum [garbanzo]
ref|XP_010113033.1|  Ethanolamine-phosphate cytidylyltransferase        107   1e-23   
gb|EEC68755.1|  hypothetical protein OsI_37278                          105   5e-23   Oryza sativa Indica Group [Indian rice]
gb|EMT25098.1|  Ethanolamine-phosphate cytidylyltransferase             105   6e-23   
emb|CDY18374.1|  BnaA04g22130D                                          103   3e-22   Brassica napus [oilseed rape]
gb|ABX10446.1|  ethanolamine-phosphate cytidylyltransferase 2         99.4    1e-20   Gossypium hirsutum [American cotton]
emb|CDY48653.1|  BnaC07g27560D                                          100   3e-20   Brassica napus [oilseed rape]
ref|XP_005538734.1|  phosphoethanolamine cytidylyltransferase         94.0    1e-18   Cyanidioschyzon merolae strain 10D
ref|XP_010913786.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  89.7    2e-17   
ref|XP_005647873.1|  CTP-phosphoethanolamine cytidylyltransferase     90.1    3e-17   Coccomyxa subellipsoidea C-169
ref|XP_005845984.1|  hypothetical protein CHLNCDRAFT_25204            84.3    4e-16   Chlorella variabilis
ref|XP_005714716.1|  Ethanolamine-phosphate cytidylyltransferase,...  85.1    1e-15   Chondrus crispus [carageen]
emb|CDY52476.1|  BnaC07g49370D                                        79.0    9e-15   Brassica napus [oilseed rape]
ref|XP_004368196.1|  CTP:ethanolaminephosphate cytidylyltransferase   81.6    1e-14   Acanthamoeba castellanii str. Neff
ref|XP_001008378.1|  cytidyltransferase-related domain containing...  81.3    3e-14   Tetrahymena thermophila SB210
ref|XP_002950808.1|  hypothetical protein VOLCADRAFT_109104           80.9    4e-14   Volvox carteri f. nagariensis
ref|XP_004032276.1|  hypothetical protein IMG5_125800                 79.7    7e-14   Ichthyophthirius multifiliis
ref|XP_010774781.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  78.6    9e-14   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_002155934.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  78.6    2e-13   Hydra vulgaris
ref|XP_007236102.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  77.4    2e-13   
ref|XP_005989106.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  78.6    2e-13   Latimeria chalumnae
ref|XP_005597110.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  76.6    3e-13   
emb|CEG66905.1|  Putative Ethanolamine-phosphate cytidylyltransfe...  77.8    3e-13   Rhizopus microsporus
emb|CEG84347.1|  Putative Ethanolamine-phosphate cytidylyltransfe...  77.8    3e-13   Rhizopus microsporus
ref|XP_005805135.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  77.8    3e-13   Xiphophorus maculatus
ref|XP_008408685.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  77.8    4e-13   Poecilia reticulata
gb|AAK13093.1|AC078839_9  Putative phospholipid cytidylyltransferase  78.6    4e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007570241.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  77.4    5e-13   Poecilia formosa
ref|XP_010870922.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  77.0    7e-13   Esox lucius
ref|XP_005597109.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  76.6    7e-13   
ref|XP_010143924.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.5    8e-13   Buceros rhinoceros silvestris
ref|XP_004559465.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.5    9e-13   Maylandia zebra
ref|XP_005597108.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  76.3    9e-13   
ref|NP_001167040.1|  Ethanolamine-phosphate cytidylyltransferase      76.6    1e-12   Salmo salar
ref|XP_003964731.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  76.3    1e-12   
ref|XP_005925138.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  76.3    1e-12   
ref|XP_005925137.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  76.3    1e-12   Haplochromis burtoni
ref|XP_003455812.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  76.3    1e-12   Oreochromis niloticus
ref|XP_006790764.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  76.3    1e-12   Neolamprologus brichardi [lyretail cichlid]
ref|NP_001006037.1|  ethanolamine-phosphate cytidylyltransferase      75.9    1e-12   Danio rerio [leopard danio]
ref|XP_010743291.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.9    2e-12   Larimichthys crocea [croceine croaker]
ref|XP_007243145.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.9    2e-12   
ref|XP_004559464.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.5    2e-12   
ref|XP_006635464.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.9    2e-12   Lepisosteus oculatus
ref|XP_010143917.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.1    2e-12   Buceros rhinoceros silvestris
ref|XP_002672471.1|  predicted protein                                75.5    2e-12   Naegleria gruberi strain NEG-M
ref|XP_006753085.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  74.7    2e-12   Myotis davidii
ref|XP_005735765.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.9    2e-12   
ref|XP_004539072.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.5    2e-12   Maylandia zebra
ref|XP_001851245.1|  ethanolamine-phosphate cytidylyltransferase      75.5    2e-12   Culex quinquefasciatus
emb|CEG84904.1|  Putative Ethanolamine-phosphate cytidylyltransfe...  70.9    2e-12   Rhizopus microsporus
ref|XP_006753084.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  74.7    2e-12   Myotis davidii
ref|XP_008278508.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.5    2e-12   Stegastes partitus
ref|XP_009308303.1|  putative ethanolamine-phosphate cytidylyltra...  75.5    2e-12   Trypanosoma grayi
ref|XP_001692963.1|  CDP-Ethanolamine synthase                        75.5    2e-12   Chlamydomonas reinhardtii
ref|XP_010080655.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.9    3e-12   Pterocles gutturalis
ref|XP_008301525.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.1    3e-12   Stegastes partitus
ref|XP_004559463.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.1    3e-12   Maylandia zebra
ref|XP_010728353.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.1    3e-12   Larimichthys crocea [croceine croaker]
ref|XP_003450120.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.1    3e-12   Oreochromis niloticus
emb|CEG75719.1|  Putative Ethanolamine-phosphate cytidylyltransfe...  74.7    3e-12   Rhizopus microsporus
ref|XP_008518630.1|  PREDICTED: LOW QUALITY PROTEIN: ethanolamine...  74.7    3e-12   Equus przewalskii [Przewalski horse]
ref|XP_009874095.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    3e-12   Apaloderma vittatum
ref|XP_006108014.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  74.3    3e-12   
ref|XP_005350939.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  74.3    4e-12   
gb|EIE92478.1|  hypothetical protein RO3G_17000                       73.9    4e-12   Rhizopus delemar RA 99-880
ref|XP_006753083.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  74.3    4e-12   Myotis davidii
ref|XP_011304879.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.9    4e-12   Fopius arisanus
ref|XP_011478363.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  74.3    4e-12   
ref|XP_002782897.1|  Choline-phosphate cytidylyltransferase A, pu...  71.6    4e-12   Perkinsus marinus ATCC 50983
ref|XP_010201094.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    4e-12   Colius striatus
ref|XP_009080963.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  74.3    4e-12   Acanthisitta chloris
emb|CEG75718.1|  Putative Ethanolamine-phosphate cytidylyltransfe...  74.3    4e-12   Rhizopus microsporus
ref|XP_006753082.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  74.3    4e-12   Myotis davidii
ref|XP_003931691.2|  PREDICTED: ethanolamine-phosphate cytidylylt...  74.3    5e-12   Saimiri boliviensis boliviensis
emb|CEF71025.1|  Ethanolamine-phosphate cytidylyltransferase          74.7    5e-12   Strongyloides ratti
gb|EDM06870.1|  phosphate cytidylyltransferase 2, ethanolamine, i...  70.5    5e-12   Rattus norvegicus [brown rat]
ref|XP_005283125.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.6    5e-12   Chrysemys picta bellii
ref|XP_004432926.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.9    5e-12   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_003931692.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  74.3    5e-12   Saimiri boliviensis boliviensis
ref|XP_004621165.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.2    5e-12   Sorex araneus [Eurasian shrew]
ref|XP_008153350.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  74.3    6e-12   
ref|XP_006108013.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  74.3    6e-12   Myotis lucifugus
ref|XP_001623420.1|  predicted protein                                73.9    6e-12   Nematostella vectensis
ref|XP_006108012.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  74.3    6e-12   Myotis lucifugus
ref|XP_011304878.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.9    6e-12   Fopius arisanus
ref|XP_006987734.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.9    6e-12   Peromyscus maniculatus bairdii
ref|XP_003972083.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  74.3    6e-12   Takifugu rubripes [tiger puffer]
gb|KFO84331.1|  Ethanolamine-phosphate cytidylyltransferase           73.6    6e-12   Buceros rhinoceros silvestris
ref|XP_004071464.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.9    7e-12   Oryzias latipes [Japanese rice fish]
ref|XP_005350938.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.9    7e-12   Microtus ochrogaster [prairie voles]
dbj|BAE02335.1|  unnamed protein product                              72.0    7e-12   Macaca fascicularis [crab eating macaque]
ref|XP_008327791.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.2    7e-12   
ref|XP_003768669.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.9    8e-12   
ref|XP_005350937.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.9    8e-12   Microtus ochrogaster [prairie voles]
emb|CAG06029.1|  unnamed protein product                              73.9    8e-12   Tetraodon nigroviridis
ref|XP_008165931.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.6    8e-12   
ref|XP_008574518.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    8e-12   Galeopterus variegatus [Malayan flying lemur]
ref|XP_006987733.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.9    8e-12   Peromyscus maniculatus bairdii
ref|XP_005011600.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.6    8e-12   
ref|XP_004353870.1|  phosphoethanolamine-cytidyltransferase           73.6    8e-12   Cavenderia fasciculata
emb|CEP18288.1|  hypothetical protein                                 73.6    9e-12   Parasitella parasitica
ref|XP_004695585.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.6    9e-12   Condylura cristata
ref|XP_009092525.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    9e-12   
ref|XP_008939759.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    9e-12   Merops nubicus
gb|KDO54356.1|  hypothetical protein CISIN_1g0144871mg                73.6    1e-11   Citrus sinensis [apfelsine]
ref|XP_009987641.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    1e-11   Tauraco erythrolophus
ref|XP_007556416.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.6    1e-11   
ref|XP_010282190.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    1e-11   
gb|KFP79007.1|  Ethanolamine-phosphate cytidylyltransferase           70.9    1e-11   
gb|KDO54357.1|  hypothetical protein CISIN_1g0144871mg                73.6    1e-11   
ref|XP_010127567.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    1e-11   
ref|XP_004177012.1|  PREDICTED: LOW QUALITY PROTEIN: ethanolamine...  73.2    1e-11   
ref|XP_005283123.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.6    1e-11   
ref|XP_009642454.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    1e-11   
ref|XP_009930965.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    1e-11   
ref|XP_009485599.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    1e-11   
gb|KIZ02908.1|  ethanolamine-phosphatecytidylyltransferase            73.6    1e-11   
ref|XP_007482915.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    1e-11   
gb|KFP25915.1|  Ethanolamine-phosphate cytidylyltransferase           70.9    1e-11   
ref|XP_009465225.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    1e-11   
ref|XP_008920033.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    1e-11   
ref|XP_009944224.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    1e-11   
ref|XP_005069860.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.2    1e-11   
gb|KFV14382.1|  Ethanolamine-phosphate cytidylyltransferase           71.6    1e-11   
ref|XP_005069859.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.2    1e-11   
ref|XP_010769178.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    1e-11   
ref|XP_005508410.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    1e-11   
ref|XP_646687.1|  hypothetical protein DDB_G0270298                   72.8    1e-11   
ref|XP_009557287.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    1e-11   
emb|CEI95984.1|  Putative Ethanolamine-phosphate cytidylyltransfe...  70.5    1e-11   
ref|XP_010019461.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    1e-11   
ref|XP_005530696.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    1e-11   
ref|XP_009926039.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    1e-11   
ref|XP_009667071.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    2e-11   
ref|XP_009926038.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    2e-11   
ref|XP_008574516.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    2e-11   
ref|XP_011247510.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    2e-11   
ref|XP_008327790.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    2e-11   
ref|XP_010411684.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    2e-11   
ref|XP_005429859.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    2e-11   
ref|XP_005056300.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    2e-11   
ref|XP_006145690.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    2e-11   
ref|XP_001651208.1|  AAEL005651-PA                                    72.8    2e-11   
ref|XP_007886883.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    2e-11   
ref|NP_001086220.1|  phosphate cytidylyltransferase 2, ethanolamine   72.8    2e-11   
ref|XP_008492788.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    2e-11   
gb|EFX78214.1|  hypothetical protein DAPPUDRAFT_305267                72.4    2e-11   
ref|XP_010719650.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    2e-11   
ref|XP_005508409.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    2e-11   
ref|XP_005801499.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    2e-11   
ref|XP_006145686.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    2e-11   
ref|XP_007482912.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    2e-11   
ref|XP_009987640.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    2e-11   
ref|XP_009926037.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    2e-11   
ref|XP_005495710.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    2e-11   
gb|KFP88627.1|  Ethanolamine-phosphate cytidylyltransferase           72.0    2e-11   
ref|XP_001379677.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    2e-11   
ref|XP_002423231.1|  Ethanolamine-phosphate cytidylyltransferase,...  72.8    2e-11   
ref|XP_002611477.1|  hypothetical protein BRAFLDRAFT_113520           72.4    2e-11   
ref|XP_005508408.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    2e-11   
ref|XP_009574039.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    2e-11   
ref|NP_001243364.1|  ethanolamine-phosphate cytidylyltransferase ...  71.6    2e-11   
ref|XP_003831150.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    2e-11   
ref|XP_010209813.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    2e-11   
ref|XP_007652345.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    2e-11   
ref|XP_004040835.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    2e-11   
ref|XP_010127566.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    2e-11   
dbj|BAG52690.1|  unnamed protein product                              71.6    2e-11   
ref|XP_010311275.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    2e-11   
ref|NP_001278895.1|  ethanolamine-phosphate cytidylyltransferase      72.0    2e-11   
ref|XP_005144256.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    2e-11   
ref|XP_010282186.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    2e-11   
ref|XP_009642437.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    2e-11   
ref|XP_009814381.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    2e-11   
ref|XP_009465224.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    2e-11   
ref|XP_006038731.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    2e-11   
ref|XP_009930949.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    2e-11   
ref|XP_005495709.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    2e-11   
ref|XP_003211513.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    2e-11   
ref|XP_005144257.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    2e-11   
ref|XP_004593054.1|  PREDICTED: uncharacterized protein LOC101530952  73.2    2e-11   
ref|XP_009485598.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    2e-11   
ref|XP_010282187.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    2e-11   
ref|XP_009277662.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    2e-11   
ref|XP_008920032.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    2e-11   
ref|XP_009944209.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    2e-11   
ref|XP_009667070.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    2e-11   
ref|XP_005530695.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    3e-11   
ref|XP_009704648.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    3e-11   
ref|NP_001243362.1|  ethanolamine-phosphate cytidylyltransferase ...  71.6    3e-11   
ref|XP_005801498.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    3e-11   
ref|XP_005801497.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    3e-11   
ref|XP_006912212.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.9    3e-11   
ref|XP_003283291.1|  phosphoethanolamine-cytidyltransferase           72.0    3e-11   
ref|XP_005585334.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    3e-11   
dbj|GAM28819.1|  hypothetical protein SAMD00019534_119950             72.0    3e-11   
ref|XP_007652337.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    3e-11   
ref|XP_011335797.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    3e-11   
ref|XP_007538295.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    3e-11   
ref|XP_007063441.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    3e-11   
ref|XP_009027596.1|  hypothetical protein HELRODRAFT_107813           72.0    3e-11   
ref|NP_001269133.1|  ethanolamine-phosphate cytidylyltransferase ...  71.6    3e-11   
ref|XP_004040834.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    3e-11   
ref|XP_008011481.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    3e-11   
ref|XP_008996160.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    3e-11   
ref|XP_009944216.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    3e-11   
dbj|BAH12702.1|  unnamed protein product                              71.6    3e-11   
ref|XP_003831149.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    3e-11   
ref|XP_008996159.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    3e-11   
ref|XP_005585333.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    3e-11   
ref|XP_009189750.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    3e-11   
gb|KFQ30887.1|  Ethanolamine-phosphate cytidylyltransferase           69.3    3e-11   
ref|XP_001011315.1|  cytidyltransferase-related domain containing...  72.4    3e-11   
ref|XP_009930958.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    3e-11   
ref|XP_010769177.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    3e-11   
ref|XP_787725.3|  PREDICTED: ethanolamine-phosphate cytidylyltran...  69.7    3e-11   
ref|NP_001243363.1|  ethanolamine-phosphate cytidylyltransferase ...  71.6    3e-11   
ref|XP_002060439.1|  GJ14912                                          68.9    4e-11   
ref|XP_006145689.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    4e-11   
gb|EHH58431.1|  hypothetical protein EGM_08284                        71.6    4e-11   
ref|XP_005585331.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    4e-11   
ref|XP_004040836.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    4e-11   
ref|XP_003701917.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    4e-11   
ref|XP_829470.1|  ethanolamine-phosphate cytidylyltransferase         72.0    4e-11   
ref|XP_008996158.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    4e-11   
ref|XP_004655111.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    4e-11   
ref|XP_005256443.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    4e-11   
ref|XP_006270716.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    4e-11   
ref|XP_008954739.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    4e-11   
ref|XP_819288.1|  ethanolamine-phosphate cytidylyltransferase         71.6    4e-11   
emb|CCC54014.1|  putative ethanolamine-phosphate cytidylyltransfe...  71.6    4e-11   
ref|XP_011335781.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    4e-11   
ref|XP_003786588.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    4e-11   
emb|CAH91892.1|  hypothetical protein                                 71.6    4e-11   
gb|EOB07183.1|  Ethanolamine-phosphate cytidylyltransferase           71.2    4e-11   
gb|AAH10075.1|  Phosphate cytidylyltransferase 2, ethanolamine        71.6    4e-11   
ref|XP_006199519.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.9    4e-11   
ref|NP_002852.1|  ethanolamine-phosphate cytidylyltransferase iso...  71.6    4e-11   
ref|XP_003913624.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    4e-11   
ref|XP_007652324.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.2    4e-11   
gb|ELW68195.1|  Ethanolamine-phosphate cytidylyltransferase           72.4    4e-11   
ref|XP_010948950.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.9    4e-11   
ref|XP_007185942.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.9    4e-11   
ref|XP_005585332.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    4e-11   
ref|XP_007125690.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.9    5e-11   
ref|XP_004861030.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.2    5e-11   
ref|XP_011153206.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.2    5e-11   
ref|XP_005585330.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    5e-11   
ref|XP_008996157.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    5e-11   
ref|XP_008011480.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    5e-11   
ref|NP_001171846.1|  ethanolamine-phosphate cytidylyltransferase ...  71.6    5e-11   
ref|XP_320056.4|  AGAP009264-PA                                       71.2    5e-11   
ref|XP_007652319.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.2    5e-11   
ref|XP_002607683.1|  hypothetical protein BRAFLDRAFT_82871            71.2    5e-11   
gb|EHB09343.1|  Ethanolamine-phosphate cytidylyltransferase           71.2    5e-11   
ref|XP_004894622.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.2    5e-11   
ref|XP_008011479.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    5e-11   
ref|NP_001011300.1|  ethanolamine-phosphate cytidylyltransferase      71.2    5e-11   
ref|XP_002806926.3|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    6e-11   
ref|XP_006940730.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    6e-11   
ref|XP_006743153.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    6e-11   
ref|XP_010175405.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.2    6e-11   
ref|XP_004894621.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.2    6e-11   
gb|EMP32451.1|  Ethanolamine-phosphate cytidylyltransferase           72.0    6e-11   
ref|XP_010854636.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    6e-11   
gb|ESL06891.1|  ethanolamine-phosphate cytidylyltransferase           71.2    6e-11   
ref|XP_007125689.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.9    6e-11   
ref|XP_011503865.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.2    6e-11   
ref|XP_005407305.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.2    6e-11   
gb|EIE76135.1|  hypothetical protein RO3G_00839                       71.2    6e-11   
gb|ELU08724.1|  hypothetical protein CAPTEDRAFT_162811                69.3    6e-11   
ref|XP_004861028.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.2    6e-11   
ref|XP_006912211.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.9    6e-11   
ref|XP_008058604.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.9    6e-11   
ref|XP_004639529.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.2    6e-11   
gb|EMC84069.1|  Ethanolamine-phosphate cytidylyltransferase           70.5    7e-11   
ref|XP_007482914.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.9    7e-11   
ref|XP_008414452.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.2    7e-11   
ref|XP_005407304.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.2    7e-11   
ref|XP_011006224.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.9    7e-11   
ref|XP_011262173.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.9    8e-11   
ref|XP_011398757.1|  Ethanolamine-phosphate cytidylyltransferase      71.2    8e-11   
ref|XP_010854635.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    8e-11   
ref|XP_007185940.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.9    8e-11   
ref|XP_004861027.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.9    8e-11   
gb|KFP01530.1|  Ethanolamine-phosphate cytidylyltransferase           70.5    8e-11   
gb|KFO52931.1|  Ethanolamine-phosphate cytidylyltransferase           70.5    8e-11   
ref|XP_006199517.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.9    8e-11   
ref|XP_004275630.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.9    8e-11   
ref|XP_007125688.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.9    8e-11   
ref|XP_005624050.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    8e-11   
ref|XP_006172758.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    8e-11   
ref|XP_010948951.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    8e-11   
ref|XP_006064294.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    8e-11   
ref|XP_006940729.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    8e-11   
ref|XP_004013110.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    9e-11   
ref|XP_004310339.1|  PREDICTED: LOW QUALITY PROTEIN: ethanolamine...  70.9    9e-11   
ref|XP_007482911.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.9    9e-11   
gb|KFV19828.1|  Ethanolamine-phosphate cytidylyltransferase           70.1    9e-11   
ref|XP_005979293.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    9e-11   
ref|XP_005407303.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.9    9e-11   
ref|XP_006199518.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    9e-11   
gb|KFQ43527.1|  Ethanolamine-phosphate cytidylyltransferase           69.7    9e-11   
ref|XP_007482910.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.9    9e-11   
gb|KFW03135.1|  Ethanolamine-phosphate cytidylyltransferase           70.1    9e-11   
gb|KFP38725.1|  Ethanolamine-phosphate cytidylyltransferase           70.1    9e-11   
ref|XP_008058606.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    9e-11   
gb|KFO03906.1|  Ethanolamine-phosphate cytidylyltransferase           70.1    9e-11   
ref|XP_005694113.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    9e-11   
ref|XP_008826609.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    9e-11   
ref|XP_007125687.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    1e-10   
gb|EKG04727.1|  ethanolamine-phosphate cytidylyltransferase, puta...  70.5    1e-10   
gb|KFV65365.1|  Ethanolamine-phosphate cytidylyltransferase           70.1    1e-10   
ref|XP_007427843.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    1e-10   
gb|KFQ66588.1|  Ethanolamine-phosphate cytidylyltransferase           70.1    1e-10   
ref|XP_006743151.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    1e-10   
gb|KFQ98930.1|  Ethanolamine-phosphate cytidylyltransferase           70.1    1e-10   
gb|KFO74744.1|  Ethanolamine-phosphate cytidylyltransferase           69.7    1e-10   
gb|KFM07623.1|  Ethanolamine-phosphate cytidylyltransferase           70.1    1e-10   
gb|KGL75135.1|  Ethanolamine-phosphate cytidylyltransferase           70.1    1e-10   
ref|XP_010998501.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    1e-10   
ref|XP_004527208.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.9    1e-10   
gb|KFQ02428.1|  Ethanolamine-phosphate cytidylyltransferase           70.1    1e-10   
ref|XP_004527209.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    1e-10   
gb|KFV47543.1|  Ethanolamine-phosphate cytidylyltransferase           70.1    1e-10   
ref|XP_008692086.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    1e-10   
ref|XP_005979292.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    1e-10   



>ref|XP_009783881.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nicotiana 
sylvestris]
 ref|XP_009783882.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nicotiana 
sylvestris]
Length=429

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+T+DMITTFNIS+VVHGTVSESNS ++   DPYAVPKSMGIF++I+S
Sbjct  326  RYVDEVIIGAPWEVTQDMITTFNISVVVHGTVSESNSSMEGGQDPYAVPKSMGIFQVIES  385

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PKDITTTSV QRIIANHEIYVKRN KK ASEKKYYA++KYVSG+
Sbjct  386  PKDITTTSVAQRIIANHEIYVKRNTKKAASEKKYYAQRKYVSGD  429



>ref|XP_009626648.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nicotiana 
tomentosiformis]
 ref|XP_009626649.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nicotiana 
tomentosiformis]
 ref|XP_009626650.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nicotiana 
tomentosiformis]
Length=429

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIG+PWE+T+DMITTFNISLVVHGTVSESNS ++   DPYAVPKSMGIF++I+S
Sbjct  326  RYVDEVIIGSPWEVTQDMITTFNISLVVHGTVSESNSSMEGGQDPYAVPKSMGIFQVIES  385

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PKDITTTSV QRIIANHEIYVKRN KK ASEKKYYAE+KYVSG+
Sbjct  386  PKDITTTSVAQRIIANHEIYVKRNTKKAASEKKYYAERKYVSGD  429



>ref|XP_006361583.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006361584.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Solanum tuberosum]
Length=429

 Score =   150 bits (379),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+T+DMITTFNISLVVHGTVSESNS  +   DPYAVPKSMGIF++I+S
Sbjct  326  RYVDEVIIGAPWEVTQDMITTFNISLVVHGTVSESNSSTEGGQDPYAVPKSMGIFQVIES  385

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PKDITT+SV QRIIANHEIYVKRN KK ASEKKYYAE+KYVSG+
Sbjct  386  PKDITTSSVAQRIIANHEIYVKRNTKKAASEKKYYAERKYVSGD  429



>emb|CBI40665.3| unnamed protein product [Vitis vinifera]
Length=362

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW++TKDMITTFNISLVVHGTV+ESNS L    DPY VPKSMGIF +++S
Sbjct  259  RYVDEVIIGAPWDVTKDMITTFNISLVVHGTVAESNSFLNGARDPYEVPKSMGIFHMLES  318

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PKDITTTSV QRIIANHE Y+KRN KK  SEKKYYAEKKYVSGE
Sbjct  319  PKDITTTSVAQRIIANHEAYMKRNVKKAESEKKYYAEKKYVSGE  362



>ref|XP_009770718.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009770719.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Nicotiana sylvestris]
Length=426

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+T+DM+TTFNIS+VVHGTVSE NS   +  DPYAVPK+MGIFR+I+S
Sbjct  323  RYVDEVIIGAPWEVTQDMVTTFNISVVVHGTVSERNSSTGERHDPYAVPKNMGIFRVIES  382

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PKDITTTSV QRIIANHEIYVKRNAKKEASEKKYYAEK+YVSG+
Sbjct  383  PKDITTTSVAQRIIANHEIYVKRNAKKEASEKKYYAEKQYVSGD  426



>ref|XP_006360666.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Solanum 
tuberosum]
Length=427

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+T DM+TTFNIS+VVHGTVSE NS   +  DPYAVPK+MGIFRII+S
Sbjct  324  RYVDEVIIGAPWEVTHDMVTTFNISVVVHGTVSERNSSTGEEHDPYAVPKNMGIFRIIES  383

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PKDITTTSV QRIIANHEIYVKRN+KKEASEKKYYAEK+YVSG+
Sbjct  384  PKDITTTSVAQRIIANHEIYVKRNSKKEASEKKYYAEKQYVSGD  427



>ref|XP_004242864.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Solanum 
lycopersicum]
 ref|XP_010323368.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Solanum 
lycopersicum]
Length=429

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+T+DMITTFNISLVVHGTVSESN   +   DPYAVPKSMGIF++I+S
Sbjct  326  RYVDEVIIGAPWEVTQDMITTFNISLVVHGTVSESNFSTEGGQDPYAVPKSMGIFQVIES  385

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PKDITT+SV QRIIANHEIYVKRN KK ASEKKYYAE+KYVSG+
Sbjct  386  PKDITTSSVAQRIIANHEIYVKRNTKKAASEKKYYAERKYVSGD  429



>ref|XP_002265606.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Vitis 
vinifera]
 ref|XP_010656673.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Vitis 
vinifera]
 ref|XP_010656675.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Vitis 
vinifera]
Length=431

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW++TKDMITTFNISLVVHGTV+ESNS L    DPY VPKSMGIF +++S
Sbjct  328  RYVDEVIIGAPWDVTKDMITTFNISLVVHGTVAESNSFLNGARDPYEVPKSMGIFHMLES  387

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PKDITTTSV QRIIANHE Y+KRN KK  SEKKYYAEKKYVSGE
Sbjct  388  PKDITTTSVAQRIIANHEAYMKRNVKKAESEKKYYAEKKYVSGE  431



>ref|XP_007014459.1| Phosphorylethanolamine cytidylyltransferase 1 isoform 1 [Theobroma 
cacao]
 ref|XP_007014460.1| Phosphorylethanolamine cytidylyltransferase 1 isoform 1 [Theobroma 
cacao]
 gb|EOY32078.1| Phosphorylethanolamine cytidylyltransferase 1 isoform 1 [Theobroma 
cacao]
 gb|EOY32079.1| Phosphorylethanolamine cytidylyltransferase 1 isoform 1 [Theobroma 
cacao]
Length=424

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+TKDMITTFNISLVVHGTV+ESN++L    DPYAVPKSMGIFR+++S
Sbjct  321  RYVDEVIIGAPWEVTKDMITTFNISLVVHGTVAESNTLLAGETDPYAVPKSMGIFRLLES  380

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            PK ITT+SV QRI+ANHE Y+KRN
Sbjct  381  PKRITTSSVAQRIVANHEAYMKRN  404



>gb|ABX10445.1| ethanolamine-phosphate cytidylyltransferase 1 [Gossypium hirsutum]
Length=384

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+TKDMITTFNIS+VVHGTV+ESNS+L    DPYA PKSMGIFR+++S
Sbjct  281  RYVDEVIIGAPWEVTKDMITTFNISIVVHGTVAESNSLLPGETDPYAFPKSMGIFRLLES  340

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PK +TT+SV QRI+ANHE YVKRNAKK  SE KYY EK YV+GE
Sbjct  341  PKSLTTSSVSQRIVANHEAYVKRNAKKAQSEMKYYEEKTYVAGE  384



>gb|KHG01776.1| Ethanolamine-phosphate cytidylyltransferase [Gossypium arboreum]
Length=425

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+TKDMITTFNIS+VVHGTV+ESNS+L    DPYA PKSMGIFR+++S
Sbjct  322  RYVDEVIIGAPWEVTKDMITTFNISIVVHGTVAESNSLLPGETDPYAFPKSMGIFRLLES  381

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PK +TT+SV QRI+ANHE YVKRNAKK  SE KYY EK YV+GE
Sbjct  382  PKSLTTSSVSQRIVANHEAYVKRNAKKAQSEMKYYEEKTYVAGE  425



>ref|XP_011017741.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Populus 
euphratica]
 ref|XP_011017742.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Populus 
euphratica]
Length=423

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+TKDM+TTFNI+LVVHGTV+E NS+L    DPYAVPKSMGIFR+++S
Sbjct  320  RYVDEVIIGAPWEVTKDMVTTFNITLVVHGTVAEKNSLLAGEPDPYAVPKSMGIFRMLES  379

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PK ITTTSV QRI+ANHE Y+KRNAKK  +EKKYYAEK YVSG+
Sbjct  380  PKTITTTSVAQRIVANHEAYLKRNAKKAENEKKYYAEKVYVSGD  423



>gb|KJB23397.1| hypothetical protein B456_004G096200 [Gossypium raimondii]
 gb|KJB23399.1| hypothetical protein B456_004G096200 [Gossypium raimondii]
Length=424

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+TKDMITTFNIS+VVHGTV+ESNS+L    DPYA PKSMGIFR+++S
Sbjct  321  RYVDEVIIGAPWEVTKDMITTFNISIVVHGTVAESNSLLPGETDPYAFPKSMGIFRLLES  380

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PK +TT+SV QRI+ANHE YVKRN KK  SE KYY EK YV+GE
Sbjct  381  PKSLTTSSVSQRIVANHEAYVKRNVKKAQSEMKYYEEKTYVAGE  424



>ref|XP_004240130.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Solanum 
lycopersicum]
 ref|XP_010321543.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Solanum 
lycopersicum]
Length=427

 Score =   145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+T DM+TTFNIS+VVHGTVSE NS   +  DPYAVPK+MGIFR+I+S
Sbjct  324  RYVDEVIIGAPWEVTHDMVTTFNISVVVHGTVSERNSSTGEEHDPYAVPKNMGIFRVIES  383

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PKDI TTSV QRIIANHEIYVKRN KKEASEKKYYAEK+YVSG+
Sbjct  384  PKDIITTSVAQRIIANHEIYVKRNTKKEASEKKYYAEKRYVSGD  427



>gb|KJB83345.1| hypothetical protein B456_013G242400 [Gossypium raimondii]
 gb|KJB83346.1| hypothetical protein B456_013G242400 [Gossypium raimondii]
Length=424

 Score =   145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+TKDMITTFNISLVVHGTV+ESNS L    DPYA+PKSMGIFR+++S
Sbjct  321  RYVDEVIIGAPWEVTKDMITTFNISLVVHGTVAESNSSLPGETDPYAIPKSMGIFRLLES  380

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            PK ITT+SV QRI+ NHE+Y+KRN
Sbjct  381  PKSITTSSVAQRIVTNHEVYMKRN  404



>gb|KDP45833.1| hypothetical protein JCGZ_17440 [Jatropha curcas]
Length=425

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGT++E NS+L    DPYAVPKSMGIF+I++S
Sbjct  322  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTIAECNSLLAGIPDPYAVPKSMGIFQILES  381

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PK+ITTTSV QRI+ANHE Y+KRNAKK  SEKKYYAEK YVSG+
Sbjct  382  PKNITTTSVAQRIVANHEAYMKRNAKKAESEKKYYAEKVYVSGD  425



>ref|XP_002526236.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36133.1| conserved hypothetical protein [Ricinus communis]
Length=377

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGTV+E NS+L    DPYAVPKSMGIFR ++S
Sbjct  274  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAECNSLLAGISDPYAVPKSMGIFRTLES  333

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PK+I T+SV QRI+ANHE Y+KRN+KK  SEKKYYAEK YVSG+
Sbjct  334  PKNIITSSVAQRIVANHEAYMKRNSKKAKSEKKYYAEKVYVSGD  377



>ref|XP_010263306.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010263307.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nelumbo 
nucifera]
Length=432

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIG+PWE+TKDMI TFNISLVVHGTV+ES + L D  DPYA PKSMGIFR+I+S
Sbjct  329  RYVDEVIIGSPWEVTKDMIITFNISLVVHGTVAESTNFLNDDADPYAAPKSMGIFRMIES  388

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PKDITT+SV +RIIANHE+Y KRNAKK  SEK+YYAEKKYVSG+
Sbjct  389  PKDITTSSVAKRIIANHEVYKKRNAKKVESEKRYYAEKKYVSGD  432



>emb|CDP20190.1| unnamed protein product [Coffea canephora]
Length=429

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+T DMI TFNIS VVHGTV+ES+S L    DPYAVPKSMGIFR+++S
Sbjct  326  RYVDEVIIGAPWEVTNDMIKTFNISFVVHGTVAESSSALNGKSDPYAVPKSMGIFRVLES  385

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PK ITT+SV QRIIANHEIYVKRNAKKEASEKKYY EKKYVSG+
Sbjct  386  PKTITTSSVAQRIIANHEIYVKRNAKKEASEKKYYEEKKYVSGD  429



>ref|XP_004149674.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
sativus]
Length=116

 Score =   136 bits (342),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 76/84 (90%), Gaps = 1/84 (1%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWEIT+DMITTFNISLVVHGTV+E+NS   D+ DPYAVPKSMGIF++++S
Sbjct  14   RYVDEVIIGAPWEITRDMITTFNISLVVHGTVAENNSFAGDS-DPYAVPKSMGIFKLLES  72

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            PK ITTTS+ +RI+ANH+ + KRN
Sbjct  73   PKTITTTSIAKRIVANHDAFKKRN  96



>ref|XP_009616437.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X3 [Nicotiana tomentosiformis]
Length=426

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIG+PWE+T+DM+TTFNIS+VVHGTVS+ N+   +  DPYAVPK+MGIFR+I S
Sbjct  323  RYVDEVIIGSPWEVTQDMVTTFNISVVVHGTVSDRNTSTGERHDPYAVPKNMGIFRVIDS  382

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PKDITTTSV QRIIANHEIYVKRN KKEASEKKYYAEK+YVSG+
Sbjct  383  PKDITTTSVAQRIIANHEIYVKRNTKKEASEKKYYAEKQYVSGD  426



>gb|AFK45455.1| unknown [Medicago truncatula]
Length=115

 Score =   135 bits (340),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 90/104 (87%), Gaps = 2/104 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAP EITKDMITTFNISLVVHGTV+E +  L    DPY VPKS+GIFR+++S
Sbjct  14   RYVDEVIIGAPLEITKDMITTFNISLVVHGTVAEKS--LPSEKDPYEVPKSIGIFRLLES  71

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PKDITTTSV QRI+ANH+ YVKRNAKK  SEK+YY E+KYVSG+
Sbjct  72   PKDITTTSVAQRIMANHDAYVKRNAKKAKSEKRYYEERKYVSGD  115



>ref|XP_011094065.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Sesamum 
indicum]
 ref|XP_011094066.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Sesamum 
indicum]
Length=427

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+TKDMITTFNISLVVHGT++E N +L    DPY VPKSMGIF++++S
Sbjct  324  RYVDEVIIGAPWEVTKDMITTFNISLVVHGTIAEKNPLLNGESDPYVVPKSMGIFQMLES  383

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P+DITTTS+ +RIIANHEIY+KRN
Sbjct  384  PEDITTTSIAERIIANHEIYLKRN  407



>ref|XP_002325231.2| hypothetical protein POPTR_0018s13260g [Populus trichocarpa]
 gb|EEF03796.2| hypothetical protein POPTR_0018s13260g [Populus trichocarpa]
Length=423

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+TKDM+TTFNI+LVVHGTV+E+NS+L    DPYAVPKSM IFR++ S
Sbjct  320  RYVDEVIIGAPWEVTKDMVTTFNITLVVHGTVAENNSLLAGEPDPYAVPKSMRIFRMLDS  379

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PK ITTTSV QRI+ANHE YVKRNAKK  +EKKYYAEK YVSG+
Sbjct  380  PKTITTTSVAQRIVANHEAYVKRNAKKAENEKKYYAEKVYVSGD  423



>ref|XP_002308992.1| hypothetical protein POPTR_0006s07030g [Populus trichocarpa]
 gb|EEE92515.1| hypothetical protein POPTR_0006s07030g [Populus trichocarpa]
Length=395

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = -1

Query  722  YVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSP  543
            YVDEVIIGAPWE+T+DM+TTFNISLVVHGTV+ESNS+L    DPYAVPKSMGIF ++ SP
Sbjct  293  YVDEVIIGAPWEVTRDMVTTFNISLVVHGTVAESNSLLAGEPDPYAVPKSMGIFWMLDSP  352

Query  542  KDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            K+ITTTSV QRI+ANHE Y+KRNAKK  SEKKYYAEK +VSG+
Sbjct  353  KNITTTSVAQRIVANHEAYLKRNAKKAESEKKYYAEKVHVSGD  395



>ref|XP_011094071.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Sesamum 
indicum]
 ref|XP_011094072.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Sesamum 
indicum]
Length=427

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+TKDMITTFNISLVVHGT++E N +     DPYAVPK+MGIF++I+S
Sbjct  324  RYVDEVIIGAPWEVTKDMITTFNISLVVHGTIAEKNPLSIGKSDPYAVPKNMGIFQMIES  383

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            PKDITTTS+ +RIIANHEIY+KRN
Sbjct  384  PKDITTTSIARRIIANHEIYLKRN  407



>ref|XP_004299778.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011464712.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=415

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWEIT DMITTFNISLVVHGTVSE NS      DPY+VPKSMGIF++++S
Sbjct  312  RYVDEVIIGAPWEITMDMITTFNISLVVHGTVSEYNSSFTGESDPYSVPKSMGIFQVLES  371

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PK+ITTTSV QRIIANH+ Y+KRNA+K ASEKKYY +KKYVSG+
Sbjct  372  PKEITTTSVAQRIIANHDAYLKRNARKTASEKKYYEQKKYVSGD  415



>ref|XP_007222601.1| hypothetical protein PRUPE_ppa006288mg [Prunus persica]
 gb|EMJ23800.1| hypothetical protein PRUPE_ppa006288mg [Prunus persica]
Length=419

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+T DM+TTFNISLVVHGTVSE NS+     DPY+VPKSMGIF++++S
Sbjct  316  RYVDEVIIGAPWEVTMDMVTTFNISLVVHGTVSEYNSLFTGESDPYSVPKSMGIFKLLES  375

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PK+ITTTSV QRIIANH+ Y+KRNAKK  SEKKYYA+K YVSG+
Sbjct  376  PKNITTTSVSQRIIANHDAYMKRNAKKAESEKKYYAQKTYVSGD  419



>ref|XP_008223819.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Prunus 
mume]
Length=419

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+T DM+TTFNISLVVHGTVSE NS+     DPY+VPKSMGIF++++S
Sbjct  316  RYVDEVIIGAPWEVTMDMVTTFNISLVVHGTVSEYNSLFPGESDPYSVPKSMGIFKLLES  375

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PK+ITTTSV QRIIANH+ Y+KRNAKK  SEKKYYA+K YVSG+
Sbjct  376  PKNITTTSVSQRIIANHDAYMKRNAKKAESEKKYYAQKTYVSGD  419



>ref|XP_010106955.1| Ethanolamine-phosphate cytidylyltransferase [Morus notabilis]
 gb|EXC12837.1| Ethanolamine-phosphate cytidylyltransferase [Morus notabilis]
Length=421

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+TKD+I TFNISLVVHGT+SES+S L    DPY+VPKSMGIF++++S
Sbjct  318  RYVDEVIIGAPWEVTKDVIATFNISLVVHGTISESDSPLTRETDPYSVPKSMGIFQLLES  377

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PK+ITTTSV QRIIANHE Y KRNAKK  SEKKYYAEKKYVSG+
Sbjct  378  PKNITTTSVAQRIIANHEAYTKRNAKKAESEKKYYAEKKYVSGD  421



>ref|XP_009770720.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Nicotiana sylvestris]
Length=418

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+T+DM+TTFNIS+VVHGTVSE NS   +  DPYAVPK+MGIFR+I+S
Sbjct  323  RYVDEVIIGAPWEVTQDMVTTFNISVVVHGTVSERNSSTGERHDPYAVPKNMGIFRVIES  382

Query  545  PKDITTTSVGQRIIANHEIYV  483
            PKDITTTSV QRIIANHEIYV
Sbjct  383  PKDITTTSVAQRIIANHEIYV  403



>ref|XP_011020099.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Populus 
euphratica]
Length=423

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -1

Query  722  YVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSP  543
            YVDEVIIGAPWE+T+DM+TTFNISLVVHGTV+ESNS+L    DPYAVPKSMGIF ++ SP
Sbjct  321  YVDEVIIGAPWEVTRDMVTTFNISLVVHGTVAESNSLLAGEPDPYAVPKSMGIFWMLDSP  380

Query  542  KDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            K+ TTTSV QRI+ANHE Y+KRNAKK  SEKKYYAEK +VSG+
Sbjct  381  KNTTTTSVAQRIVANHEAYLKRNAKKTESEKKYYAEKVHVSGD  423



>gb|KJB23398.1| hypothetical protein B456_004G096200 [Gossypium raimondii]
Length=423

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 89/104 (86%), Gaps = 1/104 (1%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+TKDMITTFNIS+VVHGTV+ESNS+L    DPYA PKSMGIFR+++S
Sbjct  321  RYVDEVIIGAPWEVTKDMITTFNISIVVHGTVAESNSLLPGETDPYAFPKSMGIFRLLES  380

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PK +TT+SV QRI+ANHE Y KRN KK  SE KYY EK YV+GE
Sbjct  381  PKSLTTSSVSQRIVANHEAY-KRNVKKAQSEMKYYEEKTYVAGE  423



>gb|EYU25735.1| hypothetical protein MIMGU_mgv1a007058mg [Erythranthe guttata]
 gb|EYU25736.1| hypothetical protein MIMGU_mgv1a007058mg [Erythranthe guttata]
 gb|EYU25737.1| hypothetical protein MIMGU_mgv1a007058mg [Erythranthe guttata]
Length=421

 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+TKDMITTFNISLVVHGT+SE+N  L    DPYA+PKS GIF+++ S
Sbjct  318  RYVDEVIIGAPWEVTKDMITTFNISLVVHGTISENNPFLNGKSDPYALPKSTGIFQMLDS  377

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            PKDIT+TS+ +RIIANHEIY KRN
Sbjct  378  PKDITSTSIARRIIANHEIYEKRN  401



>gb|KDO54355.1| hypothetical protein CISIN_1g0144871mg [Citrus sinensis]
Length=420

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+TKDMITTFNI LVVHGTVSE+N+ L    DPY V KSMGIF++++S
Sbjct  317  RYVDEVIIGAPWEVTKDMITTFNICLVVHGTVSETNTPLTGQSDPYEVAKSMGIFQLLES  376

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PK ITTTSV QRIIANHE Y+KRNAKK  SEKKYY +K +VSG+
Sbjct  377  PKSITTTSVAQRIIANHEAYMKRNAKKAVSEKKYYEQKMFVSGD  420



>ref|XP_006428518.1| hypothetical protein CICLE_v10011809mg [Citrus clementina]
 ref|XP_006491802.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Citrus sinensis]
 ref|XP_006491803.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Citrus sinensis]
 gb|ESR41758.1| hypothetical protein CICLE_v10011809mg [Citrus clementina]
 gb|KDO54353.1| hypothetical protein CISIN_1g0144871mg [Citrus sinensis]
 gb|KDO54354.1| hypothetical protein CISIN_1g0144871mg [Citrus sinensis]
Length=423

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+TKDMITTFNI LVVHGTVSE+N+ L    DPY V KSMGIF++++S
Sbjct  320  RYVDEVIIGAPWEVTKDMITTFNICLVVHGTVSETNTPLTGQSDPYEVAKSMGIFQLLES  379

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PK ITTTSV QRIIANHE Y+KRNAKK  SEKKYY +K +VSG+
Sbjct  380  PKSITTTSVAQRIIANHEAYMKRNAKKAVSEKKYYEQKMFVSGD  423



>ref|XP_004503546.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cicer 
arietinum]
Length=421

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 91/104 (88%), Gaps = 2/104 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWEITKDMITTFNISLVVHGTV+E +  L    DPY VPKSMGIFR+++S
Sbjct  320  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVAEKS--LYSETDPYEVPKSMGIFRLLES  377

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P+D+TT+SV QRI+ANHE YVKRNAKK  SEK+YY E+KYVSG+
Sbjct  378  PRDLTTSSVAQRIMANHEAYVKRNAKKAQSEKRYYEERKYVSGD  421



>ref|XP_009616439.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X5 [Nicotiana tomentosiformis]
Length=416

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIG+PWE+T+DM+TTFNIS+VVHGTVS+ N+   +  DPYAVPK+MGIFR+I S
Sbjct  323  RYVDEVIIGSPWEVTQDMVTTFNISVVVHGTVSDRNTSTGERHDPYAVPKNMGIFRVIDS  382

Query  545  PKDITTTSVGQRIIANHEIYVK  480
            PKDITTTSV QRIIANHEIYVK
Sbjct  383  PKDITTTSVAQRIIANHEIYVK  404



>ref|XP_008453525.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
melo]
 ref|XP_008453526.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
melo]
 ref|XP_008453527.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
melo]
Length=423

 Score =   136 bits (343),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 77/84 (92%), Gaps = 1/84 (1%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWEIT+DMITTFNISLVVHGTV+E+NS   D+ DPYAVPKSMGIF++++S
Sbjct  321  RYVDEVIIGAPWEITRDMITTFNISLVVHGTVAENNSFAGDS-DPYAVPKSMGIFKLLES  379

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            PK+ITTTS+ +RI+ANH+ + KRN
Sbjct  380  PKNITTTSIAKRIVANHDAFKKRN  403



>ref|XP_009616433.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009616434.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009616435.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=442

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIG+PWE+T+DM+TTFNIS+VVHGTVS+ N+   +  DPYAVPK+MGIFR+I S
Sbjct  323  RYVDEVIIGSPWEVTQDMVTTFNISVVVHGTVSDRNTSTGERHDPYAVPKNMGIFRVIDS  382

Query  545  PKDITTTSVGQRIIANHEIYVK  480
            PKDITTTSV QRIIANHEIYV+
Sbjct  383  PKDITTTSVAQRIIANHEIYVE  404



>ref|XP_009616438.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X4 [Nicotiana tomentosiformis]
Length=424

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIG+PWE+T+DM+TTFNIS+VVHGTVS+ N+   +  DPYAVPK+MGIFR+I S
Sbjct  323  RYVDEVIIGSPWEVTQDMVTTFNISVVVHGTVSDRNTSTGERHDPYAVPKNMGIFRVIDS  382

Query  545  PKDITTTSVGQRIIANHEIYV  483
            PKDITTTSV QRIIANHEIYV
Sbjct  383  PKDITTTSVAQRIIANHEIYV  403



>ref|XP_010048543.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010048544.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010048545.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010048546.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Eucalyptus 
grandis]
 gb|KCW80818.1| hypothetical protein EUGRSUZ_C02186 [Eucalyptus grandis]
Length=418

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGT++ESN +     DPYAVPKSMGIFR+++S
Sbjct  315  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTIAESNPLALVGIDPYAVPKSMGIFRLLES  374

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              +ITT+S+ QRI+ANHE Y+KRN
Sbjct  375  SNNITTSSIAQRIVANHEAYMKRN  398



>ref|XP_010688423.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=428

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDE+I+GAPWE+TKDMI TFNI LVVHGTVSE+N ++    DPY VPKSMGIFR+I+S
Sbjct  325  RYVDEIIMGAPWEVTKDMIKTFNICLVVHGTVSEANPLVNGDTDPYRVPKSMGIFRMIES  384

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PK+ITT+SV  RII NHE+Y KRNAKK  SEKKYY +K YVSG+
Sbjct  385  PKNITTSSVAHRIITNHEVYKKRNAKKVESEKKYYDQKTYVSGD  428



>ref|XP_004163014.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
sativus]
 gb|KGN65519.1| hypothetical protein Csa_1G434170 [Cucumis sativus]
Length=423

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 76/84 (90%), Gaps = 1/84 (1%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWEIT+DMITTFNISLVVHGTV+E+NS   D+ DPYAVPKSMGIF++++S
Sbjct  321  RYVDEVIIGAPWEITRDMITTFNISLVVHGTVAENNSFAGDS-DPYAVPKSMGIFKLLES  379

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            PK ITTTS+ +RI+ANH+ + KRN
Sbjct  380  PKTITTTSIAKRIVANHDAFKKRN  403



>ref|XP_009616436.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Nicotiana tomentosiformis]
Length=434

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIG+PWE+T+DM+TTFNIS+VVHGTVS+ N+   +  DPYAVPK+MGIFR+I S
Sbjct  323  RYVDEVIIGSPWEVTQDMVTTFNISVVVHGTVSDRNTSTGERHDPYAVPKNMGIFRVIDS  382

Query  545  PKDITTTSVGQRIIANHEIYV  483
            PKDITTTSV QRIIANHEIYV
Sbjct  383  PKDITTTSVAQRIIANHEIYV  403



>ref|XP_008351357.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Malus 
domestica]
 ref|XP_008351358.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Malus 
domestica]
Length=418

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+T DMITTFNIS VVHGTVSE NS+     DPY+VPKSMGIF++++S
Sbjct  315  RYVDEVIIGAPWEVTLDMITTFNISSVVHGTVSEYNSLFTGESDPYSVPKSMGIFKLLES  374

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PK ITT+SV QRIIANH+ Y++RNAKK+ SEKKYYA+K YVSG+
Sbjct  375  PKSITTSSVSQRIIANHDAYLRRNAKKKESEKKYYAQKTYVSGD  418



>ref|XP_010553187.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Tarenaya 
hassleriana]
Length=421

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGTV+ESN  LK+  +PYAVP  MGIFRI++S
Sbjct  318  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAESNDFLKEKDNPYAVPIRMGIFRILKS  377

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITT+++ +RI+ANHE Y KRN
Sbjct  378  PLDITTSTIIKRIVANHEAYQKRN  401



>ref|XP_009341732.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009341733.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Pyrus x bretschneideri]
Length=418

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+T DMITTFNIS VVHGTVSE NS      DPY++PKSMGIF++++S
Sbjct  315  RYVDEVIIGAPWEVTLDMITTFNISSVVHGTVSEYNSSFTGESDPYSLPKSMGIFKLLES  374

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PK ITT+SV QRIIANH+ Y++RNAKK+ SEKKYYA+K YVSG+
Sbjct  375  PKSITTSSVSQRIIANHDAYLRRNAKKKESEKKYYAQKTYVSGD  418



>ref|XP_003525313.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X1 [Glycine max]
 ref|XP_006580492.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X2 [Glycine max]
 gb|KHM99852.1| Ethanolamine-phosphate cytidylyltransferase [Glycine soja]
Length=420

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 89/104 (86%), Gaps = 2/104 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIG+PWEIT DMITTFNIS+VVHGTVSE +  L    DPY +PKSMGIFR+++S
Sbjct  319  RYVDEVIIGSPWEITNDMITTFNISVVVHGTVSEKS--LNCELDPYEIPKSMGIFRLLES  376

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PKDITT +V QRI+ANHE YVKRNAKK  SE++YY EKKYVSG+
Sbjct  377  PKDITTATVAQRIMANHEAYVKRNAKKTRSEQRYYEEKKYVSGD  420



>ref|XP_007160226.1| hypothetical protein PHAVU_002G303400g [Phaseolus vulgaris]
 ref|XP_007160227.1| hypothetical protein PHAVU_002G303400g [Phaseolus vulgaris]
 gb|ESW32220.1| hypothetical protein PHAVU_002G303400g [Phaseolus vulgaris]
 gb|ESW32221.1| hypothetical protein PHAVU_002G303400g [Phaseolus vulgaris]
Length=420

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 89/104 (86%), Gaps = 2/104 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIG+PWEITKDMITTFNISLVVHGTV+E +  L    DPY VPK MGIFR+++S
Sbjct  319  RYVDEVIIGSPWEITKDMITTFNISLVVHGTVAEKS--LNCEQDPYEVPKIMGIFRLLES  376

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PKDITT +V QRI+ANHE YVKRNAKK  SE++YY EKK+VSG+
Sbjct  377  PKDITTATVAQRIMANHEAYVKRNAKKARSEQRYYEEKKFVSGD  420



>ref|XP_009342823.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Pyrus 
x bretschneideri]
Length=419

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+T DMITTFNIS VVHGTVSE N  L    DPY+VPKSMGIF++++S
Sbjct  316  RYVDEVIIGAPWEVTVDMITTFNISSVVHGTVSEYNFSLTGESDPYSVPKSMGIFKLLES  375

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P  ITTTSV QRIIANH+ Y+KRNAKK  SEKKYYA+K YVSG+
Sbjct  376  PISITTTSVSQRIIANHDAYLKRNAKKNESEKKYYAQKTYVSGD  419



>ref|XP_003630619.1| Ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
 gb|AET05095.1| ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=418

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 90/104 (87%), Gaps = 2/104 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAP EITKDMITTFNISLVVHGTV+E +  L    DPY VPKS+GIFR+++S
Sbjct  317  RYVDEVIIGAPLEITKDMITTFNISLVVHGTVAEKS--LPSEKDPYEVPKSIGIFRLLES  374

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PKDITTTSV QRI+ANH+ YVKRNAKK  SEK+YY E+KYVSG+
Sbjct  375  PKDITTTSVAQRIMANHDAYVKRNAKKAKSEKRYYEERKYVSGD  418



>gb|ACJ85759.1| unknown [Medicago truncatula]
 gb|AFK45819.1| unknown [Medicago truncatula]
Length=418

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 90/104 (87%), Gaps = 2/104 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAP EITKDMITTFNISLVVHGTV+E +  L    DPY VPKS+GIFR+++S
Sbjct  317  RYVDEVIIGAPLEITKDMITTFNISLVVHGTVAEKS--LPSEKDPYEVPKSIGIFRLLES  374

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PKDITTTSV QRI+ANH+ YVKRNAKK  SEK+YY E+KYVSG+
Sbjct  375  PKDITTTSVAQRIMANHDAYVKRNAKKAKSEKRYYEERKYVSGD  418



>ref|XP_003630620.1| Ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=431

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 90/104 (87%), Gaps = 2/104 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAP EITKDMITTFNISLVVHGTV+E +  L    DPY VPKS+GIFR+++S
Sbjct  330  RYVDEVIIGAPLEITKDMITTFNISLVVHGTVAEKS--LPSEKDPYEVPKSIGIFRLLES  387

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PKDITTTSV QRI+ANH+ YVKRNAKK  SEK+YY E+KYVSG+
Sbjct  388  PKDITTTSVAQRIMANHDAYVKRNAKKAKSEKRYYEERKYVSGD  431



>ref|XP_010505513.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Camelina 
sativa]
Length=117

 Score =   124 bits (312),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+++D ITTF+ISLVVHGTV+ES+   K+  +PYAVP SMGIF I++S
Sbjct  14   RYVDEVIIGAPWEVSRDTITTFDISLVVHGTVAESDDFQKEEDNPYAVPISMGIFEILES  73

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITT+++ +RI+ANHE Y KRN
Sbjct  74   PLDITTSTIIRRIVANHEAYQKRN  97



>ref|XP_010529959.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Tarenaya hassleriana]
Length=422

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGTV+ES+  LK+  +PYAVP SMGIF I++S
Sbjct  319  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAESSDFLKEKDNPYAVPISMGIFTILES  378

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P D+TT+++ +RI+ANHE Y KRN
Sbjct  379  PLDLTTSTIIKRIVANHEAYQKRN  402



>gb|EEE51553.1| hypothetical protein OsJ_32765 [Oryza sativa Japonica Group]
Length=362

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW+++KDMITTFNISLVVHGT++E+   +KD  +PYAVP++MGI+R ++S
Sbjct  259  RYVDEVIIGAPWDVSKDMITTFNISLVVHGTIAENMDFMKDDLNPYAVPRAMGIYRRLES  318

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI+ANHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  319  PLDITTSTIIRRIVANHEAYQKRNEKKEASEKKYYDSKSFVNGE  362



>ref|XP_003530503.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Glycine max]
 ref|XP_006584793.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Glycine max]
 gb|KHN16693.1| Ethanolamine-phosphate cytidylyltransferase [Glycine soja]
Length=420

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 87/104 (84%), Gaps = 2/104 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIG+PWEIT DMITTFNIS+VVHGTV+E    L    DPY VPKSMGIF +++S
Sbjct  319  RYVDEVIIGSPWEITNDMITTFNISVVVHGTVAEKT--LNCELDPYEVPKSMGIFHLLES  376

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PKDITT +V QRI+ANHE YVKRNAKK  SE++YY EKKYVSG+
Sbjct  377  PKDITTATVAQRIMANHEAYVKRNAKKTRSEQRYYEEKKYVSGD  420



>gb|ABA91254.1| phosphoethanolamine cytidylyltransferase, putative, expressed 
[Oryza sativa Japonica Group]
Length=344

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW+++KDMITTFNISLVVHGT++E+   +KD  +PYAVP++MGI+R ++S
Sbjct  241  RYVDEVIIGAPWDVSKDMITTFNISLVVHGTIAENMDFMKDDLNPYAVPRAMGIYRRLES  300

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI+ANHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  301  PLDITTSTIIRRIVANHEAYQKRNEKKEASEKKYYDSKSFVNGE  344



>gb|AFW57038.1| hypothetical protein ZEAMMB73_658422 [Zea mays]
Length=425

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 86/104 (83%), Gaps = 2/104 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGTV+E NS      DPYAVPKSMGIF+ I+S
Sbjct  324  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAEGNSA--GEIDPYAVPKSMGIFQTIRS  381

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PK ITT SV  RI+ NHE Y KRN KK+ASE +YY +KK+VSG+
Sbjct  382  PKSITTLSVATRIVDNHEAYKKRNLKKKASEDRYYTQKKFVSGD  425



>ref|NP_001066024.1| Os12g0121300 [Oryza sativa Japonica Group]
 gb|ABA95682.2| Cytidylyltransferase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29043.1| Os12g0121300 [Oryza sativa Japonica Group]
 dbj|BAG94236.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE52664.1| hypothetical protein OsJ_35038 [Oryza sativa Japonica Group]
Length=424

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW+++KDMITTFNISLVVHGT++E+   +KD  +PYAVP++MGI+R ++S
Sbjct  321  RYVDEVIIGAPWDVSKDMITTFNISLVVHGTIAENMDFMKDDLNPYAVPRAMGIYRRLES  380

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI+ANHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  381  PLDITTSTIIRRIVANHEAYQKRNEKKEASEKKYYDSKSFVNGE  424



>gb|EEC67567.1| hypothetical protein OsI_34911 [Oryza sativa Indica Group]
Length=424

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW+++KDMITTFNISLVVHGT++E+   +KD  +PYAVP++MGI+R ++S
Sbjct  321  RYVDEVIIGAPWDVSKDMITTFNISLVVHGTIAENMDFMKDDLNPYAVPRAMGIYRRLES  380

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI+ANHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  381  PLDITTSTIIRRIVANHEAYQKRNEKKEASEKKYYDSKSFVNGE  424



>ref|XP_006663169.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Oryza 
brachyantha]
Length=188

 Score =   123 bits (309),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW+++KDMITTFNISLVVHGT++E+   +KD  +PYAVP++MGI+  ++S
Sbjct  85   RYVDEVIIGAPWDVSKDMITTFNISLVVHGTIAENMDFMKDDLNPYAVPRAMGIYCRLES  144

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI+ NHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  145  PLDITTSTIIRRIVTNHEAYQKRNEKKEASEKKYYDSKSFVNGE  188



>ref|XP_009606107.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Nicotiana 
tomentosiformis]
Length=413

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RY DEVIIGAPWE++KDMITTFNISLVVHGTV+E N   K+  +PYAVP SMGIF+I+ S
Sbjct  310  RYADEVIIGAPWEVSKDMITTFNISLVVHGTVAEDNDFQKEKGNPYAVPISMGIFKILDS  369

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI++NHE Y KRN KK ASE++YY  K YVSG+
Sbjct  370  PLDITTSTIIRRIVSNHEAYQKRNDKKAASERRYYEGKSYVSGD  413



>emb|CDP06353.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGTV+E N   K+  +PYAVP SMGI ++++S
Sbjct  259  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAEDNDFQKEKSNPYAVPISMGILKLLES  318

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITT+++ +RI++NHE Y KRN
Sbjct  319  PLDITTSTIIRRIVSNHEAYQKRN  342



>ref|XP_002450173.1| hypothetical protein SORBIDRAFT_05g001470 [Sorghum bicolor]
 gb|EES09161.1| hypothetical protein SORBIDRAFT_05g001470 [Sorghum bicolor]
Length=423

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW+++KDMITTFNISLVVHGT++E+    +D  +PYAVPK+MGI+R ++S
Sbjct  320  RYVDEVIIGAPWDVSKDMITTFNISLVVHGTIAENMDFAEDDSNPYAVPKAMGIYRRLES  379

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI+ANHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  380  PLDITTSTIIRRIVANHEAYQKRNEKKEASEKKYYESKSFVNGE  423



>ref|XP_011101976.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Sesamum 
indicum]
Length=427

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RY DEVIIGAPWE++KDMITTFNISLVVHGTV+E N   K+  +PYAVP SMGIF++++S
Sbjct  324  RYADEVIIGAPWEVSKDMITTFNISLVVHGTVAEDNDFQKEKRNPYAVPISMGIFKLLES  383

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI++NHE Y KRN KK  SEKKYY EK YVSG+
Sbjct  384  PLDITTSTIIRRIVSNHEAYQKRNDKKAQSEKKYYEEKTYVSGD  427



>ref|XP_004302493.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Fragaria 
vesca subsp. vesca]
Length=428

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWEITKD+ITTFNISLVVHGTV+E+N+  K+T +PY VP SMGIF+++ S
Sbjct  325  RYVDEVIIGAPWEITKDVITTFNISLVVHGTVAENNNFEKETGNPYEVPISMGIFKVLAS  384

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITT+++ +RI++NHE Y KRN
Sbjct  385  PLDITTSTIIRRIVSNHEAYQKRN  408



>emb|CCW28789.1| putative cytidylyltransferase [Arachis duranensis]
Length=400

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 71/84 (85%), Gaps = 4/84 (5%)
 Frame = -1

Query  722  YVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSP  543
            YVDEVIIGAPWEITKDMITTFNIS VVHGTV+E +   +   DPY VPKSMGIF +++SP
Sbjct  300  YVDEVIIGAPWEITKDMITTFNISAVVHGTVAEKSLSER---DPYEVPKSMGIFHLLESP  356

Query  542  KDITTTSVGQRIIANHEIY-VKRN  474
            KDITTTSV QRI+ANHE Y VKRN
Sbjct  357  KDITTTSVAQRIMANHEAYVVKRN  380



>ref|XP_010931423.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Elaeis 
guineensis]
Length=421

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGT++E+   LK+  +PYAVP +MGI+R I+S
Sbjct  318  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTIAENMDFLKEKSNPYAVPMAMGIYRQIES  377

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITT+++ +RI++NHE Y KRN
Sbjct  378  PLDITTSTIIRRIVSNHEAYQKRN  401



>ref|XP_006293474.1| hypothetical protein CARUB_v10023288mg [Capsella rubella]
 gb|EOA26372.1| hypothetical protein CARUB_v10023288mg [Capsella rubella]
Length=420

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KD ITTF+ISLVVHGTV+ES+   K+  +PYAVP SMGIF+I++S
Sbjct  317  RYVDEVIIGAPWEVSKDTITTFDISLVVHGTVAESDDFQKEEDNPYAVPISMGIFQILES  376

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI+ANHE Y KRNAKKEASEKKYY +K +VSG+
Sbjct  377  PLDITTSTIIRRIVANHEAYQKRNAKKEASEKKYYEQKSFVSGD  420



>ref|XP_010913784.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010913785.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Elaeis guineensis]
Length=424

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 70/84 (83%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+T+DMITTFNISLVVHGTV+E +    +  DPYA PKSMGIF+ I S
Sbjct  323  RYVDEVIIGAPWEVTRDMITTFNISLVVHGTVAEGS--CNNEVDPYATPKSMGIFKTIAS  380

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            PK+IT+TSV +RII NHE Y KRN
Sbjct  381  PKNITSTSVARRIIDNHEAYKKRN  404



>ref|XP_008788034.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Phoenix 
dactylifera]
Length=417

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGT +E+   LK+  +PYAVP +MGI+R I+S
Sbjct  314  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTFAENMDFLKEKSNPYAVPMAMGIYRQIES  373

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DI TT++ +RI++NHE Y KRN +KEASE++YY  K +VSG+
Sbjct  374  PLDIRTTTIIKRIVSNHEAYQKRNEQKEASERRYYEGKTHVSGD  417



>ref|XP_007140015.1| hypothetical protein PHAVU_008G077100g [Phaseolus vulgaris]
 gb|ESW12009.1| hypothetical protein PHAVU_008G077100g [Phaseolus vulgaris]
Length=421

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGT++E+N   K+ C+PYAVP SMG+F++++S
Sbjct  318  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTIAENNDFQKEQCNPYAVPISMGVFKLLES  377

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITTT++ +RI++NHE Y KRN KK  SEK+YY  K +VSG+
Sbjct  378  PVDITTTTIIKRIVSNHEAYQKRNEKKGESEKRYYEGKGHVSGD  421



>dbj|BAD03428.1| putative phosphoethanolamine cytidylyltransferase [Oryza sativa 
Japonica Group]
 gb|EEC83124.1| hypothetical protein OsI_28285 [Oryza sativa Indica Group]
 gb|EEE68256.1| hypothetical protein OsJ_26465 [Oryza sativa Japonica Group]
Length=428

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 87/104 (84%), Gaps = 2/104 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+++DMITTFNISLVVHGTV+E +S++    DPYAVPKSMGIF+ I S
Sbjct  327  RYVDEVIIGAPWEVSRDMITTFNISLVVHGTVTEGSSVV--GIDPYAVPKSMGIFQTITS  384

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PK ITT SV  RII NHE Y KRN KK+ASE +YY +KK+VSG+
Sbjct  385  PKPITTVSVATRIIDNHEAYKKRNLKKKASEDRYYTQKKFVSGD  428


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 48/78 (62%), Gaps = 7/78 (9%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFR  558
            ++VDEVI  AP+EIT++ + T    +NI  ++HG   +   +L D  D YA+ K +G ++
Sbjct  130  KWVDEVIPNAPYEITEEFMNTLFNKYNIDYIIHG---DDPCLLPDGTDAYALAKKVGRYK  186

Query  557  IIQSPKDITTTSVGQRII  504
             I+  + +++T +  RI+
Sbjct  187  QIKRTEGVSSTDIVGRIL  204



>ref|XP_008355152.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Malus 
domestica]
Length=117

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            R+VDEVIIGAPW I+KDM+TTFNISLVVHGTV+E+++  K+  +PY VP ++GIF++++S
Sbjct  14   RHVDEVIIGAPWVISKDMLTTFNISLVVHGTVAENSNFEKEEGNPYEVPINLGIFKVLES  73

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI++NHE Y KRN KK ASEK+YY  K YVSG+
Sbjct  74   PLDITTSTIIRRIVSNHEAYQKRNEKKAASEKRYYESKGYVSGD  117



>ref|XP_004977412.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Setaria 
italica]
Length=425

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW+++KDMITTFNISLVVHGT++E+   ++D  +PYAVP +MGI+R ++S
Sbjct  322  RYVDEVIIGAPWDVSKDMITTFNISLVVHGTIAENMDFMEDDSNPYAVPIAMGIYRRLES  381

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI+ANHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  382  PLDITTSTIIRRIVANHEAYQKRNEKKEASEKKYYESKSFVNGE  425



>ref|XP_009143367.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Brassica 
rapa]
Length=420

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KD ITTF+ISLVVHGTV+ES+   ++  +PYAVP SMGIF++++S
Sbjct  317  RYVDEVIIGAPWEVSKDTITTFDISLVVHGTVAESDDFQREEENPYAVPISMGIFQVLES  376

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI+ANHE Y KRN KKEASEKKYY +K +VSG+
Sbjct  377  PLDITTSTIIRRIVANHEAYQKRNLKKEASEKKYYEQKAFVSGD  420



>ref|XP_009801689.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Nicotiana 
sylvestris]
Length=413

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RY DEVIIGAPWE++KDMITTFNISLVVHGTV+E N   K+  +PYAVP SM IF+I+ S
Sbjct  310  RYTDEVIIGAPWEVSKDMITTFNISLVVHGTVAEDNDFQKEKGNPYAVPISMDIFKILDS  369

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI++NHE Y KRN KK ASE++YY  K YVSG+
Sbjct  370  PLDITTSTIIRRIVSNHEAYQKRNEKKAASERRYYEGKSYVSGD  413



>ref|XP_006362326.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Solanum 
tuberosum]
Length=414

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RY DEVIIGAP E++KDMITTFNISLVVHGTV+E N   K+T +PYAVP SMGIF+++ S
Sbjct  311  RYADEVIIGAPGEVSKDMITTFNISLVVHGTVAEDNDFQKETGNPYAVPISMGIFQVLDS  370

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI++NHE Y KRN KK ASEK+YY  K YVSG+
Sbjct  371  PLDITTSTIIRRIVSNHEAYQKRNEKKAASEKRYYEGKSYVSGD  414



>ref|XP_004249014.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Solanum 
lycopersicum]
Length=413

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RY DEVIIGAP E++KDMITTFNISLVVHGTV+E N   K+T +PYAVP SMGIF+++ S
Sbjct  310  RYADEVIIGAPGEVSKDMITTFNISLVVHGTVAEDNDFQKETGNPYAVPISMGIFQVLDS  369

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI++NHE Y KRN KK ASEK+YY  K YVSG+
Sbjct  370  PLDITTSTIIRRIVSNHEAYQKRNEKKAASEKRYYEGKSYVSGD  413



>ref|XP_006659222.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Oryza 
brachyantha]
Length=429

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 86/104 (83%), Gaps = 2/104 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+++DMITTFNISLVVHGTV+E +S+     DPYAVPKSMGIF+ I S
Sbjct  328  RYVDEVIIGAPWEVSRDMITTFNISLVVHGTVTEGSSV--GGIDPYAVPKSMGIFQTITS  385

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PK ITT SV  RII NHE Y KRN KK+ASE +YY +KK+VSG+
Sbjct  386  PKPITTVSVATRIIDNHEAYKKRNLKKKASEDRYYTQKKFVSGD  429


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 48/78 (62%), Gaps = 7/78 (9%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFR  558
            ++VDEVI  AP+EIT++ + T    +NI  ++HG   +   +L D  D YA+ K +G ++
Sbjct  131  KWVDEVIPNAPYEITEEFMNTLFNKYNIDYIIHG---DDPCLLPDGTDAYALAKKVGRYK  187

Query  557  IIQSPKDITTTSVGQRII  504
             I+  + +++T +  RI+
Sbjct  188  QIKRTEGVSSTDIVGRIL  205



>ref|XP_004171635.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
sativus]
Length=117

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGTV+E N   K  C+PYAVP SMGIF+I+ S
Sbjct  14   RYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAEINDFQKRDCNPYAVPISMGIFKILDS  73

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITTT++ +RI++NHE Y KRN
Sbjct  74   PLDITTTTIIRRIVSNHEAYQKRN  97



>ref|XP_010505515.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Camelina 
sativa]
Length=362

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+++D ITTF+ISLVVHGTV+ES+   K+  +PYAVP SMGIF I++S
Sbjct  259  RYVDEVIIGAPWEVSRDTITTFDISLVVHGTVAESDDFQKEEDNPYAVPISMGIFEILES  318

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITT+++ +RI+ANHE Y KRN
Sbjct  319  PLDITTSTIIRRIVANHEAYQKRN  342



>ref|XP_004972545.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X4 [Setaria italica]
Length=466

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 84/104 (81%), Gaps = 2/104 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGTV+E N       DPYAVPKSMGIF+ I S
Sbjct  365  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAEGNP--AGEIDPYAVPKSMGIFKTITS  422

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PK IT+ SV  RI+ NHE Y KRN KK+ASE +YY +KK+VSG+
Sbjct  423  PKSITSVSVATRIVDNHEAYKKRNLKKKASEDRYYTQKKFVSGD  466



>gb|EMS66153.1| Ethanolamine-phosphate cytidylyltransferase [Triticum urartu]
Length=312

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW+I+KDMITTFNISLVV GT++E+    KD   PYAVP  MGIFR ++S
Sbjct  209  RYVDEVIIGAPWDISKDMITTFNISLVVQGTIAENMDFAKDESHPYAVPMDMGIFRRLES  268

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI++NHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  269  PLDITTSTIIRRIVSNHEAYQKRNEKKEASEKKYYESKNFVNGE  312



>ref|XP_010517175.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Camelina 
sativa]
Length=420

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+++D ITTF+ISLVVHGTV+ES+   K+  +PYAVP SMGIF I++S
Sbjct  317  RYVDEVIIGAPWEVSRDTITTFDISLVVHGTVAESDDFQKEEDNPYAVPISMGIFEILES  376

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITT+++ +RI+ANHE Y KRN
Sbjct  377  PLDITTSTIIRRIVANHEAYQKRN  400



>ref|XP_010509160.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Camelina 
sativa]
Length=420

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+++D ITTF+ISLVVHGTV+ES+   K+  +PYAVP SMGIF I++S
Sbjct  317  RYVDEVIIGAPWEVSRDTITTFDISLVVHGTVAESDDFRKEEDNPYAVPISMGIFEILES  376

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITT+++ +RI+ANHE Y KRN
Sbjct  377  PLDITTSTIIRRIVANHEAYQKRN  400



>ref|XP_008679350.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Zea 
mays]
 gb|AFW64659.1| hypothetical protein ZEAMMB73_095669 [Zea mays]
Length=422

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW+++KDMITTFNISLVVHGT++E+    +D   PYAVP +MGI+R ++S
Sbjct  319  RYVDEVIIGAPWDVSKDMITTFNISLVVHGTIAENMDFTEDDLHPYAVPMAMGIYRRLES  378

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI+ANHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  379  PLDITTSTIIRRIVANHEAYQKRNEKKEASEKKYYEGKSFVNGE  422



>ref|NP_001170703.1| hypothetical protein [Zea mays]
 gb|ACR34556.1| unknown [Zea mays]
 tpg|DAA39300.1| TPA: hypothetical protein ZEAMMB73_839605 [Zea mays]
Length=424

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW+++KDMITTFNISLVVHGT++E+    +D   PYAVP +MGI+R ++S
Sbjct  321  RYVDEVIIGAPWDVSKDMITTFNISLVVHGTIAENMDFTEDDLHPYAVPMAMGIYRRLES  380

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI+ANHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  381  PLDITTSTIIRRIVANHEAYQKRNEKKEASEKKYYESKSFVNGE  424



>gb|EPS71148.1| hypothetical protein M569_03610, partial [Genlisea aurea]
Length=373

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 89/105 (85%), Gaps = 1/105 (1%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNS-MLKDTCDPYAVPKSMGIFRIIQ  549
            RYVDEVIIGAPWE++KDMITTFNISLVVHGTV+E  S   KD  +PYA+P S+GIF+ ++
Sbjct  269  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAEDYSDFHKDKQNPYAIPMSLGIFKQLE  328

Query  548  SPKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            SP DITT+++ +RI++NHE Y+KRN +K  SE++YY +KKYVSG+
Sbjct  329  SPLDITTSTIIKRIVSNHEAYLKRNERKAESERRYYEDKKYVSGD  373



>gb|EMT02889.1| Ethanolamine-phosphate cytidylyltransferase [Aegilops tauschii]
Length=371

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW+I+KDMITTFNISLVV GT++E+    KD   PYAVP  MGIFR ++S
Sbjct  268  RYVDEVIIGAPWDISKDMITTFNISLVVQGTIAENMDFAKDESHPYAVPMDMGIFRRLES  327

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI++NHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  328  PLDITTSTIIRRIVSNHEAYQKRNEKKEASEKKYYESKNFVNGE  371



>ref|XP_006664291.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Oryza 
brachyantha]
Length=423

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW+++KDMITTFNISLVVHGT++E+   +KD  +PYAVP++MGI+  ++S
Sbjct  320  RYVDEVIIGAPWDVSKDMITTFNISLVVHGTIAENMDFMKDDLNPYAVPRAMGIYCRLES  379

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI+ NHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  380  PLDITTSTIIRRIVTNHEAYQKRNEKKEASEKKYYDSKSFVNGE  423



>gb|KFK36771.1| hypothetical protein AALP_AA4G168400 [Arabis alpina]
Length=419

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+++D ITTF+ISLVVHGTV+ES+   K+  +PY+VP SMGIF+I++S
Sbjct  316  RYVDEVIIGAPWEVSRDTITTFDISLVVHGTVAESDDFQKEEDNPYSVPISMGIFQILES  375

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITT+++ +RI+ANHE Y KRN
Sbjct  376  PLDITTSTIIRRIVANHEAYQKRN  399



>ref|NP_181401.1| ethanolamine-phosphate cytidylyltransferase [Arabidopsis thaliana]
 sp|Q9ZVI9.1|PECT1_ARATH RecName: Full=Ethanolamine-phosphate cytidylyltransferase; AltName: 
Full=CTP:phosphoethanolamine cytidylyltransferase; AltName: 
Full=Phosphorylethanolamine cytidylyltransferase 1 [Arabidopsis 
thaliana]
 gb|AAC67351.1| putative phospholipid cytidylyltransferase [Arabidopsis thaliana]
 gb|AAM12983.1| putative phospholipid cytidylyltransferase [Arabidopsis thaliana]
 gb|AAM91207.1| putative phospholipid cytidylyltransferase [Arabidopsis thaliana]
 gb|AEC09568.1| ethanolamine-phosphate cytidylyltransferase [Arabidopsis thaliana]
Length=421

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+++D ITTF+ISLVVHGTV+ES+   K+  +PY+VP SMGIF+++ S
Sbjct  318  RYVDEVIIGAPWEVSRDTITTFDISLVVHGTVAESDDFRKEEDNPYSVPISMGIFQVLDS  377

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI+ANHE Y KRNAKKEASEKKYY +K +VSG+
Sbjct  378  PLDITTSTIIRRIVANHEAYQKRNAKKEASEKKYYEQKSFVSGD  421



>ref|XP_008355786.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Malus 
domestica]
Length=249

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIG+PWEI+KDM+TTFNISLVVHGT++E+++  K+  +PY VP S+GIF+++ S
Sbjct  146  RYVDEVIIGSPWEISKDMLTTFNISLVVHGTIAENSNFEKEEGNPYQVPISLGIFKVLDS  205

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
              DITT+++ +RI++NHE Y KRN KK ASEK+YY  K YVSG+
Sbjct  206  SLDITTSTIIRRIVSNHEAYQKRNXKKAASEKRYYEGKXYVSGD  249



>ref|XP_008244222.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Prunus 
mume]
Length=428

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            R+VDEVIIGAPWEI+KDMITTFNISLVVHGTV+E+N+  K+  +PY VP SMGIF+++ S
Sbjct  325  RHVDEVIIGAPWEISKDMITTFNISLVVHGTVAENNNFQKEQGNPYEVPISMGIFKVLNS  384

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITT+++ +RI++NHE Y  RN
Sbjct  385  PLDITTSTIIRRIVSNHEAYQIRN  408



>ref|XP_006411085.1| hypothetical protein EUTSA_v10016709mg [Eutrema salsugineum]
 gb|ESQ52538.1| hypothetical protein EUTSA_v10016709mg [Eutrema salsugineum]
Length=423

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+++D ITTF+ISLVVHGTV+ES+   K+  +PYAVP SMGIF+I++S
Sbjct  320  RYVDEVIIGAPWEVSRDTITTFDISLVVHGTVAESDDFQKEEDNPYAVPISMGIFQILES  379

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI+ANHE Y  RN KKEASEKKYY +K +VSG+
Sbjct  380  PLDITTSTIIKRIVANHEAYQIRNKKKEASEKKYYEQKAFVSGD  423



>ref|XP_003573570.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brachypodium 
distachyon]
 ref|XP_010234484.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brachypodium 
distachyon]
Length=416

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 84/104 (81%), Gaps = 2/104 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+++DMITTFNISLVVHGTV+E +S      DPYA+PKSMGIF+ + S
Sbjct  315  RYVDEVIIGAPWEVSRDMITTFNISLVVHGTVAERSS--AGEVDPYALPKSMGIFQTVTS  372

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            PK IT+ SV  RII NHE Y KRN KK+ASE  YY +KK+VSG+
Sbjct  373  PKTITSVSVATRIIDNHEAYKKRNLKKKASEDMYYTQKKFVSGD  416



>ref|XP_008804653.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Phoenix 
dactylifera]
Length=414

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW+++KDMITTFNIS+VVHGT++E+   LK+  +PYAVP +MGI+  I+S
Sbjct  311  RYVDEVIIGAPWQVSKDMITTFNISMVVHGTIAENMDFLKEKSNPYAVPMAMGIYLQIES  370

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI++NHE Y KRN KKEASE++YY  K YVSG+
Sbjct  371  PLDITTSTIIRRIVSNHEAYQKRNEKKEASERRYYEGKTYVSGD  414



>dbj|BAJ95410.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96704.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=418

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 68/84 (81%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+++DMITTFNISLVVHGTV+E  S      DPYA+PK+MGIF+++ S
Sbjct  317  RYVDEVIIGAPWEVSRDMITTFNISLVVHGTVTEGGS--ASEVDPYALPKNMGIFQVVTS  374

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            PK IT+ SV  RII NHE Y KRN
Sbjct  375  PKTITSVSVATRIIDNHEAYKKRN  398


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 47/78 (60%), Gaps = 7/78 (9%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFR  558
            ++VDEVI  AP+EIT++ + T    +NI  ++HG   +   +L D  D YA+ K  G ++
Sbjct  132  KWVDEVIPNAPYEITEEFMNTLFSKYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYK  188

Query  557  IIQSPKDITTTSVGQRII  504
             I+  + +++T +  RI+
Sbjct  189  QIRRTEGVSSTDIVGRIL  206



>ref|XP_010928770.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Elaeis guineensis]
 ref|XP_010928771.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Elaeis guineensis]
 ref|XP_010928772.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Elaeis guineensis]
Length=419

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 68/84 (81%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+T+DMITTFNISLVVHGTV+E +    D  DPY  P+SMGIF+ I S
Sbjct  318  RYVDEVIIGAPWEVTRDMITTFNISLVVHGTVAEGS--CSDEVDPYVTPRSMGIFKTIAS  375

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P +IT TSV +RI+ NHE+Y KRN
Sbjct  376  PNNITWTSVARRIVDNHEVYKKRN  399



>ref|XP_010928769.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Elaeis guineensis]
Length=443

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 68/84 (81%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+T+DMITTFNISLVVHGTV+E +    D  DPY  P+SMGIF+ I S
Sbjct  342  RYVDEVIIGAPWEVTRDMITTFNISLVVHGTVAEGSC--SDEVDPYVTPRSMGIFKTIAS  399

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P +IT TSV +RI+ NHE+Y KRN
Sbjct  400  PNNITWTSVARRIVDNHEVYKKRN  423



>ref|XP_002990148.1| hypothetical protein SELMODRAFT_131236 [Selaginella moellendorffii]
 gb|EFJ08708.1| hypothetical protein SELMODRAFT_131236 [Selaginella moellendorffii]
Length=416

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RY DE+IIGAPWE+TKDM+TTFNISLVVHGTV+E+    +   DPYA PK +G F+I++S
Sbjct  313  RYADEIIIGAPWEVTKDMVTTFNISLVVHGTVAETTDFKEGDFDPYACPKQLGKFKILES  372

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P++ITT+++  RI+ANHE + KRN
Sbjct  373  PRNITTSTIIARIVANHEAFRKRN  396



>ref|XP_009133281.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brassica 
rapa]
Length=418

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KD ITTF+I  VVHGTV+ES+   K+  +PYAVPKSMGIF +++S
Sbjct  315  RYVDEVIIGAPWEVSKDTITTFDIWKVVHGTVAESDDFQKEEGNPYAVPKSMGIFEVLES  374

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DI+T+++ +RI+ANHE Y KRN
Sbjct  375  PLDISTSTIIKRIVANHEAYQKRN  398



>ref|XP_003564627.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brachypodium 
distachyon]
Length=418

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 70/84 (83%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIG+P E+++DMITTFNISLVVHGTV+E +S+  D  DPYA+PKSMGIF+II S
Sbjct  317  RYVDEVIIGSPREVSRDMITTFNISLVVHGTVAEGSSV--DEVDPYALPKSMGIFQIITS  374

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            PK IT+ SV  RII NHE Y KRN
Sbjct  375  PKAITSVSVATRIIDNHEAYKKRN  398



>ref|XP_002992541.1| hypothetical protein SELMODRAFT_162424 [Selaginella moellendorffii]
 gb|EFJ06479.1| hypothetical protein SELMODRAFT_162424 [Selaginella moellendorffii]
Length=420

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RY DE+IIGAPWE+TKDM+TTFNISLVVHGTV+E+    +   DPYA PK +G F+I++S
Sbjct  317  RYADEIIIGAPWEVTKDMVTTFNISLVVHGTVAETTDFKEGDFDPYACPKQLGKFKILES  376

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P++ITT+++  RI+ANHE + KRN
Sbjct  377  PRNITTSTIIARIVANHEAFRKRN  400



>ref|XP_007207330.1| hypothetical protein PRUPE_ppa006076mg [Prunus persica]
 gb|EMJ08529.1| hypothetical protein PRUPE_ppa006076mg [Prunus persica]
Length=428

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            R+VDEVIIGAPWEI+KD+ITTFNISLVVHGTV+E+N+  K+  +PY VP SMGIF+++ S
Sbjct  325  RHVDEVIIGAPWEISKDVITTFNISLVVHGTVAENNNFQKEQGNPYEVPISMGIFKVLDS  384

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI++NHE Y  RN KK ASEKKYY  K YVSG+
Sbjct  385  PLDITTSTIIRRIVSNHEAYQIRNEKKAASEKKYYEGKSYVSGD  428



>ref|XP_002879759.1| hypothetical protein ARALYDRAFT_903103 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56018.1| hypothetical protein ARALYDRAFT_903103 [Arabidopsis lyrata subsp. 
lyrata]
Length=421

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+++D I TF+ISLVVHGTV+ES+   K+  +PY+VP SMGIF+++ S
Sbjct  318  RYVDEVIIGAPWEVSRDTIMTFDISLVVHGTVAESDDFQKEEDNPYSVPISMGIFQVLDS  377

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI+ANHE Y KRNAKKEASEKKYY +K +VSG+
Sbjct  378  PLDITTSTIIRRIVANHEAYQKRNAKKEASEKKYYEQKSFVSGD  421



>ref|XP_010922838.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Elaeis 
guineensis]
Length=421

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW+++KDMITTFNIS+VVHGT++E+   LK+  +PYAVP  MGI+  I+S
Sbjct  318  RYVDEVIIGAPWQVSKDMITTFNISMVVHGTIAENMDFLKEKSNPYAVPMDMGIYWQIES  377

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI++NHE Y KRN KKEASE++YY  K YVSG+
Sbjct  378  PLDITTSTIIKRIVSNHEAYQKRNDKKEASERRYYEGKTYVSGD  421



>gb|EEC66861.1| hypothetical protein OsI_33354 [Oryza sativa Indica Group]
Length=351

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 85/104 (82%), Gaps = 2/104 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+++DMITTFNISLVVHGTV+E +S++    D YAVPKSMGIF+ I S
Sbjct  250  RYVDEVIIGAPWEVSRDMITTFNISLVVHGTVTEGSSVVG--IDSYAVPKSMGIFQTITS  307

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
             K ITT SV  RII NHE Y KRN KK+ASE +YY +KK+VSG+
Sbjct  308  TKPITTVSVATRIIDNHEAYKKRNLKKKASEDRYYTQKKFVSGD  351


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 48/78 (62%), Gaps = 7/78 (9%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFR  558
            ++VDEVI  AP+EIT++ + T    +NI  ++HG   +   +L D  D YA+ K +G ++
Sbjct  58   KWVDEVIPNAPYEITEEFMNTLFNKYNIDYIIHG---DDPCLLPDGTDAYALAKKVGRYK  114

Query  557  IIQSPKDITTTSVGQRII  504
             I+  + +++T +  RI+
Sbjct  115  QIKRTEGVSSTDIVGRIL  132



>ref|XP_009410481.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=421

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGA WE++KDMITTFNISLVVHGTV+E+   LK+  +PYAVP  MGI++ ++S
Sbjct  318  RYVDEVIIGATWEVSKDMITTFNISLVVHGTVAENMDFLKEESNPYAVPMDMGIYKQLKS  377

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITT+++ +RI++NHE Y KRN
Sbjct  378  PLDITTSTIIKRIVSNHESYQKRN  401



>ref|XP_009337844.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Pyrus 
x bretschneideri]
Length=428

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW I+KDM+TTFNISLVVHGTV+E+++  K+  +PY VP ++GIF++++S
Sbjct  325  RYVDEVIIGAPWVISKDMLTTFNISLVVHGTVAENSNFEKEEGNPYEVPINLGIFKVLES  384

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI++NHE Y KRN KK ASEK+YY  K YVSG+
Sbjct  385  PLDITTSTIIRRIVSNHEAYQKRNEKKAASEKRYYESKGYVSGD  428



>ref|XP_009384337.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=421

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RY DEVIIGAPWE++KDMITTFNISLVVHGTV+E     K+  +PYAVP +MGI++ + S
Sbjct  318  RYADEVIIGAPWEVSKDMITTFNISLVVHGTVAEYMDFSKEESNPYAVPMAMGIYKQLNS  377

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI++NHE Y KRN KKEASEK+YY  K YVSG+
Sbjct  378  PLDITTSTIIKRIVSNHEAYQKRNEKKEASEKRYYETKTYVSGD  421



>ref|XP_008781724.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Phoenix 
dactylifera]
 ref|XP_008781725.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Phoenix 
dactylifera]
Length=420

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 68/84 (81%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+T+DMI+TFNISLVVHGTV+E +       DPYA+PKSMGIF+ I S
Sbjct  319  RYVDEVIIGAPWEVTRDMISTFNISLVVHGTVAEGS--CNSEVDPYAIPKSMGIFKTIAS  376

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            PK IT+T V +RI+ NHE Y KRN
Sbjct  377  PKVITSTLVARRIMDNHEAYKKRN  400



>ref|XP_003552337.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
1 [Glycine max]
Length=420

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWEI+KDM+TTFNISLVVHGT++ESN   K+ C+PYAVP SMGIF++++S
Sbjct  317  RYVDEVIIGAPWEISKDMLTTFNISLVVHGTIAESNDFQKEECNPYAVPISMGIFKVLES  376

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITTT++ +RI++NHE Y  RN
Sbjct  377  PLDITTTTIIRRIVSNHEAYQNRN  400



>ref|XP_009141755.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brassica 
rapa]
Length=417

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAP E++KD ITTF+ISLVVHGTV+ES++  K+  +PYAVP SMGIF+I++S
Sbjct  314  RYVDEVIIGAPSEVSKDTITTFDISLVVHGTVAESDAFQKEEGNPYAVPISMGIFQILES  373

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITT+++ +RI+ NHE Y KRN
Sbjct  374  PLDITTSTIIKRIVNNHEAYQKRN  397



>ref|XP_009370855.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Pyrus 
x bretschneideri]
Length=428

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIG+PWEI+KDM+TTFNISLVVHGTV+E+++  K+  +PY VP S+GIF+++ S
Sbjct  325  RYVDEVIIGSPWEISKDMLTTFNISLVVHGTVAENSNFEKEEGNPYEVPISLGIFKVLDS  384

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
              DITT+++ +RI++NHE Y KRN KK ASEK+YY  K YVSG+
Sbjct  385  SLDITTSTIIRRIVSNHEAYQKRNEKKAASEKRYYEGKAYVSGD  428



>ref|XP_004972544.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X3 [Setaria italica]
Length=476

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 66/84 (79%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGTV+E N       DPYAVPKSMGIF+ I S
Sbjct  365  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAEGNP--AGEIDPYAVPKSMGIFKTITS  422

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            PK IT+ SV  RI+ NHE Y  R+
Sbjct  423  PKSITSVSVATRIVDNHEAYKVRD  446



>ref|XP_003577861.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brachypodium 
distachyon]
Length=425

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW+I+KDMITTFNISLVVHGT++E+    +D  +PYAVP +MGI+  + S
Sbjct  322  RYVDEVIIGAPWDISKDMITTFNISLVVHGTIAENMDYTEDDSNPYAVPIAMGIYHKLDS  381

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI++NHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  382  PLDITTSTIIRRIVSNHEAYQKRNEKKEASEKKYYDSKSFVNGE  425



>dbj|BAK04174.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=421

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW I+KDM+TTFNISLVVHGT++E+    +D  +PYAVP +MGI+  ++S
Sbjct  318  RYVDEVIIGAPWHISKDMVTTFNISLVVHGTIAENMDYTEDDSNPYAVPVAMGIYHKLES  377

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI++NHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  378  PLDITTSTIIRRIVSNHEAYQKRNEKKEASEKKYYDSKSFVNGE  421



>gb|AAO43227.1| phosphoethanolamine cytidylyltransferase [Hordeum vulgare subsp. 
vulgare]
Length=421

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW I+KDM+TTFNISLVVHGT++E+    +D  +PYAVP +MGI+  ++S
Sbjct  318  RYVDEVIIGAPWHISKDMVTTFNISLVVHGTIAENMDYTEDDSNPYAVPVAMGIYHKLES  377

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI++NHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  378  PLDITTSTIIRRIVSNHEAYQKRNEKKEASEKKYYDSKSFVNGE  421



>ref|XP_006842638.1| hypothetical protein AMTR_s00077p00187820 [Amborella trichopoda]
 gb|ERN04313.1| hypothetical protein AMTR_s00077p00187820 [Amborella trichopoda]
Length=423

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW ++KDMITTFNISLVVHGTV+E++   K   +PYA P SMGI+R I+S
Sbjct  320  RYVDEVIIGAPWVVSKDMITTFNISLVVHGTVAENSDFWKVDDNPYAAPISMGIYREIES  379

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P D+TTT++ +RI+ANHE Y KRN
Sbjct  380  PLDVTTTTIIRRIVANHESYQKRN  403



>emb|CDM85025.1| unnamed protein product [Triticum aestivum]
Length=418

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 67/84 (80%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAP E+++DMITTFNISLVVHGTV+E  S      DPYA+PKSMGIF+++ S
Sbjct  317  RYVDEVIIGAPLEVSRDMITTFNISLVVHGTVAEGGS--ASEVDPYALPKSMGIFQVVTS  374

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            PK IT+ SV  RII NHE Y KRN
Sbjct  375  PKTITSVSVATRIIDNHEAYKKRN  398


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 47/78 (60%), Gaps = 7/78 (9%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFR  558
            ++VDEVI  AP+EIT++ + T    +NI  ++HG   +   +L D  D YA+ K  G ++
Sbjct  132  KWVDEVIPNAPYEITEEFMNTLFSKYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYK  188

Query  557  IIQSPKDITTTSVGQRII  504
             I+  + +++T +  RI+
Sbjct  189  QIRRTEGVSSTDIVGRIL  206



>ref|XP_004978492.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Setaria 
italica]
Length=425

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW+++KDMITTFNIS VVHGT++E+   ++D  +PYAVP +MGI+  ++S
Sbjct  322  RYVDEVIIGAPWDVSKDMITTFNISSVVHGTIAENMDFMEDDSNPYAVPIAMGIYCRLES  381

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI+ANHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  382  PLDITTSTIIRRIVANHEAYQKRNEKKEASEKKYYESKSFVNGE  425



>gb|EAZ15919.1| hypothetical protein OsJ_31340 [Oryza sativa Japonica Group]
Length=423

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 85/104 (82%), Gaps = 2/104 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+++DMITTFNISLVVHGTV+E +S++    D YAVPKSMGIF+ I S
Sbjct  322  RYVDEVIIGAPWEVSRDMITTFNISLVVHGTVTEGSSVV--GIDSYAVPKSMGIFQTITS  379

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
             K ITT SV  RII NHE Y KRN KK+ASE +YY +KK+VSG+
Sbjct  380  TKPITTVSVATRIIDNHEAYKKRNLKKKASEDRYYTQKKFVSGD  423


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 48/78 (62%), Gaps = 7/78 (9%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFR  558
            ++VDEVI  AP+EIT++ + T    +NI  ++HG   +   +L D  D YA+ K +G ++
Sbjct  130  KWVDEVIPNAPYEITEEFMNTLFNKYNIDYIIHG---DDPCLLPDGTDAYALAKKVGRYK  186

Query  557  IIQSPKDITTTSVGQRII  504
             I+  + +++T +  RI+
Sbjct  187  QIKRTEGVSSTDIVGRIL  204



>ref|NP_001064493.1| Os10g0387000 [Oryza sativa Japonica Group]
 gb|ABB47464.1| Cytidylyltransferase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26407.1| Os10g0387000 [Oryza sativa Japonica Group]
Length=425

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 85/104 (82%), Gaps = 2/104 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+++DMITTFNISLVVHGTV+E +S++    D YAVPKSMGIF+ I S
Sbjct  324  RYVDEVIIGAPWEVSRDMITTFNISLVVHGTVTEGSSVV--GIDSYAVPKSMGIFQTITS  381

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
             K ITT SV  RII NHE Y KRN KK+ASE +YY +KK+VSG+
Sbjct  382  TKPITTVSVATRIIDNHEAYKKRNLKKKASEDRYYTQKKFVSGD  425


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 48/78 (62%), Gaps = 7/78 (9%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFR  558
            ++VDEVI  AP+EIT++ + T    +NI  ++HG   +   +L D  D YA+ K +G ++
Sbjct  132  KWVDEVIPNAPYEITEEFMNTLFNKYNIDYIIHG---DDPCLLPDGTDAYALAKKVGRYK  188

Query  557  IIQSPKDITTTSVGQRII  504
             I+  + +++T +  RI+
Sbjct  189  QIKRTEGVSSTDIVGRIL  206



>ref|XP_010278899.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Nelumbo 
nucifera]
Length=418

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGTV+E+N   K  C+PY VP SMGIFR+++S
Sbjct  315  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAENNDYQKGKCNPYDVPISMGIFRLLES  374

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITTT++ +RI++NHE Y KRN
Sbjct  375  PLDITTTTIIRRIVSNHEAYQKRN  398



>ref|XP_009381352.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=419

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGT++E+   LK   +PYAVP +M I++ ++S
Sbjct  316  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTIAENMDFLKKESNPYAVPMAMAIYKKLES  375

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI++N+E Y KRN KKEASE++YY  K +VSG+
Sbjct  376  PLDITTSTIIKRIVSNNEAYQKRNEKKEASERRYYENKSFVSGD  419



>ref|XP_008370315.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Malus 
domestica]
Length=428

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIG+PWEI+KDM+TTFNISLVVHGT++E+++  K+  +PY VP S+GIF+++ S
Sbjct  325  RYVDEVIIGSPWEISKDMLTTFNISLVVHGTIAENSNFEKEEGNPYQVPISLGIFKVLDS  384

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
              DITT+++ +RI++NHE Y KRN KK ASEK+YY  K YVSG+
Sbjct  385  SLDITTSTIIRRIVSNHEAYQKRNXKKAASEKRYYEGKAYVSGD  428



>gb|KJB27590.1| hypothetical protein B456_005G001400 [Gossypium raimondii]
Length=418

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGTV+ES+   K+  +PY VP SMGIF++++S
Sbjct  315  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAESSDFQKEKDNPYDVPISMGIFKVLES  374

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITTT++ +RI+ANH+ Y KRN
Sbjct  375  PLDITTTTIIKRIVANHKAYQKRN  398



>emb|CDX91484.1| BnaC04g06660D [Brassica napus]
Length=411

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KD ITTF+ISLVVHGTV+ES+   ++  +PYAVP SMGIF++++S
Sbjct  317  RYVDEVIIGAPWEVSKDTITTFDISLVVHGTVAESDDFQREEENPYAVPISMGIFQVLES  376

Query  545  PKDITTTSVGQRIIANHEIY  486
            P DITT+++ +RI+ANHE Y
Sbjct  377  PLDITTSTIIRRIVANHEAY  396



>emb|CDX74894.1| BnaA05g06400D [Brassica napus]
Length=430

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KD ITTF+ISLVVHGTV+ES+   ++  +PYAVP SMGIF++++S
Sbjct  317  RYVDEVIIGAPWEVSKDTITTFDISLVVHGTVAESDDFQREEENPYAVPISMGIFQVLES  376

Query  545  PKDITTTSVGQRIIANHEIY  486
            P DITT+++ +RI+ANHE Y
Sbjct  377  PLDITTSTIIRRIVANHEAY  396



>ref|XP_008358193.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Malus 
domestica]
Length=428

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            R+VDEVIIGAPW I+KDM+TTFNISLVVHGTV+E+++  K+  +PY VP ++GIF++++S
Sbjct  325  RHVDEVIIGAPWVISKDMLTTFNISLVVHGTVAENSNFEKEEGNPYEVPINLGIFKVLES  384

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI++NHE Y KRN KK ASEK+YY  K YVSG+
Sbjct  385  PLDITTSTIIRRIVSNHEAYQKRNEKKAASEKRYYESKGYVSGD  428



>dbj|BAJ86064.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=421

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW+I+KDMI TFNISLVV GT++E+    KD   PYAVP  MGIF  ++S
Sbjct  318  RYVDEVIIGAPWDISKDMIATFNISLVVQGTIAENMDFAKDESHPYAVPMDMGIFHRLES  377

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI++NHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  378  PLDITTSTIIRRIVSNHEAYQKRNEKKEASEKKYYESKNFVNGE  421



>ref|XP_004972543.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Setaria italica]
Length=494

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 87/130 (67%), Gaps = 26/130 (20%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNS-----------------------  615
            RYVDEVIIGAPWE++KDMITTFNISLVVHGTV+E N                        
Sbjct  365  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAEGNPAVSINELMSKTNLHVVAEFIMKI  424

Query  614  ---MLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQRIIANHEIYVKRNakkeasekky  444
               +L+   DPYAVPKSMGIF+ I SPK IT+ SV  RI+ NHE Y KRN KK+ASE +Y
Sbjct  425  DEWVLQGEIDPYAVPKSMGIFKTITSPKSITSVSVATRIVDNHEAYKKRNLKKKASEDRY  484

Query  443  yaekkYVSGE  414
            Y +KK+VSG+
Sbjct  485  YTQKKFVSGD  494



>ref|XP_004137664.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
sativus]
 gb|KGN58672.1| hypothetical protein Csa_3G727900 [Cucumis sativus]
Length=431

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGTV+E N   K  C+PYAVP SMGIF+I+ S
Sbjct  328  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAEINDFQKRDCNPYAVPISMGIFKILDS  387

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITTT++ +RI++NHE Y KRN
Sbjct  388  PLDITTTTIIRRIVSNHEAYQKRN  411



>ref|XP_002323699.2| hypothetical protein POPTR_0016s15020g [Populus trichocarpa]
 gb|EEF05460.2| hypothetical protein POPTR_0016s15020g [Populus trichocarpa]
Length=427

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            +YVDEVIIGAPWE++KDMITTFNIS VVHGTV+E+N  LK+  +PY VP SMGIF+++ S
Sbjct  324  QYVDEVIIGAPWEVSKDMITTFNISSVVHGTVAENNDFLKEKDNPYVVPISMGIFQVLDS  383

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITTT++ +RI++NHE Y KRN KK ASE++YY +K YVSG+
Sbjct  384  PLDITTTTIIKRIVSNHEAYQKRNQKKAASERRYYEDKAYVSGD  427



>gb|EMT24851.1| Ethanolamine-phosphate cytidylyltransferase [Aegilops tauschii]
Length=418

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 66/84 (79%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAP E+++DMITTFNISLVVHGTV E  S      DPYA+PKSMGIF+++ S
Sbjct  317  RYVDEVIIGAPLEVSRDMITTFNISLVVHGTVVEGGS--ASEVDPYALPKSMGIFQVVTS  374

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            PK IT+ SV  RII NHE Y KRN
Sbjct  375  PKTITSVSVATRIIDNHEAYKKRN  398


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 47/78 (60%), Gaps = 7/78 (9%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFR  558
            ++VDEVI  AP+EIT++ + T    +NI  ++HG   +   +L D  D YA+ K  G ++
Sbjct  132  KWVDEVIPNAPYEITEEFMNTLFSKYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYK  188

Query  557  IIQSPKDITTTSVGQRII  504
             I+  + +++T +  RI+
Sbjct  189  QIRRTEGVSSTDIVGRIL  206



>gb|EMS51700.1| Ethanolamine-phosphate cytidylyltransferase [Triticum urartu]
Length=428

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 66/84 (79%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAP E+++DMITTFNISLVVHGTV E  S      DPYA+PKSMGIF+++ S
Sbjct  327  RYVDEVIIGAPLEVSRDMITTFNISLVVHGTVVEGGS--ASEVDPYALPKSMGIFQVVTS  384

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            PK IT+ SV  RII NHE Y KRN
Sbjct  385  PKTITSVSVATRIIDNHEAYKKRN  408


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 47/78 (60%), Gaps = 7/78 (9%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFR  558
            ++VDEVI  AP+EIT++ + T    +NI  ++HG   +   +L D  D YA+ K  G ++
Sbjct  132  KWVDEVIPNAPYEITEEFMNTLFSKYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYK  188

Query  557  IIQSPKDITTTSVGQRII  504
             I+  + +++T +  RI+
Sbjct  189  QIRRTEGVSSTDIVGRIL  206



>gb|EYU26697.1| hypothetical protein MIMGU_mgv1a007403mg [Erythranthe guttata]
 gb|EYU26698.1| hypothetical protein MIMGU_mgv1a007403mg [Erythranthe guttata]
 gb|EYU26699.1| hypothetical protein MIMGU_mgv1a007403mg [Erythranthe guttata]
Length=409

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            +Y DEVIIGAP E++KDMITTFNISLVV GTV+E N   KD  +PYA+P S+GIF++++S
Sbjct  306  QYADEVIIGAPREVSKDMITTFNISLVVQGTVAEDNDFQKDKQNPYAIPISLGIFKLLES  365

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITT+++ +RI++NHE Y KRN
Sbjct  366  PLDITTSTIIRRILSNHEAYQKRN  389



>gb|KDP21814.1| hypothetical protein JCGZ_00601 [Jatropha curcas]
Length=417

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGTV+E+    ++ C+PYAVP SMGIF++++S
Sbjct  314  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAENIDYAEEKCNPYAVPISMGIFKVLES  373

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITTT++ +RI+ANHE Y KRN
Sbjct  374  PLDITTTTIIRRIVANHEAYQKRN  397



>ref|XP_008442304.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X3 [Cucumis melo]
Length=376

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGTV+E N   K  C+PYAVP +MGIF+I+ S
Sbjct  273  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAEVNDFQKRDCNPYAVPINMGIFKILDS  332

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITTT++ +RI++NHE Y KRN
Sbjct  333  PLDITTTTIIRRIVSNHEAYQKRN  356



>ref|XP_011006223.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Populus euphratica]
Length=426

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            +YVDEVIIGAPWE++KDMITTFNIS VVHGTV+E+N  LK+  +PY VP SMGIF+++ S
Sbjct  323  QYVDEVIIGAPWEVSKDMITTFNISSVVHGTVAENNDFLKEKDNPYVVPISMGIFQVLDS  382

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITTT++ +RI++NHE Y KRN KK ASE++YY +K Y+SG+
Sbjct  383  PLDITTTTIIKRIVSNHEAYQKRNQKKAASERRYYEDKAYISGD  426



>ref|XP_010036047.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X1 [Eucalyptus grandis]
 gb|KCW47570.1| hypothetical protein EUGRSUZ_K01317 [Eucalyptus grandis]
Length=425

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+++DMITTF+ISLVVHGT++E+N   KD  +PYAVP SMGIF++++S
Sbjct  322  RYVDEVIIGAPWEVSRDMITTFDISLVVHGTIAENNDFQKDEGNPYAVPISMGIFKVLES  381

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITTT++ +RI+ANHE ++KRN
Sbjct  382  PLDITTTTIIRRIVANHEAFLKRN  405



>ref|XP_008442303.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X2 [Cucumis melo]
Length=430

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGTV+E N   K  C+PYAVP +MGIF+I+ S
Sbjct  327  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAEVNDFQKRDCNPYAVPINMGIFKILDS  386

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITTT++ +RI++NHE Y KRN
Sbjct  387  PLDITTTTIIRRIVSNHEAYQKRN  410



>ref|XP_001759318.1| predicted protein [Physcomitrella patens]
 gb|EDQ76002.1| predicted protein [Physcomitrella patens]
Length=422

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 69/87 (79%), Gaps = 3/87 (3%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSML---KDTCDPYAVPKSMGIFRI  555
            RYVDEVIIGAPWE+TKDMITTFNISLVVHGT +E N +L   +   DPY+  K+ GIF  
Sbjct  316  RYVDEVIIGAPWEVTKDMITTFNISLVVHGTCAEENFVLPWRQGEIDPYSAAKAAGIFSE  375

Query  554  IQSPKDITTTSVGQRIIANHEIYVKRN  474
            I+SP+DITT+++  RI+ANH+ Y KRN
Sbjct  376  IKSPRDITTSTIISRILANHDAYKKRN  402



>ref|XP_003533643.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Glycine max]
Length=415

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWEI+KDM+TTFNISLVVHGT++ESN   K+ C+PYAVP SMGIF++++S
Sbjct  312  RYVDEVIIGAPWEISKDMLTTFNISLVVHGTIAESNDFKKEECNPYAVPISMGIFKVLES  371

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              DITTT++ +RI++NHE Y  RN
Sbjct  372  TLDITTTTIIRRIVSNHEAYQNRN  395



>ref|XP_008442302.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X1 [Cucumis melo]
Length=493

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGTV+E N   K  C+PYAVP +MGIF+I+ S
Sbjct  390  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAEVNDFQKRDCNPYAVPINMGIFKILDS  449

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITTT++ +RI++NHE Y KRN
Sbjct  450  PLDITTTTIIRRIVSNHEAYQKRN  473



>gb|EPS64234.1| hypothetical protein M569_10547, partial [Genlisea aurea]
Length=423

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 71/87 (82%), Gaps = 3/87 (3%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSML---KDTCDPYAVPKSMGIFRI  555
            +YVD++IIGAP+ +TKDMI+TFNISLVV G++SE N+ L       DPY VPK MGIFR 
Sbjct  318  QYVDDIIIGAPFAVTKDMISTFNISLVVRGSISEDNNPLLWDGAASDPYDVPKGMGIFRN  377

Query  554  IQSPKDITTTSVGQRIIANHEIYVKRN  474
            ++SP+ ITT+S+ +RIIANHEIY+KRN
Sbjct  378  LESPEVITTSSIAERIIANHEIYLKRN  404



>ref|XP_006429675.1| hypothetical protein CICLE_v10011843mg [Citrus clementina]
 ref|XP_006481274.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Citrus 
sinensis]
 gb|ESR42915.1| hypothetical protein CICLE_v10011843mg [Citrus clementina]
Length=416

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGTV+E+N   KD  +PYA+P SM IF++++S
Sbjct  313  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAENNDFQKDDGNPYAIPISMDIFKVLES  372

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITTT++ +RI++NHE Y KRN KK ASEK+YY  K +VSG+
Sbjct  373  PLDITTTTIIRRIVSNHEAYQKRNEKKNASEKRYYEGKTFVSGD  416



>emb|CDY07710.1| BnaA03g18010D [Brassica napus]
Length=439

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KD ITTF+I  VVHGTV+ES+   K+  +PYAVPKSMGIF +++S
Sbjct  315  RYVDEVIIGAPWEVSKDTITTFDIWKVVHGTVAESDDFQKEEGNPYAVPKSMGIFEVLES  374

Query  545  PKDITTTSVGQRIIANHEIY  486
            P DI+T+++ +RI+ANHE Y
Sbjct  375  PLDISTSTIIKRIVANHEAY  394



>emb|CDY14442.1| BnaC03g21530D [Brassica napus]
Length=426

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KD ITTF+I  VVHGTV+ES+   K+  +PYAVPKSMGIF +++S
Sbjct  311  RYVDEVIIGAPWEVSKDTITTFDIWKVVHGTVAESDDFQKEEGNPYAVPKSMGIFEVLES  370

Query  545  PKDITTTSVGQRIIANHEIY  486
            P DI+T+++ +RI+ANHE Y
Sbjct  371  PLDISTSTIIKRIVANHEAY  390



>ref|XP_010036048.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X2 [Eucalyptus grandis]
Length=425

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+++DMITTF+ISLVVHGT++E+N   KD  +PYAVP SMGIF++++S
Sbjct  322  RYVDEVIIGAPWEVSRDMITTFDISLVVHGTIAENNDFQKDEGNPYAVPISMGIFKVLES  381

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITTT++ +RI+ANHE ++KR+
Sbjct  382  PLDITTTTIIRRIVANHEAFLKRS  405



>ref|XP_003579008.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brachypodium 
distachyon]
Length=427

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNIS+VV GT++E+    KD   PYAV   MGI   ++S
Sbjct  324  RYVDEVIIGAPWEVSKDMITTFNISIVVQGTIAENMDFAKDESHPYAVAMEMGILHRLES  383

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITT+++ +RI++NHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  384  PLDITTSTIIRRIVSNHEAYQKRNEKKEASEKKYYESKNFVNGE  427



>ref|XP_010684667.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Beta 
vulgaris subsp. vulgaris]
Length=422

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KD ITTFNISLVVHGTV+ES+   ++  +PYAVP SMGIF++I S
Sbjct  319  RYVDEVIIGAPWEVSKDTITTFNISLVVHGTVAESDDFQQENDNPYAVPISMGIFKVIDS  378

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITTT++ +RI+ANHE Y KRN KK  SE+KYY EK YVSG+
Sbjct  379  PLDITTTTIIRRIVANHEAYQKRNEKKATSERKYYEEKTYVSGD  422



>ref|XP_006587893.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Glycine max]
Length=393

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWEI+KDM+TTFNISLVVHGT++ESN   K+ C+PYAVP SMGIF++++S
Sbjct  312  RYVDEVIIGAPWEISKDMLTTFNISLVVHGTIAESNDFKKEECNPYAVPISMGIFKVLES  371

Query  545  PKDITTTSVGQRIIANHEIYVK  480
              DITTT++ +RI++NHE Y K
Sbjct  372  TLDITTTTIIRRIVSNHEAYQK  393



>gb|KEH23310.1| ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=312

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGT +E+    K+  +PYAVP S+GIF+I+ S
Sbjct  209  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTTAENTDFQKEQSNPYAVPISLGIFQILDS  268

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITTT++ +RI++NHE Y KRN KK  SEKKYY  K +VSG+
Sbjct  269  PLDITTTTIIRRIVSNHEAYQKRNEKKGESEKKYYESKTHVSGD  312



>ref|XP_009151252.1| PREDICTED: uncharacterized protein LOC103874581 [Brassica rapa]
Length=533

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVI GAPWE++K  IT F ISLVVHGTV+ES++  +   +PYAVP SMGIF+I++S
Sbjct  397  RYVDEVIFGAPWEVSKITITFFGISLVVHGTVAESDNFQRKEENPYAVPISMGIFQILES  456

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P +ITT+++  RI+ANHE Y KRN
Sbjct  457  PLNITTSTIMGRIVANHEAYQKRN  480



>ref|XP_004972546.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X5 [Setaria italica]
 ref|XP_004972547.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X6 [Setaria italica]
Length=462

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 69/110 (63%), Gaps = 26/110 (24%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNS-----------------------  615
            RYVDEVIIGAPWE++KDMITTFNISLVVHGTV+E N                        
Sbjct  323  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAEGNPAVSINELMSKTNLHVVAEFIMKI  382

Query  614  ---MLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQRIIANHEIYVKRN  474
               +L+   DPYAVPKSMGIF+ I SPK IT+ SV  RI+ NHE Y  R+
Sbjct  383  DEWVLQGEIDPYAVPKSMGIFKTITSPKSITSVSVATRIVDNHEAYKVRD  432



>gb|KHN29458.1| Ethanolamine-phosphate cytidylyltransferase [Glycine soja]
Length=414

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWEI+KDM+TTFNISLVVHGT++ESN   K+ C+PYAVP SMGIF++++S
Sbjct  312  RYVDEVIIGAPWEISKDMLTTFNISLVVHGTIAESNDFKKEECNPYAVPISMGIFKVLES  371

Query  545  PKDITTTSVGQRIIANHEIY  486
              DITTT++ +RI++NHE Y
Sbjct  372  TLDITTTTIIRRIVSNHEAY  391



>ref|XP_001780359.1| predicted protein [Physcomitrella patens]
 gb|EDQ54813.1| predicted protein [Physcomitrella patens]
Length=393

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+TKDMITTFNISLVVHG+ +E N +     DPY   K+ GIF  I+S
Sbjct  292  RYVDEVIIGAPWEVTKDMITTFNISLVVHGSCAEENELR--NIDPYKAAKAAGIFAEIKS  349

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P++ITT+++  RI+ NHE Y KRN
Sbjct  350  PRNITTSTIISRILTNHEAYRKRN  373



>ref|XP_004972542.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Setaria italica]
Length=504

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 69/110 (63%), Gaps = 26/110 (24%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNS-----------------------  615
            RYVDEVIIGAPWE++KDMITTFNISLVVHGTV+E N                        
Sbjct  365  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAEGNPAVSINELMSKTNLHVVAEFIMKI  424

Query  614  ---MLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQRIIANHEIYVKRN  474
               +L+   DPYAVPKSMGIF+ I SPK IT+ SV  RI+ NHE Y  R+
Sbjct  425  DEWVLQGEIDPYAVPKSMGIFKTITSPKSITSVSVATRIVDNHEAYKVRD  474



>ref|XP_003623695.1| Ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=419

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGT +E+    K+  +PYAVP S+GIF+I+ S
Sbjct  316  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTTAENTDFQKEQSNPYAVPISLGIFQILDS  375

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITTT++ +RI++NHE Y KRN KK  SEKKYY  K +VSG+
Sbjct  376  PLDITTTTIIRRIVSNHEAYQKRNEKKGESEKKYYESKTHVSGD  419



>gb|AES79913.2| ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=422

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGT +E+    K+  +PYAVP S+GIF+I+ S
Sbjct  319  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTTAENTDFQKEQSNPYAVPISLGIFQILDS  378

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITTT++ +RI++NHE Y KRN KK  SEKKYY  K +VSG+
Sbjct  379  PLDITTTTIIRRIVSNHEAYQKRNEKKGESEKKYYESKTHVSGD  422



>ref|XP_011018911.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Populus 
euphratica]
Length=428

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWEI+KDMITTFNIS VVHGTV+E++   K+  +PYAVP SMGIF+I+ S
Sbjct  325  RYVDEVIIGAPWEISKDMITTFNISSVVHGTVAENDDFQKEQDNPYAVPISMGIFKILDS  384

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITTT++ +RI++NHE Y KRN
Sbjct  385  PLDITTTTIIRRIVSNHEAYQKRN  408



>gb|AFK43034.1| unknown [Medicago truncatula]
Length=422

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGT +E+    K+  +PYAVP S+GIF+I+ S
Sbjct  319  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTTAENTDFQKEQSNPYAVPISLGIFQILDS  378

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITTT++ +RI++NHE Y KRN KK  SEKKYY  K +VSG+
Sbjct  379  PLDITTTTIIRRIVSNHEAYQKRNEKKGESEKKYYESKTHVSGD  422



>ref|XP_006381291.1| hypothetical protein POPTR_0006s11470g [Populus trichocarpa]
 gb|ERP59088.1| hypothetical protein POPTR_0006s11470g [Populus trichocarpa]
Length=423

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWEI+KDMITTFNIS VVHGTV+E++   K+  +PYAVP SMGIF+++ S
Sbjct  320  RYVDEVIIGAPWEISKDMITTFNISSVVHGTVAENDDFQKEQDNPYAVPISMGIFKVLDS  379

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P DITTT++ +RI++NHE Y KRN
Sbjct  380  PLDITTTTIIRRIVSNHEAYQKRN  403



>emb|CBI31131.3| unnamed protein product [Vitis vinifera]
Length=362

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGTV+E N+  K   DPYA+P S+GI+  ++S
Sbjct  259  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAEYNNFPKGKEDPYAIPISLGIYEQLES  318

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITTT++ +RI++NHE Y KRN KK  SEK+YY +K +VSG+
Sbjct  319  PLDITTTTIIRRIVSNHEAYQKRNEKKAESEKRYYEDKTFVSGD  362



>ref|XP_002265169.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Vitis 
vinifera]
 emb|CAQ58612.1| Ethanolamine-phosphate cytidylyltransferase [Vitis vinifera]
Length=421

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGTV+E N+  K   DPYA+P S+GI+  ++S
Sbjct  318  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAEYNNFPKGKEDPYAIPISLGIYEQLES  377

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITTT++ +RI++NHE Y KRN KK  SEK+YY +K +VSG+
Sbjct  378  PLDITTTTIIRRIVSNHEAYQKRNEKKAESEKRYYEDKTFVSGD  421



>emb|CAQ58636.1| Ethanolamine-phosphate cytidylyltransferase [Vitis vinifera]
Length=424

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNISLVVHGTV+E N+  K   DPYA+P S+GI+  ++S
Sbjct  321  RYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAEYNNFPKGKEDPYAIPISLGIYEQLES  380

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITTT++ +RI++NHE Y KRN KK  SEK+YY +K +VSG+
Sbjct  381  PLDITTTTIIRRIVSNHEAYQKRNEKKAESEKRYYEDKTFVSGD  424



>ref|XP_002519980.1| Ethanolamine-phosphate cytidylyltransferase, putative [Ricinus 
communis]
 gb|EEF42304.1| Ethanolamine-phosphate cytidylyltransferase, putative [Ricinus 
communis]
Length=418

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE++KDMITTFNI LVVHGTV+E+    ++  +PY VP SMGIF++++S
Sbjct  315  RYVDEVIIGAPWEVSKDMITTFNIFLVVHGTVAENTDYQEEKSNPYDVPISMGIFQVLES  374

Query  545  PKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            P DITTT++ +RI+ANHE Y KRN KK  SEK+YY  K +VSG+
Sbjct  375  PLDITTTTIIRRIVANHEAYQKRNEKKAESEKRYYEGKTFVSGD  418



>ref|XP_004492610.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cicer 
arietinum]
Length=418

 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+++DMITTFNISLVVHGT +E+    K+  +PYAVP SMGIF+I+ S
Sbjct  315  RYVDEVIIGAPWEVSRDMITTFNISLVVHGTTAENTDFQKEQSNPYAVPISMGIFQILDS  374

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              DITTT++ +RI++NHE Y KRN
Sbjct  375  SLDITTTTIIRRIVSNHEAYQKRN  398



>ref|XP_010113033.1| Ethanolamine-phosphate cytidylyltransferase [Morus notabilis]
 gb|EXC35204.1| Ethanolamine-phosphate cytidylyltransferase [Morus notabilis]
Length=383

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+++DMITTFNISLVVHGTV+E+N   K+  +PY VP SMGIF+I++S
Sbjct  255  RYVDEVIIGAPWEVSRDMITTFNISLVVHGTVAENNDFQKENGNPYDVPISMGIFKILES  314

Query  545  PKDITTTSVGQRIIANHEIY  486
            P DITTT++ +RI++NHE Y
Sbjct  315  PLDITTTTIIRRIVSNHEAY  334



>gb|EEC68755.1| hypothetical protein OsI_37278 [Oryza sativa Indica Group]
Length=412

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 90/154 (58%), Gaps = 50/154 (32%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDM------------------------------------------  672
            RYVDEVIIGAPW+++KDM                                          
Sbjct  259  RYVDEVIIGAPWDVSKDMELLDATASNSSLNMAQLCMHSSKIEHDIYATPAKALLTAIID  318

Query  671  --------ITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVG  516
                    ITTFNISLVVHGT++E+   +KD  +PYAVP++MGI+R ++SP DITT+++ 
Sbjct  319  FRYRLTDMITTFNISLVVHGTIAENMDFMKDDLNPYAVPRAMGIYRRLESPLDITTSTII  378

Query  515  QRIIANHEIYVKRNakkeasekkyyaekkYVSGE  414
            +RI+ANHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  379  RRIVANHEAYQKRNEKKEASEKKYYDSKSFVNGE  412



>gb|EMT25098.1| Ethanolamine-phosphate cytidylyltransferase [Aegilops tauschii]
Length=349

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 84/123 (68%), Gaps = 19/123 (15%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDM-------------------ITTFNISLVVHGTVSESNSMLKD  603
            RYVDEVIIGAPW I+KDM                   ITTFNISLVVHGT++E+    +D
Sbjct  227  RYVDEVIIGAPWHISKDMDRLVITCCNFSCQPGYVCVITTFNISLVVHGTIAENMDYTED  286

Query  602  TCDPYAVPKSMGIFRIIQSPKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYV  423
              +PYA P +MGI+  + SP DITT+++ +RI++NHE Y KRN KKEASEKKYY  K +V
Sbjct  287  DSNPYAAPIAMGIYHKLDSPLDITTSTIIRRIVSNHEAYQKRNEKKEASEKKYYDSKSFV  346

Query  422  SGE  414
            +GE
Sbjct  347  NGE  349



>emb|CDY18374.1| BnaA04g22130D [Brassica napus]
 emb|CDX93310.1| BnaC04g45860D [Brassica napus]
Length=409

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAP E++KD ITTF+ISLVVHGTV+ES+   K+  +PYAVP SMGIF+I++S
Sbjct  314  RYVDEVIIGAPSEVSKDTITTFDISLVVHGTVAESDDFQKEEGNPYAVPISMGIFQILES  373

Query  545  PKDITTTSVGQRIIAN  498
            P DITT+++ +RI  N
Sbjct  374  PLDITTSTIIKRIKRN  389



>gb|ABX10446.1| ethanolamine-phosphate cytidylyltransferase 2 [Gossypium hirsutum]
Length=413

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEV             T     LVVHGTV+ESNS L    DPYA+PKSMGIFR+++S
Sbjct  310  RYVDEVYRALRRSKAWFTFTFLGGPLVVHGTVAESNSSLPGETDPYAIPKSMGIFRLLES  369

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            PK ITT+SV QRI+ NHE+Y+KRN
Sbjct  370  PKSITTSSVAQRIVTNHEVYMKRN  393



>emb|CDY48653.1| BnaC07g27560D [Brassica napus]
Length=672

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVI GAPWE++K+ IT F ISLVVHGTV+ES++  +   +PYAVP SMGIF+I++S
Sbjct  443  RYVDEVIFGAPWEVSKNTITFFGISLVVHGTVAESDNFQRKEENPYAVPISMGIFQILES  502

Query  545  PKDITTTSVGQRIIAN  498
            P DITT+++  RI  N
Sbjct  503  PLDITTSTIMGRIKRN  518



>ref|XP_005538734.1| phosphoethanolamine cytidylyltransferase [Cyanidioschyzon merolae 
strain 10D]
 dbj|BAM82698.1| phosphoethanolamine cytidylyltransferase [Cyanidioschyzon merolae 
strain 10D]
Length=442

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW++T+DMI T NISLV+HGT  +  ++     DPY VPK +GIFR I S
Sbjct  339  RYVDEVIIGAPWKVTEDMIKTMNISLVIHGTHYDELNIRDGDDDPYEVPKRLGIFREIPS  398

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              D++   + +RI+ N E Y++R 
Sbjct  399  SSDLSVPKIIERIVRNRERYLERQ  422



>ref|XP_010913786.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Elaeis guineensis]
Length=362

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 52/66 (79%), Gaps = 2/66 (3%)
 Frame = -1

Query  671  ITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQRIIANHE  492
            ITTFNISLVVHGTV+E +    +  DPYA PKSMGIF+ I SPK+IT+TSV +RII NHE
Sbjct  279  ITTFNISLVVHGTVAEGS--CNNEVDPYATPKSMGIFKTIASPKNITSTSVARRIIDNHE  336

Query  491  IYVKRN  474
             Y KRN
Sbjct  337  AYKKRN  342



>ref|XP_005647873.1| CTP-phosphoethanolamine cytidylyltransferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23329.1| CTP-phosphoethanolamine cytidylyltransferase [Coccomyxa subellipsoidea 
C-169]
Length=461

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -1

Query  722  YVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSP  543
            YV+EVIIGAP E+T+D++TTFNISLVV GTVSE+ +        Y VPK   I R ++SP
Sbjct  359  YVNEVIIGAPLEVTEDLLTTFNISLVVRGTVSETGAADNADHPRYMVPKQRDIMRTLRSP  418

Query  542  KDITTTSVGQRIIANHEIYVKRN  474
            +DITT ++  RI++N   Y  RN
Sbjct  419  RDITTATIIHRIVSNRAAYEARN  441



>ref|XP_005845984.1| hypothetical protein CHLNCDRAFT_25204, partial [Chlorella variabilis]
 gb|EFN53882.1| hypothetical protein CHLNCDRAFT_25204, partial [Chlorella variabilis]
Length=200

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 58/84 (69%), Gaps = 1/84 (1%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEV+IGAP EI +D++TTFNISLVV GTV E+ S   +    YAVP+  GIF+ + S
Sbjct  97   RYVDEVVIGAPMEIAEDLLTTFNISLVVTGTVHETCSRDSER-QRYAVPQERGIFQRLDS  155

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P  +T+  + +RI+AN  ++  R 
Sbjct  156  PDTMTSAKLIERIMANRALFEARQ  179



>ref|XP_005714716.1| Ethanolamine-phosphate cytidylyltransferase, putative [Chondrus 
crispus]
 emb|CDF34897.1| Ethanolamine-phosphate cytidylyltransferase, putative [Chondrus 
crispus]
Length=453

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            R+VDEVIIGAPW I++DMI T NIS VVHG+    +  + +  DPY VP+ M +   ++S
Sbjct  349  RHVDEVIIGAPWCISEDMIKTMNISAVVHGSHRGDSKYVDNFVDPYEVPRQMNLLHKVKS  408

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              ++T   V  RI+ N E +VKRN
Sbjct  409  ESELTVQVVLDRIVQNREAFVKRN  432



>emb|CDY52476.1| BnaC07g49370D [Brassica napus]
Length=142

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -1

Query  671  ITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQRIIANHE  492
            IT F ISLVVHGTV+ES++  +   +PYAVP SMGIF+I++SP +ITT+++  RI+ANHE
Sbjct  7    ITIFGISLVVHGTVAESDNFQRKEENPYAVPISMGIFQILESPLNITTSTIMGRIVANHE  66

Query  491  IY  486
             Y
Sbjct  67   AY  68



>ref|XP_004368196.1| CTP:ethanolaminephosphate cytidylyltransferase [Acanthamoeba 
castellanii str. Neff]
 gb|ELR25441.1| CTP:ethanolaminephosphate cytidylyltransferase [Acanthamoeba 
castellanii str. Neff]
Length=366

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPW I++D +T   ISLV+HG   +    L    DPYA  K +GIF+ I+ 
Sbjct  261  RYVDEVIIGAPWGISEDDLTNLRISLVLHGDERDQYYPLPSADDPYAAAKKLGIFQEIKY  320

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
             + ++TTS+  RII +   Y KRN
Sbjct  321  SQGLSTTSIVDRIIHHRLTYEKRN  344



>ref|XP_001008378.1| cytidyltransferase-related domain containing protein [Tetrahymena 
thermophila]
 gb|EAR88133.1| choline-phosphate cytidylyltransferase [Tetrahymena thermophila 
SB210]
Length=454

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 59/90 (66%), Gaps = 6/90 (7%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTC--DPYAVPKSMGIFRII  552
            +YVDEVIIGAPW+ T+ +I  FNIS+VV GT+++      +    DPY VPK +GIF+ I
Sbjct  349  KYVDEVIIGAPWQPTEQLIKQFNISIVVEGTMTKLKENKPEVIEQDPYLVPKKLGIFKQI  408

Query  551  QSPKDITTTSVGQRIIANH----EIYVKRN  474
            +S  D+TT  + +RII N     EIY  +N
Sbjct  409  ESSNDMTTDKIVERIIENRLRFLEIYNVKN  438



>ref|XP_002950808.1| hypothetical protein VOLCADRAFT_109104 [Volvox carteri f. nagariensis]
 gb|EFJ48123.1| hypothetical protein VOLCADRAFT_109104 [Volvox carteri f. nagariensis]
Length=402

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            +YVDEVIIG+P  +T D+I TFNISLVV G+VSE++ +     + Y+VP++ GIFR ++S
Sbjct  298  KYVDEVIIGSPCVMTDDLIKTFNISLVVRGSVSETSMLGPVKQERYSVPRAAGIFRELRS  357

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P ++T  ++  RI+     + +RN
Sbjct  358  PSEVTARNIIHRIVDKRAAFEERN  381



>ref|XP_004032276.1| hypothetical protein IMG5_125800 [Ichthyophthirius multifiliis]
 gb|EGR30689.1| hypothetical protein IMG5_125800 [Ichthyophthirius multifiliis]
Length=373

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 59/91 (65%), Gaps = 8/91 (9%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSES----NSMLKDTCDPYAVPKSMGIFR  558
            +YVDEVIIGAPW I ++MI  FNIS+VV G++++      + +    DPY +PK MGI+R
Sbjct  278  KYVDEVIIGAPWNINQNMIKEFNISIVVEGSMTKQKVNDQTQVTREDDPYKIPKQMGIYR  337

Query  557  IIQSPKDITTTSVGQRIIANH----EIYVKR  477
            I+ S  ++TT  + +RII       EIY +R
Sbjct  338  IVVSACNLTTEKIVERIIDQRLKYLEIYNER  368



>ref|XP_010774781.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Notothenia 
coriiceps]
Length=302

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ + KD++  F + LV HG         KDT DPYA PK  G+F+ + S
Sbjct  191  RYVSEVVIGAPYAVGKDLLDHFRVDLVCHGKTEVFPD--KDTSDPYAEPKKRGVFKAVDS  248

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              ++TT  + QRIIAN   +  RN
Sbjct  249  ANNLTTDDIVQRIIANRLQFEARN  272



>ref|XP_002155934.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Hydra 
vulgaris]
Length=374

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 57/84 (68%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV++VIIGAP+++T+++IT F + +VVHG+    N    D  DPYA PK +GIF+ + S
Sbjct  266  RYVNQVIIGAPYKVTEELITQFKVDVVVHGSTLIMNDA--DGSDPYAYPKQIGIFQTVDS  323

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
               +TT+ + QRIIA+   Y  RN
Sbjct  324  GNPLTTSDIVQRIIAHKLEYELRN  347



>ref|XP_007236102.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like, 
partial [Astyanax mexicanus]
Length=281

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ + KD++  F + +V HG         KD  DPYA PK  GIFRII S
Sbjct  172  RYVSEVVIGAPYAVNKDLLDHFRVDMVCHGQTEVFPD--KDGTDPYAEPKKRGIFRIINS  229

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
               +TT  + QRII N   +  RN
Sbjct  230  RNGLTTDDIVQRIIENRLQFEARN  253



>ref|XP_005989106.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Latimeria 
chalumnae]
Length=394

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 51/84 (61%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +T D++  F I L  HG       + KD  DPYA PK  GIFR++ S
Sbjct  282  RYVSEVVIGAPYAVTADLLDYFKIDLFCHGKTE--VFLDKDGSDPYAEPKRRGIFRVVDS  339

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              D+TT ++ QRII N   +  RN
Sbjct  340  GNDLTTDNIVQRIIKNRLEFEARN  363



>ref|XP_005597110.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X3 [Equus caballus]
Length=283

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +T +++  F + LV HG         KD  DPY  PKS GIFR I S
Sbjct  173  RYVSEVVIGAPYAVTAELLDHFKVDLVCHGKTEVMPD--KDGSDPYQEPKSRGIFRQIDS  230

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              D+TT  + QRII N   Y  RN
Sbjct  231  GNDLTTDLIVQRIIKNRLEYEARN  254



>emb|CEG66905.1| Putative Ethanolamine-phosphate cytidylyltransferase [Rhizopus 
microsporus]
Length=364

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 58/86 (67%), Gaps = 4/86 (5%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITT-FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQ  549
            RYVDEVIIGAP+ +T+D++ T +N+++VVHGT S    +  D  DPY +PKS GI++ I 
Sbjct  251  RYVDEVIIGAPYSVTEDVLNTEYNVTVVVHGTTSSEPDI--DGKDPYELPKSRGIYKEIS  308

Query  548  SPKD-ITTTSVGQRIIANHEIYVKRN  474
            SP   +TT  +  RII N  IY +R 
Sbjct  309  SPNSTLTTQDIIDRIIENRMIYEERQ  334



>emb|CEG84347.1| Putative Ethanolamine-phosphate cytidylyltransferase [Rhizopus 
microsporus]
Length=364

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 58/86 (67%), Gaps = 4/86 (5%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITT-FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQ  549
            RYVDEVIIGAP+ +T+D++ T +N+++VVHGT S    +  D  DPY +PKS GI++ I 
Sbjct  251  RYVDEVIIGAPYSVTEDVLNTEYNVTVVVHGTTSSEPDI--DGKDPYELPKSRGIYKEIS  308

Query  548  SPKD-ITTTSVGQRIIANHEIYVKRN  474
            SP   +TT  +  RII N  IY +R 
Sbjct  309  SPNSTLTTQDIIDRIIENRMIYEERQ  334



>ref|XP_005805135.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Xiphophorus 
maculatus]
Length=403

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ + KD++  F + LV HG         KD  DPYA P+  GIFR I S
Sbjct  290  RYVSEVVIGAPYAVGKDLLDHFKVDLVCHGKTEVFPD--KDGVDPYAEPRRRGIFRTIDS  347

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
               +TT  + QRIIAN   Y  RN
Sbjct  348  GNSLTTDDIVQRIIANRLQYEARN  371



>ref|XP_008408685.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Poecilia 
reticulata]
Length=405

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ + KD++  F + LV HG         KD  DPYA P+  GIFR I S
Sbjct  290  RYVSEVVIGAPYAVGKDLLDHFKVDLVCHGKTEVFPD--KDGVDPYAEPRRRGIFRTIDS  347

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
               +TT  + QRIIAN   Y  RN
Sbjct  348  GNSLTTDDIVQRIIANRLQYEARN  371



>gb|AAK13093.1|AC078839_9 Putative phospholipid cytidylyltransferase [Oryza sativa Japonica 
Group]
Length=742

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 46/80 (58%), Gaps = 22/80 (28%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEVIIGAPWE+++DM+                        D YAVPKSMGIF+ I S
Sbjct  681  RYVDEVIIGAPWEVSRDMVGI----------------------DSYAVPKSMGIFQTITS  718

Query  545  PKDITTTSVGQRIIANHEIY  486
             K ITT SV  RII NHE Y
Sbjct  719  TKPITTVSVATRIIDNHEAY  738



>ref|XP_007570241.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Poecilia 
formosa]
Length=404

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ + KD++  F + LV HG         KD  DPYA P+  GIFR I S
Sbjct  290  RYVSEVVIGAPYTVGKDLLDHFKVDLVCHGKTEVFPD--KDGVDPYAEPRRRGIFRTIDS  347

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
               +TT  + QRIIAN   Y  RN
Sbjct  348  GNSLTTDDIVQRIIANRLQYEARN  371



>ref|XP_010870922.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Esox 
lucius]
Length=401

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 50/84 (60%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ + KD++  F + LV+HG         KD+ DPYA PK  GIFR + S
Sbjct  289  RYVSEVVIGAPYAVGKDLLDHFKVDLVIHGKTEVFPD--KDSSDPYAEPKKRGIFRTVDS  346

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
               +TT  + QRII N   +  RN
Sbjct  347  GNSLTTDDIVQRIIENRLQFEARN  370



>ref|XP_005597109.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X2 [Equus caballus]
Length=357

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +T +++  F + LV HG         KD  DPY  PKS GIFR I S
Sbjct  247  RYVSEVVIGAPYAVTAELLDHFKVDLVCHGKTEVMPD--KDGSDPYQEPKSRGIFRQIDS  304

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              D+TT  + QRII N   Y  RN
Sbjct  305  GNDLTTDLIVQRIIKNRLEYEARN  328



>ref|XP_010143924.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X2 [Buceros rhinoceros silvestris]
Length=296

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 51/84 (61%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +T D++  F ++LV HG       + KD  DPY  PK  GIF+++ S
Sbjct  193  RYVSEVVIGAPYAVTADLLDHFKVTLVCHGMTE--VVLDKDGSDPYQEPKRRGIFQLVDS  250

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              D+TT  + QRII N   +  RN
Sbjct  251  GSDLTTDLIVQRIIKNRLQFEARN  274



>ref|XP_004559465.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X3 [Maylandia zebra]
 ref|XP_005744396.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Pundamilia nyererei]
 ref|XP_005936245.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Haplochromis burtoni]
Length=309

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 50/84 (60%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +TKD++  F + LV HG         KD  DPYA P+  GI R + S
Sbjct  198  RYVSEVVIGAPFAVTKDLLDHFKVDLVCHGKTEIYPD--KDGSDPYAEPRRKGILRTVDS  255

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
               +TT ++ QRII N  ++  RN
Sbjct  256  GNSLTTDAIVQRIIKNRLLFEARN  279



>ref|XP_005597108.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X1 [Equus caballus]
Length=375

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +T +++  F + LV HG         KD  DPY  PKS GIFR I S
Sbjct  265  RYVSEVVIGAPYAVTAELLDHFKVDLVCHGKTEVMPD--KDGSDPYQEPKSRGIFRQIDS  322

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              D+TT  + QRII N   Y  RN
Sbjct  323  GNDLTTDLIVQRIIKNRLEYEARN  346



>ref|NP_001167040.1| Ethanolamine-phosphate cytidylyltransferase [Salmo salar]
 gb|ACN10530.1| Ethanolamine-phosphate cytidylyltransferase [Salmo salar]
Length=401

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ + KD++  F + LV HG         +DT DPYA PK  GIFR + S
Sbjct  289  RYVSEVVIGAPYAVGKDLLDHFKVDLVCHGKTEVFPD--RDTADPYAEPKKRGIFRTVDS  346

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
               +TT  + QRII N   +  RN
Sbjct  347  GNGLTTDDIVQRIIKNRLQFEARN  370



>ref|XP_003964731.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Takifugu 
rubripes]
Length=402

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 51/84 (61%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +TKD++  F + LV HG         +D  DPYA P+  GI RI+ S
Sbjct  291  RYVSEVVIGAPFAVTKDLLDHFKVDLVCHGRTEIYPG--RDGSDPYAEPRRRGILRIVDS  348

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
               +TT ++ QRII N  ++  RN
Sbjct  349  GNGLTTDAIVQRIIKNRLLFEARN  372



>ref|XP_005925138.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Haplochromis burtoni]
Length=403

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ + KD++  F + LV HG         KD  DPYA PK  GIFR I S
Sbjct  291  RYVSEVVIGAPYAVGKDLLDHFKVDLVCHGKTEVLPD--KDGVDPYAEPKKRGIFRAIDS  348

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              ++TT  + QRII N   +  RN
Sbjct  349  GNNLTTDDIVQRIIENRLQFEARN  372



>ref|XP_005925137.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Haplochromis burtoni]
Length=402

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ + KD++  F + LV HG         KD  DPYA PK  GIFR I S
Sbjct  290  RYVSEVVIGAPYAVGKDLLDHFKVDLVCHGKTEVLPD--KDGVDPYAEPKKRGIFRAIDS  347

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              ++TT  + QRII N   +  RN
Sbjct  348  GNNLTTDDIVQRIIENRLQFEARN  371



>ref|XP_003455812.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Oreochromis 
niloticus]
Length=402

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ + KD++  F + LV HG         KD  DPYA PK  GIFR I S
Sbjct  290  RYVSEVVIGAPYAVGKDLLDHFKVDLVCHGKTEVLPD--KDGVDPYAEPKKRGIFRAIDS  347

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              ++TT  + QRII N   +  RN
Sbjct  348  GNNLTTDDIVQRIIENRLQFEARN  371



>ref|XP_006790764.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Neolamprologus 
brichardi]
Length=402

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ + KD++  F + LV HG         KD  DPYA PK  GIFR I S
Sbjct  290  RYVSEVVIGAPYAVGKDLLDHFKVDLVCHGKTEVLPD--KDGVDPYAEPKKRGIFRAIDS  347

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              ++TT  + QRII N   +  RN
Sbjct  348  GNNLTTDDIVQRIIENRLQFEARN  371



>ref|NP_001006037.1| ethanolamine-phosphate cytidylyltransferase [Danio rerio]
 gb|AAH83378.1| Zgc:103434 [Danio rerio]
 gb|AAI64006.1| Zgc:103434 protein [Danio rerio]
Length=397

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 50/84 (60%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ + KD++  F + LV HG  +       D  DPYA PK  GIFRI+ S
Sbjct  286  RYVSEVVIGAPYAVEKDLLDHFKVDLVCHGKTNVFPDA--DGTDPYAEPKKRGIFRILDS  343

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              ++TT  + QRII N   +  RN
Sbjct  344  SNNLTTDDIVQRIIENRLQFEARN  367



>ref|XP_010743291.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Larimichthys 
crocea]
Length=402

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 50/84 (60%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ + KD++  F + LV HG         KD+ DPYA P+  GIFR I S
Sbjct  290  RYVSEVVIGAPYAVGKDLLDHFKVDLVCHGKTEVIPD--KDSSDPYAEPRKRGIFRTIDS  347

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              ++TT  + QRII N   +  RN
Sbjct  348  GNNLTTDDIVQRIIENRLQFEARN  371



>ref|XP_007243145.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Astyanax 
mexicanus]
Length=81

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 48/79 (61%), Gaps = 2/79 (3%)
 Frame = -1

Query  734  WLPRYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRI  555
            +L +YV EV+IGAP+ ++KD++  F + LV HG         +D  DPY VP+  GI RI
Sbjct  4    FLYQYVSEVVIGAPYTVSKDLLDHFKVDLVCHGKTEVFPD--RDGSDPYTVPRRKGILRI  61

Query  554  IQSPKDITTTSVGQRIIAN  498
            + S   +TT  + QRII N
Sbjct  62   VDSGNSLTTDDIVQRIIKN  80



>ref|XP_004559464.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Maylandia zebra]
Length=349

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 50/84 (60%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +TKD++  F + LV HG         KD  DPYA P+  GI R + S
Sbjct  238  RYVSEVVIGAPFAVTKDLLDHFKVDLVCHGKTEIYPD--KDGSDPYAEPRRKGILRTVDS  295

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
               +TT ++ QRII N  ++  RN
Sbjct  296  GNSLTTDAIVQRIIKNRLLFEARN  319



>ref|XP_006635464.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Lepisosteus 
oculatus]
Length=407

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +T D++  F I LV HG         KD  DPYA PK  GIF  + S
Sbjct  289  RYVSEVVIGAPYAVTADLLDHFKIDLVCHGKTEVFPD--KDGSDPYAEPKKRGIFHTVDS  346

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              D+TT  + QRII N   +  RN
Sbjct  347  GNDLTTDDIVQRIIKNRLQFEARN  370



>ref|XP_010143917.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X1 [Buceros rhinoceros silvestris]
Length=350

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 51/84 (61%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +T D++  F ++LV HG       + KD  DPY  PK  GIF+++ S
Sbjct  247  RYVSEVVIGAPYAVTADLLDHFKVTLVCHGMTE--VVLDKDGSDPYQEPKRRGIFQLVDS  304

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              D+TT  + QRII N   +  RN
Sbjct  305  GSDLTTDLIVQRIIKNRLQFEARN  328



>ref|XP_002672471.1| predicted protein [Naegleria gruberi]
 gb|EFC39727.1| predicted protein [Naegleria gruberi]
Length=371

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 59/85 (69%), Gaps = 5/85 (6%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVD+VIIGAP+ +T+D++    I++VV GTV E    +    DPY +PK +GI+  I+S
Sbjct  275  RYVDDVIIGAPFIVTQDLVDVMKINIVVSGTVLEPEVKV----DPYELPKKLGIYHQIES  330

Query  545  P-KDITTTSVGQRIIANHEIYVKRN  474
            P K++TTT++  RII N + Y +RN
Sbjct  331  PCKELTTTNIINRIIDNAKRYEERN  355



>ref|XP_006753085.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X4 [Myotis davidii]
Length=302

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +T +++  F + LV HG         KD  DPY  PK  GIFR I S
Sbjct  193  RYVSEVVIGAPYAVTAELLDHFKVDLVCHGKTEIMPD--KDGSDPYQEPKKRGIFRQIDS  250

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              D+TT  + QRII N   Y  RN
Sbjct  251  GSDLTTDLIVQRIIKNRLEYEARN  274



>ref|XP_005735765.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Pundamilia nyererei]
Length=403

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ + KD++  F + LV HG         KD  DPYA PK  G+FR I S
Sbjct  291  RYVSEVVIGAPYAVGKDLLDHFKVDLVCHGKTEVLPD--KDGVDPYAEPKKRGVFRAIDS  348

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              ++TT  + QRII N   +  RN
Sbjct  349  GNNLTTDDIVQRIIENRLQFEARN  372



>ref|XP_004539072.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Maylandia 
zebra]
 ref|XP_005735764.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Pundamilia nyererei]
Length=402

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ + KD++  F + LV HG         KD  DPYA PK  G+FR I S
Sbjct  290  RYVSEVVIGAPYAVGKDLLDHFKVDLVCHGKTEVLPD--KDGVDPYAEPKKRGVFRAIDS  347

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              ++TT  + QRII N   +  RN
Sbjct  348  GNNLTTDDIVQRIIENRLQFEARN  371



>ref|XP_001851245.1| ethanolamine-phosphate cytidylyltransferase [Culex quinquefasciatus]
 gb|EDS33301.1| ethanolamine-phosphate cytidylyltransferase [Culex quinquefasciatus]
Length=372

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            +YV+EV+IGAP+ +TKD++  FN+ LV HG  + +  +     DPYAVPK MG F +I S
Sbjct  267  KYVNEVVIGAPYSVTKDLMEHFNVDLVCHGQTTIAPDV--GNLDPYAVPKQMGKFMLIDS  324

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
               ITT  + +RII +   Y  RN
Sbjct  325  GNPITTEDIVERIIRHRLEYEARN  348



>emb|CEG84904.1| Putative Ethanolamine-phosphate cytidylyltransferase [Rhizopus 
microsporus]
Length=92

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 54/81 (67%), Gaps = 4/81 (5%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMIT-TFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQ  549
            RYVDEVIIGAP+ +T +++   + +SLVVHGT      +  D  DPY +PK +GI++ I+
Sbjct  14   RYVDEVIIGAPYSVTDEILKGEYKVSLVVHGTTHLEKDV--DGRDPYELPKKLGIYKQIE  71

Query  548  SPKD-ITTTSVGQRIIANHEI  489
            +PK  ITT  +  RII N ++
Sbjct  72   TPKSTITTEDIIHRIIENRKM  92



>ref|XP_006753084.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X3 [Myotis davidii]
Length=320

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +T +++  F + LV HG         KD  DPY  PK  GIFR I S
Sbjct  211  RYVSEVVIGAPYAVTAELLDHFKVDLVCHGKTEIMPD--KDGSDPYQEPKKRGIFRQIDS  268

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              D+TT  + QRII N   Y  RN
Sbjct  269  GSDLTTDLIVQRIIKNRLEYEARN  292



>ref|XP_008278508.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Stegastes 
partitus]
Length=403

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ + KD++  F + LV HG         KD  DPYA P+  GIFR I S
Sbjct  291  RYVSEVVIGAPYAVGKDLLDHFKVDLVCHGKTEVFPD--KDGSDPYAEPRKRGIFRTIDS  348

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              ++TT  + QRII N   +  RN
Sbjct  349  GNNLTTDDIVQRIIENRLQFEARN  372



>ref|XP_009308303.1| putative ethanolamine-phosphate cytidylyltransferase [Trypanosoma 
grayi]
 gb|KEG13459.1| putative ethanolamine-phosphate cytidylyltransferase [Trypanosoma 
grayi]
Length=382

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYVDEV++GAP+E+T+++I    IS+VV G   ++     D  D YAVPK MG ++ + S
Sbjct  276  RYVDEVVLGAPYEVTREVIENLGISVVVGGKTCDAYES-GDCHDAYAVPKGMGCYQEVDS  334

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              D+TT ++ +R++ N   Y+KR 
Sbjct  335  GCDLTTYTLIERVVTNEVAYLKRQ  358



>ref|XP_001692963.1| CDP-Ethanolamine synthase [Chlamydomonas reinhardtii]
 gb|AAO60076.1| CTP:ethanolamine cytidylyltransferase [Chlamydomonas reinhardtii]
 gb|AAP21826.1| CTP-phosphoethanolamine cytidylyltransferase [Chlamydomonas reinhardtii]
 gb|EDP03532.1| CDP-Ethanolamine synthase [Chlamydomonas reinhardtii]
Length=443

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            +YVDEV+IG+P  IT+D++TTFNIS+VV G++SE++ +     + Y VP+ MG+F  + S
Sbjct  339  KYVDEVVIGSPCVITEDLMTTFNISVVVRGSMSETSMLGPVEEERYEVPRRMGLFTELPS  398

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
            P D++  ++  RI+     +  RN
Sbjct  399  PSDVSARNIIHRIVDKRAAFEARN  422



>ref|XP_010080655.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase, partial 
[Pterocles gutturalis]
Length=268

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 51/84 (61%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +T D++  F ++LV HG     +   KD  DPY  PK  GIF+++ S
Sbjct  165  RYVSEVVIGAPYAVTADLLEHFRVTLVCHGMTEVVSD--KDGSDPYEEPKRRGIFQLVDS  222

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              ++TT  + QRII N   +  RN
Sbjct  223  GSNLTTDLIVQRIIKNRLEFEARN  246



>ref|XP_008301525.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Stegastes 
partitus]
Length=401

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 50/84 (60%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +TKD++  F + LV HG         KD  DPYA P+  GI R + S
Sbjct  290  RYVSEVVIGAPFAVTKDLLDHFKVDLVCHGKTEIYPD--KDGSDPYAEPRRKGILRTVDS  347

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
               +TT ++ QRII N  ++  RN
Sbjct  348  GNSLTTDAIVQRIIKNRLLFEARN  371



>ref|XP_004559463.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Maylandia zebra]
 ref|XP_005744395.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Pundamilia nyererei]
 ref|XP_005936244.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Haplochromis burtoni]
Length=403

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 50/84 (60%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +TKD++  F + LV HG         KD  DPYA P+  GI R + S
Sbjct  292  RYVSEVVIGAPFAVTKDLLDHFKVDLVCHGKTEIYPD--KDGSDPYAEPRRKGILRTVDS  349

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
               +TT ++ QRII N  ++  RN
Sbjct  350  GNSLTTDAIVQRIIKNRLLFEARN  373



>ref|XP_010728353.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Larimichthys 
crocea]
Length=405

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 50/84 (60%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +TKD++  F + LV HG         KD  DPYA P+  GI R + S
Sbjct  290  RYVSEVVIGAPFAVTKDLLDHFKVDLVCHGKTEIYPD--KDGSDPYAEPRRKGILRTVDS  347

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
               +TT ++ QRII N  ++  RN
Sbjct  348  GNSLTTDAIVQRIIKNRLLFEARN  371



>ref|XP_003450120.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Oreochromis 
niloticus]
Length=403

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 50/84 (60%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +TKD++  F + LV HG         KD  DPYA P+  GI R + S
Sbjct  292  RYVSEVVIGAPFAVTKDLLDHFKVDLVCHGKTEIYPD--KDGSDPYAEPRRKGILRTVDS  349

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
               +TT ++ QRII N  ++  RN
Sbjct  350  GNSLTTDAIVQRIIKNRLLFEARN  373



>emb|CEG75719.1| Putative Ethanolamine-phosphate cytidylyltransferase [Rhizopus 
microsporus]
Length=354

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 57/86 (66%), Gaps = 4/86 (5%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMIT-TFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQ  549
            RYVDEVIIGAP+ +T +++   + +SLVVHGT      +  D  DPY +PK +GI++ I+
Sbjct  249  RYVDEVIIGAPYSVTDEILKGEYKVSLVVHGTTHLEKDV--DGRDPYELPKKLGIYKQIE  306

Query  548  SPKD-ITTTSVGQRIIANHEIYVKRN  474
            +PK  ITT  +  RII N +I+ +R 
Sbjct  307  TPKSTITTEDIIHRIIENRKIFEERQ  332



>ref|XP_008518630.1| PREDICTED: LOW QUALITY PROTEIN: ethanolamine-phosphate cytidylyltransferase 
[Equus przewalskii]
Length=361

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +T +++  F + LV HG         KD  DPY  PK  GIFR I S
Sbjct  251  RYVSEVVIGAPYAVTAELLDHFKVDLVCHGKTEVMPD--KDGSDPYQEPKRRGIFRQIDS  308

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              D+TT  + QRII N   Y  RN
Sbjct  309  GNDLTTDLIVQRIIKNRLEYEARN  332



>ref|XP_009874095.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase, partial 
[Apaloderma vittatum]
Length=202

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 50/84 (60%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +T D++  F ++LV HG         KD  DPY  PK  GIF+++ S
Sbjct  100  RYVSEVVIGAPYAVTADLLDHFKVTLVCHGMTEVVPD--KDGSDPYKEPKRRGIFQLVDS  157

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              ++TT  + QRII N   +  RN
Sbjct  158  GSNLTTDLIVQRIIKNRLEFEARN  181



>ref|XP_006108014.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X3 [Myotis lucifugus]
Length=334

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +T +++  F + LV HG         KD  DPY  PK  GIFR I S
Sbjct  225  RYVSEVVIGAPYAVTAELLDHFKVDLVCHGKTEIMPD--KDGSDPYQEPKKRGIFRQIDS  282

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              D+TT  + QRII N   Y  RN
Sbjct  283  GSDLTTDLIVQRIIKNRLEYEARN  306



>ref|XP_005350939.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X3 [Microtus ochrogaster]
Length=332

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +T ++++ F + LV HG         +D  DPY  PK  GIFR I S
Sbjct  225  RYVSEVVIGAPYSVTAELLSHFKVDLVCHGKTEIVPD--RDGSDPYQEPKRRGIFRQIDS  282

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              D+TT  + QRII N   Y  RN
Sbjct  283  GSDLTTDLIVQRIIKNRLEYEARN  306



>gb|EIE92478.1| hypothetical protein RO3G_17000 [Rhizopus delemar RA 99-880]
Length=314

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 57/86 (66%), Gaps = 4/86 (5%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMIT-TFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQ  549
            RYVDEV+IGAP+ +T++++   + +S+VVHGT      M  D  DPY +PK +GI++ I 
Sbjct  212  RYVDEVVIGAPYSVTEELLKGEYQVSIVVHGTSHLEKDM--DGKDPYELPKKLGIYKQID  269

Query  548  SPKD-ITTTSVGQRIIANHEIYVKRN  474
            +PK  ITT  +  RII N +I+ +R 
Sbjct  270  TPKSTITTEDIIYRIIENRKIFEERQ  295



>ref|XP_006753083.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X2 [Myotis davidii]
 gb|ELK38327.1| Ethanolamine-phosphate cytidylyltransferase [Myotis davidii]
Length=356

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +T +++  F + LV HG         KD  DPY  PK  GIFR I S
Sbjct  247  RYVSEVVIGAPYAVTAELLDHFKVDLVCHGKTEIMPD--KDGSDPYQEPKKRGIFRQIDS  304

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              D+TT  + QRII N   Y  RN
Sbjct  305  GSDLTTDLIVQRIIKNRLEYEARN  328



>ref|XP_011304879.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X2 [Fopius arisanus]
Length=307

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            +YV+EV+IGAP+E+TKD++  FN+S+V HG         +D  DPYA PK    F+I+ S
Sbjct  200  KYVNEVVIGAPYEVTKDLMEHFNVSIVCHGQT--PIPTCEDGADPYAEPKRQHKFKILDS  257

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              D+TT  + +RII +   +  RN
Sbjct  258  GNDMTTEKIVERIILHRLEFEDRN  281



>ref|XP_011478363.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Oryzias 
latipes]
Length=355

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ + KD++  F + LV HG         KD  DPY+ PK  GIFR I S
Sbjct  246  RYVSEVVIGAPYAVGKDLLDHFKVDLVCHGKTEVFPD--KDGSDPYSEPKRRGIFRSIDS  303

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              ++TT  + QRII N   +  RN
Sbjct  304  GNNLTTDDIVQRIIENRLQFEARN  327



>ref|XP_002782897.1| Choline-phosphate cytidylyltransferase A, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER14693.1| Choline-phosphate cytidylyltransferase A, putative [Perkinsus 
marinus ATCC 50983]
Length=158

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 56/85 (66%), Gaps = 1/85 (1%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            ++VDEVIIGAP EIT+D+I T NIS+V  G++S S+   +       VPKS+GI R ++S
Sbjct  54   KHVDEVIIGAPVEITEDLIRTMNISIVAQGSISPSSIQYRFMTQVNEVPKSLGILRDVES  113

Query  545  PKD-ITTTSVGQRIIANHEIYVKRN  474
                +T+ ++ +RI  N  +Y+ RN
Sbjct  114  DYPYLTSATIAERIAINRLMYISRN  138



>ref|XP_010201094.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase, partial 
[Colius striatus]
Length=213

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 50/84 (60%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +T D++  F ++LV HG         KD  DPY  PK  GIF+++ S
Sbjct  110  RYVSEVVIGAPYAVTADLLDHFRVTLVCHGMTEVVPD--KDGSDPYEEPKRRGIFQLVDS  167

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              ++TT  + QRII N   +  RN
Sbjct  168  GSNLTTDLIVQRIIKNRLEFEARN  191



>ref|XP_009080963.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Acanthisitta 
chloris]
Length=350

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 50/84 (60%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +T D++  F ++LV HG         KD  DPY  PK  GIF+++ S
Sbjct  247  RYVSEVVIGAPYAVTADLLEHFRVTLVCHGMTEVVPD--KDGSDPYEEPKRRGIFQLVDS  304

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              D+TT  + QRII N   +  RN
Sbjct  305  GSDLTTDLIVQRIIKNRLEFEARN  328



>emb|CEG75718.1| Putative Ethanolamine-phosphate cytidylyltransferase [Rhizopus 
microsporus]
Length=372

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 57/86 (66%), Gaps = 4/86 (5%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMIT-TFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQ  549
            RYVDEVIIGAP+ +T +++   + +SLVVHGT      +  D  DPY +PK +GI++ I+
Sbjct  267  RYVDEVIIGAPYSVTDEILKGEYKVSLVVHGTTHLEKDV--DGRDPYELPKKLGIYKQIE  324

Query  548  SPKD-ITTTSVGQRIIANHEIYVKRN  474
            +PK  ITT  +  RII N +I+ +R 
Sbjct  325  TPKSTITTEDIIHRIIENRKIFEERQ  350



>ref|XP_006753082.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X1 [Myotis davidii]
Length=374

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +T +++  F + LV HG         KD  DPY  PK  GIFR I S
Sbjct  265  RYVSEVVIGAPYAVTAELLDHFKVDLVCHGKTEIMPD--KDGSDPYQEPKKRGIFRQIDS  322

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              D+TT  + QRII N   Y  RN
Sbjct  323  GSDLTTDLIVQRIIKNRLEYEARN  346



>ref|XP_003931691.2| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X1 [Saimiri boliviensis boliviensis]
Length=370

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +T ++++ F + LV HG         +D  DPY  PK  GIFR I S
Sbjct  260  RYVSEVVIGAPYAVTAELLSHFKVDLVCHGKTEIMPD--RDGSDPYQEPKRRGIFRQIDS  317

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              D+TT  + QRII N   Y  RN
Sbjct  318  GSDLTTDLIVQRIITNRLEYEARN  341



>emb|CEF71025.1| Ethanolamine-phosphate cytidylyltransferase [Strongyloides ratti]
Length=411

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = -1

Query  719  VDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPK  540
            V EVIIGAP+ ITKD+I  FN+S+V  G+    ++ L D  D Y +PK MGI+ +I S  
Sbjct  295  VSEVIIGAPYIITKDLIKNFNVSIVADGSRVPHHNTLDDV-DIYKIPKEMGIYELIDSEN  353

Query  539  DITTTSVGQRIIANHEIYVKRN  474
            D+TT  + +R++ N + + KRN
Sbjct  354  DMTTDMIIKRVVENEKAFKKRN  375



>gb|EDM06870.1| phosphate cytidylyltransferase 2, ethanolamine, isoform CRA_c 
[Rattus norvegicus]
Length=121

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 47/84 (56%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +T +++  F + LV HG         +D  DPY  PK  GIF  I S
Sbjct  14   RYVSEVVIGAPYSVTAELLNHFKVDLVCHGKTEIVPD--RDGSDPYEEPKRRGIFCQIDS  71

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              D+TT  + QRII N   Y  RN
Sbjct  72   GSDLTTDLIVQRIIKNRLEYEARN  95



>ref|XP_005283125.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X4 [Chrysemys picta bellii]
Length=310

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = -1

Query  725  RYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQS  546
            RYV EV+IGAP+ +T D++  F + LV HG +SE     KD  DPY  PK  GIFR++ S
Sbjct  201  RYVSEVVIGAPYAVTADLLDHFKVELVCHG-LSEVVPD-KDGSDPYQEPKRRGIFRLVDS  258

Query  545  PKDITTTSVGQRIIANHEIYVKRN  474
              ++TT  + QRII N   +  RN
Sbjct  259  GSNLTTDLIVQRIIKNRLEFEARN  282



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1340626501500